WorldWideScience

Sample records for shd imaging system

  1. Dicty_cDB: SHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHD4-D/SHD492Q.Seq.d/ Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  2. Dicty_cDB: SHD573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  3. Experience of slowly infused high-iodine-dose contrast computed tomography (SHD) of intracranial tumors

    International Nuclear Information System (INIS)

    Muraoka, Kiyoaki; Numata, Hideharu; Hokama, Yasuo

    1983-01-01

    A study was done on 20 patients with intracranial tumors by means of the slowly infused high-iodine-dose (SHD) contrast-enhancement technique. An intravenous drip infusion of 300 ml of Angiografin was given for three hours. Computerized tomograms were taken 1 hour, (2 hours), and 3 hours after the beginning of the drip infusion. The authors divided the lesions into four groups by analyzing the sequential changes in CT numbers using a histograms or profile of the region of interest. In group I, additional lesions were visible on the SHD scan (one case of metastatic brain tumors from lung cancer). In group 2, lesions were better displayed on the SHD scan due to increased enhancement (17 cases). In group 3, SHD scans showed no change (2 cases of fibrous astrocytoma). In group 4, the enhancement was diminished, but the lesion per se was still clealy identifiable (no case). Finally, in 18 cases out of 20 (90%), an additional or better display of the lesion was detected on SHD enhanced CT. The rational for doing the SHD enhancement is to detect a lesion with a minimally impaired blood-brain barrier by exposing a prolonged high blood-iodine level, and so the scanning is delayed until detectable levels of the contrast medium have accumulated within the vascular-channel pool or extravascular space of the lesion. SHD enhancement is useful: I) for revealing any additional lesion in a metastatic brain tumor; 2) for better displaying an obscure lesion on a usual scan; 3) for differentiating the quality of the lesion (for example, malignancy or cyst formation), and 4) for predicting the prognosis of the lesion. (J.P.N.)

  4. Development of a networked four-million-pixel pathological and radiological digital image presentation system and its application to medical conferences

    Science.gov (United States)

    Sakano, Toshikazu; Furukawa, Isao; Okumura, Akira; Yamaguchi, Takahiro; Fujii, Tetsuro; Ono, Sadayasu; Suzuki, Junji; Matsuya, Shoji; Ishihara, Teruo

    2001-08-01

    The wide spread of digital technology in the medical field has led to a demand for the high-quality, high-speed, and user-friendly digital image presentation system in the daily medical conferences. To fulfill this demand, we developed a presentation system for radiological and pathological images. It is composed of a super-high-definition (SHD) imaging system, a radiological image database (R-DB), a pathological image database (P-DB), and the network interconnecting these three. The R-DB consists of a 270GB RAID, a database server workstation, and a film digitizer. The P-DB includes an optical microscope, a four-million-pixel digital camera, a 90GB RAID, and a database server workstation. A 100Mbps Ethernet LAN interconnects all the sub-systems. The Web-based system operation software was developed for easy operation. We installed the whole system in NTT East Kanto Hospital to evaluate it in the weekly case conferences. The SHD system could display digital full-color images of 2048 x 2048 pixels on a 28-inch CRT monitor. The doctors evaluated the image quality and size, and found them applicable to the actual medical diagnosis. They also appreciated short image switching time that contributed to smooth presentation. Thus, we confirmed that its characteristics met the requirements.

  5. Self-Homodyne Detection in Optical Communication Systems

    Directory of Open Access Journals (Sweden)

    Benjamin J. Puttnam

    2014-05-01

    Full Text Available We review work on self-homodyne detection (SHD for optical communication systems. SHD uses a transmitted pilot-tone (PT, originating from the transmitter laser, to exploit phase noise cancellation at a coherent receiver and to enable transmitter linewidth tolerance and potential energy savings. We give an overview of SHD performance, outlining the key contributors to the optical signal-to-noise ratio penalty compared to equivalent intradyne systems, and summarize the advantages, differences and similarities between schemes using polarization-division multiplexed PTs (PDM-SHD and those using space-division multiplexed PTs (SDM-SHD. For PDM-SHD, we review the extensive work on the transmission of advanced modulation formats and techniques to minimize the trade-off with spectral efficiency, as well as recent work on digital SHD, where the SHD receiver is combined with an polarization-diversity ID front-end receiver to provide both polarization and modulation format alignment. We then focus on SDM-SHD systems, describing experimental results using multi-core fibers (MCFs with up to 19 cores, including high capacity transmission with broad-linewidth lasers and experiments incorporating SDM-SHD in networking. Additionally, we discuss the requirement for polarization tracking of the PTs at the receiver and path length alignment and review some variants of SHD before outlining the future challenges of self-homodyne optical transmission and gaps in current knowledge.

  6. UV irradiation of Shigella Dysenteriae induced the transformation and excision of a presumed integrated lysogenic prophage Shd-4L10 into a lytic phase

    International Nuclear Information System (INIS)

    Rodrigues, F. K.; Addy, B.; Armah, G.; Fobil, J.; Steiner-Asiedu, M.; Efavi, J.

    2012-01-01

    Repeated exposures of Shigella dysenteriae strain A to ultra-violet radiation (253.7 nm) with intervening outgrowth of survivors gave rise to clear bacteriophage plaques. Isolation, propagation and partial purification of the new Shd-4LI0 phages showed that they are similar in morphology to the Myxobacteriaphage Mx-4 described earlier. The new phages retained the general characteristics of S. dystenteriae phageShd-4L3, including serological properties and phage typing. It is suggested that ultra-violet irradiation may have played a role in the transformation and excision of the presumed lysogen of S. dysenteriaestrain A into a lytic phase. PhageShd-4LI0 was subsequently partially characterized. It has a density of 1.61, a DNA: protein ratio of 0.42 and thus a cryptogram of D/2:54.3/32.5:X/X: B/O. The phage was further characterised by fractionation of its protein using SDS-polyacrilamide gel electrophoresis. DNA extracted from phages was hydrolysed with restriction endonuclease R., EcoR1. The restriction fragments were catalogued and their apparent molecular weights calculated from electrophoresis gels calibrated with fragments from DNA of coliphageλ λ. From the total fragments obtained with nuclease R., EcoR1, the apparent minimum molecular weight of phage Shd-4LI0DNA was found to be 54.3 x 10 6 Daltons. The molecular weight of the phage DNA was also calculated from measurements of contour length of purified DNA samples, using the formula MW = 1.97 x 10 10 1/(magnification), where 1 is the measured length of DNA in centimetres). The very close relatedness with phage Shd-4L3 was confirmed by these techniques. (au)

  7. Autodisplay of an avidin with biotin-binding activity on the surface of Escherichia coli.

    Science.gov (United States)

    Pardavé-Alejandre, H D; Alvarado-Yaah, J E; Pompa-Mera, E N; Muñoz-Medina, J E; Sárquiz-Martínez, B; Santacruz-Tinoco, C E; Manning-Cela, R G; Ortíz-Navarrete, V; López-Macías, C; González-Bonilla, C R

    2018-03-01

    To display a recombinant avidin fused to the autotransporter ShdA to bind biotinylated molecules on the surface of Escherichia coli. Two chimeric protein constructs containing avidin fused to the autotransporter ShdA were expressed on the surface of Escherichia coli DH5α. One fusion protein contained 476 amino acids of the ShdA α and β domains, whereas the second consisted of a 314 amino acid from α and truncated β domains. Protein production was verified by SDS-PAGE using an antibody to the molecular FLAG-tag. The surface display of the avidin-shdA fusion protein was confirmed by confocal microscopy and flow cytometry analysis, and the biotin-binding activity was evaluated by fluorescence microscopy and flow cytometry using biotin-4-fluorescein and biotinylated-ovalbumin (OVA). Expression of a recombinant avidin with biotin-binding activity on the surface of E. coli was achieved using the autotransporter ShdA. This system is an alternative to bind biotinylated molecules to E. coli.

  8. The P450 enzyme Shade mediates the hydroxylation of ecdysone to 20-hydroxyecdysone in the Colorado potato beetle, Leptinotarsa decemlineata.

    Science.gov (United States)

    Kong, Y; Liu, X-P; Wan, P-J; Shi, X-Q; Guo, W-C; Li, G-Q

    2014-10-01

    Ecdysone 20-monooxygenase (E20MO), a cytochrome P450 monooxygenase (CYP314A1), catalyses the conversion of ecdysone (E) to 20-hydroxyecdysone (20E). We report here the cloning and characterization of the Halloween gene Shade (Shd) encoding E20MO in the Colorado potato beetle, Leptinotarsa decemlineata. LdSHD has five conserved motifs typical of insect P450s, ie the Helix-C, Helix-I, Helix-K, PxxFxPE/DRF (PERF) and heme-binding motifs. LdShd was expressed in developing eggs, the first to fourth instars, wandering larvae, pupae and adults, with statistically significant fluctuations. Its mRNA was ubiquitously distributed in the head, thorax and abdomen. The recombinant LdSHD protein expressed in Spodoptera frugiperda 9 (Sf9) cells catalysed the conversion of E to 20E. Dietary introduction of double-stranded RNA (dsRNA) of LdShd into the second instar larvae successfully knocked down the LdShd expression level, decreased the mRNA level of the ecdysone receptor (LdEcR) gene, caused larval lethality, delayed development and affected pupation. Moreover, ingestion of LdShd-dsRNA by the fourth instars also down-regulated LdShd and LdEcR expression, reduced the 20E titre, and negatively influenced pupation. Introduction of 20E and a nonsteroidal ecdysteroid agonist halofenozide into the LdShd-dsRNA-ingested second instars, and of halofenozide into the LdShd-dsRNA-ingested fourth instars almost completely relieved the negative effects on larval performance. Thus, LdSHD functions to regulate metamorphotic processes by converting E to 20E in a coleopteran insect species Le. decemlineata. © 2014 The Royal Entomological Society.

  9. Medical Imaging System

    Science.gov (United States)

    1991-01-01

    The MD Image System, a true-color image processing system that serves as a diagnostic aid and tool for storage and distribution of images, was developed by Medical Image Management Systems, Huntsville, AL, as a "spinoff from a spinoff." The original spinoff, Geostar 8800, developed by Crystal Image Technologies, Huntsville, incorporates advanced UNIX versions of ELAS (developed by NASA's Earth Resources Laboratory for analysis of Landsat images) for general purpose image processing. The MD Image System is an application of this technology to a medical system that aids in the diagnosis of cancer, and can accept, store and analyze images from other sources such as Magnetic Resonance Imaging.

  10. Evaluating healthcare resource utilization and outcomes for surgical hip dislocation and hip arthroscopy for femoroacetabular impingement.

    Science.gov (United States)

    de Sa, Darren; Horner, Nolan S; MacDonald, Austin; Simunovic, Nicole; Slobogean, Gerard; Philippon, Marc J; Belzile, Etienne L; Karlsson, Jon; Ayeni, Olufemi R

    2016-12-01

    Surgical hip dislocation (SHD) and hip arthroscopy are surgical methods used to correct deformity associated with femoroacetabular impingement (FAI). Though both of these approaches appear to benefit patients, no studies exist comparing healthcare resource utilization of the two surgical approaches. This systematic review examines the literature and the records of two surgeons to evaluate the resource utilization associated with treating symptomatic FAI via these two methods. EMBASE, MEDLINE and PubMed were searched for relevant articles. The articles were systematically screened, and data was abstracted in duplicate. To further supplement resource utilization data, a retrospective chart review of two surgeon's patient data (one using SHD and another using an arthroscopic approach) was completed. Experts in pharmacy, physiotherapy, radiology, anaesthesia, physiatry and the local hospital finance department were also consulted. There were 52 studies included with a total of 460 patients (535 hips) and 3886 patients (4147 hips) who underwent SHD and arthroscopic surgery for FAI, respectively. Regardless of approach, most patients treated for symptomatic FAI improved across various outcomes measures with low complication rates. Surgical time across all approaches was similar, averaging 118 ± 2 min. On a per patient basis, hip arthroscopy ($10,976) uses approximately 41 % of the resources of SHD ($24,379). There were no significant differences in outcomes for FAI treated with SHD or arthroscopy. However, with regard to healthcare resource utilization based on the OHIP healthcare system, hip arthroscopy uses substantially less resources than SHD within the first post-operative year. Systematic Review of Level IV Studies, Level IV.

  11. Medical imaging systems

    Science.gov (United States)

    Frangioni, John V [Wayland, MA

    2012-07-24

    A medical imaging system provides simultaneous rendering of visible light and fluorescent images. The system may employ dyes in a small-molecule form that remains in a subject's blood stream for several minutes, allowing real-time imaging of the subject's circulatory system superimposed upon a conventional, visible light image of the subject. The system may also employ dyes or other fluorescent substances associated with antibodies, antibody fragments, or ligands that accumulate within a region of diagnostic significance. In one embodiment, the system provides an excitation light source to excite the fluorescent substance and a visible light source for general illumination within the same optical guide that is used to capture images. In another embodiment, the system is configured for use in open surgical procedures by providing an operating area that is closed to ambient light. More broadly, the systems described herein may be used in imaging applications where a visible light image may be usefully supplemented by an image formed from fluorescent emissions from a fluorescent substance that marks areas of functional interest.

  12. Medical imaging systems

    Science.gov (United States)

    Frangioni, John V

    2013-06-25

    A medical imaging system provides simultaneous rendering of visible light and diagnostic or functional images. The system may be portable, and may include adapters for connecting various light sources and cameras in open surgical environments or laparascopic or endoscopic environments. A user interface provides control over the functionality of the integrated imaging system. In one embodiment, the system provides a tool for surgical pathology.

  13. Design and Implementation of an Intelligent Windowsill System Using Smart Handheld Device and Fuzzy Microcontroller.

    Science.gov (United States)

    Wang, Jing-Min; Yang, Ming-Ta; Chen, Po-Lin

    2017-04-11

    With the advance of science and technology, people have a desire for convenient and comfortable living. Creating comfortable and healthy indoor environments is a major consideration for designing smart homes. As handheld devices become increasingly powerful and ubiquitous, this paper proposes an innovative use of smart handheld devices (SHD), using MIT App Inventor and fuzzy control, to perform the real-time monitoring and smart control of the designed intelligent windowsill system (IWS) in a smart home. A compact weather station that consists of environment sensors was constructed in the IWS for measuring of indoor illuminance, temperature-humidity, carbon dioxide (CO₂) concentration and outdoor rain and wind direction. According to the measured environment information, the proposed system can automatically send a command to a fuzzy microcontroller performed by Arduino UNO to fully or partly open the electric curtain and electric window for adapting to climate changes in the indoor and outdoor environment. Moreover, the IWS can automatically close windows for rain splashing on the window. The presented novel control method for the windowsill not only expands the SHD applications, but greatly enhances convenience to users. To validate the feasibility and effectiveness of the IWS, a laboratory prototype was built and confirmed experimentally.

  14. Physiological characteristics of elite short- and long-distance triathletes.

    Science.gov (United States)

    Millet, Grégoire P; Dréano, Patrick; Bentley, David J

    2003-01-01

    The purpose of this study was to compare the physiological responses in cycling and running of elite short-distance (ShD) and long-distance (LD) triathletes. Fifteen elite male triathletes participating in the World Championships were divided into two groups (ShD and LD) and performed a laboratory trial that comprised submaximal treadmill running, maximal then submaximal ergometry cycling and then an additional submaximal run. "In situ" best ShD triathlon performances were also analysed for each athlete. ShD demonstrated a significantly faster swim time than LD whereas .VO(2max) (ml kg(-1) min(-1)), cycling economy (W l(-1) min(-1)), peak power output (.W(peak),W) and ventilatory threshold (%.VO(2max)) were all similar between ShD and LD. Moreover, there were no differences between the two groups in the change (%) in running economy from the first to the second running bout. Swimming time was correlated to .W(peak)(r=-0.76; Ptriathlon was correlated to .W(peak)(r=-0.83; P<0.05) in LD. In conclusion, ShD triathletes had a faster swimming time but did not exhibit different maximal or submaximal physiological characteristics measured in cycling and running than LD triathletes.

  15. Multipurpose Hyperspectral Imaging System

    Science.gov (United States)

    Mao, Chengye; Smith, David; Lanoue, Mark A.; Poole, Gavin H.; Heitschmidt, Jerry; Martinez, Luis; Windham, William A.; Lawrence, Kurt C.; Park, Bosoon

    2005-01-01

    A hyperspectral imaging system of high spectral and spatial resolution that incorporates several innovative features has been developed to incorporate a focal plane scanner (U.S. Patent 6,166,373). This feature enables the system to be used for both airborne/spaceborne and laboratory hyperspectral imaging with or without relative movement of the imaging system, and it can be used to scan a target of any size as long as the target can be imaged at the focal plane; for example, automated inspection of food items and identification of single-celled organisms. The spectral resolution of this system is greater than that of prior terrestrial multispectral imaging systems. Moreover, unlike prior high-spectral resolution airborne and spaceborne hyperspectral imaging systems, this system does not rely on relative movement of the target and the imaging system to sweep an imaging line across a scene. This compact system (see figure) consists of a front objective mounted at a translation stage with a motorized actuator, and a line-slit imaging spectrograph mounted within a rotary assembly with a rear adaptor to a charged-coupled-device (CCD) camera. Push-broom scanning is carried out by the motorized actuator which can be controlled either manually by an operator or automatically by a computer to drive the line-slit across an image at a focal plane of the front objective. To reduce the cost, the system has been designed to integrate as many as possible off-the-shelf components including the CCD camera and spectrograph. The system has achieved high spectral and spatial resolutions by using a high-quality CCD camera, spectrograph, and front objective lens. Fixtures for attachment of the system to a microscope (U.S. Patent 6,495,818 B1) make it possible to acquire multispectral images of single cells and other microscopic objects.

  16. Image reconstruction of dynamic infrared single-pixel imaging system

    Science.gov (United States)

    Tong, Qi; Jiang, Yilin; Wang, Haiyan; Guo, Limin

    2018-03-01

    Single-pixel imaging technique has recently received much attention. Most of the current single-pixel imaging is aimed at relatively static targets or the imaging system is fixed, which is limited by the number of measurements received through the single detector. In this paper, we proposed a novel dynamic compressive imaging method to solve the imaging problem, where exists imaging system motion behavior, for the infrared (IR) rosette scanning system. The relationship between adjacent target images and scene is analyzed under different system movement scenarios. These relationships are used to build dynamic compressive imaging models. Simulation results demonstrate that the proposed method can improve the reconstruction quality of IR image and enhance the contrast between the target and the background in the presence of system movement.

  17. Developmental expression of Manduca shade, the P450 mediating the final step in molting hormone synthesis

    DEFF Research Database (Denmark)

    Rewitz, Kim; Rybczynski, Robert; Warren, James T.

    2006-01-01

    body and epidermis with very low expression in the prothoracic gland and nervous system. Developmental variations in E20MO enzymatic activity are almost perfectly correlated with comparable changes in the gene expression of Msshd in the fat body and midgut during the fifth instar and the beginning...... gene shade (shd; CYP314A1) that encodes the E20MO in the tobacco hornworm, Manduca sexta. Manduca Shd (MsShd) mediates the conversion of E to 20E when expressed in Drosophila S2 cells. In accord with the central dogma, the data show that Msshd is expressed mainly in the midgut, Malpighian tubules, fat...... of pupal-adult development. The results indicate three successive and overlapping peaks of expression in the fat body, midgut and Malpighian tubules, respectively, during the fifth larval instar. The data suggest that precise tissue-specific transcriptional regulation controls the levels, and thereby...

  18. Imaging systems in nuclear medicine and image evaluation

    International Nuclear Information System (INIS)

    Beck, R.; Charleston, D.; Metz, C.

    1980-01-01

    This project deals with imaging systems in nuclear medicine and image evaluation and is presented as four subprojects. The goal of the first subproject is to improve diagnositc image quality by development of a general computer code for optimizing collimator design. The second subproject deals with a secondary emission and fluorescence technique for thyroid scanning while the third subproject emphasizes the need for more sophisticated image processing systems such as coherent optical spatial filtering systems and digital image processing. The fourth subproject presents a new approach for processing image data by taking into account the energy of each detected gamma-ray photon

  19. Imaging system design and image interpolation based on CMOS image sensor

    Science.gov (United States)

    Li, Yu-feng; Liang, Fei; Guo, Rui

    2009-11-01

    An image acquisition system is introduced, which consists of a color CMOS image sensor (OV9620), SRAM (CY62148), CPLD (EPM7128AE) and DSP (TMS320VC5509A). The CPLD implements the logic and timing control to the system. SRAM stores the image data, and DSP controls the image acquisition system through the SCCB (Omni Vision Serial Camera Control Bus). The timing sequence of the CMOS image sensor OV9620 is analyzed. The imaging part and the high speed image data memory unit are designed. The hardware and software design of the image acquisition and processing system is given. CMOS digital cameras use color filter arrays to sample different spectral components, such as red, green, and blue. At the location of each pixel only one color sample is taken, and the other colors must be interpolated from neighboring samples. We use the edge-oriented adaptive interpolation algorithm for the edge pixels and bilinear interpolation algorithm for the non-edge pixels to improve the visual quality of the interpolated images. This method can get high processing speed, decrease the computational complexity, and effectively preserve the image edges.

  20. Multi-channel medical imaging system

    Science.gov (United States)

    Frangioni, John V

    2013-12-31

    A medical imaging system provides simultaneous rendering of visible light and fluorescent images. The system may employ dyes in a small-molecule form that remain in the subject's blood stream for several minutes, allowing real-time imaging of the subject's circulatory system superimposed upon a conventional, visible light image of the subject. The system may provide an excitation light source to excite the fluorescent substance and a visible light source for general illumination within the same optical guide used to capture images. The system may be configured for use in open surgical procedures by providing an operating area that is closed to ambient light. The systems described herein provide two or more diagnostic imaging channels for capture of multiple, concurrent diagnostic images and may be used where a visible light image may be usefully supplemented by two or more images that are independently marked for functional interest.

  1. Image quality of digital mammography images produced using wet and dry laser imaging systems

    International Nuclear Information System (INIS)

    Al Khalifah, K.; Brindhaban, A.; AlArfaj, R.; Jassim, O.

    2006-01-01

    Introduction: A study was carried out to compare the quality of digital mammographic images printed or processed by a wet laser imaging system and a dedicated mammographic dry laser imaging system. Material and methods: Digital images of a tissue equivalent breast phantom were obtained using a GE Senographe 2000D digital mammography system and different target/filter combinations of the X-ray tube. These images were printed on films using the Fuji FL-IM D wet laser imaging system and the Kodak DryView 8600 dry laser imaging system. The quality of images was assessed in terms of detectability of microcalcifications and simulated tumour masses by five radiologists. In addition, the contrast index and speed index of the two systems were measured using the step wedge in the phantom. The unpaired, unequal variance t-test was used to test any statistically significant differences. Results: There were no significant (p < 0.05) differences between the images printed using the two systems in terms of microcalcification and tumour mass detectability. The wet system resulted in slightly higher contrast index while the dry system showed significantly higher speed index. Conclusion: Both wet and dry laser imaging systems can produce mammography images of good quality on which 0.2 mm microcalcifications and 2 mm tumour masses can be detected. Dry systems are preferable due to the absence of wet chemical processing and solid or liquid chemical waste. The wet laser imaging systems, however, still represent a useful alternative to dry laser imaging systems for mammography studies

  2. Severe hypovitaminosis D correlates with increased inflammatory markers in HIV infected patients

    Directory of Open Access Journals (Sweden)

    Ansemant Thiphaine

    2013-01-01

    Full Text Available Abstract Background Even though it has been suggested that antiretroviral therapy has an impact on severe hypovitaminosis D (SHD in HIV infected patients, it could be speculated that the different levels of residual inflammation on HAART (Highly Active Anti Retroviral Therapy could contribute to SHD and aggravate bone catabolism in these patients. Methods A cross-sectional study was carried out in an unselected cohort of 263 HIV infected outpatients consulting during Spring 2010. Clinical examinations were performed and medical history, food habits, sun exposure and addictions were collected. Fasting blood samples were taken for immunological, virological, inflammation, endocrine and bone markers evaluations. Results Ninety-five (36% patients had SHD. In univariate analysis, a significant and positive association was found between SHD and IL6 (p = 0.001, hsCRP (p = 0.04, increased serum C-Telopeptides X (CTX (p = 0.005 and Parathyroid Hormon (PTH (p Conclusions SHD is frequent and correlates with inflammation in HIV infected patients. Since SHD is also associated with falls and increased bone catabolism, it may be of interest to take into account not only the type of antiretroviral therapy but also the residual inflammation on HAART in order to assess functional and bone risks. This finding also suggests that vitamin D supplementation may be beneficial in these HIV-infected patients.

  3. Improved Interactive Medical-Imaging System

    Science.gov (United States)

    Ross, Muriel D.; Twombly, Ian A.; Senger, Steven

    2003-01-01

    An improved computational-simulation system for interactive medical imaging has been invented. The system displays high-resolution, three-dimensional-appearing images of anatomical objects based on data acquired by such techniques as computed tomography (CT) and magnetic-resonance imaging (MRI). The system enables users to manipulate the data to obtain a variety of views for example, to display cross sections in specified planes or to rotate images about specified axes. Relative to prior such systems, this system offers enhanced capabilities for synthesizing images of surgical cuts and for collaboration by users at multiple, remote computing sites.

  4. OSPACS: Ultrasound image management system

    Directory of Open Access Journals (Sweden)

    Bessant Conrad

    2008-06-01

    Full Text Available Abstract Background Ultrasound scanning uses the medical imaging format, DICOM, for electronically storing the images and data associated with a particular scan. Large health care facilities typically use a picture archiving and communication system (PACS for storing and retrieving such images. However, these systems are usually not suitable for managing large collections of anonymized ultrasound images gathered during a clinical screening trial. Results We have developed a system enabling the accurate archiving and management of ultrasound images gathered during a clinical screening trial. It is based upon a Windows application utilizing an open-source DICOM image viewer and a relational database. The system automates the bulk import of DICOM files from removable media by cross-validating the patient information against an external database, anonymizing the data as well as the image, and then storing the contents of the file as a field in a database record. These image records may then be retrieved from the database and presented in a tree-view control so that the user can select particular images for display in a DICOM viewer or export them to external media. Conclusion This system provides error-free automation of ultrasound image archiving and management, suitable for use in a clinical trial. An open-source project has been established to promote continued development of the system.

  5. New image-stabilizing system

    Science.gov (United States)

    Zhao, Yuejin

    1996-06-01

    In this paper, a new method for image stabilization with a three-axis image- stabilizing reflecting prism assembly is presented, and the principle of image stabilization in this prism assembly, formulae for image stabilization and working formulae with an approximation up to the third power are given in detail. In this image-stabilizing system, a single chip microcomputer is used to calculate value of compensating angles and thus to control the prism assembly. Two gyroscopes act as sensors from which information of angular perturbation is obtained, three stepping motors drive the prism assembly to compensate for the movement of image produced by angular perturbation. The image-stabilizing device so established is a multifold system which involves optics, mechanics, electronics and computer.

  6. Army medical imaging system: ARMIS

    International Nuclear Information System (INIS)

    Siedband, M.P.; Kramp, D.C.

    1987-01-01

    Recent advances of stimulable phosphor screens, data cards using optical storage means, and new personal computers with image processing capability have made possible the design of economical filmless medical imaging systems. The addition of communication links means that remote interpretation of images is also possible. The Army Medical Imaging System uses stimulable phosphor screens, digital readout, a small computer, an optical digital data card device, and a DIN/PACS link. Up to 200 images can be stored in the computer hard disk for rapid recall and reading by the radiologist. The computer permits image processing, annotation, insertion of text, and control of the system. Each device contains an image storage RAM and communicates with the computer via the small computer systems interface. Data compression is used to reduce the required storage capacity and transmission times of the 1-mB images. The credit card-size optical data cards replace film and can store 12 or more images. The data cards can be read on an independent viewer. The research is supported by the U.S. Army Biomedical Research and Development Laboratory

  7. Design of low noise imaging system

    Science.gov (United States)

    Hu, Bo; Chen, Xiaolai

    2017-10-01

    In order to meet the needs of engineering applications for low noise imaging system under the mode of global shutter, a complete imaging system is designed based on the SCMOS (Scientific CMOS) image sensor CIS2521F. The paper introduces hardware circuit and software system design. Based on the analysis of key indexes and technologies about the imaging system, the paper makes chips selection and decides SCMOS + FPGA+ DDRII+ Camera Link as processing architecture. Then it introduces the entire system workflow and power supply and distribution unit design. As for the software system, which consists of the SCMOS control module, image acquisition module, data cache control module and transmission control module, the paper designs in Verilog language and drives it to work properly based on Xilinx FPGA. The imaging experimental results show that the imaging system exhibits a 2560*2160 pixel resolution, has a maximum frame frequency of 50 fps. The imaging quality of the system satisfies the requirement of the index.

  8. Artificial intelligence and medical imaging. Expert systems and image analysis

    International Nuclear Information System (INIS)

    Wackenheim, A.; Zoellner, G.; Horviller, S.; Jacqmain, T.

    1987-01-01

    This paper gives an overview on the existing systems for automated image analysis and interpretation in medical imaging, especially in radiology. The example of ORFEVRE, the system for the analysis of CAT-scan images of the cervical triplet (c3-c5) by image analysis and subsequent expert-system is given and discussed in detail. Possible extensions are described [fr

  9. Highly integrated image sensors enable low-cost imaging systems

    Science.gov (United States)

    Gallagher, Paul K.; Lake, Don; Chalmers, David; Hurwitz, J. E. D.

    1997-09-01

    The highest barriers to wide scale implementation of vision systems have been cost. This is closely followed by the level of difficulty of putting a complete imaging system together. As anyone who has every been in the position of creating a vision system knows, the various bits and pieces supplied by the many vendors are not under any type of standardization control. In short, unless you are an expert in imaging, electrical interfacing, computers, digital signal processing, and high speed storage techniques, you will likely spend more money trying to do it yourself rather than to buy the exceedingly expensive systems available. Another alternative is making headway into the imaging market however. The growing investment in highly integrated CMOS based imagers is addressing both the cost and the system integration difficulties. This paper discusses the benefits gained from CMOS based imaging, and how these benefits are already being applied.

  10. Imaging system

    International Nuclear Information System (INIS)

    Rushbrooke, J.G.; Ansorge, R.E.

    1987-01-01

    A moving object such as a container on a conveyor belt is imaged by an optical system onto a charge coupled device array in which the lines of the array are arranged perpendicular to the direction of motion of the object. The speed of movement of the object is sensed to generate electrical signals which are processed to provide shift signals enabling the shifting of data row to row in the array in synchronism with the movement of the container. The electrical charge associated with a given point on the array is transferred from one line to the other until it appears at the last line of the array, from which it is read out in known manner in conjunction with all other electrical charges associated with the row of charge coupled devices in the last line of the array. Due to the integrating effect achieved, the aperture of the imaging system can be much smaller than otherwise would be required, and/or the level of light illumination can be reduced. The imaging system can be applied to X-ray inspection devices, aerial surveillance or scanning of moving documents in copying processes. (author)

  11. Handheld microwave bomb-detecting imaging system

    Science.gov (United States)

    Gorwara, Ashok; Molchanov, Pavlo

    2017-05-01

    Proposed novel imaging technique will provide all weather high-resolution imaging and recognition capability for RF/Microwave signals with good penetration through highly scattered media: fog, snow, dust, smoke, even foliage, camouflage, walls and ground. Image resolution in proposed imaging system is not limited by diffraction and will be determined by processor and sampling frequency. Proposed imaging system can simultaneously cover wide field of view, detect multiple targets and can be multi-frequency, multi-function. Directional antennas in imaging system can be close positioned and installed in cell phone size handheld device, on small aircraft or distributed around protected border or object. Non-scanning monopulse system allows dramatically decrease in transmitting power and at the same time provides increased imaging range by integrating 2-3 orders more signals than regular scanning imaging systems.

  12. IDAPS (Image Data Automated Processing System) System Description

    Science.gov (United States)

    1988-06-24

    This document describes the physical configuration and components used in the image processing system referred to as IDAPS (Image Data Automated ... Processing System). This system was developed by the Environmental Research Institute of Michigan (ERIM) for Eglin Air Force Base. The system is designed

  13. Imaging systems in nuclear medicine and image evaluation

    International Nuclear Information System (INIS)

    Beck, R.; Charleston, D.; Metz, C.; Tsui, B.

    1981-01-01

    A general computer code to simulate the imaging properties of existing and hypothetical imaging systems viewing realistic source distributions within non-uniform media. Such a code allows comparative evaluations of existing and hypothetical systems, and optimization of critical parameters of system design by maximizing the signal-to-noise ratio. To be most useful, such a code allows simulation of conventional scintillation scanners and cameras as well as single-photon and position tomographic systems

  14. Analysis of image plane's Illumination in Image-forming System

    International Nuclear Information System (INIS)

    Duan Lihua; Zeng Yan'an; Zhang Nanyangsheng; Wang Zhiguo; Yin Shiliang

    2011-01-01

    In the detection of optical radiation, the detecting accuracy is affected by optic power distribution of the detector's surface to a large extent. In addition, in the image-forming system, the quality of the image is greatly determined by the uniformity of the image's illumination distribution. However, in the practical optical system, affected by the factors such as field of view, false light and off axis and so on, the distribution of the image's illumination tends to be non uniform, so it is necessary to discuss the image plane's illumination in image-forming systems. In order to analyze the characteristics of the image-forming system at a full range, on the basis of photometry, the formulas to calculate the illumination of the imaging plane have been summarized by the numbers. Moreover, the relationship between the horizontal offset of the light source and the illumination of the image has been discussed in detail. After that, the influence of some key factors such as aperture angle, off-axis distance and horizontal offset on illumination of the image has been brought forward. Through numerical simulation, various theoretical curves of those key factors have been given. The results of the numerical simulation show that it is recommended to aggrandize the diameter of the exit pupil to increase the illumination of the image. The angle of view plays a negative role in the illumination distribution of the image, that is, the uniformity of the illumination distribution can be enhanced by compressing the angle of view. Lastly, it is proved that telecentric optical design is an effective way to advance the uniformity of the illumination distribution.

  15. CORPORATE SOCIAL RESPONSIBILITY IMPACTS ON SUSTAINABLE HUMAN DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Kerstin Anstätt

    2016-06-01

    Full Text Available The goal of this article is to critically analyze the findings of the first, recently published, studies about Corporate Social Responsibility (CSR impacts on Sustainable Human Development (SHD. We aim at deriving conclusions for effective CSR strategies and at identifying consequences for management and research. As CSR claims to create value for corporations and for society, we argue that the people-centered Capability Approach (CA is promising to provide neglected and much needed insights how corporate activities affect individuals and communities. Based on a survey of recent literature addressing CSR impacts on SHD, we highlight CSR potentials to improve average well-being in multiple dimensions of SHD. Moreover, we critically assess challenges and limitations of CSR as a strategy to preserve and foster SHD. For instance, studies have shown that, despite CSR-driven well-being increases, social capital, relational capabilities and collective agency may become challenged by corporate strategies. Moreover, corporate environmental impacts have been found to be less often addressed by both, companies and SHD researchers. Resulting inequality and fairness issues have been identified as causes of violence against corporations even in the presence of total well-being improvements. We conclude that companies should strategically take into account a comprehensive range of factors driving and hampering SHD to account for their whole portfolio of corporate opportunities and risks. This requires evaluating CSR impacts instead of only focusing on CSR inputs and outputs. Thereby, corporations can mitigate their risks, improve their stakeholder trust and strengthen their competitiveness.

  16. Quantitative luminescence imaging system

    Science.gov (United States)

    Erwin, David N.; Kiel, Johnathan L.; Batishko, Charles R.; Stahl, Kurt A.

    1990-01-01

    The QLIS images and quantifies low-level chemiluminescent reactions in an electromagnetic field. It is capable of real time nonperturbing measurement and simultaneous recording of many biochemical and chemical reactions such as luminescent immunoassays or enzyme assays. The system comprises image transfer optics, a low-light level digitizing camera with image intensifying microchannel plates, an image process or, and a control computer. The image transfer optics may be a fiber image guide with a bend, or a microscope, to take the light outside of the RF field. Output of the camera is transformed into a localized rate of cumulative digitalized data or enhanced video display or hard-copy images. The system may be used as a luminescent microdosimetry device for radiofrequency or microwave radiation, as a thermal dosimeter, or in the dosimetry of ultra-sound (sonoluminescence) or ionizing radiation. It provides a near-real-time system capable of measuring the extremely low light levels from luminescent reactions in electromagnetic fields in the areas of chemiluminescence assays and thermal microdosimetry, and is capable of near-real-time imaging of the sample to allow spatial distribution analysis of the reaction. It can be used to instrument three distinctly different irradiation configurations, comprising (1) RF waveguide irradiation of a small Petri-dish-shaped sample cell, (2) RF irradiation of samples in a microscope for the microscopie imaging and measurement, and (3) RF irradiation of small to human body-sized samples in an anechoic chamber.

  17. Coal-tar-based parking lot sealcoat: An unrecognized source of PAH to settled house dust

    Science.gov (United States)

    Mahler, B.J.; Van Metre, P.C.; Wilson, J.T.; Musgrove, M.; Burbank, T.L.; Ennis, T.E.; Bashara, T.J.

    2010-01-01

    Despite much speculation, the principal factors controlling concentrations of polycyclic aromatic hydrocarbons (PAH) in settled house dust (SHD) have not yet been identified. In response to recent reports that dust from pavement with coaltar-based sealcoat contains extremely high concentrations of PAH, we measured PAH in SHD from 23 apartments and in dust from their associated parking lots, one-half of which had coal-tar-based sealcoat (CT). The median concentration of total PAH (T-PAH) in dust from CT parking lots (4760 ??g/g, n = 11) was 530 times higher than that from parking lots with other pavement surface types (asphalt-based sealcoat, unsealed asphalt, concrete [median 9.0 ??g/g, n = 12]). T-PAH in SHD from apartments with CT parking lots (median 129 ??g/g) was 25 times higher than that in SHD from apartments with parking lots with other pavement surface types (median 5.1 ??g/g). Presence or absence of CT on a parking lot explained 48% of the variance in log-transformed T-PAH in SHD. Urban land-use intensity near the residence also had a significant but weaker relation to T-PAH. No other variables tested, including carpeting, frequency of vacuuming, and indoor burning, were significant. ?? 2010 American Chemical Society.

  18. Objective analysis of image quality of video image capture systems

    Science.gov (United States)

    Rowberg, Alan H.

    1990-07-01

    As Picture Archiving and Communication System (PACS) technology has matured, video image capture has become a common way of capturing digital images from many modalities. While digital interfaces, such as those which use the ACR/NEMA standard, will become more common in the future, and are preferred because of the accuracy of image transfer, video image capture will be the dominant method in the short term, and may continue to be used for some time because of the low cost and high speed often associated with such devices. Currently, virtually all installed systems use methods of digitizing the video signal that is produced for display on the scanner viewing console itself. A series of digital test images have been developed for display on either a GE CT9800 or a GE Signa MRI scanner. These images have been captured with each of five commercially available image capture systems, and the resultant images digitally transferred on floppy disk to a PC1286 computer containing Optimast' image analysis software. Here the images can be displayed in a comparative manner for visual evaluation, in addition to being analyzed statistically. Each of the images have been designed to support certain tests, including noise, accuracy, linearity, gray scale range, stability, slew rate, and pixel alignment. These image capture systems vary widely in these characteristics, in addition to the presence or absence of other artifacts, such as shading and moire pattern. Other accessories such as video distribution amplifiers and noise filters can also add or modify artifacts seen in the captured images, often giving unusual results. Each image is described, together with the tests which were performed using them. One image contains alternating black and white lines, each one pixel wide, after equilibration strips ten pixels wide. While some systems have a slew rate fast enough to track this correctly, others blur it to an average shade of gray, and do not resolve the lines, or give

  19. Multispectral system for medical fluorescence imaging

    International Nuclear Information System (INIS)

    Andersson, P.S.; Montan, S.; Svanberg, S.

    1987-01-01

    The principles of a powerful multicolor imaging system for tissue fluorescence diagnostics are discussed. Four individually spectrally filtered images are formed on a matrix detector by means of a split-mirror arrangement. The four images are processed in a computer, pixel by pixel, by means of mathematical operations, leading to an optimized contrast image, which enhances a selected feature. The system is being developed primarily for medical fluorescence imaging, but has wide applications in fluorescence, reflectance, and transmission monitoring related to a wide range of industrial and environmental problems. The system operation is described for the case of linear imaging on a diode array detector. Laser-induced fluorescence is used for cancer tumor and arteriosclerotic plaque demarcation using the contrast enhancement capabilities of this imaging system. Further examples of applications include fluorescing minerals and flames

  20. Transfer function analysis of radiographic imaging systems

    International Nuclear Information System (INIS)

    Metz, C.E.; Doi, K.

    1979-01-01

    The theoretical and experimental aspects of the techniques of transfer function analysis used in radiographic imaging systems are reviewed. The mathematical principles of transfer function analysis are developed for linear, shift-invariant imaging systems, for the relation between object and image and for the image due to a sinusoidal plane wave object. The other basic mathematical principle discussed is 'Fourier analysis' and its application to an input function. Other aspects of transfer function analysis included are alternative expressions for the 'optical transfer function' of imaging systems and expressions are derived for both serial and parallel transfer image sub-systems. The applications of transfer function analysis to radiographic imaging systems are discussed in relation to the linearisation of the radiographic imaging system, the object, the geometrical unsharpness, the screen-film system unsharpness, other unsharpness effects and finally noise analysis. It is concluded that extensive theoretical, computer simulation and experimental studies have demonstrated that the techniques of transfer function analysis provide an accurate and reliable means for predicting and understanding the effects of various radiographic imaging system components in most practical diagnostic medical imaging situations. (U.K.)

  1. Dynamic MR imaging of the musculoskeletal system

    International Nuclear Information System (INIS)

    Shah, A.S.; Hylton, H.; Hentz, V.R.; Schattner, P.

    1991-01-01

    This paper reports on dynamic MR imaging which is an MR technique that allows imaging of the musculoskeletal system in motion. Current methods for observing the articulation of muscles and joints are limited to acquisition of stationary images at different spatial orientations. These images are then replayed from computer memory to simulate motion. Unlike stationary acquisition, dynamic MR imaging allows the volume of interest to be subjected to motion and dynamic stress, which is important for detecting stress-induced pathology. To demonstrate the utility of dynamic MR imaging, a system for imaging a moving wrist has been developed. The system consists of apparatus capable of providing simultaneous radialulnar deviation and flexion-extension, and hardware for system control and acquisition gating. The apparatus is mounted on the patient bed and is transferable to a variety of standard clinical MR imaging systems. Images were obtained during motion, and the ability of dynamic MR imaging to accurately image the moving wrist with very little motion artifact was demonstrated

  2. Mechanics of bioinspired imaging systems

    Directory of Open Access Journals (Sweden)

    Zhengwei Li

    2016-01-01

    Full Text Available Imaging systems in nature have attracted a lot of research interest due to their superior optical and imaging characteristics. Recent advancements in materials science, mechanics, and stretchable electronics have led to successful development of bioinspired cameras that resemble the structures and functions of biological light-sensing organs. In this review, we discuss some recent progresses in mechanics of bioinspired imaging systems, including tunable hemispherical eyeball camera and artificial compound eye camera. The mechanics models and results reviewed in this article can provide efficient tools for design and optimization of such systems, as well as other related optoelectronic systems that combine rigid elements with soft substrates.

  3. High sensitivity optical molecular imaging system

    Science.gov (United States)

    An, Yu; Yuan, Gao; Huang, Chao; Jiang, Shixin; Zhang, Peng; Wang, Kun; Tian, Jie

    2018-02-01

    Optical Molecular Imaging (OMI) has the advantages of high sensitivity, low cost and ease of use. By labeling the regions of interest with fluorescent or bioluminescence probes, OMI can noninvasively obtain the distribution of the probes in vivo, which play the key role in cancer research, pharmacokinetics and other biological studies. In preclinical and clinical application, the image depth, resolution and sensitivity are the key factors for researchers to use OMI. In this paper, we report a high sensitivity optical molecular imaging system developed by our group, which can improve the imaging depth in phantom to nearly 5cm, high resolution at 2cm depth, and high image sensitivity. To validate the performance of the system, special designed phantom experiments and weak light detection experiment were implemented. The results shows that cooperated with high performance electron-multiplying charge coupled device (EMCCD) camera, precision design of light path system and high efficient image techniques, our OMI system can simultaneously collect the light-emitted signals generated by fluorescence molecular imaging, bioluminescence imaging, Cherenkov luminance and other optical imaging modality, and observe the internal distribution of light-emitting agents fast and accurately.

  4. Image processing of integrated video image obtained with a charged-particle imaging video monitor system

    International Nuclear Information System (INIS)

    Iida, Takao; Nakajima, Takehiro

    1988-01-01

    A new type of charged-particle imaging video monitor system was constructed for video imaging of the distributions of alpha-emitting and low-energy beta-emitting nuclides. The system can display not only the scintillation image due to radiation on the video monitor but also the integrated video image becoming gradually clearer on another video monitor. The distortion of the image is about 5% and the spatial resolution is about 2 line pairs (lp)mm -1 . The integrated image is transferred to a personal computer and image processing is performed qualitatively and quantitatively. (author)

  5. Breast imaging with the SoftVue imaging system: first results

    Science.gov (United States)

    Duric, Neb; Littrup, Peter; Schmidt, Steven; Li, Cuiping; Roy, Olivier; Bey-Knight, Lisa; Janer, Roman; Kunz, Dave; Chen, Xiaoyang; Goll, Jeffrey; Wallen, Andrea; Zafar, Fouzaan; Allada, Veerendra; West, Erik; Jovanovic, Ivana; Li, Kuo; Greenway, William

    2013-03-01

    For women with dense breast tissue, who are at much higher risk for developing breast cancer, the performance of mammography is at its worst. Consequently, many early cancers go undetected when they are the most treatable. Improved cancer detection for women with dense breasts would decrease the proportion of breast cancers diagnosed at later stages, which would significantly lower the mortality rate. The emergence of whole breast ultrasound provides good performance for women with dense breast tissue, and may eliminate the current trade-off between the cost effectiveness of mammography and the imaging performance of more expensive systems such as magnetic resonance imaging. We report on the performance of SoftVue, a whole breast ultrasound imaging system, based on the principles of ultrasound tomography. SoftVue was developed by Delphinus Medical Technologies and builds on an early prototype developed at the Karmanos Cancer Institute. We present results from preliminary testing of the SoftVue system, performed both in the lab and in the clinic. These tests aimed to validate the expected improvements in image performance. Initial qualitative analyses showed major improvements in image quality, thereby validating the new imaging system design. Specifically, SoftVue's imaging performance was consistent across all breast density categories and had much better resolution and contrast. The implications of these results for clinical breast imaging are discussed and future work is described.

  6. Stereoscopic medical imaging collaboration system

    Science.gov (United States)

    Okuyama, Fumio; Hirano, Takenori; Nakabayasi, Yuusuke; Minoura, Hirohito; Tsuruoka, Shinji

    2007-02-01

    The computerization of the clinical record and the realization of the multimedia have brought improvement of the medical service in medical facilities. It is very important for the patients to obtain comprehensible informed consent. Therefore, the doctor should plainly explain the purpose and the content of the diagnoses and treatments for the patient. We propose and design a Telemedicine Imaging Collaboration System which presents a three dimensional medical image as X-ray CT, MRI with stereoscopic image by using virtual common information space and operating the image from a remote location. This system is composed of two personal computers, two 15 inches stereoscopic parallax barrier type LCD display (LL-151D, Sharp), one 1Gbps router and 1000base LAN cables. The software is composed of a DICOM format data transfer program, an operation program of the images, the communication program between two personal computers and a real time rendering program. Two identical images of 512×768 pixcels are displayed on two stereoscopic LCD display, and both images show an expansion, reduction by mouse operation. This system can offer a comprehensible three-dimensional image of the diseased part. Therefore, the doctor and the patient can easily understand it, depending on their needs.

  7. Stepped scanner radiographic imaging system

    International Nuclear Information System (INIS)

    Lapidus, S.N.

    1981-01-01

    The imaging system includes a radiographic camera, a bed for supporting a subject in view of the camera, and a display system. The camera provides X and Y coordinate signals of each radiographic event. The position of the bed relative to the camera is altered sequentially by drive means, between each of a sequence of images provided by the camera. The sequentially occurring images are presented on the display system, each image being positioned on the display in correspondence with the location of the bed relative to the camera. The coordinates of each image point presented on the display is equal to the sum of the respective X and Y coordinate signals from the camera with X and Y coordinate signals provided by a timer which controls the drive means and defines the location of the bed relative to the camera. The camera is electronically decoupled from the display by a gate during movement of the bed relative to the camera from one location to the next location to prevent any smearing effect within the composite image presented on the display. (author)

  8. Automated imaging system for single molecules

    Science.gov (United States)

    Schwartz, David Charles; Runnheim, Rodney; Forrest, Daniel

    2012-09-18

    There is provided a high throughput automated single molecule image collection and processing system that requires minimal initial user input. The unique features embodied in the present disclosure allow automated collection and initial processing of optical images of single molecules and their assemblies. Correct focus may be automatically maintained while images are collected. Uneven illumination in fluorescence microscopy is accounted for, and an overall robust imaging operation is provided yielding individual images prepared for further processing in external systems. Embodiments described herein are useful in studies of any macromolecules such as DNA, RNA, peptides and proteins. The automated image collection and processing system and method of same may be implemented and deployed over a computer network, and may be ergonomically optimized to facilitate user interaction.

  9. Digital image information systems in radiology

    International Nuclear Information System (INIS)

    Greinacher, C.F.C.; Luetke, B.; Seufert, G.

    1987-01-01

    About 25% of all patient examinations are performed digitally in a today's radiological department. A computerized system is described that supports generation, transport, interpretation and archiving of digital radiological images (Picture Archiving and Communication System PACS). The technical features concerning image communication via local area networks, image storage on magnetic and optical media and digital workstations for image display and manipulation are described. A structured system architecture is introduced. It allows flexible adaption to individual organizations and minimizes the requirements of the communication network. (orig.) [de

  10. Scorpion image segmentation system

    Science.gov (United States)

    Joseph, E.; Aibinu, A. M.; Sadiq, B. A.; Bello Salau, H.; Salami, M. J. E.

    2013-12-01

    Death as a result of scorpion sting has been a major public health problem in developing countries. Despite the high rate of death as a result of scorpion sting, little report exists in literature of intelligent device and system for automatic detection of scorpion. This paper proposed a digital image processing approach based on the floresencing characteristics of Scorpion under Ultra-violet (UV) light for automatic detection and identification of scorpion. The acquired UV-based images undergo pre-processing to equalize uneven illumination and colour space channel separation. The extracted channels are then segmented into two non-overlapping classes. It has been observed that simple thresholding of the green channel of the acquired RGB UV-based image is sufficient for segmenting Scorpion from other background components in the acquired image. Two approaches to image segmentation have also been proposed in this work, namely, the simple average segmentation technique and K-means image segmentation. The proposed algorithm has been tested on over 40 UV scorpion images obtained from different part of the world and results obtained show an average accuracy of 97.7% in correctly classifying the pixel into two non-overlapping clusters. The proposed 1system will eliminate the problem associated with some of the existing manual approaches presently in use for scorpion detection.

  11. Underwater laser imaging system (UWLIS)

    Energy Technology Data Exchange (ETDEWEB)

    DeLong, M. [Lawrence Livermore National Lab., CA (United States)

    1994-11-15

    Practical limitations with underwater imaging systems area reached when the noise in the back scattered radiation generated in the water between the imaging system and the target obscures the spatial contrast and resolution necessary for target discovery and identification. The advent of high power lasers operating in the blue-green portion of the visible spectrum (oceanic transmission window) has led to improved experimental illumination systems for underwater imaging. Range-gated and synchronously scanned devices take advantage of the unique temporal and spatial coherence properties of laser radiation, respectively, to overcome the deleterious effects of common volume back scatter.

  12. Stokes image reconstruction for two-color microgrid polarization imaging systems.

    Science.gov (United States)

    Lemaster, Daniel A

    2011-07-18

    The Air Force Research Laboratory has developed a new microgrid polarization imaging system capable of simultaneously reconstructing linear Stokes parameter images in two colors on a single focal plane array. In this paper, an effective method for extracting Stokes images is presented for this type of camera system. It is also shown that correlations between the color bands can be exploited to significantly increase overall spatial resolution. Test data is used to show the advantages of this approach over bilinear interpolation. The bounds (in terms of available reconstruction bandwidth) on image resolution are also provided.

  13. High dynamic range coding imaging system

    Science.gov (United States)

    Wu, Renfan; Huang, Yifan; Hou, Guangqi

    2014-10-01

    We present a high dynamic range (HDR) imaging system design scheme based on coded aperture technique. This scheme can help us obtain HDR images which have extended depth of field. We adopt Sparse coding algorithm to design coded patterns. Then we utilize the sensor unit to acquire coded images under different exposure settings. With the guide of the multiple exposure parameters, a series of low dynamic range (LDR) coded images are reconstructed. We use some existing algorithms to fuse and display a HDR image by those LDR images. We build an optical simulation model and get some simulation images to verify the novel system.

  14. Imaging system

    International Nuclear Information System (INIS)

    Froggatt, R.J.

    1981-01-01

    The invention provides a two dimensional imaging system in which a pattern of radiation falling on the system is detected to give electrical signals for each of a plurality of strips across the pattern. The detection is repeated for different orientations of the strips and the whole processed by compensated back projection. For a shadow x-ray system a plurality of strip x-ray detectors are rotated on a turntable. For lower frequencies the pattern may be rotated with a Dove prism and the strips condensed to suit smaller detectors with a cylindrical lens. (author)

  15. Image registration for a UV-Visible dual-band imaging system

    Science.gov (United States)

    Chen, Tao; Yuan, Shuang; Li, Jianping; Xing, Sheng; Zhang, Honglong; Dong, Yuming; Chen, Liangpei; Liu, Peng; Jiao, Guohua

    2018-06-01

    The detection of corona discharge is an effective way for early fault diagnosis of power equipment. UV-Visible dual-band imaging can detect and locate corona discharge spot at all-weather condition. In this study, we introduce an image registration protocol for this dual-band imaging system. The protocol consists of UV image denoising and affine transformation model establishment. We report the algorithm details of UV image preprocessing, affine transformation model establishment and relevant experiments for verification of their feasibility. The denoising algorithm was based on a correlation operation between raw UV images, a continuous mask and the transformation model was established by using corner feature and a statistical method. Finally, an image fusion test was carried out to verify the accuracy of affine transformation model. It has proved the average position displacement error between corona discharge and equipment fault at different distances in a 2.5m-20 m range are 1.34 mm and 1.92 mm in the horizontal and vertical directions, respectively, which are precise enough for most industrial applications. The resultant protocol is not only expected to improve the efficiency and accuracy of such imaging system for locating corona discharge spot, but also supposed to provide a more generalized reference for the calibration of various dual-band imaging systems in practice.

  16. An Ibm PC/AT-Based Image Acquisition And Processing System For Quantitative Image Analysis

    Science.gov (United States)

    Kim, Yongmin; Alexander, Thomas

    1986-06-01

    In recent years, a large number of applications have been developed for image processing systems in the area of biological imaging. We have already finished the development of a dedicated microcomputer-based image processing and analysis system for quantitative microscopy. The system's primary function has been to facilitate and ultimately automate quantitative image analysis tasks such as the measurement of cellular DNA contents. We have recognized from this development experience, and interaction with system users, biologists and technicians, that the increasingly widespread use of image processing systems, and the development and application of new techniques for utilizing the capabilities of such systems, would generate a need for some kind of inexpensive general purpose image acquisition and processing system specially tailored for the needs of the medical community. We are currently engaged in the development and testing of hardware and software for a fairly high-performance image processing computer system based on a popular personal computer. In this paper, we describe the design and development of this system. Biological image processing computer systems have now reached a level of hardware and software refinement where they could become convenient image analysis tools for biologists. The development of a general purpose image processing system for quantitative image analysis that is inexpensive, flexible, and easy-to-use represents a significant step towards making the microscopic digital image processing techniques more widely applicable not only in a research environment as a biologist's workstation, but also in clinical environments as a diagnostic tool.

  17. Raster images vectorization system

    OpenAIRE

    Genytė, Jurgita

    2006-01-01

    The problem of raster images vectorization was analyzed and researched in this work. Existing vectorization systems are quite expensive, the results are inaccurate, and the manual vectorization of a large number of drafts is impossible. That‘s why our goal was to design and develop a new raster images vectorization system using our suggested automatic vectorization algorithm and the way to record results in a new universal vectorial file format. The work consists of these main parts: analysis...

  18. Evaluation of IsoCal geometric calibration system for Varian linacs equipped with on-board imager and electronic portal imaging device imaging systems.

    Science.gov (United States)

    Gao, Song; Du, Weiliang; Balter, Peter; Munro, Peter; Jeung, Andrew

    2014-05-08

    The purpose of this study is to evaluate the accuracy and reproducibility of the IsoCal geometric calibration system for kilovoltage (kV) and megavoltage (MV) imagers on Varian C-series linear accelerators (linacs). IsoCal calibration starts by imaging a phantom and collimator plate using MV images with different collimator angles, as well as MV and kV images at different gantry angles. The software then identifies objects on the collimator plate and in the phantom to determine the location of the treatment isocenter and its relation to the MV and kV imager centers. It calculates offsets between the positions of the imaging panels and the treatment isocenter as a function of gantry angle and writes a correction file that can be applied to MV and kV systems to correct for those offsets in the position of the panels. We performed IsoCal calibration three times on each of five Varian C-series linacs, each time with an independent setup. We then compared the IsoCal calibrations with a simplified Winston-Lutz (WL)-based system and with a Varian cubic phantom (VC)-based system. The maximum IsoCal corrections ranged from 0.7 mm to 1.5 mm for MV and 0.9 mm to 1.8 mm for kV imagers across the five linacs. The variations in the three calibrations for each linac were less than 0.2 mm. Without IsoCal correction, the WL results showed discrepancies between the treatment isocenter and the imager center of 0.9 mm to 1.6 mm (for the MV imager) and 0.5 mm to 1.1 mm (for the kV imager); with IsoCal corrections applied, the differences were reduced to 0.2 mm to 0.6 mm (MV) and 0.3 mm to 0.6 mm (kV) across the five linacs. The VC system was not as precise as the WL system, but showed similar results, with discrepancies of less than 1.0 mm when the IsoCal corrections were applied. We conclude that IsoCal is an accurate and consistent method for calibration and periodic quality assurance of MV and kV imaging systems.

  19. Digital image display system for emergency room

    International Nuclear Information System (INIS)

    Murry, R.C.; Lane, T.J.; Miax, L.S.

    1989-01-01

    This paper reports on a digital image display system for the emergency room (ER) in a major trauma hospital. Its objective is to reduce radiographic image delivery time to a busy ER while simultaneously providing a multimodality capability. Image storage, retrieval, and display will also be facilitated with this system. The system's backbone is a token-ring network of RISC and personal computers. The display terminals are higher- function RISC computers with 1,024 2 color or gray-scale monitors. The PCs serve as administrative terminals. Nuclear medicine, CT, MR, and digitized film images are transferred to the image display system

  20. Hologlyphics: volumetric image synthesis performance system

    Science.gov (United States)

    Funk, Walter

    2008-02-01

    This paper describes a novel volumetric image synthesis system and artistic technique, which generate moving volumetric images in real-time, integrated with music. The system, called the Hologlyphic Funkalizer, is performance based, wherein the images and sound are controlled by a live performer, for the purposes of entertaining a live audience and creating a performance art form unique to volumetric and autostereoscopic images. While currently configured for a specific parallax barrier display, the Hologlyphic Funkalizer's architecture is completely adaptable to various volumetric and autostereoscopic display technologies. Sound is distributed through a multi-channel audio system; currently a quadraphonic speaker setup is implemented. The system controls volumetric image synthesis, production of music and spatial sound via acoustic analysis and human gestural control, using a dedicated control panel, motion sensors, and multiple musical keyboards. Music can be produced by external acoustic instruments, pre-recorded sounds or custom audio synthesis integrated with the volumetric image synthesis. Aspects of the sound can control the evolution of images and visa versa. Sounds can be associated and interact with images, for example voice synthesis can be combined with an animated volumetric mouth, where nuances of generated speech modulate the mouth's expressiveness. Different images can be sent to up to 4 separate displays. The system applies many novel volumetric special effects, and extends several film and video special effects into the volumetric realm. Extensive and various content has been developed and shown to live audiences by a live performer. Real world applications will be explored, with feedback on the human factors.

  1. 3D images and expert system

    International Nuclear Information System (INIS)

    Hasegawa, Jun-ichi

    1998-01-01

    This paper presents an expert system called 3D-IMPRESS for supporting applications of three dimensional (3D) image processing. This system can automatically construct a 3D image processing procedure based on a pictorial example of the goal given by a user. In the paper, to evaluate the performance of the system, it was applied to construction of procedures for extracting specific component figures from practical chest X-ray CT images. (author)

  2. Characterization of lens based photoacoustic imaging system

    Directory of Open Access Journals (Sweden)

    Kalloor Joseph Francis

    2017-12-01

    Full Text Available Some of the challenges in translating photoacoustic (PA imaging to clinical applications includes limited view of the target tissue, low signal to noise ratio and the high cost of developing real-time systems. Acoustic lens based PA imaging systems, also known as PA cameras are a potential alternative to conventional imaging systems in these scenarios. The 3D focusing action of lens enables real-time C-scan imaging with a 2D transducer array. In this paper, we model the underlying physics in a PA camera in the mathematical framework of an imaging system and derive a closed form expression for the point spread function (PSF. Experimental verification follows including the details on how to design and fabricate the lens inexpensively. The system PSF is evaluated over a 3D volume that can be imaged by this PA camera. Its utility is demonstrated by imaging phantom and an ex vivo human prostate tissue sample.

  3. Characterization of lens based photoacoustic imaging system.

    Science.gov (United States)

    Francis, Kalloor Joseph; Chinni, Bhargava; Channappayya, Sumohana S; Pachamuthu, Rajalakshmi; Dogra, Vikram S; Rao, Navalgund

    2017-12-01

    Some of the challenges in translating photoacoustic (PA) imaging to clinical applications includes limited view of the target tissue, low signal to noise ratio and the high cost of developing real-time systems. Acoustic lens based PA imaging systems, also known as PA cameras are a potential alternative to conventional imaging systems in these scenarios. The 3D focusing action of lens enables real-time C-scan imaging with a 2D transducer array. In this paper, we model the underlying physics in a PA camera in the mathematical framework of an imaging system and derive a closed form expression for the point spread function (PSF). Experimental verification follows including the details on how to design and fabricate the lens inexpensively. The system PSF is evaluated over a 3D volume that can be imaged by this PA camera. Its utility is demonstrated by imaging phantom and an ex vivo human prostate tissue sample.

  4. Musashi dynamic image processing system

    International Nuclear Information System (INIS)

    Murata, Yutaka; Mochiki, Koh-ichi; Taguchi, Akira

    1992-01-01

    In order to produce transmitted neutron dynamic images using neutron radiography, a real time system called Musashi dynamic image processing system (MDIPS) was developed to collect, process, display and record image data. The block diagram of the MDIPS is shown. The system consists of a highly sensitive, high resolution TV camera driven by a custom-made scanner, a TV camera deflection controller for optimal scanning, which adjusts to the luminous intensity and the moving speed of an object, a real-time corrector to perform the real time correction of dark current, shading distortion and field intensity fluctuation, a real time filter for increasing the image signal to noise ratio, a video recording unit and a pseudocolor monitor to realize recording in commercially available products and monitoring by means of the CRTs in standard TV scanning, respectively. The TV camera and the TV camera deflection controller utilized for producing still images can be applied to this case. The block diagram of the real-time corrector is shown. Its performance is explained. Linear filters and ranked order filters were developed. (K.I.)

  5. The image acquisition system design of floor grinder

    Science.gov (United States)

    Wang, Yang-jiang; Liu, Wei; Liu, Hui-qin

    2018-01-01

    Based on linear CCD, high resolution image real-time acquisition system serves as designing a set of image acquisition system for floor grinder through the calculation of optical imaging system. The entire image acquisition system can collect images of ground before and after the work of the floor grinder, and the data is transmitted through the Bluetooth system to the computer and compared to realize real-time monitoring of its working condition. The system provides technical support for the design of unmanned ground grinders.

  6. A Diagnostic Ultrasound Imaging System

    International Nuclear Information System (INIS)

    Lee, Seong Woo

    1999-01-01

    The ability to see the internal organs of the human body in a noninvasive way is a powerful diagnostic tool of modern medicine. Among these imaging modalities such as X-ray, MRI, and ultrasound. MRI and ultrasound are presenting much less risk of undesirable damage of both patient and examiner. In fact, no deleterious effects have been reported as a result of clinical examination by using MRI and ultrasound diagnostic equipment. As a result, their market volume has been rapidly increased. MRI has a good resolution. but there are a few disadvantages such as high price. non-real-time imaging capability. and expensive diagnostic cost. On the other hand, the ultrasound imaging system has inherently poor resolution as compared with X-ray and MRI. In spite of its poor resolution, the ultrasound diagnostic equipment is lower in price and has an ability of real-time imaging as compared with the others. As a result, the ultrasound imaging system has become general and essential modality for imaging the internal organs of human body. In this review various researches and developments to enhance the resolution of the ultrasound images are explained and future trends of the ultrasound imaging technology are described

  7. Exploratory survey of image quality on CR digital mammography imaging systems in Mexico

    International Nuclear Information System (INIS)

    Gaona, E.; Rivera, T.; Arreola, M.; Franco, J.; Molina, N.; Alvarez, B.; Azorín, C.G.; Casian, G.

    2014-01-01

    The purpose of this study was to assess the current status of image quality and dose in computed radiographic digital mammography (CRDM) systems. Studies included CRDM systems of various models and manufacturers which dose and image quality comparisons were performed. Due to the recent rise in the use of digital radiographic systems in Mexico, CRDM systems are rapidly replacing conventional film-screen systems without any regard to quality control or image quality standards. Study was conducted in 65 mammography facilities which use CRDM systems in the Mexico City and surrounding States. The systems were tested as used clinically. This means that the dose and beam qualities were selected using the automatic beam selection and photo-timed features. All systems surveyed generate laser film hardcopies for the radiologist to read on a scope or mammographic high luminance light box. It was found that 51 of CRDM systems presented a variety of image artefacts and non-uniformities arising from inadequate acquisition and processing, as well as from the laser printer itself. Undisciplined alteration of image processing settings by the technologist was found to be a serious prevalent problem in 42 facilities. Only four of them showed an image QC program which is periodically monitored by a medical physicist. The Average Glandular Dose (AGD) in the surveyed systems was estimated to have a mean value of 2.4 mGy. To improve image quality in mammography and make more efficient screening mammographic in early detection of breast cancer is required new legislation. - Highlights: • Radiation dose in CR digital mammography (CRDM) systems was determined. • Image quality related with dose in CR digital mammography (CRDM) systems was analysed. • Image processing artefacts were observed and correlated with dose. • Measured entrance dose by TL phosphors could be good parameter for radiation protection optimization in patient

  8. Developments of optical fast-gated imaging systems

    International Nuclear Information System (INIS)

    Koehler, H.A.; Kotecki, D.

    1984-08-01

    Several fast-gated imaging systems to measure ultra-fast single-transient data have been developed for time-resolved imaging of pulsed radiation sources. These systems were designed to achieve image recording times of 1 to 3 ms and dynamic ranges of >200:1 to produce large two-dimensional images (greater than or equal to 10 4 spatial points) of 1 to 2 ns exposure and small two-dimensional images (less than or equal to 200 spatial points) of less than or equal to 0.5 ns exposure. Both MCP intensified solid-state two-dimensional framing cameras and streak camera/solid-state camera systems were used; the framing camera system provides snap shots with high spatial resolution whereas the streak camera system provides for limited spatial points each with high temporal resolution. Applications of these systems include electron-beam, x-ray, gamma-ray, and neutron diagnostics. This report reviews the characteristics of the major components of fast-gated imaging systems developed at Lawrence Livermore National Laboratory. System performances are described in view of major experiments, and the diagnostic requirements of new experiments in atomic physics (x-ray lasers) and nuclear physics (fusion) are indicated

  9. Content Based Retrieval System for Magnetic Resonance Images

    International Nuclear Information System (INIS)

    Trojachanets, Katarina

    2010-01-01

    The amount of medical images is continuously increasing as a consequence of the constant growth and development of techniques for digital image acquisition. Manual annotation and description of each image is impractical, expensive and time consuming approach. Moreover, it is an imprecise and insufficient way for describing all information stored in medical images. This induces the necessity for developing efficient image storage, annotation and retrieval systems. Content based image retrieval (CBIR) emerges as an efficient approach for digital image retrieval from large databases. It includes two phases. In the first phase, the visual content of the image is analyzed and the feature extraction process is performed. An appropriate descriptor, namely, feature vector is then associated with each image. These descriptors are used in the second phase, i.e. the retrieval process. With the aim to improve the efficiency and precision of the content based image retrieval systems, feature extraction and automatic image annotation techniques are subject of continuous researches and development. Including the classification techniques in the retrieval process enables automatic image annotation in an existing CBIR system. It contributes to more efficient and easier image organization in the system.Applying content based retrieval in the field of magnetic resonance is a big challenge. Magnetic resonance imaging is an image based diagnostic technique which is widely used in medical environment. According to this, the number of magnetic resonance images is enormously growing. Magnetic resonance images provide plentiful medical information, high resolution and specific nature. Thus, the capability of CBIR systems for image retrieval from large database is of great importance for efficient analysis of this kind of images. The aim of this thesis is to propose content based retrieval system architecture for magnetic resonance images. To provide the system efficiency, feature

  10. Flow imaging of the cardiovascular system using magnetic resonance imaging

    International Nuclear Information System (INIS)

    Imai, Hitoshi; Sakakibara, Makoto; Sunami, Yuko

    1988-01-01

    Blood flow images by magnetic resonance imaging (MRI) using a 0.25 T unit were evaluated for nine normal volunteers and 108 subjects with a variety of cardiovascular abnormalities. Using the non-gated short-spin echo (SE) technique, blood flow in the cardiovascular systems was not imaged in the normal volunteers. Using end-systolic and end-diastolic SE techniques for the normal subjects, blood flow in the cardiac chambers was not clearly imaged. Blood flow in the ascending aorta and aortic arch often did not appear in the gated SE images of the normal subjects. However, blood flow in the descending aorta was often observed in the gated SE images. Blood flow imaging was demonstrated by both non-gated and gated SE techniques in regions where blood flow was relatively slow; for example, in the left atrium of mitral stenosis, in an aortic aneurysm, in a false lumen of an aortic dissection, and in the left ventricle having old myocardial infarction. Using the non-gated inversion recovery (IR) technique, no blood flow was imaged in the cardiovascular system except in the left atrium of one case with mitral stenosis. Using the non-gated short SE technique, there was good correlation between the thrombus formation and the presence of blood flow images in the left atria of 17 patients with mitral stenosis, and in the aneurysmal portions of the aorta or in the false lumens of aortic dissection of 18 patients. It was suggested that mural thrombi in such diseases were related to the relatively slow blood flow. Blood flow imaging easily distinguished stagnant blood flow from mural thrombi using non-gated short SE, end-systolic SE, and IR techniques. Thus, blood flow imaging using MRI should become an important means of evaluating the cardiovascular system. (author)

  11. Design and simulation of a totally digital image system for medical image applications

    International Nuclear Information System (INIS)

    Archwamety, C.

    1987-01-01

    The Totally Digital Imaging System (TDIS) is based on system requirements information from the Radiology Department, University of Arizona Health Science Center. This dissertation presents the design of this complex system, the TDIS specification, the system performance requirements, and the evaluation of the system using the computer-simulation programs. Discrete-event simulation models were developed for the TDIS subsystems, including an image network, imaging equipment, storage migration algorithm, data base archive system, and a control and management network. The simulation system uses empirical data generation and retrieval rates measured at the University Medical Center hospital. The entire TDIS system was simulated in Simscript II.5 using a VAX 8600 computer system. Simulation results show the fiber-optical-image network to be suitable; however, the optical-disk-storage system represents a performance bottleneck

  12. Developing stereo image based robot control system

    Energy Technology Data Exchange (ETDEWEB)

    Suprijadi,; Pambudi, I. R.; Woran, M.; Naa, C. F; Srigutomo, W. [Department of Physics, FMIPA, InstitutTeknologi Bandung Jl. Ganesha No. 10. Bandung 40132, Indonesia supri@fi.itb.ac.id (Indonesia)

    2015-04-16

    Application of image processing is developed in various field and purposes. In the last decade, image based system increase rapidly with the increasing of hardware and microprocessor performance. Many fields of science and technology were used this methods especially in medicine and instrumentation. New technique on stereovision to give a 3-dimension image or movie is very interesting, but not many applications in control system. Stereo image has pixel disparity information that is not existed in single image. In this research, we proposed a new method in wheel robot control system using stereovision. The result shows robot automatically moves based on stereovision captures.

  13. Image quality in digital radiographic systems

    Directory of Open Access Journals (Sweden)

    Almeida Solange Maria de

    2003-01-01

    Full Text Available The aim of the present study was to evaluate the image quality of four direct digital radiographic systems. Radiographs were made of the maxillary central incisor and mandibular left molar regions of a dry skull, and an aluminum step-wedge. The X-ray generator operated at 10 mA, 60 and 70 kVp, and images were acquired with 3, 5, 8, 12, 24 and 48 exposure pulses. Six well-trained observers classified the images by means of scores from 1 to 3. Collected data were submitted to nonparametric statistical analysis using Fisher's exact test. Statistical analysis showed significant differences (p<0.01 in image quality with the four systems. Based on the results, it was possible to conclude that: 1 all of the digital systems presented good performance in producing acceptable images for diagnosis, if the exposures of the step-wedge and the maxillary central incisor region were made at 5 pulses, as well as at 8 pulses for the mandibular left molar region, selecting 60 or 70kVp; 2 higher percentages of acceptable images were obtained with the administration of lower radiation doses in CCD-sensors (charge-coupled device; 3 the Storage Phosphor systems produced acceptable images at a large range of exposure settings, that included low, intermediate and high radiation doses.

  14. An image analysis system for near-infrared (NIR) fluorescence lymph imaging

    Science.gov (United States)

    Zhang, Jingdan; Zhou, Shaohua Kevin; Xiang, Xiaoyan; Rasmussen, John C.; Sevick-Muraca, Eva M.

    2011-03-01

    Quantitative analysis of lymphatic function is crucial for understanding the lymphatic system and diagnosing the associated diseases. Recently, a near-infrared (NIR) fluorescence imaging system is developed for real-time imaging lymphatic propulsion by intradermal injection of microdose of a NIR fluorophore distal to the lymphatics of interest. However, the previous analysis software3, 4 is underdeveloped, requiring extensive time and effort to analyze a NIR image sequence. In this paper, we develop a number of image processing techniques to automate the data analysis workflow, including an object tracking algorithm to stabilize the subject and remove the motion artifacts, an image representation named flow map to characterize lymphatic flow more reliably, and an automatic algorithm to compute lymph velocity and frequency of propulsion. By integrating all these techniques to a system, the analysis workflow significantly reduces the amount of required user interaction and improves the reliability of the measurement.

  15. Image acquisition system for traffic monitoring applications

    Science.gov (United States)

    Auty, Glen; Corke, Peter I.; Dunn, Paul; Jensen, Murray; Macintyre, Ian B.; Mills, Dennis C.; Nguyen, Hao; Simons, Ben

    1995-03-01

    An imaging system for monitoring traffic on multilane highways is discussed. The system, named Safe-T-Cam, is capable of operating 24 hours per day in all but extreme weather conditions and can capture still images of vehicles traveling up to 160 km/hr. Systems operating at different remote locations are networked to allow transmission of images and data to a control center. A remote site facility comprises a vehicle detection and classification module (VCDM), an image acquisition module (IAM) and a license plate recognition module (LPRM). The remote site is connected to the central site by an ISDN communications network. The remote site system is discussed in this paper. The VCDM consists of a video camera, a specialized exposure control unit to maintain consistent image characteristics, and a 'real-time' image processing system that processes 50 images per second. The VCDM can detect and classify vehicles (e.g. cars from trucks). The vehicle class is used to determine what data should be recorded. The VCDM uses a vehicle tracking technique to allow optimum triggering of the high resolution camera of the IAM. The IAM camera combines the features necessary to operate consistently in the harsh environment encountered when imaging a vehicle 'head-on' in both day and night conditions. The image clarity obtained is ideally suited for automatic location and recognition of the vehicle license plate. This paper discusses the camera geometry, sensor characteristics and the image processing methods which permit consistent vehicle segmentation from a cluttered background allowing object oriented pattern recognition to be used for vehicle classification. The image capture of high resolution images and the image characteristics required for the LPRMs automatic reading of vehicle license plates, is also discussed. The results of field tests presented demonstrate that the vision based Safe-T-Cam system, currently installed on open highways, is capable of producing automatic

  16. Image portion identification methods, image parsing methods, image parsing systems, and articles of manufacture

    Science.gov (United States)

    Lassahn, Gordon D.; Lancaster, Gregory D.; Apel, William A.; Thompson, Vicki S.

    2013-01-08

    Image portion identification methods, image parsing methods, image parsing systems, and articles of manufacture are described. According to one embodiment, an image portion identification method includes accessing data regarding an image depicting a plurality of biological substrates corresponding to at least one biological sample and indicating presence of at least one biological indicator within the biological sample and, using processing circuitry, automatically identifying a portion of the image depicting one of the biological substrates but not others of the biological substrates.

  17. Consultation system for image diagnosis: Report formation support system

    International Nuclear Information System (INIS)

    Ikeda, M.; Sakuma, S.; Ishigaki, T.; Suzuki, K.; Oikawa, K.

    1987-01-01

    The authors developed a consultation system for image diagnosis, involving artificial intelligence ideas. In this system, the authors proposed a new report formation support system and implemented it in lymphangiography. This support system starts with the input of image interpretation. The input process is made mainly by selecting items. This system encodes the input findings into the semantic network, which is represented as a directed graph, and it reserves them into the knowledge database in the above structure. Finally, the output (report) is made in the near natural language, which corresponds to the input findings

  18. Digital radiology and digitally formatted image management systems

    International Nuclear Information System (INIS)

    Cox, G.G.; Dwyer, S.J. III; Templeton, A.W.

    1987-01-01

    The number of diagnostic examinations performed with digitally formatted imaging equipment is increasing. Digital general-purpose and fluoroscopic radiology systems are being clinically evaluated. Digitizing conventional x-ray films, such as mammograms, frequently improves the diagnostic quality of the images. The digitizing process with laser has also afforded the opportunity to document required spatial resolution for digital imaging and network systems. The use of digitally formatted image instrumentation imposes new requirements on the acquisition, display and manipulation, transmission, hard copy image recording, and archiving of diagnostic data. Networking of digitally formatted image data offers many advantages for managing digital information. This paper identifies and describes digital radiographic systems. Parameters required for designing and implementing a digital image management system are outlined. Spatial and contrast resolution requirements are identified. The key parameters include the amount of image data generated each working day, the retrieval rate of the generated data, the display hardware and software needed for interactive diagnosis display stations, the requirements for analog hard copy generation, and on-line and long-term archiving requirements. These image management systems are often called PACS (Picture Archiving and Communication Systems)

  19. Spatial Harmonic Decomposition as a tool for unsteady flow phenomena analysis

    International Nuclear Information System (INIS)

    Duparchy, A; Guillozet, J; De Colombel, T; Bornard, L

    2014-01-01

    Hydropower is already the largest single renewable electricity source today but its further development will face new deployment constraints such as large-scale projects in emerging economies and the growth of intermittent renewable energy technologies. The potential role of hydropower as a grid stabilizer leads to operating hydro power plants in ''off-design'' zones. As a result, new methods of analyzing associated unsteady phenomena are needed to improve the design of hydraulic turbines. The key idea of the development is to compute a spatial description of a phenomenon by using a combination from several sensor signals. The spatial harmonic decomposition (SHD) extends the concept of so-called synchronous and asynchronous pulsations by projecting sensor signals on a linearly independent set of a modal scheme. This mathematical approach is very generic as it can be applied on any linear distribution of a scalar quantity defined on a closed curve. After a mathematical description of SHD, this paper will discuss the impact of instrumentation and provide tools to understand SHD signals. Then, as an example of a practical application, SHD is applied on a model test measurement in order to capture and describe dynamic pressure fields. Particularly, the spatial description of the phenomena provides new tools to separate the part of pressure fluctuations that contribute to output power instability or mechanical stresses. The study of the machine stability in partial load operating range in turbine mode or the comparison between the gap pressure field and radial thrust behavior during turbine brake operation are both relevant illustrations of SHD contribution

  20. An integral design strategy combining optical system and image processing to obtain high resolution images

    Science.gov (United States)

    Wang, Jiaoyang; Wang, Lin; Yang, Ying; Gong, Rui; Shao, Xiaopeng; Liang, Chao; Xu, Jun

    2016-05-01

    In this paper, an integral design that combines optical system with image processing is introduced to obtain high resolution images, and the performance is evaluated and demonstrated. Traditional imaging methods often separate the two technical procedures of optical system design and imaging processing, resulting in the failures in efficient cooperation between the optical and digital elements. Therefore, an innovative approach is presented to combine the merit function during optical design together with the constraint conditions of image processing algorithms. Specifically, an optical imaging system with low resolution is designed to collect the image signals which are indispensable for imaging processing, while the ultimate goal is to obtain high resolution images from the final system. In order to optimize the global performance, the optimization function of ZEMAX software is utilized and the number of optimization cycles is controlled. Then Wiener filter algorithm is adopted to process the image simulation and mean squared error (MSE) is taken as evaluation criterion. The results show that, although the optical figures of merit for the optical imaging systems is not the best, it can provide image signals that are more suitable for image processing. In conclusion. The integral design of optical system and image processing can search out the overall optimal solution which is missed by the traditional design methods. Especially, when designing some complex optical system, this integral design strategy has obvious advantages to simplify structure and reduce cost, as well as to gain high resolution images simultaneously, which has a promising perspective of industrial application.

  1. Nuclear imaging system

    International Nuclear Information System (INIS)

    Barrett, H.H.; Horrigan, F.A.

    1975-01-01

    This invention relates to a nuclear imaging system for mapping the source of high energy nuclear particles from a living organ which has selectively absorbed a radioactive compound by spatially coding the energy from the source in a Fresnel pattern on a detector and decoding the detector output to prouce an image of the source. The coding is produced by a Fresnel zone plate interposed between the nuclear energy source and the detector whose position is adjustable with respect to the detector to focus the slices of the nuclear source on the detector. By adjusting the zone plate to a plurality of positions, data from a plurality of cross-sectional slices are produced from which a three-dimensional image of the nuclear source may be obtained. (Patent Office Record)

  2. Imaging quality evaluation method of pixel coupled electro-optical imaging system

    Science.gov (United States)

    He, Xu; Yuan, Li; Jin, Chunqi; Zhang, Xiaohui

    2017-09-01

    With advancements in high-resolution imaging optical fiber bundle fabrication technology, traditional photoelectric imaging system have become ;flexible; with greatly reduced volume and weight. However, traditional image quality evaluation models are limited by the coupling discrete sampling effect of fiber-optic image bundles and charge-coupled device (CCD) pixels. This limitation substantially complicates the design, optimization, assembly, and evaluation image quality of the coupled discrete sampling imaging system. Based on the transfer process of grayscale cosine distribution optical signal in the fiber-optic image bundle and CCD, a mathematical model of coupled modulation transfer function (coupled-MTF) is established. This model can be used as a basis for following studies on the convergence and periodically oscillating characteristics of the function. We also propose the concept of the average coupled-MTF, which is consistent with the definition of traditional MTF. Based on this concept, the relationships among core distance, core layer radius, and average coupled-MTF are investigated.

  3. Scanned Image Projection System Employing Intermediate Image Plane

    Science.gov (United States)

    DeJong, Christian Dean (Inventor); Hudman, Joshua M. (Inventor)

    2014-01-01

    In imaging system, a spatial light modulator is configured to produce images by scanning a plurality light beams. A first optical element is configured to cause the plurality of light beams to converge along an optical path defined between the first optical element and the spatial light modulator. A second optical element is disposed between the spatial light modulator and a waveguide. The first optical element and the spatial light modulator are arranged such that an image plane is created between the spatial light modulator and the second optical element. The second optical element is configured to collect the diverging light from the image plane and collimate it. The second optical element then delivers the collimated light to a pupil at an input of the waveguide.

  4. Evaluation of transmitted images by teleradiology system

    International Nuclear Information System (INIS)

    Hoshikawa, Yoshikazu

    1993-01-01

    Teleradiology system is a combination of digital data networks and computer systems, which is the electric transmission of radiographs and/or radiologic images from local to center radiological system. The author evaluated reproducibility of transmitted images using Photophone (Image Data Corporation) as teleradiology system. Proven cases of abdominal free air (38 plain films, 15 CT), pneumothorax (24 plain films, 20 CT) and small bowel obstruction (30 plain films, 8 CT) were transmitted. Findings could be identified on non-magnified plain films in 75.6%, 83.3% and 96.7% respectively and on magnified CT in 100%, 100% and 100%. Transmitted images of 57 cases of abdominal trauma were read for positive findings and diagnosis by three radiologists. Average positive ratio was 47.3% on plain films and 70.9% on CT. Diagnosis was correct in 66.7% on CT. Specificity and sensitivity were 81.9% and 61.6% respectively on plain film and 88.6% and 93.9% on CT. The accuracy of transmitted images appears to be unsatisfactory on this study. It is suggested that the system is useful for consultation of already identified findings on the original images. (author)

  5. Evaluation of transmitted images by teleradiology system

    Energy Technology Data Exchange (ETDEWEB)

    Hoshikawa, Yoshikazu (St. Marianna Univ., Kawasaki (Japan). School of Medicine)

    1993-12-01

    Teleradiology system is a combination of digital data networks and computer systems, which is the electric transmission of radiographs and/or radiologic images from local to center radiological system. The author evaluated reproducibility of transmitted images using Photophone (Image Data Corporation) as teleradiology system. Proven cases of abdominal free air (38 plain films, 15 CT), pneumothorax (24 plain films, 20 CT) and small bowel obstruction (30 plain films, 8 CT) were transmitted. Findings could be identified on non-magnified plain films in 75.6%, 83.3% and 96.7% respectively and on magnified CT in 100%, 100% and 100%. Transmitted images of 57 cases of abdominal trauma were read for positive findings and diagnosis by three radiologists. Average positive ratio was 47.3% on plain films and 70.9% on CT. Diagnosis was correct in 66.7% on CT. Specificity and sensitivity were 81.9% and 61.6% respectively on plain film and 88.6% and 93.9% on CT. The accuracy of transmitted images appears to be unsatisfactory on this study. It is suggested that the system is useful for consultation of already identified findings on the original images. (author).

  6. The National Ignition Facility Neutron Imaging System

    International Nuclear Information System (INIS)

    Wilke, Mark D.; Batha, Steven H.; Bradley, Paul A.; Day, Robert D.; Clark, David D.; Fatherley, Valerie E.; Finch, Joshua P.; Gallegos, Robert A.; Garcia, Felix P.; Grim, Gary P.; Jaramillo, Steven A.; Montoya, Andrew J.; Morgan, George L.; Oertel, John A.; Ortiz, Thomas A.; Payton, Jeremy R.; Pazuchanics, Peter; Schmidt, Derek W.; Valdez, Adelaida C.; Wilde, Carl H.

    2008-01-01

    The National Ignition Facility (NIF) is scheduled to begin deuterium-tritium (DT) shots possibly in the next several years. One of the important diagnostics in understanding capsule behavior and to guide changes in Hohlraum illumination, capsule design, and geometry will be neutron imaging of both the primary 14 MeV neutrons and the lower-energy downscattered neutrons in the 6-13 MeV range. The neutron imaging system (NIS) described here, which we are currently building for use on NIF, uses a precisely aligned set of apertures near the target to form the neutron images on a segmented scintillator. The images are recorded on a gated, intensified charge coupled device. Although the aperture set may be as close as 20 cm to the target, the imaging camera system will be located at a distance of 28 m from the target. At 28 m the camera system is outside the NIF building. Because of the distance and shielding, the imager will be able to obtain images with little background noise. The imager will be capable of imaging downscattered neutrons from failed capsules with yields Y n >10 14 neutrons. The shielding will also permit the NIS to function at neutron yields >10 18 , which is in contrast to most other diagnostics that may not work at high neutron yields. The following describes the current NIF NIS design and compares the predicted performance with the NIF specifications that must be satisfied to generate images that can be interpreted to understand results of a particular shot. The current design, including the aperture, scintillator, camera system, and reconstruction methods, is briefly described. System modeling of the existing Omega NIS and comparison with the Omega data that guided the NIF design based on our Omega results is described. We will show NIS model calculations of the expected NIF images based on component evaluations at Omega. We will also compare the calculated NIF input images with those unfolded from the NIS images generated from our NIS numerical

  7. Reliability demonstration of imaging surveillance systems

    International Nuclear Information System (INIS)

    Sheridan, T.F.; Henderson, J.T.; MacDiarmid, P.R.

    1979-01-01

    Security surveillance systems which employ closed circuit television are being deployed with increasing frequency for the protection of property and other valuable assets. A need exists to demonstrate the reliability of such systems before their installation to assure that the deployed systems will operate when needed with only the scheduled amount of maintenance and support costs. An approach to the reliability demonstration of imaging surveillance systems which employ closed circuit television is described. Failure definitions based on industry television standards and imaging alarm assessment criteria for surveillance systems are discussed. Test methods which allow 24 hour a day operation without the need for numerous test scenarios, test personnel and elaborate test facilities are presented. Existing reliability demonstration standards are shown to apply which obviate the need for elaborate statistical tests. The demonstration methods employed are shown to have applications in other types of imaging surveillance systems besides closed circuit television

  8. Development of a PET/Cerenkov-light hybrid imaging system

    International Nuclear Information System (INIS)

    Yamamoto, Seiichi; Hamamura, Fuka; Kato, Katsuhiko; Ogata, Yoshimune; Watabe, Tadashi; Ikeda, Hayato; Kanai, Yasukazu; Hatazawa, Jun; Watabe, Hiroshi

    2014-01-01

    Purpose: Cerenkov-light imaging is a new molecular imaging technology that detects visible photons from high-speed electrons using a high sensitivity optical camera. However, the merit of Cerenkov-light imaging remains unclear. If a PET/Cerenkov-light hybrid imaging system were developed, the merit of Cerenkov-light imaging would be clarified by directly comparing these two imaging modalities. Methods: The authors developed and tested a PET/Cerenkov-light hybrid imaging system that consists of a dual-head PET system, a reflection mirror located above the subject, and a high sensitivity charge coupled device (CCD) camera. The authors installed these systems inside a black box for imaging the Cerenkov-light. The dual-head PET system employed a 1.2 × 1.2 × 10 mm 3 GSO arranged in a 33 × 33 matrix that was optically coupled to a position sensitive photomultiplier tube to form a GSO block detector. The authors arranged two GSO block detectors 10 cm apart and positioned the subject between them. The Cerenkov-light above the subject is reflected by the mirror and changes its direction to the side of the PET system and is imaged by the high sensitivity CCD camera. Results: The dual-head PET system had a spatial resolution of ∼1.2 mm FWHM and sensitivity of ∼0.31% at the center of the FOV. The Cerenkov-light imaging system's spatial resolution was ∼275μm for a 22 Na point source. Using the combined PET/Cerenkov-light hybrid imaging system, the authors successfully obtained fused images from simultaneously acquired images. The image distributions are sometimes different due to the light transmission and absorption in the body of the subject in the Cerenkov-light images. In simultaneous imaging of rat, the authors found that 18 F-FDG accumulation was observed mainly in the Harderian gland on the PET image, while the distribution of Cerenkov-light was observed in the eyes. Conclusions: The authors conclude that their developed PET/Cerenkov-light hybrid imaging

  9. New real-time image processing system for IRFPA

    Institute of Scientific and Technical Information of China (English)

    WANG Bing-jian; LIU Shang-qian; CHENG Yu-bao

    2006-01-01

    Influenced by detectors' material,manufacturing technology etc,every detector in infrared focal plane array (IRFPA) will output different voltages even if their input radiation flux is the same.And this is called non-uniformity of IRFPA.At the same time,the high background temperature,low temperature difference between targets and background and the low responsivity of IRFPA result in low contrast of infrared images.So non-uniformity correction and image enhancement are important techniques for IRFPA imaging system.This paper proposes a new real-time infrared image processing system based on Field Programmable Gate Array(FPGA).The system implements non-uniformity correction,image enhancement and video synthesization etc.By using parallel architecture and pipeline technique,the system processing speed is as high as 50Mx12bits per second.It is appropriate greatly to a large IRFPA and a high frame frequency IRFPA imaging system.The system is miniatured in one FPGA.

  10. Radiographic imaging system

    International Nuclear Information System (INIS)

    Davis, L. Jr.; Barrett, H.H.

    1979-01-01

    This invention describes a system for imaging a subject, such as a human being, in which there has been injected a contrast agent which absorbs radiation of a predetermined frequency. The system utilizes a source of high energy radiation such as X or gamma radiation. The source is a composite of first and second radiating materials each of which is arranged in a predetermined pattern or code, each pattern having both luminous and dark regions. In one embodiment, the luminous regions of one pattern are in registration with the dark regions of the other pattern, these regions being spaced apart in an alternative embodiment. The characteristic frequencies of radiation emitted by the first and second materials are respectively lower and higher than the predetermined absorption frequency. A detector of radiation is positioned relative to the subject and the source such that radiation propagating through the subject is incident upon the detector. Since the absorption edge of the contrast agent lies between the two characteristic frequencies of radiation, radiation from the second material is preferentially absorbed by the contrast agent with the result that the contrast agent appears to be illuminated by a coded source while the remainder of the subject may be regarded as illuminated essentially by a uniform uncoded source. Imaging is accomplished by a decoding of a detected coded image. Substances within the subject having other absorption frequencies are not imaged since the radiations of both materials are essentially equally absorbed by the subject so that the source appears uncoded

  11. Detection rates in pediatric diagnostic imaging: a picture archive and communication system compared with a web-based imaging system

    International Nuclear Information System (INIS)

    McDonald, L.; Cramer, B.; Barrett, B.

    2006-01-01

    This prospective study assesses whether there are differences in accuracy of interpretation of diagnostic images among users of a picture archive and communication system (PACS) diagnostic workstation, compared with a less costly Web-based imaging system on a personal computer (PC) with a high resolution monitor. One hundred consecutive pediatric chest or abdomen and skeletal X-rays were selected from hospital inpatient and outpatient studies over a 5-month interval. They were classified as normal (n = 32), obviously abnormal (n = 33), or having subtle abnormal findings (n = 35) by 2 senior radiologists who reached a consensus for each individual case. Subsequently, 5 raters with varying degrees of experience independently viewed and interpreted the cases as normal or abnormal. Raters viewed each image 1 month apart on a PACS and on the Web-based PC imaging system. There was no relation between accuracy of detection and the system used to evaluate X-ray images (P = 0.92). The total percentage of incorrect interpretations on the Web-based PC imaging system was 23.2%, compared with 23.6% on the PACS (P = 0.92). For all raters combined, the overall difference in proportion assessed incorrectly on the PACS, compared with the PC system, was not significant at 0.4% (95%CI, -3.5% to 4.3%). The high-resolution Web-based imaging system via PC is an adequate alternative to a PACS clinical workstation. Accordingly, the provision of a more extensive network of workstations throughout the hospital setting could have potentially significant cost savings. (author)

  12. Multispectral Panoramic Imaging System, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — International Electronic Machines Corporation, a leader in the design of precision imaging systems, will develop an innovative multispectral, panoramic imaging...

  13. Medical image information system 2001. Development of the medical image information system to risk management- Medical exposure management

    International Nuclear Information System (INIS)

    Kuranishi, Makoto; Kumagai, Michitomo; Shintani, Mitsuo

    2000-01-01

    This paper discusses the methods and systems for optimizing the following supplements 10 and 17 for national health and medical care. The supplements 10 and 17 of DICOM (digital imaging and communications in medicine) system, which is now under progress for the purpose to keep compatibility within medical image information system as an international standard, are important for making the cooperation between HIS (hospital information system)/RIS (radiation information system) and modality (imaging instruments). Supplement 10 concerns the system to send the information of patients and their orders through HIS/RIS to modality and 17, the information of modality performed procedure step (MPPS) to HIS/RIS. The latter defines to document patients' exposure, a part of which has not been recognized in Japan. Thus the medical information system can be useful for risk-management of medical exposure in future. (K.H.)

  14. Medical image information system 2001. Development of the medical image information system to risk management- Medical exposure management

    Energy Technology Data Exchange (ETDEWEB)

    Kuranishi, Makoto; Kumagai, Michitomo; Shintani, Mitsuo [Toyama Medical and Pharmaceutical Univ. (Japan). Hospital

    2000-12-01

    This paper discusses the methods and systems for optimizing the following supplements 10 and 17 for national health and medical care. The supplements 10 and 17 of DICOM (digital imaging and communications in medicine) system, which is now under progress for the purpose to keep compatibility within medical image information system as an international standard, are important for making the cooperation between HIS (hospital information system)/RIS (radiation information system) and modality (imaging instruments). Supplement 10 concerns the system to send the information of patients and their orders through HIS/RIS to modality and 17, the information of modality performed procedure step (MPPS) to HIS/RIS. The latter defines to document patients' exposure, a part of which has not been recognized in Japan. Thus the medical information system can be useful for risk-management of medical exposure in future. (K.H.)

  15. Triangular SPECT system for 3-D total organ volume imaging: Design concept and preliminary imaging results

    International Nuclear Information System (INIS)

    Lim, C.B.; Anderson, J.; Covic, J.

    1985-01-01

    SPECT systems based on 2-D detectors for projection data collection and filtered back-projection image reconstruction have the potential for true 3-D imaging, providing contiguous slice images in any orientation. Anger camera-based SPECT systems have the natural advantage supporting planar imaging clinical procedures. However, current systems suffer from two drawbacks; poor utilization of emitted photons, and inadequate system design for SPECT. A SPECT system consisting of three rectangular cameras with radial translation would offer the variable cylindrical FOV of 25 cm to 40 cm diameter allowing close detector access to the object. This system would provide optimized imaging for both brain and body organs in terms of sensitivity and resolution. For brain imaging a tight detector triangle with fan beam collimation, matching detector UFOV to the head, allows full 2 π utilization of emitted photons, resulting in >4 times sensitivity increase over the single detector system. Minification of intrinsic detector resolution in fan beam collimation further improves system resolution. For body organ imaging the three detectors with parallel hole collimators, rotating in non-circular orbit, provide both improved resolution and three-fold sensitivity increase. Practical challenges lie in ensuring perfect image overlap from three detectors without resolution degradation and artifact generation in order to benefit from the above improvements. An experimental system has been developed to test the above imaging concept and we have successfully demonstrated the superior image quality of the overlapped images. Design concept will be presented with preliminary imaging results

  16. Japanese experience of telemedicine in oncology.

    Science.gov (United States)

    Mizushima, H; Uchiyama, E; Nagata, H; Matsuno, Y; Sekiguchi, R; Ohmatsu, H; Hojo, F; Shimoda, T; Wakao, F; Shinkai, T; Yamaguchi, N; Moriyama, N; Kakizoe, T; Abe, K; Terada, M

    2001-05-01

    We started telemedicine projects from 1990 with a telepathology system within Tsukiji Campus of National Cancer Center. In 1994, we connected Tsukiji Campus and Kashiwa Campus by 6 Mbps optical fiber leased line using IP protocol for data transmission, for teleconference, telepathology, and teleradiology projects. We also started connection of regional cancer centers and are now forming a cancer center network of 14 cancer centers. We are at present organizing 130 teleconferences per year with an attendance of more than 16000 people as summary. We have also used a high-resolution image transferring system, such as SHD (2000 pixelsx2000 pixels resolution) system on one side, and an economical telemedicine system using JAVA and a WWW browser (NCC_image) on the other side. We think that providing information is another field of telemedicine. We began the experimental gopher and WWW service in 1993. We are now providing official up-to-date cancer information for patients and healthcare professionals. We are getting more than 400000 hits per month. We are also providing a teleconference video session which is held every week on the Internet using a Real Video system with synchronized slide presentation on the WWW browser. We are also organizing a Cancer Image Reference Database System including DICOM images with viewer software. This paper is a summary of the telemedicine projects performed at the National Cancer Center.

  17. ORIS: the Oak Ridge Imaging System program listings

    International Nuclear Information System (INIS)

    Bell, P.R.; Dougherty, J.M.

    1978-04-01

    The Oak Ridge Imaging System (ORIS) is a general purpose access, storage, processing and display system for nuclear medicine imaging with rectilinear scanner and gamma camera. This volume contains listings of the PDP-8/E version of ORIS Version 2. The system is designed to run under the Digital Equipment Corporation's OS/8 monitor in 16K or more words of core. System and image file mass storage is on RK8E disk; longer-time image file storage is provided on DECtape. Another version of this program exists for use with the RF08 disk, and a more limited version is for DECtape only. This latter version is intended for non-medical imaging

  18. Space-Ready Advanced Imaging System, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — In this Phase II effort Toyon will increase the state-of-the-art for video/image systems. This will include digital image compression algorithms as well as system...

  19. An integrated compact airborne multispectral imaging system using embedded computer

    Science.gov (United States)

    Zhang, Yuedong; Wang, Li; Zhang, Xuguo

    2015-08-01

    An integrated compact airborne multispectral imaging system using embedded computer based control system was developed for small aircraft multispectral imaging application. The multispectral imaging system integrates CMOS camera, filter wheel with eight filters, two-axis stabilized platform, miniature POS (position and orientation system) and embedded computer. The embedded computer has excellent universality and expansibility, and has advantages in volume and weight for airborne platform, so it can meet the requirements of control system of the integrated airborne multispectral imaging system. The embedded computer controls the camera parameters setting, filter wheel and stabilized platform working, image and POS data acquisition, and stores the image and data. The airborne multispectral imaging system can connect peripheral device use the ports of the embedded computer, so the system operation and the stored image data management are easy. This airborne multispectral imaging system has advantages of small volume, multi-function, and good expansibility. The imaging experiment results show that this system has potential for multispectral remote sensing in applications such as resource investigation and environmental monitoring.

  20. Development of an integrated filing system for endoscopic images.

    Science.gov (United States)

    Fujino, M A; Ikeda, M; Yamamoto, Y; Kinose, T; Tachikawa, H; Morozumi, A; Sano, S; Kojima, Y; Nakamura, T; Kawai, T

    1991-01-01

    A new integrated filing system for endoscopic images has been developed, comprising a main image filing system and subsystems located at different stations. A hybrid filing system made up of both digital and analog filing devices was introduced to construct this system that combines the merits of the two filing methods. Each subsystem provided with a video processor, is equipped with a digital filing device, and routine images were recorded in the analog image filing device of the main system. The use of a multi-input adapter enabled simultaneous input of analog images from up to 8 video processors. Recorded magneto-optical disks make it possible to recall the digital images at any station in the hospital; the disks are copied without image degradation and also utilised for image processing. This system promises reliable storage and integrated, efficient management of endoscopic information. It also costs less to install than the so-called PACS (picture archiving and communication system), which connects all the stations of the hospital using optical fiber cables.

  1. Recent developments of MR imaging system and future trends

    International Nuclear Information System (INIS)

    Fujieda, Kunimi

    1996-01-01

    Because MR imaging technique has no limitation of slice direction, uses none of mechanically moving components and can employ electronic scanning method for data acquisition, the most advanced electronics and CPU techniques have been applied to develop MR imaging systems. Along with pursuance of better equipment performance as clinical diagnostic equipment, cost reduction, improvement of operability and safety, easy siting, comfortable examination and economical operation cost by remarkable reduction of running cost have become important factors in development of MR imaging system. From this viewpoint, MR imaging systems incorporating an open gantry with a relatively low field strength and of vertical field system have been developed recently and they are being accepted as clinically useful equipment. The vertical field, open gantry system has an optimum structure capable of performing interventional imaging, thus clinical application of the system have been actively attempted. Thanks to recent development of various MRI techniques, image quality quite acceptable for routine clinical diagnosis can now be obtained by using the systems with permanent magnet and resistive magnet. Thus, it is considered that evaluation of not only equipment performance but also the total performances of the MR imaging system as described above will become important. The MR imaging technique has a possibility to substitute itself for other conventional imaging modalities because the technique can visualize physiological and metabolic functions in addition to morphological imaging. It is expected that application of MR imaging modality will be further expanded by continuous investigation of applicable clinical fields and development of imaging technologies. (J.P.N.)

  2. An integrated multimodality image-guided robot system for small-animal imaging research

    International Nuclear Information System (INIS)

    Hsu, Wen-Lin; Hsin Wu, Tung; Hsu, Shih-Ming; Chen, Chia-Lin; Lee, Jason J.S.; Huang, Yung-Hui

    2011-01-01

    We design and construct an image-guided robot system for use in small-animal imaging research. This device allows the use of co-registered small-animal PET-MRI images to guide the movements of robotic controllers, which will accurately place a needle probe at any predetermined location inside, for example, a mouse tumor, for biological readouts without sacrificing the animal. This system is composed of three major components: an automated robot device, a CCD monitoring mechanism, and a multimodality registration implementation. Specifically, the CCD monitoring mechanism was used for correction and validation of the robot device. To demonstrate the value of the proposed system, we performed a tumor hypoxia study that involved FMISO small-animal PET imaging and the delivering of a pO 2 probe into the mouse tumor using the image-guided robot system. During our evaluation, the needle positioning error was found to be within 0.153±0.042 mm of desired placement; the phantom simulation errors were within 0.693±0.128 mm. In small-animal studies, the pO 2 probe measurements in the corresponding hypoxia areas showed good correlation with significant, low tissue oxygen tensions (less than 6 mmHg). We have confirmed the feasibility of the system and successfully applied it to small-animal investigations. The system could be easily adapted to extend to other biomedical investigations in the future.

  3. Imaging system for creating 3D block-face cryo-images of whole mice

    Science.gov (United States)

    Roy, Debashish; Breen, Michael; Salvado, Olivier; Heinzel, Meredith; McKinley, Eliot; Wilson, David

    2006-03-01

    We developed a cryomicrotome/imaging system that provides high resolution, high sensitivity block-face images of whole mice or excised organs, and applied it to a variety of biological applications. With this cryo-imaging system, we sectioned cryo-preserved tissues at 2-40 μm thickness and acquired high resolution brightfield and fluorescence images with microscopic in-plane resolution (as good as 1.2 μm). Brightfield images of normal and pathological anatomy show exquisite detail, especially in the abdominal cavity. Multi-planar reformatting and 3D renderings allow one to interrogate 3D structures. In this report, we present brightfield images of mouse anatomy, as well as 3D renderings of organs. For BPK mice model of polycystic kidney disease, we compared brightfield cryo-images and kidney volumes to MRI. The color images provided greater contrast and resolution of cysts as compared to in vivo MRI. We note that color cryo-images are closer to what a researcher sees in dissection, making it easier for them to interpret image data. The combination of field of view, depth of field, ultra high resolution and color/fluorescence contrast enables cryo-image volumes to provide details that cannot be found through in vivo imaging or other ex vivo optical imaging approaches. We believe that this novel imaging system will have applications that include identification of mouse phenotypes, characterization of diseases like blood vessel disease, kidney disease, and cancer, assessment of drug and gene therapy delivery and efficacy and validation of other imaging modalities.

  4. Design of optically stable image reflector system.

    Science.gov (United States)

    Tsai, Chung-Yu

    2013-08-01

    The design of a partially optically stable (POS) reflector system, in which the exit ray direction and image pose are unchanged as the reflector system rotates about a specific directional vector, was presented in an earlier study by the current group [Appl. Phys. B100, 883-890 (2010)]. The present study further proposes an optically stable image (OSI) reflector system, in which not only is the optical stability property of the POS system retained, but the image position and total ray path length are also fixed. An analytical method is proposed for the design of OSI reflector systems comprising multiple reflectors. The validity of the proposed approach is demonstrated by means of two illustrative examples.

  5. Performance assessment of imaging plates for the JHR transfer Neutron Imaging System

    Science.gov (United States)

    Simon, E.; Guimbal, P. AB(; )

    2018-01-01

    The underwater Neutron Imaging System to be installed in the Jules Horowitz Reactor (JHR-NIS) is based on a transfer method using a neutron activated beta-emitter like Dysprosium. The information stored in the converter is to be offline transferred on a specific imaging system, still to be defined. Solutions are currently under investigation for the JHR-NIS in order to anticipate the disappearance of radiographic films commonly used in these applications. We report here the performance assessment of Computed Radiography imagers (Imaging Plates) performed at LLB/Orphée (CEA Saclay). Several imaging plate types are studied, in one hand in the configuration involving an intimate contact with an activated dysprosium foil converter: Fuji BAS-TR, Fuji UR-1 and Carestream Flex XL Blue imaging plates, and in the other hand by using a prototypal imaging plate doped with dysprosium and thus not needing any contact with a separate converter foil. The results for these imaging plates are compared with those obtained with gadolinium doped imaging plate used in direct neutron imaging (Fuji BAS-ND). The detection performances of the different imagers are compared regarding resolution and noise. The many advantages of using imaging plates over radiographic films (high sensitivity, linear response, high dynamic range) could palliate its lower intrinsic resolution.

  6. Initial application of a geometric QA tool for integrated MV and kV imaging systems on three image guided radiotherapy systems.

    Science.gov (United States)

    Mao, Weihua; Speiser, Michael; Medin, Paul; Papiez, Lech; Solberg, Timothy; Xing, Lei

    2011-05-01

    Several linacs with integrated kilovoltage (kV) imaging have been developed for delivery of image guided radiation therapy (IGRT). High geometric accuracy and coincidence of kV imaging systems and megavoltage (MV) beam delivery are essential for successful image guidance. A geometric QA tool has been adapted for routine QA for evaluating and characterizing the geometric accuracy of kV and MV cone-beam imaging systems. The purpose of this work is to demonstrate the application of methodology to routine QA across three IGRT-dedicated linac platforms. It has been applied to a Varian Trilogy (Varian Medical Systems, Palo Alto, CA), an Elekta SynergyS (Elekta, Stockholm, Sweden), and a Brainlab Vero (Brainlab AG, Feldkirchen, Germany). Both the Trilogy and SynergyS linacs are equipped with a retractable kV x-ray tube and a flat panel detector. The Vero utilizes a rotating, rigid ring structure integrating a MV x-ray head mounted on orthogonal gimbals, an electronic portal imaging device (EPID), two kV x-ray tubes, and two fixed flat panel detectors. This dual kV imaging system provides orthogonal radiographs, CBCT images, and real-time fluoroscopic monitoring. Two QA phantoms were built to suit different field sizes. Projection images of a QA phantom were acquired using MV and kV imaging systems at a series of gantry angles. Software developed for this study was used to analyze the projection images and calculate nine geometric parameters for each projection. The Trilogy was characterized five times over one year, while the SynergyS was characterized four times and the Vero once. Over 6500 individual projections were acquired and analyzed. Quantitative geometric parameters of both MV and kV imaging systems, as well as the isocenter consistency of the imaging systems, were successfully evaluated. A geometric tool has been successfully implemented for calibration and QA of integrated kV and MV across a variety of radiotherapy platforms. X-ray source angle deviations up to

  7. Imaging of the peripheral vascular system

    International Nuclear Information System (INIS)

    Gould, S.A.; Pond, G.D.; Pinsky, S.; Moss, G.S.; Srikantaswamy, S.; Ryo, U.Y.

    1984-01-01

    This book is limited neither to the peripheral vascular system nor to diagnostic imaging techniques. Its 18 chapters cover nonimaging blood-flow techniques (Doppler ultrasound, plethysmography) as well as noninvasive and invasive imaging techniques (ultrasound, computed tomography, radionuclide digital-subtraction angiography, and contrast angiography). These are applied not only to the peripheral vascular system but also to the aorta and vena cava

  8. Optimization of a Biometric System Based on Acoustic Images

    Directory of Open Access Journals (Sweden)

    Alberto Izquierdo Fuente

    2014-01-01

    Full Text Available On the basis of an acoustic biometric system that captures 16 acoustic images of a person for 4 frequencies and 4 positions, a study was carried out to improve the performance of the system. On a first stage, an analysis to determine which images provide more information to the system was carried out showing that a set of 12 images allows the system to obtain results that are equivalent to using all of the 16 images. Finally, optimization techniques were used to obtain the set of weights associated with each acoustic image that maximizes the performance of the biometric system. These results improve significantly the performance of the preliminary system, while reducing the time of acquisition and computational burden, since the number of acoustic images was reduced.

  9. Optimization of a Biometric System Based on Acoustic Images

    Science.gov (United States)

    Izquierdo Fuente, Alberto; Del Val Puente, Lara; Villacorta Calvo, Juan J.; Raboso Mateos, Mariano

    2014-01-01

    On the basis of an acoustic biometric system that captures 16 acoustic images of a person for 4 frequencies and 4 positions, a study was carried out to improve the performance of the system. On a first stage, an analysis to determine which images provide more information to the system was carried out showing that a set of 12 images allows the system to obtain results that are equivalent to using all of the 16 images. Finally, optimization techniques were used to obtain the set of weights associated with each acoustic image that maximizes the performance of the biometric system. These results improve significantly the performance of the preliminary system, while reducing the time of acquisition and computational burden, since the number of acoustic images was reduced. PMID:24616643

  10. A fractal-based image encryption system

    KAUST Repository

    Abd-El-Hafiz, S. K.

    2014-12-01

    This study introduces a novel image encryption system based on diffusion and confusion processes in which the image information is hidden inside the complex details of fractal images. A simplified encryption technique is, first, presented using a single-fractal image and statistical analysis is performed. A general encryption system utilising multiple fractal images is, then, introduced to improve the performance and increase the encryption key up to hundreds of bits. This improvement is achieved through several parameters: feedback delay, multiplexing and independent horizontal or vertical shifts. The effect of each parameter is studied separately and, then, they are combined to illustrate their influence on the encryption quality. The encryption quality is evaluated using different analysis techniques such as correlation coefficients, differential attack measures, histogram distributions, key sensitivity analysis and the National Institute of Standards and Technology (NIST) statistical test suite. The obtained results show great potential compared to other techniques.

  11. Scanning Terahertz Heterodyne Imaging Systems

    Science.gov (United States)

    Siegel, Peter; Dengler, Robert

    2007-01-01

    Scanning terahertz heterodyne imaging systems are now at an early stage of development. In a basic scanning terahertz heterodyne imaging system, (see Figure 1) two far-infrared lasers generate beams denoted the local-oscillator (LO) and signal that differ in frequency by an amount, denoted the intermediate frequency (IF), chosen to suit the application. The LO beam is sent directly to a mixer as one of two inputs. The signal beam is focused to a spot on or in the specimen. After transmission through or reflection from the specimen, the beams are focused to a spot on a terahertz mixer, which extracts the IF outputs. The specimen is mounted on a translation stage, by means of which the focal spot is scanned across the specimen to build up an image.

  12. Simulation of an image network in a medical image information system

    International Nuclear Information System (INIS)

    Massar, A.D.A.; De Valk, J.P.J.; Reijns, G.L.; Bakker, A.R.

    1985-01-01

    The desirability of an integrated (digital) communication system for medical images is widely accepted. In the USA and in Europe several experimental projects are in progress to realize (a part of) such a system. Among these is the IMAGIS project in the Netherlands. From the conclusions of the preliminary studies performed, some requirements can be formulated such a system should meet in order to be accepted by its users. For example, the storage resolution of the images should match the maximum resolution of the presently acquired digital images. This determines the amount of data and therefore the storage requirements. Further, the desired images should be there when needed. This time constraint determines the speed requirements to be imposed on the system. As compared to current standards, very large storage capacities and very fast communication media are needed to meet these requirements. By employing cacheing techniques and suitable data compression schemes for the storage and by carefully choosing the network protocols, bare capacity demands can be alleviated. A communication network is needed to make the imaging system available over a larger area. As the network is very likely to become a major bottleneck for system performance, effects of variation of various attributes have to be carefully studied and analysed. After interesting results had been obtained (although preliminary) using a simulation model for a layered storage structure, it was decided to apply simulation also to this problem. Effects of network topology, access protocols and buffering strategies will be tested. Changes in performance resulting from changes in various network parameters will be studied. Results of this study at its present state are presented

  13. Millimeter-wave Imaging Systems with Aperture Synthesis Techniques

    DEFF Research Database (Denmark)

    Löffler, Torsten; Krozer, Viktor; Zhurbenko, Vitaliy

    2010-01-01

    The paper describes development of a millimetre-wave imaging system using multi-element aperture filling techniques [1]. Such imaging systems are increasingly demonstrated for security applications and in particular standoff imaging of persons and bonding flaw and defect detection [2]. The major ...

  14. System for imaging plutonium through heavy shielding

    International Nuclear Information System (INIS)

    Kuckertz, T.H.; Cannon, T.M.; Fenimore, E.E.; Moss, C.E.; Nixon, K.V.

    1984-04-01

    A single pinhole can be used to image strong self-luminescent gamma-ray sources such as plutonium on gamma scintillation (Anger) cameras. However, if the source is weak or heavily shielded, a poor signal to noise ratio can prevent acquisition of the image. An imaging system designed and built at Los Alamos National Laboratory uses a coded aperture to image heavily shielded sources. The paper summarizes the mathematical techniques, based on the Fast Delta Hadamard transform, used to decode raw images. Practical design considerations such as the phase of the uniformly redundant aperture and the encoded image sampling are discussed. The imaging system consists of a custom designed m-sequence coded aperture, a Picker International Corporation gamma scintillation camera, a LeCroy 3500 data acquisition system, and custom imaging software. The paper considers two sources - 1.5 mCi 57 Co unshielded at a distance of 27 m and 220 g of bulk plutonium (11.8% 240 Pu) with 0.3 cm lead, 2.5 cm steel, and 10 cm of dense plastic material at a distance of 77.5 cm. Results show that the location and geometry of a source hidden in a large sealed package can be determined without having to open the package. 6 references, 4 figures

  15. MIDAS - ESO's new image processing system

    Science.gov (United States)

    Banse, K.; Crane, P.; Grosbol, P.; Middleburg, F.; Ounnas, C.; Ponz, D.; Waldthausen, H.

    1983-03-01

    The Munich Image Data Analysis System (MIDAS) is an image processing system whose heart is a pair of VAX 11/780 computers linked together via DECnet. One of these computers, VAX-A, is equipped with 3.5 Mbytes of memory, 1.2 Gbytes of disk storage, and two tape drives with 800/1600 bpi density. The other computer, VAX-B, has 4.0 Mbytes of memory, 688 Mbytes of disk storage, and one tape drive with 1600/6250 bpi density. MIDAS is a command-driven system geared toward the interactive user. The type and number of parameters in a command depends on the unique parameter invoked. MIDAS is a highly modular system that provides building blocks for the undertaking of more sophisticated applications. Presently, 175 commands are available. These include the modification of the color-lookup table interactively, to enhance various image features, and the interactive extraction of subimages.

  16. Design of CMOS imaging system based on FPGA

    Science.gov (United States)

    Hu, Bo; Chen, Xiaolai

    2017-10-01

    In order to meet the needs of engineering applications for high dynamic range CMOS camera under the rolling shutter mode, a complete imaging system is designed based on the CMOS imaging sensor NSC1105. The paper decides CMOS+ADC+FPGA+Camera Link as processing architecture and introduces the design and implementation of the hardware system. As for camera software system, which consists of CMOS timing drive module, image acquisition module and transmission control module, the paper designs in Verilog language and drives it to work properly based on Xilinx FPGA. The ISE 14.6 emulator ISim is used in the simulation of signals. The imaging experimental results show that the system exhibits a 1280*1024 pixel resolution, has a frame frequency of 25 fps and a dynamic range more than 120dB. The imaging quality of the system satisfies the requirement of the index.

  17. Lossy image compression for digital medical imaging systems

    Science.gov (United States)

    Wilhelm, Paul S.; Haynor, David R.; Kim, Yongmin; Nelson, Alan C.; Riskin, Eve A.

    1990-07-01

    Image compression at rates of 10:1 or greater could make PACS much more responsive and economically attractive. This paper describes a protocol for subjective and objective evaluation of the fidelity of compressed/decompressed images to the originals and presents the results ofits application to four representative and promising compression methods. The methods examined are predictive pruned tree-structured vector quantization, fractal compression, the discrete cosine transform with equal weighting of block bit allocation, and the discrete cosine transform with human visual system weighting of block bit allocation. Vector quantization is theoretically capable of producing the best compressed images, but has proven to be difficult to effectively implement. It has the advantage that it can reconstruct images quickly through a simple lookup table. Disadvantages are that codebook training is required, the method is computationally intensive, and achieving the optimum performance would require prohibitively long vector dimensions. Fractal compression is a relatively new compression technique, but has produced satisfactory results while being computationally simple. It is fast at both image compression and image reconstruction. Discrete cosine iransform techniques reproduce images well, but have traditionally been hampered by the need for intensive computing to compress and decompress images. A protocol was developed for side-by-side observer comparison of reconstructed images with originals. Three 1024 X 1024 CR (Computed Radiography) images and two 512 X 512 X-ray CT images were viewed at six bit rates (0.2, 0.4, 0.6, 0.9, 1.2, and 1.5 bpp for CR, and 1.0, 1.3, 1.6, 1.9, 2.2, 2.5 bpp for X-ray CT) by nine radiologists at the University of Washington Medical Center. The CR images were viewed on a Pixar II Megascan (2560 X 2048) monitor and the CT images on a Sony (1280 X 1024) monitor. The radiologists' subjective evaluations of image fidelity were compared to

  18. [Characteristics of mass size distributions of water-soluble, inorganic ions during summer and winter haze days of Beijing].

    Science.gov (United States)

    Huang, Yi-Min; Liu, Zi-Rui; Chen, Hong; Wang, Yue-Si

    2013-04-01

    To investigate the size distribution characteristics of water soluble inorganic ions in haze days, the particle samples were collected by two Andersen cascade impactors in Beijing during summer and winter time and each sampling period lasted two weeks. Online measurement of PM10 and PM2.5 using TEOM were also conducted at the same time. Sources and formation mechanism of water soluble inorganic ions were analyzed based on their size distributions. The results showed that average concentrations of PM10 and PM 2.5 were (245.5 +/- 8.4) microg x m(-3) and (120.2 +/- 2.0) microg x m(-3) during summer haze days (SHD), and were (384.2 +/- 30.2) microg x m(-3) and (252.7 +/- 47.1) microg x m(-3) during winter haze days (WHD), which suggested fine particles predominated haze pollution episode in both seasons. Total water-soluble inorganic ions concentrations were higher in haze days than those in non-haze days, especially in fine particles. Furthermore, concentrations of secondary inorganic ions (SO4(2-), NO3(-) and NH4(+)) increased quicker than other inorganic ions in fine particles during haze days, indicating secondary inorganic ions played an important role in the formation of haze pollution. Similar size distributions were found for all Sinorganic water soluble ions except for NO3(-), during SHD and WHD. SO4(2-) and NH4(+) dominated in the fine mode (PM1.0) while Mg2+ and Ca2+ accumulated in coarse fraction, Na+, Cl- and K+ showed a bimodal distribution. For NO3(-), however, it showed a bimodal distribution during SHD and a unimodal distribution dominated in the fine fraction was found during WHD. The average mass median aerodynamic diameter (MMAD) of SO4(2-) was 0.64 microm in SHD, which suggested the formation of SO4(2-) was mainly attributed to in-cloud processes. Furthermore, a higher apparent conversion rate of sulfur dioxide (SOR) was found in SHD, indicating more fine particles were produced by photochemical reaction in haze days than that in non-haze days. The

  19. Parameters leading to a successful radiographic outcome following surgical treatment for Lenke 2 curves.

    Science.gov (United States)

    Koller, Heiko; Meier, Oliver; McClung, Anna; Hitzl, Wolfgang; Mayer, Michael; Sucato, Daniel

    2015-07-01

    In Lenke 2 curves, there are conflicting data when to include the PTC into the fusion. Studies focusing on Lenke 2 curves are scant. The number of patients with significant postoperative shoulder height difference (SHD) or trunk shift (TS) is as high as 30 % indicating further research. Therefore, the purpose of the current study was to improve understanding of curve resolution and shoulder balance following surgical correction of Lenke 2 curves as well as the identification of radiographic parameters predicting postoperative curve resolution, shoulder and trunk balance in perspective of inclusion/exclusion of the proximal thoracic curve (PTC). This is a retrospective study of a 158 Lenke 2 curves. Serial radiographs were analyzed for the main thoracic curve (MTC), PTC, and lumbar curve (LC), SHD, clavicle angle (CA), T-1 tilt, deviation of the central sacral vertical line (CSVL) off the C7 plumb line.Patients were stratified whether the PTC was included in the fusion (+PTC group, n = 60) or not (-PTC group, n = 98). Intergroup results were studied. Compensatory mechanisms for SHD were studied in detail. Adding-on distally was defined as an increase of the lowest instrumented vertebra adjacent disc angle (LIVDA) >3°. Stepwise regression analyses were performed to establish predictive radiographic parameters. At follow-up averaging 24 months significant differences between the +PTC and -PTC group existed for the PTC (24° vs 28°, p 5° (27 vs 53 %, p 2 cm) was 9 (6 %): 7 in the -PTC vs 2 in the +PTC group (p = .03). Utilization of compensatory mechanisms (99 vs 83 %, p Statistics showed postoperative SHD improvement in both the +PTC and -PTC groups. There were no significant differences regarding SHD, CA and T1-Tilt between groups. However, only in the -PTC group, a significant change between postoperative and follow-up SHD existed (p = .02). Statistics identified a preoperative 'left shoulder up' (p statistical model only for the -PTC group showed 9 parameters

  20. Image BOSS: a biomedical object storage system

    Science.gov (United States)

    Stacy, Mahlon C.; Augustine, Kurt E.; Robb, Richard A.

    1997-05-01

    Researchers using biomedical images have data management needs which are oriented perpendicular to clinical PACS. The image BOSS system is designed to permit researchers to organize and select images based on research topic, image metadata, and a thumbnail of the image. Image information is captured from existing images in a Unix based filesystem, stored in an object oriented database, and presented to the user in a familiar laboratory notebook metaphor. In addition, the ImageBOSS is designed to provide an extensible infrastructure for future content-based queries directly on the images.

  1. Advanced imaging of skeletal manifestations of systemic mastocytosis

    International Nuclear Information System (INIS)

    Fritz, J.; Fishman, E.K.; Carrino, J.A.; Horger, M.S.

    2012-01-01

    Systemic mastocytosis comprises a group of clonal disorders of the mast cell that most commonly involves the skeletal system. Imaging can be helpful in the detection and characterization of the osseous manifestations of this disease. While radiography and bone scans are frequently used for this assessment, low-dose multidetector computed tomography and magnetic resonance imaging can be more sensitive for the detection of marrow involvement and for the demonstration of the various disease patterns. In this article, we review the pathophysiological and clinical features of systemic mastocytosis, discuss the role of imaging for staging and management, and illustrate the various cross-sectional imaging appearances. Awareness and knowledge of the imaging features of this disorder will increase the accuracy of image interpretation and can contribute important information for management decisions. (orig.)

  2. Advanced imaging of skeletal manifestations of systemic mastocytosis

    Energy Technology Data Exchange (ETDEWEB)

    Fritz, J. [Johns Hopkins University School of Medicine, Russell H. Morgan Department of Radiology and Radiological Science, Baltimore, MD (United States); Fishman, E.K.; Carrino, J.A. [Johns Hopkins University School of Medicine, Russell H. Morgan Department of Radiology and Radiological Science, Baltimore, MD (United States); Horger, M.S. [Eberhard-Karls-University, Department of Diagnostic and Interventional Radiology, Tuebingen (Germany)

    2012-08-15

    Systemic mastocytosis comprises a group of clonal disorders of the mast cell that most commonly involves the skeletal system. Imaging can be helpful in the detection and characterization of the osseous manifestations of this disease. While radiography and bone scans are frequently used for this assessment, low-dose multidetector computed tomography and magnetic resonance imaging can be more sensitive for the detection of marrow involvement and for the demonstration of the various disease patterns. In this article, we review the pathophysiological and clinical features of systemic mastocytosis, discuss the role of imaging for staging and management, and illustrate the various cross-sectional imaging appearances. Awareness and knowledge of the imaging features of this disorder will increase the accuracy of image interpretation and can contribute important information for management decisions. (orig.)

  3. An XCT image database system

    International Nuclear Information System (INIS)

    Komori, Masaru; Minato, Kotaro; Koide, Harutoshi; Hirakawa, Akina; Nakano, Yoshihisa; Itoh, Harumi; Torizuka, Kanji; Yamasaki, Tetsuo; Kuwahara, Michiyoshi.

    1984-01-01

    In this paper, an expansion of X-ray CT (XCT) examination history database to XCT image database is discussed. The XCT examination history database has been constructed and used for daily examination and investigation in our hospital. This database consists of alpha-numeric information (locations, diagnosis and so on) of more than 15,000 cases, and for some of them, we add tree structured image data which has a flexibility for various types of image data. This database system is written by MUMPS database manipulation language. (author)

  4. Using a web-based image quality assurance reporting system to improve image quality.

    Science.gov (United States)

    Czuczman, Gregory J; Pomerantz, Stuart R; Alkasab, Tarik K; Huang, Ambrose J

    2013-08-01

    The purpose of this study is to show the impact of a web-based image quality assurance reporting system on the rates of three common image quality errors at our institution. A web-based image quality assurance reporting system was developed and used beginning in April 2009. Image quality endpoints were assessed immediately before deployment (period 1), approximately 18 months after deployment of a prototype reporting system (period 2), and approximately 12 months after deployment of a subsequent upgraded department-wide reporting system (period 3). A total of 3067 axillary shoulder radiographs were reviewed for correct orientation, 355 shoulder CT scans were reviewed for correct reformatting of coronal and sagittal images, and 346 sacral MRI scans were reviewed for correct acquisition plane of axial images. Error rates for each review period were calculated and compared using the Fisher exact test. Error rates of axillary shoulder radiograph orientation were 35.9%, 7.2%, and 10.0%, respectively, for the three review periods. The decrease in error rate between periods 1 and 2 was statistically significant (p < 0.0001). Error rates of shoulder CT reformats were 9.8%, 2.7%, and 5.8%, respectively, for the three review periods. The decrease in error rate between periods 1 and 2 was statistically significant (p = 0.03). Error rates for sacral MRI axial sequences were 96.5%, 32.5%, and 3.4%, respectively, for the three review periods. The decrease in error rates between periods 1 and 2 and between periods 2 and 3 was statistically significant (p < 0.0001). A web-based system for reporting image quality errors may be effective for improving image quality.

  5. Development of an image intensifier-TV digital imaging system with a multiple-slit scanning x-ray beam

    International Nuclear Information System (INIS)

    Kume, Y.; Doi, K.

    1986-01-01

    The authors are developing a new digital x-ray imaging system employing a multiple-slit assembly (MSA) and an image intensifier (II)-TV digital system. The final image consisting of primary radiation is digitally reconstructed from multiple slit images obtained with the MSA. This system can significantly reduce the scattered radiation from an object and the veiling glare from II-TV system. The quality of the reconstructed image is related to many parameters, such as slit width, the number of image frames, and the image reconstruction algorithm. They present the effect of these various parameters on basic imaging properties and the practicability of the method in comparison with conventional wide beam imaging

  6. Image processing system for flow pattern measurements

    International Nuclear Information System (INIS)

    Ushijima, Satoru; Miyanaga, Yoichi; Takeda, Hirofumi

    1989-01-01

    This paper describes the development and application of an image processing system for measurements of flow patterns occuring in natural circulation water flows. In this method, the motions of particles scattered in the flow are visualized by a laser light slit and they are recorded on normal video tapes. These image data are converted to digital data with an image processor and then transfered to a large computer. The center points and pathlines of the particle images are numerically analized, and velocity vectors are obtained with these results. In this image processing system, velocity vectors in a vertical plane are measured simultaneously, so that the two dimensional behaviors of various eddies, with low velocity and complicated flow patterns usually observed in natural circulation flows, can be determined almost quantitatively. The measured flow patterns, which were obtained from natural circulation flow experiments, agreed with photographs of the particle movements, and the validity of this measuring system was confirmed in this study. (author)

  7. Under sodium ultrasonic imaging system for PFBR

    International Nuclear Information System (INIS)

    Patankar, V.H.; Lalwani, S.K.; Agashe, A.A.

    2014-01-01

    Under Sodium UltraSonic Scanner (USUSS) has been developed to detect the growth and protrusion of fuel sub-assemblies of PFBR, submerged in liquid sodium by using the ultrasonic imaging technique during reactor shut-down when liquid sodium is at 180 ℃. The imaging is carried out prior to every Fuel handling operation. Electronics Division, BARC has designed and developed an 8-Channel Ultrasonic Imaging System (UIS) which consists of 4 downward viewing and 4 side viewing ultrasonic transducers alongwith pulser-receiver, signal processing electronics hardware and software. An automated mechanical scanner developed by IGCAR houses sodium immersible transducers to image the fuel sub assemblies. The system has been successfully tested with dummy protruding and grown FSAs, submerged under liquid sodium. Such ultrasonic imaging systems are not available to India from international market. The USUSS developed indigenously has all the features available in similar systems developed by other countries. After every imaging campaign, the mechanical scanner containing ultrasonic transducers is stored in the Argon filled storage-pit. Before every campaign of USUSS, it is necessary to check the healthiness of the sodium immersible and contaminated ultrasonic transducers, as the under-sodium scanner is decontaminated once in five years. For this purpose, a novel Non Contact Ultrasonic Inspection System (NCUIS) has been designed and developed by Electronics Division, BARC to check the functionality of the high-temperature and contaminated transducers of USUSS, using air-coupled ultrasonic technique. (author)

  8. A new remote-imaging diagnosis system at Komazawa University

    International Nuclear Information System (INIS)

    Shimada, Morio; Kohda, Eiichi; Yoshikawa, Kohki

    2007-01-01

    We developed a remote-imaging diagnosis system that links the highly experienced radiologists at Komazawa University with Fuji Electric Hospital, where no such radiologists are present. MRI or CT images from Fuji Electric hospital are transmitted to Komazawa University via private line (INS64). The radiologists at Komazawa University then read the MRI or CT images, and relay the results to Fuji Electric Hospital. We describe the advantages and disadvantages of this system. MRI or CT imaging data from 80 cases were used. The data were stored in the imaging system server at Fuji Electric Hospital and were evaluated by experienced radiologists at Komazawa University. The images were sent one by one to the diagnostic support system server at Komazawa University through the private INS64 line. We examined transmission time per case and the security of transmission. Transmission of MRI or CT images from the 80 cases required a mean duration of 63 minutes 30 seconds per image. The quality of all images was highly satisfactory. In addition, there was no evidence of weaknesses in security. A physician at Fuji Electric Hospital was able to readily explain to the patient the results of the images by referring to the findings written by a radiologist at Komazawa University. We were able to transmit MRI or CT images by using this system safely and readily. The primary disadvantage of this system was the slow transmission speed. This will be improved by upgrading to an optical fibers. (author)

  9. X-ray micro-tomography system for small-animal imaging with zoom-in imaging capability

    International Nuclear Information System (INIS)

    Chun, In Kon; Cho, Myung Hye; Lee, Sang Chul; Cho, Min Hyoung; Lee, Soo Yeol

    2004-01-01

    Since a micro-tomography system capable of μm-resolution imaging cannot be used for whole-body imaging of a small laboratory animal without sacrificing its spatial resolution, it is desirable for a micro-tomography system to have local imaging capability. In this paper, we introduce an x-ray micro-tomography system capable of high-resolution imaging of a local region inside a small animal. By combining two kinds of projection data, one from a full field-of-view (FOV) scan of the whole body and the other from a limited FOV scan of the region of interest (ROI), we have obtained zoomed-in images of the ROI without any contrast anomalies commonly appearing in conventional local tomography. For experimental verification of the zoom-in imaging capability, we have integrated a micro-tomography system using a micro-focus x-ray source, a 1248 x 1248 flat-panel x-ray detector, and a precision scan mechanism. The mismatches between the two projection data caused by misalignments of the scan mechanism have been estimated with a calibration phantom, and the mismatch effects have been compensated in the image reconstruction procedure. Zoom-in imaging results of bony tissues with a spatial resolution of 10 lp mm -1 suggest that zoom-in micro-tomography can be greatly used for high-resolution imaging of a local region in small-animal studies

  10. A fractal-based image encryption system

    KAUST Repository

    Abd-El-Hafiz, S. K.; Radwan, Ahmed Gomaa; Abdel Haleem, Sherif H.; Barakat, Mohamed L.

    2014-01-01

    single-fractal image and statistical analysis is performed. A general encryption system utilising multiple fractal images is, then, introduced to improve the performance and increase the encryption key up to hundreds of bits. This improvement is achieved

  11. Intellectual system for images restoration

    Science.gov (United States)

    Mardare, Igor

    2005-02-01

    Intelligence systems on basis of artificial neural networks and associative memory allow to solve effectively problems of recognition and restoration of images. However, within analytical technologies there are no dominating approaches of deciding of intellectual problems. Choice of the best technology depends on nature of problem, features of objects, volume of represented information about the object, number of classes of objects, etc. It is required to determine opportunities, preconditions and field of application of neural networks and associative memory for decision of problem of restoration of images and to use their supplementary benefits for further development of intelligence systems.

  12. Shimadzu magnetic resonance imaging system, SMT-50

    International Nuclear Information System (INIS)

    Oikawa, Shiro; Nishida, Takayuki; Fujio, Yasuo

    1986-01-01

    The magnetic resonance imaging (MRI) system, as a new modality of medical imaging, has already been put to practical applications on many clinical sites, through which a lot of clinical data has been accumulated. It can offer a powerful new probe of internal anatomy of the human body and its functions. Now that the MRI has established its effectiveness in diagnosis, a really practical MRI system which features high efficiency and economical design with high patient throughput is strongly called for. Introduced in this article is a superconductive magnet MRI system, SMT-50, operating at 5000 Gauss. It has realized an excellent diagnostic capability with such functions as multi-slice multi-echo imaging, high sensitive, surface coil technique and so on. High resolution image display (1024 x 1024 pixcel) unit and separate console system (viewing console and scanning console) will assist high patient throughput. The outline of the SMT-50 and its clinical data are reported here. (author)

  13. Quantification of image persistence in a digital angiography system

    International Nuclear Information System (INIS)

    Okkalides, D.P.; Raptou, P.D.

    1993-01-01

    Image persistence, as a characteristic of video imaging systems affecting the quality of fast moving fluoroscopic images, is shown to vary considerably. A simple quantitative method for measuring image persistence in a digital angiography system is presented, together with a series of image intensifier exposure-response curves. For the Saticon tube, used with the Siemens 3VA Digitron, it was found that persistence increased for low exposure rates and may increase to 31% at a 120 ms interval. In addition, a sharp increase in image persistence, from 8.3% to 33%, was observed within 18 months from installation of the system. (author)

  14. A review of imaging techniques for systems biology

    Directory of Open Access Journals (Sweden)

    Po Ming J

    2008-08-01

    Full Text Available Abstract This paper presents a review of imaging techniques and of their utility in system biology. During the last decade systems biology has matured into a distinct field and imaging has been increasingly used to enable the interplay of experimental and theoretical biology. In this review, we describe and compare the roles of microscopy, ultrasound, CT (Computed Tomography, MRI (Magnetic Resonance Imaging, PET (Positron Emission Tomography, and molecular probes such as quantum dots and nanoshells in systems biology. As a unified application area among these different imaging techniques, examples in cancer targeting are highlighted.

  15. [Initial study of transthoracic echocardiography guided three-dimensional printing on the application of assessment of structural heart disease].

    Science.gov (United States)

    Zhu, Y B; Liu, J S; Wang, L Q; Guan, X; Luo, Y J; Geng, J; Geng, Q G; Lin, Y J; Zhang, L X; Li, X X; Lu, Y P

    2017-08-01

    Objective: To investigate the feasibility and diagnostic value of preoperative transthoracic echocardiography guided three dimensional printing model (TTE Guided 3DPM) on the assessment of structural heart disease (SHD). Methods: From February 2016 to October 2016, 44 patients underwent cardiac surgery in Tianjin Chest Hospital, forty-four patients were assessed preoperatively using TTE Guided 3DPM, including 25 males and 19 females, aged 3-75 years, with an average of (44±22) years. compared to conventional three dimensional transthoracic echocardiography (3D-TTE), and took direct intraoperative findings as "Golden Standard" simultaneously. There are twelve patients with SHD, including four cases with mitral prolapse, two cases with partial endocardial cushion defect, two cases with secondary atrial septal defect, two cases with rheumatic mitral stenosis, one case with tetralogy of Fallot, one case with ventricular septal defect (VSD), thirty-two patients without SHD were designed as negative control. Results: The sensitivity and specificity of TTE Guided 3DPM were greater than or equal to 3D-TTE, P value of McNemar test of 3D-TTE was greater than 0.05, the difference was not statistically significant, kappa =0.745, P Guided 3DPM was greater than 0.05, the difference was not statistically significant, kappa =0.955, P Guided 3DPM and gold standards were consistent. Compared with 3D-TTE and TTE Guided 3DPM, P value was greater than 0.05, the difference was not statistically significant, kappa =0.879, P Guided 3DPM were consistent. TTE Guided 3DPM displayed the three-dimensional structure of SHD cardiac lesions clearly, which were consistent with intraoperative findings. Conclusion: TTE Guided 3DPM provides essential information for the preoperative evaluation and decision of SHD.

  16. Magnetic resonance imaging of central nervous system haemorrhage

    International Nuclear Information System (INIS)

    Silberstein, M.; Hennessy, O.

    1993-01-01

    The variable magnetic resonance imaging appearances of central nervous system haemorrhage, both intra- and extra-axial, are described. These will vary with the type of image contrast (T1 or T2 weighting), the nature of the imaging sequence (spin-echo or gradient-echo) and the time from onset of haemorrhage. Magnetic resonance imaging is a useful technique for imaging haemorrhage in the central nervous system as it yields temporal information about haematoma development, and it is the only non-invasive means of imaging intraspinal haemorrhage. However, in the imaging of haematomas within 24 h of onset and in subarachnoid haemorrhage computed tomography is the investigation of choice. 13 refs., 6 figs

  17. Enhancement system of nighttime infrared video image and visible video image

    Science.gov (United States)

    Wang, Yue; Piao, Yan

    2016-11-01

    Visibility of Nighttime video image has a great significance for military and medicine areas, but nighttime video image has so poor quality that we can't recognize the target and background. Thus we enhance the nighttime video image by fuse infrared video image and visible video image. According to the characteristics of infrared and visible images, we proposed improved sift algorithm andαβ weighted algorithm to fuse heterologous nighttime images. We would deduced a transfer matrix from improved sift algorithm. The transfer matrix would rapid register heterologous nighttime images. And theαβ weighted algorithm can be applied in any scene. In the video image fusion system, we used the transfer matrix to register every frame and then used αβ weighted method to fuse every frame, which reached the time requirement soft video. The fused video image not only retains the clear target information of infrared video image, but also retains the detail and color information of visible video image and the fused video image can fluency play.

  18. Parameter Optimization of Multi-Element Synthetic Aperture Imaging Systems

    Directory of Open Access Journals (Sweden)

    Vera Behar

    2007-03-01

    Full Text Available In conventional ultrasound imaging systems with phased arrays, the further improvement of lateral resolution requires enlarging of the number of array elements that in turn increases both, the complexity and the cost, of imaging systems. Multi-element synthetic aperture focusing (MSAF systems are a very good alternative to conventional systems with phased arrays. The benefit of the synthetic aperture is in reduction of the system complexity, cost and acquisition time. In a MSAF system considered in the paper, a group of elements transmit and receive signals simultaneously, and the transmit beam is defocused to emulate a single element response. The echo received at each element of a receive sub-aperture is recorded in the computer memory. The process of transmission/reception is repeated for all positions of a transmit sub-aperture. All the data recordings associated with each corresponding pair "transmit-receive sub-aperture" are then focused synthetically producing a low-resolution image. The final high-resolution image is formed by summing of the all low-resolution images associated with transmit/receive sub-apertures. A problem of parameter optimization of a MSAF system is considered in this paper. The quality of imaging (lateral resolution and contrast is expressed in terms of the beam characteristics - beam width and side lobe level. The comparison between the MSAF system described in the paper and an equivalent conventional phased array system shows that the MSAF system acquires images of equivalent quality much faster using only a small part of the power per image.

  19. Ultrasound Vector Flow Imaging: Part II: Parallel Systems

    DEFF Research Database (Denmark)

    Jensen, Jørgen Arendt; Nikolov, Svetoslav Ivanov; Yu, Alfred C. H.

    2016-01-01

    The paper gives a review of the current state-of-theart in ultrasound parallel acquisition systems for flow imaging using spherical and plane waves emissions. The imaging methods are explained along with the advantages of using these very fast and sensitive velocity estimators. These experimental...... ultrasound imaging for studying brain function in animals. The paper explains the underlying acquisition and estimation methods for fast 2-D and 3-D velocity imaging and gives a number of examples. Future challenges and the potentials of parallel acquisition systems for flow imaging are also discussed....

  20. Real-time beam profile imaging system for actinotherapy accelerator

    International Nuclear Information System (INIS)

    Lin Yong; Wang Jingjin; Song Zheng; Zheng Putang; Wang Jianguo

    2003-01-01

    This paper describes a real-time beam profile imaging system for actinotheraphy accelerator. With the flash X-ray imager and the technique of digital image processing, a real-time 3-dimension dosage image is created from the intensity profile of the accelerator beam in real time. This system helps to obtain all the physical characters of the beam in any section plane, such as FWHM, penumbra, peak value, symmetry and homogeneity. This system has been used to acquire a 3-dimension dosage distribution of dynamic wedge modulator and the transient process of beam dosage. The system configure and the tested beam profile images are also presented

  1. Toward objective and quantitative evaluation of imaging systems using images of phantoms

    International Nuclear Information System (INIS)

    Gagne, Robert M.; Gallas, Brandon D.; Myers, Kyle J.

    2006-01-01

    The use of imaging phantoms is a common method of evaluating image quality in the clinical setting. These evaluations rely on a subjective decision by a human observer with respect to the faintest detectable signal(s) in the image. Because of the variable and subjective nature of the human-observer scores, the evaluations manifest a lack of precision and a potential for bias. The advent of digital imaging systems with their inherent digital data provides the opportunity to use techniques that do not rely on human-observer decisions and thresholds. Using the digital data, signal-detection theory (SDT) provides the basis for more objective and quantitative evaluations which are independent of a human-observer decision threshold. In a SDT framework, the evaluation of imaging phantoms represents a 'signal-known-exactly/background-known-exactly' ('SKE/BKE') detection task. In this study, we compute the performance of prewhitening and nonprewhitening model observers in terms of the observer signal-to-noise ratio (SNR) for these 'SKE/BKE' tasks. We apply the evaluation methods to a number of imaging systems. For example, we use data from a laboratory implementation of digital radiography and from a full-field digital mammography system in a clinical setting. In addition, we make a comparison of our methods to human-observer scoring of a set of digital images of the CDMAM phantom available from the internet (EUREF--European Reference Organization). In the latter case, we show a significant increase in the precision of the quantitative methods versus the variability in the scores from human observers on the same set of images. As regards bias, the performance of a model observer estimated from a finite data set is known to be biased. In this study, we minimize the bias and estimate the variance of the observer SNR using statistical resampling techniques, namely, 'bootstrapping' and 'shuffling' of the data sets. Our methods provide objective and quantitative evaluation of

  2. Portable remote sensing image processing system; Kahangata remote sensing gazo shori system

    Energy Technology Data Exchange (ETDEWEB)

    Fujikawa, S; Uchida, K; Tanaka, S; Jingo, H [Dowa Engineering Co. Ltd., Tokyo (Japan); Hato, M [Earth Remote Sensing Data Analysis Center, Tokyo (Japan)

    1997-10-22

    Recently, geological analysis using remote sensing data has been put into practice due to data with high spectral resolution and high spatial resolution. There has been a remarkable increase in both software and hardware of personal computer. Software is independent of hardware due to Windows. It has become easy to develop softwares. Under such situation, a portable remote sensing image processing system coping with Window 95 has been developed. Using this system, basic image processing can be conducted, and present location can be displayed on the image in real time by linking with GPS. Accordingly, it is not required to bring printed images for the field works of image processing. This system can be used instead of topographic maps for overseas surveys. Microsoft Visual C++ ver. 2.0 is used for the software. 1 fig.

  3. 3D Backscatter Imaging System

    Science.gov (United States)

    Whitaker, Ross (Inventor); Turner, D. Clark (Inventor)

    2016-01-01

    Systems and methods for imaging an object using backscattered radiation are described. The imaging system comprises both a radiation source for irradiating an object that is rotationally movable about the object, and a detector for detecting backscattered radiation from the object that can be disposed on substantially the same side of the object as the source and which can be rotationally movable about the object. The detector can be separated into multiple detector segments with each segment having a single line of sight projection through the object and so detects radiation along that line of sight. Thus, each detector segment can isolate the desired component of the backscattered radiation. By moving independently of each other about the object, the source and detector can collect multiple images of the object at different angles of rotation and generate a three dimensional reconstruction of the object. Other embodiments are described.

  4. X-ray image subtracting system

    International Nuclear Information System (INIS)

    Wesbey, W.H.; Keyes, G.S.; Georges, J.-P.J.

    1982-01-01

    An X-ray image subtracting system for making low contrast structures in the images more conspicuous is described. An X-ray source projects successive high and low energy X-ray beam pulses through a body and the resultant X-ray images are converted to optical images. Two image pick-up devices such as TV cameras that have synchronously operated shutters receive the alternate images and convert them to corresponding analog video signals. In some embodiments, the analog signals are converted to a matrix of digital pixel signals that are variously processed and subtracted and converted to signals for driving a TV monitor display and analog storage devices. In other embodiments the signals are processed and subtracted in analog form for display. The high and low energy pulses can follow each other immediately so good registration between subtracted images is obtainable even though the anatomy is in motion. The energy levels of the X-ray pulses are chosen to maximize the difference in attenuation between the anatomical structure which is to be subtracted out and that which remains. (author)

  5. Practical evaluation of clinical image quality (4). Determination of image quality in digital radiography system

    International Nuclear Information System (INIS)

    Katayama, Reiji

    2016-01-01

    Recently, for medical imaging, digital radiography systems are widely used in clinical practices. However, a study in the past reported that a patient radiation exposure level by digital radiography is in fact not lower than that by analog radiography system. High level of attention needs to be paid for over-exposure when using the conventional analog radiography with a screen and a film, as it results in high density of the film. However, for digital radiography systems, since the automatic adjusting function of image density is equipped with them, no attention for radiation dose need to be paid. Thus technologists tend to be careless and results in higher chance for over-exposure. Current digital radiography systems are high-performance in the image properties and capable of patient dose reduction. Especially, the image quality of the flat panel detector system is recognized, higher than that of the computed radiography system by imaging plates, in both objective and subjective evaluations. Therefore, we technologists are responsible for optimizing the balance between the image quality of the digital radiogram and the radiation dose required for each case. Moreover, it is also required for us as medical technologists to make effective use of such evaluation result of medical images for patients. (author)

  6. Visual computing scientific visualization and imaging systems

    CERN Document Server

    2014-01-01

    This volume aims to stimulate discussions on research involving the use of data and digital images as an understanding approach for analysis and visualization of phenomena and experiments. The emphasis is put not only on graphically representing data as a way of increasing its visual analysis, but also on the imaging systems which contribute greatly to the comprehension of real cases. Scientific Visualization and Imaging Systems encompass multidisciplinary areas, with applications in many knowledge fields such as Engineering, Medicine, Material Science, Physics, Geology, Geographic Information Systems, among others. This book is a selection of 13 revised and extended research papers presented in the International Conference on Advanced Computational Engineering and Experimenting -ACE-X conferences 2010 (Paris), 2011 (Algarve), 2012 (Istanbul) and 2013 (Madrid). The examples were particularly chosen from materials research, medical applications, general concepts applied in simulations and image analysis and ot...

  7. Development of computed tomography system and image reconstruction algorithm

    International Nuclear Information System (INIS)

    Khairiah Yazid; Mohd Ashhar Khalid; Azaman Ahmad; Khairul Anuar Mohd Salleh; Ab Razak Hamzah

    2006-01-01

    Computed tomography is one of the most advanced and powerful nondestructive inspection techniques, which is currently used in many different industries. In several CT systems, detection has been by combination of an X-ray image intensifier and charge -coupled device (CCD) camera or by using line array detector. The recent development of X-ray flat panel detector has made fast CT imaging feasible and practical. Therefore this paper explained the arrangement of a new detection system which is using the existing high resolution (127 μm pixel size) flat panel detector in MINT and the image reconstruction technique developed. The aim of the project is to develop a prototype flat panel detector based CT imaging system for NDE. The prototype consisted of an X-ray tube, a flat panel detector system, a rotation table and a computer system to control the sample motion and image acquisition. Hence this project is divided to two major tasks, firstly to develop image reconstruction algorithm and secondly to integrate X-ray imaging components into one CT system. The image reconstruction algorithm using filtered back-projection method is developed and compared to other techniques. The MATLAB program is the tools used for the simulations and computations for this project. (Author)

  8. 21 CFR 892.1630 - Electrostatic x-ray imaging system.

    Science.gov (United States)

    2010-04-01

    ... system. (a) Identification. An electrostatic x-ray imaging system is a device intended for medical... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Electrostatic x-ray imaging system. 892.1630... visible image. This generic type of device may include signal analysis and display equipment, patient and...

  9. Implementation of a program of quality assurance of image in an imaging system of flat panel portal

    International Nuclear Information System (INIS)

    Gomez Barrado, A.; Sanchez Jimenez, E.; Benitez, J. A.; Sanchez-Reyes, A.

    2013-01-01

    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  10. Stepped scanner radiographic imaging system using edge blending

    International Nuclear Information System (INIS)

    Lapidus, S.N.

    1984-01-01

    An imaging system is described which includes a radiographic camera, a bed for supporting a subject in view of the camera, and a display system. The camera provides X and Y coordinate signals for each radiographic event. The position of the bed relative to the camera is altered stepwise and a sequence of images is provided by the camera each image being positioned on a display system in correspondence with the location of the bed relative to the camera. The camera is electronically decoupled from the display by a gate during movement of the bed relative to the camera from one location to the next location to prevent any smearing effect within the composite image presented on the display. The edges of contiguous images making up the composite image are blended by electronically adjusting their boundary regions so as to provide overlapping or interlocking. (author)

  11. Document Examination: Applications of Image Processing Systems.

    Science.gov (United States)

    Kopainsky, B

    1989-12-01

    Dealing with images is a familiar business for an expert in questioned documents: microscopic, photographic, infrared, and other optical techniques generate images containing the information he or she is looking for. A recent method for extracting most of this information is digital image processing, ranging from the simple contrast and contour enhancement to the advanced restoration of blurred texts. When combined with a sophisticated physical imaging system, an image pricessing system has proven to be a powerful and fast tool for routine non-destructive scanning of suspect documents. This article reviews frequent applications, comprising techniques to increase legibility, two-dimensional spectroscopy (ink discrimination, alterations, erased entries, etc.), comparison techniques (stamps, typescript letters, photo substitution), and densitometry. Computerized comparison of handwriting is not included. Copyright © 1989 Central Police University.

  12. [A computer-aided image diagnosis and study system].

    Science.gov (United States)

    Li, Zhangyong; Xie, Zhengxiang

    2004-08-01

    The revolution in information processing, particularly the digitizing of medicine, has changed the medical study, work and management. This paper reports a method to design a system for computer-aided image diagnosis and study. Combined with some good idea of graph-text system and picture archives communicate system (PACS), the system was realized and used for "prescription through computer", "managing images" and "reading images under computer and helping the diagnosis". Also typical examples were constructed in a database and used to teach the beginners. The system was developed by the visual developing tools based on object oriented programming (OOP) and was carried into operation on the Windows 9X platform. The system possesses friendly man-machine interface.

  13. Highly Protable Airborne Multispectral Imaging System

    Science.gov (United States)

    Lehnemann, Robert; Mcnamee, Todd

    2001-01-01

    A portable instrumentation system is described that includes and airborne and a ground-based subsytem. It can acquire multispectral image data over swaths of terrain ranging in width from about 1.5 to 1 km. The system was developed especially for use in coastal environments and is well suited for performing remote sensing and general environmental monitoring. It includes a small,munpilotaed, remotely controlled airplance that carries a forward-looking camera for navigation, three downward-looking monochrome video cameras for imaging terrain in three spectral bands, a video transmitter, and a Global Positioning System (GPS) reciever.

  14. High-speed photoacoustic imaging using an LED-based photoacoustic imaging system

    Science.gov (United States)

    Sato, Naoto; Kuniyil Ajith Singh, Mithun; Shigeta, Yusuke; Hanaoka, Takamitsu; Agano, Toshitaka

    2018-02-01

    Recently we developed a multispectral LED-based photoacoustic/ultrasound imaging system (AcousticX) and have been continuously working on its technical/functional improvements. AcousticX is a linear array ultrasound transducer (128 elements, 10 MHz)-based system in which LED arrays (selectable wavelengths, pulse repetition frequency: 4 kHz, pulse width: tunable from 40 - 100 ns) are fixed on both sides of the transducer to illuminate the tissue for photoacoustic imaging. The ultrasound/photoacoustic data from all 128 elements can be simultaneously acquired, processed and displayed. We already demonstrated our system's capability to perform photoacoustic/ultrasound imaging for dynamic imaging of the tissue at a frame rate of 10 Hz (for example to visualize the pulsation of arteries in vivo in human subjects). In this work, we present the development of a new high-speed imaging mode in AcousticX. In this mode, instead of toggling between ultrasound and photoacoustic measurements, it is possible to continuously acquire only photoacoustic data for 1.5 seconds with a time interval of 1 ms. With this improvement, we can record photoacoustic signals from the whole aperture (38 mm) at fast rate and can be reviewed later at different speeds for analyzing dynamic changes in the photoacoustic signals. We believe that AcousticX with this new high-speed mode opens up a feasible technical path for multiple dynamic studies, for example one which focus on imaging the response of voltage sensitive dyes. We envisage to improve the acquisition speed further in future for exploring ultra-high-speed applications.

  15. Robust algebraic image enhancement for intelligent control systems

    Science.gov (United States)

    Lerner, Bao-Ting; Morrelli, Michael

    1993-01-01

    Robust vision capability for intelligent control systems has been an elusive goal in image processing. The computationally intensive techniques a necessary for conventional image processing make real-time applications, such as object tracking and collision avoidance difficult. In order to endow an intelligent control system with the needed vision robustness, an adequate image enhancement subsystem capable of compensating for the wide variety of real-world degradations, must exist between the image capturing and the object recognition subsystems. This enhancement stage must be adaptive and must operate with consistency in the presence of both statistical and shape-based noise. To deal with this problem, we have developed an innovative algebraic approach which provides a sound mathematical framework for image representation and manipulation. Our image model provides a natural platform from which to pursue dynamic scene analysis, and its incorporation into a vision system would serve as the front-end to an intelligent control system. We have developed a unique polynomial representation of gray level imagery and applied this representation to develop polynomial operators on complex gray level scenes. This approach is highly advantageous since polynomials can be manipulated very easily, and are readily understood, thus providing a very convenient environment for image processing. Our model presents a highly structured and compact algebraic representation of grey-level images which can be viewed as fuzzy sets.

  16. [Research on Spectral Polarization Imaging System Based on Static Modulation].

    Science.gov (United States)

    Zhao, Hai-bo; Li, Huan; Lin, Xu-ling; Wang, Zheng

    2015-04-01

    The main disadvantages of traditional spectral polarization imaging system are: complex structure, with moving parts, low throughput. A novel method of spectral polarization imaging system is discussed, which is based on static polarization intensity modulation combined with Savart polariscope interference imaging. The imaging system can obtain real-time information of spectral and four Stokes polarization messages. Compared with the conventional methods, the advantages of the imaging system are compactness, low mass and no moving parts, no electrical control, no slit and big throughput. The system structure and the basic theory are introduced. The experimental system is established in the laboratory. The experimental system consists of reimaging optics, polarization intensity module, interference imaging module, and CCD data collecting and processing module. The spectral range is visible and near-infrared (480-950 nm). The white board and the plane toy are imaged by using the experimental system. The ability of obtaining spectral polarization imaging information is verified. The calibration system of static polarization modulation is set up. The statistical error of polarization degree detection is less than 5%. The validity and feasibility of the basic principle is proved by the experimental result. The spectral polarization data captured by the system can be applied to object identification, object classification and remote sensing detection.

  17. Systems for increasing the sensitivity of gamma-ray imagers

    Science.gov (United States)

    Mihailescu, Lucian; Vetter, Kai M.; Chivers, Daniel H.

    2012-12-11

    Systems that increase the position resolution and granularity of double sided segmented semiconductor detectors are provided. These systems increase the imaging resolution capability of such detectors, either used as Compton cameras, or as position sensitive radiation detectors in imagers such as SPECT, PET, coded apertures, multi-pinhole imagers, or other spatial or temporal modulated imagers.

  18. A new optical encryption system for image transformation

    Science.gov (United States)

    Yao, Shuyu; Chen, Linfei; Chang, Guojun; He, Bingyu

    2017-12-01

    This paper introduces a new optical image encryption system based on Fresnel diffraction and phase iterative algorithm, which can realize the conversion between different images. The method is based on the optical system of free space transmission, and uses the iterative phase retrieval algorithm to encode an image into two phase masks and a ciphertext. Unlike the existed methods, the ciphertext is a visible image, which can be used to achieve the conversion of one image to another image. In order to enhance the security, two phase masks are combined into a wide-scale phase mask by the double image cross pixel scrambling approach. In the decryption process, the wide-scale phase mask is re-decrypted into two random phase masks using a random shift matrix. The ciphertext and the first phase mask are placed on the input plane and the second random phase mask is placed on the transformation plane. The Fresnel diffraction principle can be used to obtain the plaintext information on the output plane. Theoretical analysis and simulation results show that the encryption system is feasible and quite safe.

  19. Remote listening and passive acoustic detection in a 3-D environment

    Science.gov (United States)

    Barnhill, Colin

    Teleconferencing environments are a necessity in business, education and personal communication. They allow for the communication of information to remote locations without the need for travel and the necessary time and expense required for that travel. Visual information can be communicated using cameras and monitors. The advantage of visual communication is that an image can capture multiple objects and convey them, using a monitor, to a large group of people regardless of the receiver's location. This is not the case for audio. Currently, most experimental teleconferencing systems' audio is based on stereo recording and reproduction techniques. The problem with this solution is that it is only effective for one or two receivers. To accurately capture a sound environment consisting of multiple sources and to recreate that for a group of people is an unsolved problem. This work will focus on new methods of multiple source 3-D environment sound capture and applications using these captured environments. Using spherical microphone arrays, it is now possible to capture a true 3-D environment A spherical harmonic transform on the array's surface allows us to determine the basis functions (spherical harmonics) for all spherical wave solutions (up to a fixed order). This spherical harmonic decomposition (SHD) allows us to not only look at the time and frequency characteristics of an audio signal but also the spatial characteristics of an audio signal. In this way, a spherical harmonic transform is analogous to a Fourier transform in that a Fourier transform transforms a signal into the frequency domain and a spherical harmonic transform transforms a signal into the spatial domain. The SHD also decouples the input signals from the microphone locations. Using the SHD of a soundfield, new algorithms are available for remote listening, acoustic detection, and signal enhancement The new algorithms presented in this paper show distinct advantages over previous detection and

  20. The operation technology of realtime image processing system (Datacube)

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Jai Wan; Lee, Yong Bum; Lee, Nam Ho; Choi, Young Soo; Park, Soon Yong; Park, Jin Seok

    1997-02-01

    In this project, a Sparc VME-based MaxSparc system, running the solaris operating environment, is selected as the dedicated image processing hardware for robot vision applications. In this report, the operation of Datacube maxSparc system, which is high performance realtime image processing hardware, is systematized. And image flow example programs for running MaxSparc system are studied and analyzed. The state-of-the-arts of Datacube system utilizations are studied and analyzed. For the next phase, advanced realtime image processing platform for robot vision application is going to be developed. (author). 19 refs., 71 figs., 11 tabs.

  1. Automatic system for quantification and visualization of lung aeration on chest computed tomography images: the Lung Image System Analysis - LISA

    International Nuclear Information System (INIS)

    Felix, John Hebert da Silva; Cortez, Paulo Cesar; Holanda, Marcelo Alcantara

    2010-01-01

    High Resolution Computed Tomography (HRCT) is the exam of choice for the diagnostic evaluation of lung parenchyma diseases. There is an increasing interest for computational systems able to automatically analyze the radiological densities of the lungs in CT images. The main objective of this study is to present a system for the automatic quantification and visualization of the lung aeration in HRCT images of different degrees of aeration, called Lung Image System Analysis (LISA). The secondary objective is to compare LISA to the Osiris system and also to specific algorithm lung segmentation (ALS), on the accuracy of the lungs segmentation. The LISA system automatically extracts the following image attributes: lungs perimeter, cross sectional area, volume, the radiological densities histograms, the mean lung density (MLD) in Hounsfield units (HU), the relative area of the lungs with voxels with density values lower than -950 HU (RA950) and the 15th percentile of the least density voxels (PERC15). Furthermore, LISA has a colored mask algorithm that applies pseudo-colors to the lung parenchyma according to the pre-defined radiological density chosen by the system user. The lungs segmentations of 102 images of 8 healthy volunteers and 141 images of 11 patients with Chronic Obstructive Pulmonary Disease (COPD) were compared on the accuracy and concordance among the three methods. The LISA was more effective on lungs segmentation than the other two methods. LISA's color mask tool improves the spatial visualization of the degrees of lung aeration and the various attributes of the image that can be extracted may help physicians and researchers to better assess lung aeration both quantitatively and qualitatively. LISA may have important clinical and research applications on the assessment of global and regional lung aeration and therefore deserves further developments and validation studies. (author)

  2. Automatic system for quantification and visualization of lung aeration on chest computed tomography images: the Lung Image System Analysis - LISA

    Energy Technology Data Exchange (ETDEWEB)

    Felix, John Hebert da Silva; Cortez, Paulo Cesar, E-mail: jhsfelix@gmail.co [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia de Teleinformatica; Holanda, Marcelo Alcantara [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Hospital Universitario Walter Cantidio. Dept. de Medicina Clinica

    2010-12-15

    High Resolution Computed Tomography (HRCT) is the exam of choice for the diagnostic evaluation of lung parenchyma diseases. There is an increasing interest for computational systems able to automatically analyze the radiological densities of the lungs in CT images. The main objective of this study is to present a system for the automatic quantification and visualization of the lung aeration in HRCT images of different degrees of aeration, called Lung Image System Analysis (LISA). The secondary objective is to compare LISA to the Osiris system and also to specific algorithm lung segmentation (ALS), on the accuracy of the lungs segmentation. The LISA system automatically extracts the following image attributes: lungs perimeter, cross sectional area, volume, the radiological densities histograms, the mean lung density (MLD) in Hounsfield units (HU), the relative area of the lungs with voxels with density values lower than -950 HU (RA950) and the 15th percentile of the least density voxels (PERC15). Furthermore, LISA has a colored mask algorithm that applies pseudo-colors to the lung parenchyma according to the pre-defined radiological density chosen by the system user. The lungs segmentations of 102 images of 8 healthy volunteers and 141 images of 11 patients with Chronic Obstructive Pulmonary Disease (COPD) were compared on the accuracy and concordance among the three methods. The LISA was more effective on lungs segmentation than the other two methods. LISA's color mask tool improves the spatial visualization of the degrees of lung aeration and the various attributes of the image that can be extracted may help physicians and researchers to better assess lung aeration both quantitatively and qualitatively. LISA may have important clinical and research applications on the assessment of global and regional lung aeration and therefore deserves further developments and validation studies. (author)

  3. High intensity radiation imaging system

    International Nuclear Information System (INIS)

    Barrett, H.H.

    1976-01-01

    A nuclear imaging system is described for mapping a spatially distributed source of high energy nuclear particles from a living organ which has selectively absorbed a radioactive compound in which the nuclear energy is spatially coded by a zone plate positioned between the source and a spatial detector, and a half tone screen is positioned between the source and the zone plate to increase the definition of the image

  4. Kingfisher: a system for remote sensing image database management

    Science.gov (United States)

    Bruzzo, Michele; Giordano, Ferdinando; Dellepiane, Silvana G.

    2003-04-01

    At present retrieval methods in remote sensing image database are mainly based on spatial-temporal information. The increasing amount of images to be collected by the ground station of earth observing systems emphasizes the need for database management with intelligent data retrieval capabilities. The purpose of the proposed method is to realize a new content based retrieval system for remote sensing images database with an innovative search tool based on image similarity. This methodology is quite innovative for this application, at present many systems exist for photographic images, as for example QBIC and IKONA, but they are not able to extract and describe properly remote image content. The target database is set by an archive of images originated from an X-SAR sensor (spaceborne mission, 1994). The best content descriptors, mainly texture parameters, guarantees high retrieval performances and can be extracted without losses independently of image resolution. The latter property allows DBMS (Database Management System) to process low amount of information, as in the case of quick-look images, improving time performance and memory access without reducing retrieval accuracy. The matching technique has been designed to enable image management (database population and retrieval) independently of dimensions (width and height). Local and global content descriptors are compared, during retrieval phase, with the query image and results seem to be very encouraging.

  5. Image-guided stereotactic surgery using ultrasonography and reconstructive three-dimensional CT-imaging system

    International Nuclear Information System (INIS)

    Kawamura, Hirotsune; Iseki, Hiroshi; Umezawa, Yoshihiro

    1991-01-01

    A new simulation and navigation system utilizing three-dimensional CT images has been developed for image-guided stereotactic surgery. Preoperative CT images are not always useful in predicting the intraoperative location of lesions, for cerebral lesions are easily displaced or distorted by gravity, brain retraction, and/or CSF aspiration during operative procedure. This new system, however, has the advantage that the intraoperative locations of intracranial lesions or the anatomical structures of the brain can be precisely confirmed during stereotactic surgery. Serial CT images were obtained from a patient whose head had been fixed to the ISEKI CT-guided stereotactic frame. The data of serial CT images were saved on a floppy disc and then transferred to the work station (IRIS) using the off line. In order to find the best approach angle for ultrasound-guided stereotactic surgery, three-dimenstional CT images were reconstructed using the work station. The site of the craniotomy or the angle of the trajectory of the ultrasound probe was measured preoperatively based on the three-dimensional CT images. Then, in the operating room, the patient's head was fixed to the ISEKI frame with the subframe at the same position as before according to the measurement of the CT images. In a case of cystic glioma, the predicable ultrasonograms from three-dimensional reconstructive CT images were ascertained to correspond well to the actual ultrasound images during ultrasound-guided stereotactic surgery. Therefore, the new simulation and navigation system can be judged to be a powerful operative supporting modality for correcting the locations of cerebral lesions; it allows one to perform stereotactic surgery more accurately and less invasively. (author)

  6. Sustainable human development: an educational commitment

    Directory of Open Access Journals (Sweden)

    Pilar AZNAR MÍNGUET

    2017-06-01

    Full Text Available Sustainable Human Development (hereafter SHD is taking shape as a proposal for progress in the face of a crisis in civilization so complex and far-reaching that it is considered quite difficult to solve. The aim of this article is to offer a reasoned justification of the evolution of the concept of development and of the need for an educational commitment to be able to make progress towards it. Although it is still polemical and the object of criticism, SHD has become consolidated as a strongly ethical proposal to lead the change in the course of development, transversally affecting its multiple dimensions and advocating interdisciplinary and intercultural cooperation and dialogue. The article analyses the challenges posed by SHD to today’s global society, as well as some ways to respond to them from the field of educational action and research. It concludes with a reasoned structuring of the contents of the monograph and an analytical description of the contents of the different contributions.

  7. A proposed intracortical visual prosthesis image processing system.

    Science.gov (United States)

    Srivastava, N R; Troyk, P

    2005-01-01

    It has been a goal of neuroprosthesis researchers to develop a system, which could provide artifical vision to a large population of individuals with blindness. It has been demonstrated by earlier researches that stimulating the visual cortex area electrically can evoke spatial visual percepts, i.e. phosphenes. The goal of visual cortex prosthesis is to stimulate the visual cortex area and generate a visual perception in real time to restore vision. Even though the normal working of the visual system is not been completely understood, the existing knowledge has inspired research groups to develop strategies to develop visual cortex prosthesis which can help blind patients in their daily activities. A major limitation in this work is the development of an image proceessing system for converting an electronic image, as captured by a camera, into a real-time data stream for stimulation of the implanted electrodes. This paper proposes a system, which will capture the image using a camera and use a dedicated hardware real time image processor to deliver electrical pulses to intracortical electrodes. This system has to be flexible enough to adapt to individual patients and to various strategies of image reconstruction. Here we consider a preliminary architecture for this system.

  8. Development of CCD Imaging System Using Thermoelectric Cooling Method

    Directory of Open Access Journals (Sweden)

    Youngsik Park

    2000-06-01

    Full Text Available We developed low light CCD imaging system using thermoelectric cooling method collaboration with a company to design a commercial model. It consists of Kodak KAF-0401E (768x512 pixels CCD chip,thermoelectric module manufactured by Thermotek. This TEC system can reach an operative temperature of -25deg. We employed an Uniblitz VS25S shutter and it has capability a minimum exposure time 80ms. The system components are an interface card using a Korea Astronomy Observatory (hereafter KAO ISA bus controller, image acquisition with AD9816 chip, that is 12bit video processor. The performance test with this imaging system showed good operation within the initial specification of our design. It shows a dark current less than 0.4e-/pixel/sec at a temperature of -10deg, a linearity 99.9+/-0.1%, gain 4.24e-adu, and system noise is 25.3e- (rms. For low temperature CCD operation, we designed a TEC, which uses a one-stage peltier module and forced air heat exchanger. This TEC imaging system enables accurate photometry (+/-0.01mag even though the CCD is not at 'conventional' cryogenic temperatures (140K. The system can be a useful instrument for any other imaging applications. Finally, with this system, we obtained several images of astronomical objects for system performance tests.

  9. Imaging of systemic vasculitis in childhood

    Energy Technology Data Exchange (ETDEWEB)

    Soliman, Magdy [The Hospital for Sick Children, Department of Medical Imaging, Toronto, ON (Canada); Cairo University, Department of Medical Imaging, Cairo (Egypt); Laxer, Ronald; Yeung, Rae [The Hospital for Sick Children, Department of Rheumatology, Toronto, ON (Canada); Manson, David; Doria, Andrea S. [The Hospital for Sick Children, Department of Medical Imaging, Toronto, ON (Canada)

    2015-08-15

    The term ''systemic vasculitis'' encompasses a diverse set of diseases linked by the presence of blood-vessel inflammation that are often associated with critical complications. These diseases are uncommon in childhood and are frequently subjected to a delayed diagnosis. Although the diagnosis and treatment may be similar for adult and childhood systemic vasculitides, the prevalence and classification vary according to the age group under investigation. For example, Kawasaki disease affects children while it is rarely encountered in adults. In 2006, the European League Against Rheumatism (EULAR) and the Pediatric Rheumatology European Society (PReS) proposed a classification system for childhood vasculitis adopting the system devised in the Chapel Hill Consensus Conference in 1993, which categorizes vasculitides according to the predominant size of the involved blood vessels into small, medium and large vessel diseases. Currently, medical imaging has a pivotal role in the diagnosis of vasculitis given recent developments in the imaging of blood vessels. For example, early diagnosis of coronary artery aneurysms, a serious complication of Kawasaki disease, is now possible by magnetic resonance imaging (MRI) of the heart and multidetector computed tomography (MDCT); positron emission tomography/CT (PET/CT) helps to assess active vascular inflammation in Takayasu arteritis. Our review offers a unique approach using the integration of the proposed classification criteria for common systemic childhood vasculitides with their most frequent imaging findings, along with differential diagnoses and an algorithm for diagnosis based on common findings. It should help radiologists and clinicians reach an early diagnosis, therefore facilitating the ultimate goal of proper management of affected children. (orig.)

  10. Imaging of systemic vasculitis in childhood

    International Nuclear Information System (INIS)

    Soliman, Magdy; Laxer, Ronald; Yeung, Rae; Manson, David; Doria, Andrea S.

    2015-01-01

    The term ''systemic vasculitis'' encompasses a diverse set of diseases linked by the presence of blood-vessel inflammation that are often associated with critical complications. These diseases are uncommon in childhood and are frequently subjected to a delayed diagnosis. Although the diagnosis and treatment may be similar for adult and childhood systemic vasculitides, the prevalence and classification vary according to the age group under investigation. For example, Kawasaki disease affects children while it is rarely encountered in adults. In 2006, the European League Against Rheumatism (EULAR) and the Pediatric Rheumatology European Society (PReS) proposed a classification system for childhood vasculitis adopting the system devised in the Chapel Hill Consensus Conference in 1993, which categorizes vasculitides according to the predominant size of the involved blood vessels into small, medium and large vessel diseases. Currently, medical imaging has a pivotal role in the diagnosis of vasculitis given recent developments in the imaging of blood vessels. For example, early diagnosis of coronary artery aneurysms, a serious complication of Kawasaki disease, is now possible by magnetic resonance imaging (MRI) of the heart and multidetector computed tomography (MDCT); positron emission tomography/CT (PET/CT) helps to assess active vascular inflammation in Takayasu arteritis. Our review offers a unique approach using the integration of the proposed classification criteria for common systemic childhood vasculitides with their most frequent imaging findings, along with differential diagnoses and an algorithm for diagnosis based on common findings. It should help radiologists and clinicians reach an early diagnosis, therefore facilitating the ultimate goal of proper management of affected children. (orig.)

  11. Advanced digital image archival system using MPEG technologies

    Science.gov (United States)

    Chang, Wo

    2009-08-01

    Digital information and records are vital to the human race regardless of the nationalities and eras in which they were produced. Digital image contents are produced at a rapid pace from cultural heritages via digitalization, scientific and experimental data via high speed imaging sensors, national defense satellite images from governments, medical and healthcare imaging records from hospitals, personal collection of photos from digital cameras. With these mass amounts of precious and irreplaceable data and knowledge, what standards technologies can be applied to preserve and yet provide an interoperable framework for accessing the data across varieties of systems and devices? This paper presents an advanced digital image archival system by applying the international standard of MPEG technologies to preserve digital image content.

  12. Quality Control of Mega Voltage Portal Imaging System

    International Nuclear Information System (INIS)

    Diklic, A.; Dundara Debeljuh, D.; Jurkovic, S.; Smilovic Radojcic, D.; Svabic Kolacio; Kasabasic, M.; Faj, D.

    2013-01-01

    The Electronic Portal Imaging Device (EPID) is a system used to verify either the correct positioning of the patient during radiotherapy treatment or the linear accelerator beam parameters. The correct position of the patient corresponds to the position at which the patient was scanned at the CT simulator and according to which the therapy plan was made and optimized. Regarding this, besides the advanced treatment planning system and optimized treatment planning techniques, the day-to-day reproduction of simulated conditions is of great importance for the treatment outcome. Therefore, to verify the patient set-up portal imaging should be applied prior to the first treatment session and repeated according to treatment prescriptions during the treatment. In order to achieve full functionality and precision of the EPID, it must be included in radiotherapy Quality Control (QC) programme. The QC of the Mega Voltage portal imaging system was separated in two parts. In the first, the QC of the detector parameters should be performed. For this purpose, the FC2 and QC3 phantoms should be used, along with the Portal Image Processing System program (PIPSpro) package for data analysis. The second part of the QC of the linear accelerator's portal imaging system should include the QC of the CBCT. In this part a set of predefined manufacturer's tests using two different phantoms, one for the geometry calibration and the other for the image quality evaluation, should be performed. Also, the treatment conditions should be simulated using anthropomorphic phantoms and dose distributions for particular EPID protocols should be measured. Procedures for quality control of the portal imaging system developed and implemented at University Hospital Rijeka are presented in this paper.(author)

  13. Microprocessor based image processing system

    International Nuclear Information System (INIS)

    Mirza, M.I.; Siddiqui, M.N.; Rangoonwala, A.

    1987-01-01

    Rapid developments in the production of integrated circuits and introduction of sophisticated 8,16 and now 32 bit microprocessor based computers, have set new trends in computer applications. Nowadays the users by investing much less money can make optimal use of smaller systems by getting them custom-tailored according to their requirements. During the past decade there have been great advancements in the field of computer Graphics and consequently, 'Image Processing' has emerged as a separate independent field. Image Processing is being used in a number of disciplines. In the Medical Sciences, it is used to construct pseudo color images from computer aided tomography (CAT) or positron emission tomography (PET) scanners. Art, advertising and publishing people use pseudo colours in pursuit of more effective graphics. Structural engineers use Image Processing to examine weld X-rays to search for imperfections. Photographers use Image Processing for various enhancements which are difficult to achieve in a conventional dark room. (author)

  14. Effects of scanning resolution and digital image magnification on photostimulable phosphor imaging system

    International Nuclear Information System (INIS)

    Sakurai, Takashi; Inagaki, Masafumi; Asai, Hideomi; Koyama, Atsushi; Kashima, Isamu

    2000-01-01

    The purpose of this study is to examine the effects of changes in scanning resolution and digital magnification on the image quality and diagnostic ability of the photostimulable phosphor imaging system. Using a photostimulable phosphor imaging system, images of a human adult dried mandible phantom embedded in a 25 mm-thick epoxy resin block were made. The latent images on the photostimulable phosphor imaging plate were scanned using four different pixel sizes as follows: 25 μm x 25 μm, 50 μm x 50 μm, 100 μm x 100 μm and 200 μm x 200 μm. A primary image was produced for each pixel size. These images were also digitally magnified at powers of 2, 4 and 8 times. The gradient range, brightness and contrast of each image were adjusted to optimum levels on a cathode ray tube display, and hard copies were produced with a writing pixel size of 60 μm x 60 μm. The granularity, sharpness and anatomical diagnostic ability of the images were assessed subjectively by eight dentists. Increasing the scanning resolution tended to generally improve image quality and diagnostic ability. Visual image quality was maintained up to a pixel size of 50 μm, and diagnostic ability was maintained up to a pixel size of 100 μm. Digital image magnification degraded image quality, and more than 2-times magnification degraded diagnostic ability. Under the present experimental conditions, increasing the scanning resolution did not always lead to an improvement in image quality or diagnostic ability, and digital image magnification degraded image quality and diagnostic ability. (author)

  15. Study on image quality and dosage comparison of F/S system and DR system

    International Nuclear Information System (INIS)

    Kim, Sun Chil; Jung, Jae Eun

    2003-01-01

    Currently, many hospital are hastening to introduce digital radiography systems. This is a direct result of the intentions to improve medical services and to digitalized radiology information systems, and is also leading to the improvement of medical imaging technology. Throughout F/S system's long history, many people have researched the image quality and dosage concerning these systems, and as a result, huge improvements in the dosage of patients were possible. Similarly, I believe that DR systems need the same kind of effort. Of course, decreases in dosage that ignore image quality are unthinkable. The results of experiments conducted by five hospitals during a period of 3 months brought to us the conclusions listed below. Based on the comparison and analysis of the exposure control of F/S systems and DR systems, DR systems generally showed higher exposure control for parts of the phantom that became thicker, and the exposure control improved rapidly as the thickness increased. DR systems still proved to be somewhat deficient in resolution measurements compared to existing F/S systems. The image processing part of DR systems contributed much to these result. Under conditions used clinically, the dosage measurements of DR systems were generally higher regardless of region. According to the evaluation of image quality, DR systems showed a higher degree of satisfaction as the thickness of the region became thinner. As mentioned above and based on the mutual relationship experiments between the dosage and image quality of F/S systems and DR systems, research to increase the satisfaction of DR systems must be considered

  16. NMR imaging of the cardiovascular system

    International Nuclear Information System (INIS)

    Canby, R.C.; Evanochko, W.T.; Pohost, G.M.

    1986-01-01

    Proton nuclear magnetic resonance (NMR) imaging permits high-resolution tomographic and three-dimensional images of the human body to be obtained without exposure to ionizing radiation. Such imaging not only yields anatomic resolution comparable to X-ray examinations but also provides a potential means to discriminate between healthy tissue and diseased tissue. This potential is based on certain NMR properties known as relaxation times, which determine, in part, the signal intensity in an image. These properties are related to such factors as the sizes and concentrations of proteins and mobile lipids and the compartmentalization of the protons of water. Although NMR imaging (also called magnetic resonance imaging, MRI) is becoming widely available for clinical use, application to the cardiovascular system, though promising, remains primarily a research tool. Gated proton NMR imaging can generate cardiac images with excellent morphologic detail and contrast; however, its ultimate importance as a cardiovascular diagnostic modality will depend on the development of several unique applications. These applications are discussed in this paper

  17. Image digitizer system for bubble chamber laser

    International Nuclear Information System (INIS)

    Haggerty, H.

    1986-01-01

    An IBM PC-based image digitizer system has been assembled to monitor the laser flash used for holography at the 15 foot bubble chamber. The hardware and the operating software are outlined. For an operational test of the system, an array of LEDs was flashed with a 10 microsecond pulse and the image was grabbed by one of the operating programs and processed

  18. Implementation of webcam-based hyperspectral imaging system

    Science.gov (United States)

    Balooch, Ali; Nazeri, Majid; Abbasi, Hamed

    2018-02-01

    In the present work, a hyperspectral imaging system (imaging spectrometer) using a commercial webcam has been designed and developed. This system was able to capture two-dimensional spectra (in emission, transmission and reflection modes) directly from the scene in the desired wavelengths. Imaging of the object is done directly by linear sweep (pushbroom method). To do so, the spectrometer is equipped with a suitable collecting lens and a linear travel stage. A 1920 x 1080 pixel CMOS webcam was used as a detector. The spectrometer has been calibrated by the reference spectral lines of standard lamps. The spectral resolution of this system was about 2nm and its spatial resolution was about 1 mm for a 10 cm long object. The hardware solution is based on data acquisition working on the USB platform and controlled by a LabVIEW program. In this system, the initial output was a three-dimensional matrix in which two dimensions of the matrix were related to the spatial information of the object and the third dimension was the spectrum of any point of the object. Finally, the images in different wavelengths were created by reforming the data of the matrix. The free spectral range (FSR) of the system was 400 to 1100 nm. The system was successfully tested for some applications, such as plasma diagnosis as well as applications in food and agriculture sciences.

  19. Advanced image display systems in radiology

    International Nuclear Information System (INIS)

    Wendler, T.

    1987-01-01

    Advanced image display systems for the fully digital diagnostic imaging departments of the future will be far more than simple replacements of the traditional film-viewing equipment. The new capabilities of very high resolution and highly dynamic displays offer a userfriendly and problem-oriented way of image interpretation. Advanced harware-, software- and human-machine interaction-concepts have been outlined. A scenario for a future way of handling and displaying images, reflecting a new image viewing paradigm in radiology is sketched which has been realized in an experimental image workstation model in the laboratory which, despite its technical complexity, offers a consistent strategy for fast and convenient interaction with image objects. The perspective of knowledge based techniques for workstation control software with object-oriented programming environments and user- and task-adaptive behavior leads to more advanced display properties and a new quality of userfriendliness. 2 refs.; 5 figs

  20. Design of light-small high-speed image data processing system

    Science.gov (United States)

    Yang, Jinbao; Feng, Xue; Li, Fei

    2015-10-01

    A light-small high speed image data processing system was designed in order to meet the request of image data processing in aerospace. System was constructed of FPGA, DSP and MCU (Micro-controller), implementing a video compress of 3 million pixels@15frames and real-time return of compressed image to the upper system. Programmable characteristic of FPGA, high performance image compress IC and configurable MCU were made best use to improve integration. Besides, hard-soft board design was introduced and PCB layout was optimized. At last, system achieved miniaturization, light-weight and fast heat dispersion. Experiments show that, system's multifunction was designed correctly and worked stably. In conclusion, system can be widely used in the area of light-small imaging.

  1. Designing a stable feedback control system for blind image deconvolution.

    Science.gov (United States)

    Cheng, Shichao; Liu, Risheng; Fan, Xin; Luo, Zhongxuan

    2018-05-01

    Blind image deconvolution is one of the main low-level vision problems with wide applications. Many previous works manually design regularization to simultaneously estimate the latent sharp image and the blur kernel under maximum a posterior framework. However, it has been demonstrated that such joint estimation strategies may lead to the undesired trivial solution. In this paper, we present a novel perspective, using a stable feedback control system, to simulate the latent sharp image propagation. The controller of our system consists of regularization and guidance, which decide the sparsity and sharp features of latent image, respectively. Furthermore, the formational model of blind image is introduced into the feedback process to avoid the image restoration deviating from the stable point. The stability analysis of the system indicates the latent image propagation in blind deconvolution task can be efficiently estimated and controlled by cues and priors. Thus the kernel estimation used for image restoration becomes more precision. Experimental results show that our system is effective on image propagation, and can perform favorably against the state-of-the-art blind image deconvolution methods on different benchmark image sets and special blurred images. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Influence of range-gated intensifiers on underwater imaging system SNR

    Science.gov (United States)

    Wang, Xia; Hu, Ling; Zhi, Qiang; Chen, Zhen-yue; Jin, Wei-qi

    2013-08-01

    Range-gated technology has been a hot research field in recent years due to its high effective back scattering eliminating. As a result, it can enhance the contrast between a target and its background and extent the working distance of the imaging system. The underwater imaging system is required to have the ability to image in low light level conditions, as well as the ability to eliminate the back scattering effect, which means that the receiver has to be high-speed external trigger function, high resolution, high sensitivity, low noise, higher gain dynamic range. When it comes to an intensifier, the noise characteristics directly restrict the observation effect and range of the imaging system. The background noise may decrease the image contrast and sharpness, even covering the signal making it impossible to recognize the target. So it is quite important to investigate the noise characteristics of intensifiers. SNR is an important parameter reflecting the noise features of a system. Through the use of underwater laser range-gated imaging prediction model, and according to the linear SNR system theory, the gated imaging noise performance of the present market adopted super second generation and generation Ⅲ intensifiers were theoretically analyzed. Based on the active laser underwater range-gated imaging model, the effect to the system by gated intensifiers and the relationship between the system SNR and MTF were studied. Through theoretical and simulation analysis to the image intensifier background noise and SNR, the different influence on system SNR by super second generation and generation Ⅲ ICCD was obtained. Range-gated system SNR formula was put forward, and compared the different effect influence on the system by using two kind of ICCDs was compared. According to the matlab simulation, a detailed analysis was carried out theoretically. All the work in this paper lays a theoretical foundation to further eliminating back scattering effect, improving

  3. Depth-resolved ballistic imaging in a low-depth-of-field optical Kerr gated imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Yipeng; Tan, Wenjiang, E-mail: tanwenjiang@mail.xjtu.edu.cn; Si, Jinhai; Ren, YuHu; Xu, Shichao; Hou, Xun [Key Laboratory for Physical Electronics and Devices of the Ministry of Education and Shaanxi Key Lab of Information Photonic Technique, School of Electronics and Information Engineering, Xi' an Jiaotong University, Xianning-xilu 28, Xi' an 710049 (China); Tong, Junyi [Departments of Applied Physics, Xi' an University of Technology, Xi' an 710048 (China)

    2016-09-07

    We demonstrate depth-resolved imaging in a ballistic imaging system, in which a heterodyned femtosecond optical Kerr gate is introduced to extract useful imaging photons for detecting an object hidden in turbid media and a compound lens is proposed to ensure both the depth-resolved imaging capability and the long working distance. Two objects of about 15-μm widths hidden in a polystyrene-sphere suspension have been successfully imaged with approximately 600-μm depth resolution. Modulation-transfer-function curves with the object in and away from the object plane have also been measured to confirm the depth-resolved imaging capability of the low-depth-of-field (low-DOF) ballistic imaging system. This imaging approach shows potential for application in research of the internal structure of highly scattering fuel spray.

  4. Radiation dose reduction and new image modalities development for interventional C-arm imaging system

    Science.gov (United States)

    Niu, Kai

    Cardiovascular disease and stroke are the leading health problems and causes of death in the US. Due to the minimally invasive nature of the evolution of image guided techniques, interventional radiological procedures are becoming more common and are preferred in treating many cardiovascular diseases and strokes. In addition, with the recent advances in hardware and device technology, the speed and efficacy of interventional treatment has significantly improved. This implies that more image modalities can be developed based on the current C-arm system and patients treated in interventional suites can potentially experience better health outcomes. However, during the treatment patients are irradiated with substantial amounts of ionizing radiation with a high dose rate (digital subtraction angiography (DSA) with 3muGy/frame and 3D cone beam CT image with 0.36muGy/frame for a Siemens Artis Zee biplane system) and/or a long irradiation time (a roadmapping image sequence can be as long as one hour during aneurysm embolization). As a result, the patient entrance dose is extremely high. Despite the fact that the radiation dose is already substantial, image quality is not always satisfactory. By default a temporal average is used in roadmapping images to overcome poor image quality, but this technique can result in motion blurred images. Therefore, reducing radiation dose while maintaining or even improving the image quality is an important area for continued research. This thesis is focused on improving the clinical applications of C-arm cone beam CT systems in two ways: (1) Improve the performance of current image modalities on the C-arm system. (2) Develop new image modalities based on the current system. To be more specific, the objectives are to reduce radiation dose for current modalities (e.g., DSA, fluoroscopy, roadmapping, and cone beam CT) and enable cone beam CT perfusion and time resolved cone beam CT angiography that can be used to diagnose and triage acute

  5. Fiber optic neutron imaging system: calibration

    International Nuclear Information System (INIS)

    Malone, R.M.; Gow, C.E.; Thayer, D.R.

    1981-01-01

    Two neutron imaging experiments using fiber optics have been performed at the Nevada Test Site. In each experiment, an array of scintillator fluor tubes is exposed to neutrons. Light is coupled out through radiation resistant PCS fibers (8-m long) into high-bandwidth, graded index fibers. For image reconstruction to be accurate, common timing differences and transmission variations between fiber optic channels are needed. The calibration system featured a scanning pulsed dye laser, a specially designed fiber optic star coupler, a tektronix 7912AD transient digitizer, and a DEC PDP 11/34 computing system

  6. High-speed image processing systems in non-destructive testing

    Science.gov (United States)

    Shashev, D. V.; Shidlovskiy, S. V.

    2017-08-01

    Digital imaging systems are using in most of both industrial and scientific industries. Such systems effectively solve a wide range of tasks in the field of non-destructive testing. There are problems in digital image processing for decades associated with the speed of the operation of such systems, sufficient to efficiently process and analyze video streams in real time, ideally in mobile small-sized devices. In this paper, we consider the use of parallel-pipeline computing architectures in image processing problems using the example of an algorithm for calculating the area of an object on a binary image. The approach used allows us to achieve high-speed performance in the tasks of digital image processing.

  7. Heart Imaging System

    Science.gov (United States)

    1993-01-01

    Johnson Space Flight Center's device to test astronauts' heart function in microgravity has led to the MultiWire Gamma Camera, which images heart conditions six times faster than conventional devices. Dr. Jeffrey Lacy, who developed the technology as a NASA researcher, later formed Proportional Technologies, Inc. to develop a commercially viable process that would enable use of Tantalum-178 (Ta-178), a radio-pharmaceutical. His company supplies the generator for the radioactive Ta-178 to Xenos Medical Systems, which markets the camera. Ta-178 can only be optimally imaged with the camera. Because the body is subjected to it for only nine minutes, the radiation dose is significantly reduced and the technique can be used more frequently. Ta-178 also enables the camera to be used on pediatric patients who are rarely studied with conventional isotopes because of the high radiation dosage.

  8. A photoacoustic tomography system for imaging of biological tissues

    International Nuclear Information System (INIS)

    Su Yixiong; Zhang Fan; Xu Kexin; Yao Jianquan; Wang, Ruikang K

    2005-01-01

    Non-invasive laser-induced photoacoustic tomography (PAT) is a promising imaging modality in the biomedical optical imaging field. This technology, based on the intrinsic optical properties of tissue and ultrasonic detection, overcomes the resolution disadvantage of pure-optical imaging caused by strong light scattering and the contrast and speckle disadvantages of pure ultrasonic imaging. Here, we report a PAT experimental system constructed in our laboratory. In our system, a Q-switched Nd : YAG pulse laser operated at 532 nm with a 8 ns pulse width is used to generate a photoacoustic signal. By using this system, the two-dimensional distribution of optical absorption in the tissue-mimicking phantom is reconstructed and has an excellent agreement with the original ones. The spatial resolution of the imaging system approaches 100 μm through about 4 cm of highly scattering medium

  9. Architecture Of High Speed Image Processing System

    Science.gov (United States)

    Konishi, Toshio; Hayashi, Hiroshi; Ohki, Tohru

    1988-01-01

    One of architectures for a high speed image processing system which corresponds to a new algorithm for a shape understanding is proposed. And the hardware system which is based on the archtecture was developed. Consideration points of the architecture are mainly that using processors should match with the processing sequence of the target image and that the developed system should be used practically in an industry. As the result, it was possible to perform each processing at a speed of 80 nano-seconds a pixel.

  10. Active gated imaging in driver assistance system

    Science.gov (United States)

    Grauer, Yoav

    2014-04-01

    In this paper, we shall present the active gated imaging system (AGIS) in relation to the automotive field. AGIS is based on a fast-gated camera and pulsed illuminator, synchronized in the time domain to record images of a certain range of interest. A dedicated gated CMOS imager sensor and near infra-red (NIR) pulsed laser illuminator, is presented in this paper to provide active gated technology. In recent years, we have developed these key components and learned the system parameters, which are most beneficial to nighttime (in all weather conditions) driving in terms of field of view, illumination profile, resolution, and processing power. We shall present our approach of a camera-based advanced driver assistance systems (ADAS) named BrightEye™, which makes use of the AGIS technology in the automotive field.

  11. RANZAR Body Systems Framework of diagnostic imaging examination descriptors

    International Nuclear Information System (INIS)

    Pitman, Alexander D.; Penlington, Lisa; Doromal, Darren; Vukolova, Natalia; Slater, Gregory

    2014-01-01

    A unified and logical system of descriptors for diagnostic imaging examinations and procedures is a desirable resource for radiology in Australia and New Zealand and is needed to support core activities of RANZCR. Existing descriptor systems available in Australia and New Zealand (including the Medicare DIST and the ACC Schedule) have significant limitations and are inappropriate for broader clinical application. An anatomically based grid was constructed, with anatomical structures arranged in rows and diagnostic imaging modalities arranged in columns (including nuclear medicine and positron emission tomography). The grid was segregated into five body systems. The cells at the intersection of an anatomical structure row and an imaging modality column were populated with short, formulaic descriptors of the applicable diagnostic imaging examinations. Clinically illogical or physically impossible combinations were ‘greyed out’. Where the same examination applied to different anatomical structures, the descriptor was kept identical for the purposes of streamlining. The resulting Body Systems Framework of diagnostic imaging examination descriptors lists all the reasonably common diagnostic imaging examinations currently performed in Australia and New Zealand using a unified grid structure allowing navigation by both referrers and radiologists. The Framework has been placed on the RANZCR website and is available for access free of charge by registered users. The Body Systems Framework of diagnostic imaging examination descriptors is a system of descriptors based on relationships between anatomical structures and imaging modalities. The Framework is now available as a resource and reference point for the radiology profession and to support core College activities.

  12. RANZCR Body Systems Framework of diagnostic imaging examination descriptors.

    Science.gov (United States)

    Pitman, Alexander G; Penlington, Lisa; Doromal, Darren; Slater, Gregory; Vukolova, Natalia

    2014-08-01

    A unified and logical system of descriptors for diagnostic imaging examinations and procedures is a desirable resource for radiology in Australia and New Zealand and is needed to support core activities of RANZCR. Existing descriptor systems available in Australia and New Zealand (including the Medicare DIST and the ACC Schedule) have significant limitations and are inappropriate for broader clinical application. An anatomically based grid was constructed, with anatomical structures arranged in rows and diagnostic imaging modalities arranged in columns (including nuclear medicine and positron emission tomography). The grid was segregated into five body systems. The cells at the intersection of an anatomical structure row and an imaging modality column were populated with short, formulaic descriptors of the applicable diagnostic imaging examinations. Clinically illogical or physically impossible combinations were 'greyed out'. Where the same examination applied to different anatomical structures, the descriptor was kept identical for the purposes of streamlining. The resulting Body Systems Framework of diagnostic imaging examination descriptors lists all the reasonably common diagnostic imaging examinations currently performed in Australia and New Zealand using a unified grid structure allowing navigation by both referrers and radiologists. The Framework has been placed on the RANZCR website and is available for access free of charge by registered users. The Body Systems Framework of diagnostic imaging examination descriptors is a system of descriptors based on relationships between anatomical structures and imaging modalities. The Framework is now available as a resource and reference point for the radiology profession and to support core College activities. © 2014 The Royal Australian and New Zealand College of Radiologists.

  13. Investigation of physical imaging properties in various digital radiography systems

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Hoi Woun [Dept. of Radiological Science, Baekseok Culture University, Cheonan (Korea, Republic of); Min, Jung Hwan [Dept. of Radiological technology, Shingu University, Seongnam (Korea, Republic of); Yoon, Yong Su [Dept. of Health Sciences, Graduate School of Medical Sciences, Kyushu University, Kyushu (Japan); Kim, Jung Min [Dept. of Health and Environmental Science, College of Health Science, Korea University, Seoul (Korea, Republic of)

    2017-09-15

    We aimed to evaluate the physical imaging properties in various digital radiography systems with charged coupled device (CCD), computed radiography (CR), and indirect flat panel detector (FPD). The imaging properties measured in this study were modulation transfer function (MTF) wiener spectrum (WS), and detective quantum efficiency (DQE) to compare the performance of each digital radiography system. The system response of CCD were in a linear relationship with exposure and that of CR and FPD were proportional to the logarithm of exposure. The MTF of both CR and FPD indicated a similar tendency but in case of CCD, it showed lower MTF than that of CR and FPD. FPD showed the lowest WS and also indicated the highest DQE among three systems. According to the results, digital radiography system with different type of image receptor had its own image characteristics. Therefore, it is important to know the physical imaging characteristics of the digital radiography system accurately to obtain proper image quality.

  14. Diagnostic medical imaging systems. X-ray radiography and angiography, computerized tomography, nuclear medicine, NMR imaging, sonography, integrated image information systems. 3. rev. and enl. ed.

    International Nuclear Information System (INIS)

    Morneburg, H.

    1995-01-01

    This third edition is based on major review and updating work. Many recent developments have been included, as for instance novel systems for fluoroscopy and mammography, spiral CT and electron beam CT, nuclear medical tomography ( SPECT and PET), novel techniques for fast NMR imaging, spectral and colour coded duplex sonography, as well as a new chapter on integrated image information systems, including network installations. (orig.) [de

  15. Multilayer X-ray imaging systems

    Science.gov (United States)

    Shealy, D. L.; Hoover, R. B.; Gabardi, D. R.

    1986-01-01

    An assessment of the imaging properties of multilayer X-ray imaging systems with spherical surfaces has been made. A ray trace analysis was performed to investigate the effects of using spherical substrates (rather than the conventional paraboloidal/hyperboloidal contours) for doubly reflecting Cassegrain telescopes. These investigations were carried out for mirrors designed to operate at selected soft X-ray/XUV wavelengths that are of significance for studies of the solar corona/transition region from the Stanford/MSFC Rocket X-Ray Telescope. The effects of changes in separation of the primary and secondary elements were also investigated. These theoretical results are presented as well as the results of ray trace studies to establish the resolution and vignetting effects as a function of field angle and system parameters.

  16. Computer simulation of radiographic images sharpness in several system of image record

    International Nuclear Information System (INIS)

    Silva, Marcia Aparecida; Schiable, Homero; Frere, Annie France; Marques, Paulo M.A.; Oliveira, Henrique J.Q. de; Alves, Fatima F.R.; Medeiros, Regina B.

    1996-01-01

    A method to predict the influence of the record system on radiographic images sharpness by computer simulation is studied. The method intend to previously show the image to be obtained for each type of film or screen-film combination used during the exposure

  17. OBJECT-SPACE MULTI-IMAGE MATCHING OF MOBILE-MAPPING-SYSTEM IMAGE SEQUENCES

    Directory of Open Access Journals (Sweden)

    Y. C. Chen

    2012-07-01

    Full Text Available This paper proposes an object-space multi-image matching procedure of terrestrial MMS (Mobile Mapping System image sequences to determine the coordinates of an object point automatically and reliably. This image matching procedure can be applied to find conjugate points of MMS image sequences efficiently. Conventional area-based image matching methods are not reliable to deliver accurate matching results for this application due to image scale variations, viewing angle variations, and object occlusions. In order to deal with these three matching problems, an object space multi-image matching is proposed. A modified NCC (Normalized Cross Correlation coefficient is proposed to measure the similarity of image patches. A modified multi-window matching procedure will also be introduced to solve the problem of object occlusion. A coarse-to-fine procedure with a combination of object-space multi-image matching and multi-window matching is adopted. The proposed procedure has been implemented for the purpose of matching terrestrial MMS image sequences. The ratio of correct matches of this experiment was about 80 %. By providing an approximate conjugate point in an overlapping image manually, most of the incorrect matches could be fixed properly and the ratio of correct matches was improved up to 98 %.

  18. In-situ Planetary Subsurface Imaging System

    Science.gov (United States)

    Song, W.; Weber, R. C.; Dimech, J. L.; Kedar, S.; Neal, C. R.; Siegler, M.

    2017-12-01

    Geophysical and seismic instruments are considered the most effective tools for studying the detailed global structures of planetary interiors. A planet's interior bears the geochemical markers of its evolutionary history, as well as its present state of activity, which has direct implications to habitability. On Earth, subsurface imaging often involves massive data collection from hundreds to thousands of geophysical sensors (seismic, acoustic, etc) followed by transfer by hard links or wirelessly to a central location for post processing and computing, which will not be possible in planetary environments due to imposed mission constraints on mass, power, and bandwidth. Emerging opportunities for geophysical exploration of the solar system from Venus to the icy Ocean Worlds of Jupiter and Saturn dictate that subsurface imaging of the deep interior will require substantial data reduction and processing in-situ. The Real-time In-situ Subsurface Imaging (RISI) technology is a mesh network that senses and processes geophysical signals. Instead of data collection then post processing, the mesh network performs the distributed data processing and computing in-situ, and generates an evolving 3D subsurface image in real-time that can be transmitted under bandwidth and resource constraints. Seismic imaging algorithms (including traveltime tomography, ambient noise imaging, and microseismic imaging) have been successfully developed and validated using both synthetic and real-world terrestrial seismic data sets. The prototype hardware system has been implemented and can be extended as a general field instrumentation platform tailored specifically for a wide variety of planetary uses, including crustal mapping, ice and ocean structure, and geothermal systems. The team is applying the RISI technology to real off-world seismic datasets. For example, the Lunar Seismic Profiling Experiment (LSPE) deployed during the Apollo 17 Moon mission consisted of four geophone instruments

  19. Performance quantification of a flat-panel imager in industrial mega-voltage X-ray imaging systems

    Energy Technology Data Exchange (ETDEWEB)

    Stritt, Carina, E-mail: carina.stritt@empa.ch [Empa, Swiss Federal Laboratories for Material Science and Technology, Center for X-ray Analytics, Ueberlandstrasse 129, 8600 Dübendorf (Switzerland); Plamondon, Mathieu; Hofmann, Jürgen; Flisch, Alexander [Empa, Swiss Federal Laboratories for Material Science and Technology, Center for X-ray Analytics, Ueberlandstrasse 129, 8600 Dübendorf (Switzerland); Sennhauser, Urs [Empa, Swiss Federal Laboratories for Material Science and Technology, Reliability Science and Technology Laboratory, Ueberlandstrasse 129, 8600 Dübendorf (Switzerland)

    2017-03-11

    Active matrix flat-panel detectors have gained popularity amongst X-ray imaging systems due to their speed, resolution and high dynamic range. With appropriate shielding modern flat-panel imagers can even be used in high energy Computed Tomography (CT) systems of energies up to several mega-electronvolt (MeV). However, the performance of a digital detector is not independent of the rest of the radiographic system but depends on all other components of the system. Signal and noise transfer properties highly depend on all parameters of an imaging chain. This work focuses on quantifying the resolution capabilities and the noise in the signals of a MeV X-ray imaging system. The performance quantification is done by computing the modulation transfer function (MTF) using the standard edge method as well as the noise power spectrum (NPS) of the imaging system. We performed Monte Carlo (MC) simulations in order to understand the influence of scattered radiation on the measurements. A comparison of the horizontal and vertical MTF showed that the imaging behaviour of the detector is isotropic. Moreover, an additional investigation of the noise performance of the system showed that there is no measurable noise correlation present in the system. It was shown that the thickness of the edge device does not have a significant influence on the resulting system MTF. A rapid drop in the visibility could be observed resulting in a value of 1.2 line pairs per mm at 50% MTF. The visibility limit of line pair patterns was found to be at 2.3 line pairs per mm given by the 10% MTF value.

  20. Performance quantification of a flat-panel imager in industrial mega-voltage X-ray imaging systems

    International Nuclear Information System (INIS)

    Stritt, Carina; Plamondon, Mathieu; Hofmann, Jürgen; Flisch, Alexander; Sennhauser, Urs

    2017-01-01

    Active matrix flat-panel detectors have gained popularity amongst X-ray imaging systems due to their speed, resolution and high dynamic range. With appropriate shielding modern flat-panel imagers can even be used in high energy Computed Tomography (CT) systems of energies up to several mega-electronvolt (MeV). However, the performance of a digital detector is not independent of the rest of the radiographic system but depends on all other components of the system. Signal and noise transfer properties highly depend on all parameters of an imaging chain. This work focuses on quantifying the resolution capabilities and the noise in the signals of a MeV X-ray imaging system. The performance quantification is done by computing the modulation transfer function (MTF) using the standard edge method as well as the noise power spectrum (NPS) of the imaging system. We performed Monte Carlo (MC) simulations in order to understand the influence of scattered radiation on the measurements. A comparison of the horizontal and vertical MTF showed that the imaging behaviour of the detector is isotropic. Moreover, an additional investigation of the noise performance of the system showed that there is no measurable noise correlation present in the system. It was shown that the thickness of the edge device does not have a significant influence on the resulting system MTF. A rapid drop in the visibility could be observed resulting in a value of 1.2 line pairs per mm at 50% MTF. The visibility limit of line pair patterns was found to be at 2.3 line pairs per mm given by the 10% MTF value.

  1. Integrating a FISH imaging system into the cytology laboratory

    Directory of Open Access Journals (Sweden)

    Denice Smith G

    2010-01-01

    Full Text Available We have implemented an interactive imaging system for the interpretation of UroVysion fluorescence in situ hybridization (FISH to improve throughput, productivity, quality control and diagnostic accuracy. We describe the Duet imaging system, our experiences with implementation, and outline the financial investment, space requirements, information technology needs, validation, and training of cytotechnologists needed to integrate such a system into a cytology laboratory. Before purchasing the imaging system, we evaluated and validated the instrument at our facility. Implementation required slide preparation changes, IT modifications, development of training programs, and revision of job descriptions for cytotechnologists. A darkened room was built to house the automated scanning station and microscope, as well as two imaging stations. IT changes included generation of storage for archival images on the LAN, addition of external hard drives for back-up, and changes to cable connections for communication between remote locations. Training programs for cytotechnologists, and pathologists/fellows/residents were developed, and cytotechnologists were integrated into multiple steps of the process. The imaging system has resulted in increased productivity for pathologists, concomitant with an expanded role of cytotechnologists in multiple critical steps, including FISH, scan setup, reclassification, and initial interpretation.

  2. Prototype of Microwave Imaging System for Breast-Cancer Screening

    DEFF Research Database (Denmark)

    Rubæk, Tonny; Zhurbenko, Vitaliy

    2009-01-01

    Microwave imaging for breast-cancer detection has received the attention of a large number of research groups in the last decade. In this paper, the imaging system currently being developed at the Technical university of Denmark is presented. This includes a description of the antenna system......, the microwave hardware, and the imaging algorithm....

  3. A Wide Spectral Range Reflectance and Luminescence Imaging System

    Directory of Open Access Journals (Sweden)

    Tapani Hirvonen

    2013-10-01

    Full Text Available In this study, we introduce a wide spectral range (200–2500 nm imaging system with a 250 μm minimum spatial resolution, which can be freely modified for a wide range of resolutions and measurement geometries. The system has been tested for reflectance and luminescence measurements, but can also be customized for transmittance measurements. This study includes the performance results of the developed system, as well as examples of spectral images. Discussion of the system relates it to existing systems and methods. The wide range spectral imaging system that has been developed is however highly customizable and has great potential in many practical applications.

  4. GammaCam trademark radiation imaging system

    International Nuclear Information System (INIS)

    1998-02-01

    GammaCam trademark, a gamma-ray imaging system manufactured by AIL System, Inc., would benefit a site that needs to locate radiation sources. It is capable of producing a two-dimensional image of a radiation field superimposed on a black and white visual image. Because the system can be positioned outside the radiologically controlled area, the radiation exposure to personnel is significantly reduced and extensive shielding is not required. This report covers the following topics: technology description; performance; technology applicability and alternatives; cost; regulatory and policy issues; and lessons learned. The demonstration of GammaCam trademark in December 1996 was part of the Large-Scale Demonstration Project (LSDP) whose objective is to select and demonstrate potentially beneficial technologies at the Argonne National Laboratory-East (ANL) Chicago Pile-5 Research Reactor (CP-5). The purpose of the LSDP is to demonstrate that by using innovative and improved decontamination and decommissioning (D and D) technologies from various sources, significant benefits can be achieved when compared to baseline D and D technologies

  5. The use of the general image quality equation in the design and evaluation of imaging systems

    Science.gov (United States)

    Cota, Steve A.; Florio, Christopher J.; Duvall, David J.; Leon, Michael A.

    2009-08-01

    The design of any modern imaging system is the end result of many trade studies, each seeking to optimize image quality within real world constraints such as cost, schedule and overall risk. The National Imagery Interpretability Rating Scale (NIIRS) is a useful measure of image quality, because, by characterizing the overall interpretability of an image, it combines into one metric those contributors to image quality to which a human interpreter is most sensitive. The main drawback to using a NIIRS rating as a measure of image quality in engineering trade studies is the fact that it is tied to the human observer and cannot be predicted from physical principles and engineering parameters alone. The General Image Quality Equation (GIQE) of Leachtenauer et al. 1997 [Appl. Opt. 36, 8322-8328 (1997)] is a regression of actual image analyst NIIRS ratings vs. readily calculable engineering metrics, and provides a mechanism for using the expected NIIRS rating of an imaging system in the design and evaluation process. In this paper, we will discuss how we use the GIQE in conjunction with The Aerospace Corporation's Parameterized Image Chain Analysis & Simulation SOftware (PICASSO) to evaluate imager designs, taking a hypothetical high resolution commercial imaging system as an example.

  6. Development of a new electronic neutron imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Brenizer, J.S. [Department of Mechanical, Aerospace and Nuclear Engineering, Thornton Hall, University of Virginia, Charlottesville, VA 22903-2442 (United States); Berger, H. [Industrial Quality, Inc., Gaithersburg, MD (United States); Gibbs, K.M. [Industrial Quality, Inc., Gaithersburg, MD (United States); Mengers, P. [Paultek Systems, Inc., Nevada City, CA (United States); Stebbings, C.T. [Department of Mechanical, Aerospace and Nuclear Engineering, Thornton Hall, University of Virginia, Charlottesville, VA 22903-2442 (United States); Polansky, D. [Industrial Quality, Inc., Gaithersburg, MD (United States); Rogerson, D.J. [Naval Air Warfare Center, China Lake, CA (United States)

    1999-11-03

    An electronic neutron imaging camera system was developed for use with thermal, epithermal, and fast neutrons in applications that include nondestructive inspection of explosives, corrosion, turbine blades, electronics, low Z components, etc. The neutron images are expected to provide information to supplement that available from X-ray tests. The primary camera image area was a 30x30 cm field-of-view with a spatial resolution approaching 1.6 line pairs/mm (lp/mm). The camera had a remotely changeable second lens to limit the field-of-view to 7.6x7.6 cm for high spatial resolution (at least 4 lp/mm) thermal neutron imaging, but neutron and light scatter will limit resolution for fast neutrons to about 0.5 lp/mm. Remote focus capability enhanced camera set-up for optimum operation. The 75 dB dynamic range camera system included {sup 6}Li-based screens for imaging of thermal and epithermal neutrons and ZnS(Ag)-based screens for fast neutron imaging. The fast optics was input to a Super S-25 Gen II image intensifier, fiber optically coupled to a 1134 (h)x486 (v) frame transfer CCD camera. The camera system was designed to be compatible with a Navy-sponsored accelerator neutron source. The planned neutron source is an RF quadrupole accelerator that will provide a fast neutron flux of 10{sup 7} n/cm{sup 2}-s (at a source distance of 1 m) at an energy of about 2.2 MeV and a thermal neutron flux of 10{sup 6} n/cm{sup 2}-s at a source L/D ratio of 30. The electronic camera produced good quality real-time images at these neutron levels. On-chip integration could be used to improve image quality for low flux situations. The camera and accelerator combination provided a useful non-reactor neutron inspection system.

  7. Development of a digital panoramic X-ray imaging system of adaptive image layers for dental applications

    International Nuclear Information System (INIS)

    Choi, S.I.; Park, Y.O.; Cho, H.S.; Oh, J.E.; Cho, H.M.; Hong, D.K.; Lee, M.S.; Yang, Y.J.; Je, U.K.; Kim, D.S.; Lee, H.K.

    2011-01-01

    As a continuation of our digital radiographic sensor R and D, we have developed a prototyped digital panoramic X-ray imaging system for dental applications. The imaging system consists of a slit-collimated X-ray generator with a 0.4 mm focal spot size and a 3.5 mm Al filtration, a linear-array typed CMOS imager with a 48x48 μm 2 pixel size and a 128 (in the scan direction)x3072 (in the vertical direction) pixel format, a series of microstep motors for the precise motion control of the imaging system, and the designed sequences for the motion control and pixel readout required to make a specific plane of interest (POI) to be focused. With the several test phantoms we designed, we obtained useful digital panoramic X-ray images by moving the X-ray generator and the CMOS imager along a continuously sliding rotational center. In this study, we demonstrated that the prototype system can be applicable to any shaped POI or multi-POIs simultaneously to be focused, provided that adequate sequences for motion control and pixel readout are designed. We expect that the imaging system will be useful for our ongoing applications of dental panoramic radiography and nondestructive testing.

  8. ORIS: the Oak Ridge Imaging System program listings. [Nuclear medicine imaging with rectilinear scanner and gamma camera

    Energy Technology Data Exchange (ETDEWEB)

    Bell, P. R.; Dougherty, J. M.

    1978-04-01

    The Oak Ridge Imaging System (ORIS) is a general purpose access, storage, processing and display system for nuclear medicine imaging with rectilinear scanner and gamma camera. This volume contains listings of the PDP-8/E version of ORIS Version 2. The system is designed to run under the Digital Equipment Corporation's OS/8 monitor in 16K or more words of core. System and image file mass storage is on RK8E disk; longer-time image file storage is provided on DECtape. Another version of this program exists for use with the RF08 disk, and a more limited version is for DECtape only. This latter version is intended for non-medical imaging.

  9. Whole-body imaging of the musculoskeletal system: the value of MR imaging

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Gerwin P.; Reiser, Maximilian F.; Baur-Melnyk, Andrea [University Hospitals Munich/Grosshadern, LMU, Institute of Clinical Radiology, Munich (Germany)

    2007-12-15

    In clinical practice various modalities are used for whole-body imaging of the musculoskeletal system, including radiography, bone scintigraphy, computed tomography, magnetic resonance imaging (MRI), and positron emission tomography-computed tomography (PET-CT). Multislice CT is far more sensitive than radiographs in the assessment of trabecular and cortical bone destruction and allows for evaluation of fracture risk. The introduction of combined PET-CT scanners has markedly increased diagnostic accuracy for the detection of skeletal metastases compared with PET alone. The unique soft-tissue contrast of MRI enables for precise assessment of bone marrow infiltration and adjacent soft tissue structures so that alterations within the bone marrow may be detected before osseous destruction becomes apparent in CT or metabolic changes occur on bone scintigraphy or PET scan. Improvements in hard- and software, including parallel image acquisition acceleration, have made high resolution whole-body MRI clinically feasible. Whole-body MRI has successfully been applied for bone marrow screening of metastasis and systemic primary bone malignancies, like multiple myeloma. Furthermore, it has recently been proposed for the assessment of systemic bone diseases predisposing for malignancy (e.g., multiple cartilaginous exostoses) and muscle disease (e.g., muscle dystrophy). The following article gives an overview on state-of-the-art whole-body imaging of the musculoskeletal system and highlights present and potential future applications, especially in the field of whole-body MRI. (orig.)

  10. The Groningen image processing system

    International Nuclear Information System (INIS)

    Allen, R.J.; Ekers, R.D.; Terlouw, J.P.

    1985-01-01

    This paper describes an interactive, integrated software and hardware computer system for the reduction and analysis of astronomical images. A short historical introduction is presented before some examples of the astonomical data currently handled by the system are shown. A description is given of the present hardware and software structure. The system is illustrated by describing its appearance to the user, to the applications programmer, and to the system manager. Some quantitative information on the size and cost of the system is given, and its good and bad features are discussed

  11. Modeling the National Ignition Facility neutron imaging system.

    Science.gov (United States)

    Wilson, D C; Grim, G P; Tregillis, I L; Wilke, M D; Patel, M V; Sepke, S M; Morgan, G L; Hatarik, R; Loomis, E N; Wilde, C H; Oertel, J A; Fatherley, V E; Clark, D D; Fittinghoff, D N; Bower, D E; Schmitt, M J; Marinak, M M; Munro, D H; Merrill, F E; Moran, M J; Wang, T-S F; Danly, C R; Hilko, R A; Batha, S H; Frank, M; Buckles, R

    2010-10-01

    Numerical modeling of the neutron imaging system for the National Ignition Facility (NIF), forward from calculated target neutron emission to a camera image, will guide both the reduction of data and the future development of the system. Located 28 m from target chamber center, the system can produce two images at different neutron energies by gating on neutron arrival time. The brighter image, using neutrons near 14 MeV, reflects the size and symmetry of the implosion "hot spot." A second image in scattered neutrons, 10-12 MeV, reflects the size and symmetry of colder, denser fuel, but with only ∼1%-7% of the neutrons. A misalignment of the pinhole assembly up to ±175 μm is covered by a set of 37 subapertures with different pointings. The model includes the variability of the pinhole point spread function across the field of view. Omega experiments provided absolute calibration, scintillator spatial broadening, and the level of residual light in the down-scattered image from the primary neutrons. Application of the model to light decay measurements of EJ399, BC422, BCF99-55, Xylene, DPAC-30, and Liquid A suggests that DPAC-30 and Liquid A would be preferred over the BCF99-55 scintillator chosen for the first NIF system, if they could be fabricated into detectors with sufficient resolution.

  12. Portable Fluorescence Imaging System for Hypersonic Flow Facilities

    Science.gov (United States)

    Wilkes, J. A.; Alderfer, D. W.; Jones, S. B.; Danehy, P. M.

    2003-01-01

    A portable fluorescence imaging system has been developed for use in NASA Langley s hypersonic wind tunnels. The system has been applied to a small-scale free jet flow. Two-dimensional images were taken of the flow out of a nozzle into a low-pressure test section using the portable planar laser-induced fluorescence system. Images were taken from the center of the jet at various test section pressures, showing the formation of a barrel shock at low pressures, transitioning to a turbulent jet at high pressures. A spanwise scan through the jet at constant pressure reveals the three-dimensional structure of the flow. Future capabilities of the system for making measurements in large-scale hypersonic wind tunnel facilities are discussed.

  13. [The Role of Imaging in Central Nervous System Infections].

    Science.gov (United States)

    Yokota, Hajime; Tazoe, Jun; Yamada, Kei

    2015-07-01

    Many infections invade the central nervous system. Magnetic resonance imaging (MRI) is the main tool that is used to evaluate infectious lesions of the central nervous system. The useful sequences on MRI are dependent on the locations, such as intra-axial, extra-axial, and spinal cord. For intra-axial lesions, besides the fundamental sequences, including T1-weighted images, T2-weighted images, and fluid-attenuated inversion recovery (FLAIR) images, advanced sequences, such as diffusion-weighted imaging, diffusion tensor imaging, susceptibility-weighted imaging, and MR spectroscopy, can be applied. They are occasionally used as determinants for quick and correct diagnosis. For extra-axial lesions, understanding the differences among 2D-conventional T1-weighted images, 2D-fat-saturated T1-weighted images, 3D-Spin echo sequences, and 3D-Gradient echo sequence after the administration of gadolinium is required to avoid wrong interpretations. FLAIR plus gadolinium is a useful tool for revealing abnormal enhancement on the brain surface. For the spinal cord, the sequences are limited. Evaluating the distribution and time course of the spinal cord are essential for correct diagnoses. We summarize the role of imaging in central nervous system infections and show the pitfalls, key points, and latest information in them on clinical practices.

  14. Image processing. Volumetric analysis with a digital image processing system. [GAMMA]. Bildverarbeitung. Volumetrie mittels eines digitalen Bildverarbeitungssystems

    Energy Technology Data Exchange (ETDEWEB)

    Kindler, M; Radtke, F; Demel, G

    1986-01-01

    The book is arranged in seven sections, describing various applications of volumetric analysis using image processing systems, and various methods of diagnostic evaluation of images obtained by gamma scintigraphy, cardic catheterisation, and echocardiography. A dynamic ventricular phantom is explained that has been developed for checking and calibration for safe examination of patient, the phantom allowing extensive simulation of volumetric and hemodynamic conditions of the human heart: One section discusses the program development for image processing, referring to a number of different computer systems. The equipment described includes a small non-expensive PC system, as well as a standardized nuclear medical diagnostic system, and a computer system especially suited to image processing.

  15. Clinical software for MR imaging system, 4

    International Nuclear Information System (INIS)

    Shimizu, Koji; Kasai, Akira; Okamura, Shoichi

    1992-01-01

    Magnetic resonance imaging continues to elicit new application software through the recent technological advances of MR equipment. This paper describes several applications of our newly developed clinical software. The fast SE sequence (RISE) has proved to reduce routine examination time and to improve image quality, and ultra-fast FE sequence (SMASH) was found to extend the diagnostic capabilities in the field of cardiac study. Diffusion/perfusion imaging achieved in our MR system showed significant promise for providing novel information regarding tissue characterization. Furthermore, Image quality and practicalities of MR angiography have been improved by advanced imaging sequences and sophisticated post-processing software. (author)

  16. Real-Time Imaging System for the OpenPET

    Science.gov (United States)

    Tashima, Hideaki; Yoshida, Eiji; Kinouchi, Shoko; Nishikido, Fumihiko; Inadama, Naoko; Murayama, Hideo; Suga, Mikio; Haneishi, Hideaki; Yamaya, Taiga

    2012-02-01

    The OpenPET and its real-time imaging capability have great potential for real-time tumor tracking in medical procedures such as biopsy and radiation therapy. For the real-time imaging system, we intend to use the one-pass list-mode dynamic row-action maximum likelihood algorithm (DRAMA) and implement it using general-purpose computing on graphics processing units (GPGPU) techniques. However, it is difficult to make consistent reconstructions in real-time because the amount of list-mode data acquired in PET scans may be large depending on the level of radioactivity, and the reconstruction speed depends on the amount of the list-mode data. In this study, we developed a system to control the data used in the reconstruction step while retaining quantitative performance. In the proposed system, the data transfer control system limits the event counts to be used in the reconstruction step according to the reconstruction speed, and the reconstructed images are properly intensified by using the ratio of the used counts to the total counts. We implemented the system on a small OpenPET prototype system and evaluated the performance in terms of the real-time tracking ability by displaying reconstructed images in which the intensity was compensated. The intensity of the displayed images correlated properly with the original count rate and a frame rate of 2 frames per second was achieved with average delay time of 2.1 s.

  17. Depth imaging system for seismic reflection data. Part 1. Outline of system; Hanshaho jishin tansa data no tame no shindo imaging system. 1. System no gaiyo

    Energy Technology Data Exchange (ETDEWEB)

    Shimizu, N [Japex Jeoscience Institute, Tokyo (Japan); Matsuoka, T [Japan Petroleum Exploration Corp., Tokyo (Japan); Tsuru, T [Japan National Oil Corp., Tokyo (Japan)

    1996-10-01

    Structures of oil and gas fields to be recently explored have changed from simple structures represented by anticline into more complicated and more delicate structures in the deeper underground. In order to discover and develop prospective oil and gas fields among such geological structures, it is indispensable to construct a system which can treat seismic exploration date collectively before stacking and can easily perform imaging of underground structures accurately. Based on the advancement of hardware, Japan National Oil Corporation and Japan Petroleum Exploration Co., Ltd. have developed a depth imaging system as an interactive tool for constructing underground structures accurately through a cooperation of highly accurate imaging technology. Using this system, two-dimensional underground structure models can be easily given and modified by interactively referring to results of depth migration velocity analysis and stacking velocity analysis, well data, cross sections after depth transform, etc. 1 fig.

  18. Adaptive Optical System for Retina Imaging Approaches Clinic Applications

    Science.gov (United States)

    Ling, N.; Zhang, Y.; Rao, X.; Wang, C.; Hu, Y.; Jiang, W.; Jiang, C.

    We presented "A small adaptive optical system on table for human retinal imaging" at the 3rd Workshop on Adaptive Optics for Industry and Medicine. In this system, a 19 element small deformable mirror was used as wavefront correction element. High resolution images of photo receptors and capillaries of human retina were obtained. In recent two years, at the base of this system a new adaptive optical system for human retina imaging has been developed. The wavefront correction element is a newly developed 37 element deformable mirror. Some modifications have been adopted for easy operation. Experiments for different imaging wavelengths and axial positions were conducted. Mosaic pictures of photoreceptors and capillaries were obtained. 100 normal and abnormal eyes of different ages have been inspected.The first report in the world concerning the most detailed capillary distribution images cover ±3° by ± 3° field around the fovea has been demonstrated. Some preliminary very early diagnosis experiment has been tried in laboratory. This system is being planned to move to the hospital for clinic experiments.

  19. A method for reconstruction of electromagnetic shower parameters in a calorimeter with a rectangular cellular structure

    International Nuclear Information System (INIS)

    Chernov, N.I.; Ososkov, G.A.; Russakovich, N.A.; Velev, G.

    1989-01-01

    The Shower Hodoscopic Detector (SHD) is an important part of the HYPERON detector, as well as many other up-to-date detectors. It is a calorimeter with rectangular cells. In the present paper we consider a model of the distribution of energy release in the SHD cells and propose analytical solution of the problem of fitting the model distribution to experimental data. The corresponding programme is included in the HYPERON software and allows one to raise the rate of the data processing 8-9 times with about 10% reliability increase. 8 refs.; 8 figs

  20. Passive millimeter wave imaging and spectroscopy system for terrestrial remote sensing

    Science.gov (United States)

    Gopalsami, Nachappa; Liao, Shaolin; Koehl, Eugene R.; Elmer, Thomas W.; Heifetz, Alexander; Chien, Hual-Te; Raptis, Apostolos C.

    2010-04-01

    We have built a passive millimeter wave imaging and spectroscopy system with a 15-channel filter bank in the 146-154 GHz band for terrestrial remote sensing. We had built the spectroscopy system first and have now retrofitted an imaging element to it as a single pixel imager. The imaging element consisted of a 15-cm-diameter imaging lens fed to a corrugated scalar horn. Image acquisition is carried out by scanning the lens with a 2-axis translation stage. A LabVIEW-based software program integrates the imaging and spectroscopy systems with online display of spectroscopic information while the system scans each pixel position. The software also allows for integrating the image intensity of all 15 channels to increase the signal-to-noise ratio by a factor of ~4 relative to single channel image. The integrated imaging and spectroscopy system produces essentially 4-D data in which spatial data are along 2 dimensions, spectral data are in the 3rd dimension, and time is the 4th dimension. The system performance was tested by collecting imaging and spectral data with a 7.5-cm-diameter and 1m long gas cell in which test chemicals were introduced against a liquid nitrogen background.

  1. Robustness of an artificially tailored fisheye imaging system with a curvilinear image surface

    Science.gov (United States)

    Lee, Gil Ju; Nam, Won Il; Song, Young Min

    2017-11-01

    Curved image sensors inspired by animal and insect eyes have provided a new development direction in next-generation digital cameras. It is known that natural fish eyes afford an extremely wide field of view (FOV) imaging due to the geometrical properties of the spherical lens and hemispherical retina. However, its inherent drawbacks, such as the low off-axis illumination and the fabrication difficulty of a 'dome-like' hemispherical imager, limit the development of bio-inspired wide FOV cameras. Here, a new type of fisheye imaging system is introduced that has simple lens configurations with a curvilinear image surface, while maintaining high off-axis illumination and a wide FOV. Moreover, through comparisons with commercial conventional fisheye designs, it is determined that the volume and required number of optical elements of the proposed design is practical while capturing the fundamental optical performances. Detailed design guidelines for tailoring the proposed optic system are also discussed.

  2. Subwavelength image manipulation through oblique and herringbone layered acoustic systems

    International Nuclear Information System (INIS)

    Li, Chunhui; Jia, Han; Ke, Manzhu; Li, Yixiang; Liu, Zhengyou

    2014-01-01

    In this paper, an oblique and a herringbone layered acoustic structure are experimentally and theoretically demonstrated to manipulate acoustic subwavelength images. An imaging resolution of less than one tenth of a wavelength is achieved with both optimized systems, and lateral image shift has been realized by an oblique layered system. The thicknesses of both the oblique and the herringbone layered acoustic systems are largely reduced through utilizing the oblique or herringbone wave propagation path instead of the vertical wave propagation path in the rectangular layered planar acoustic system. With smaller size and subwavelength image manipulation, the acoustic systems are more favourable for practical application. (paper)

  3. CT image reconstruction system based on hardware implementation

    International Nuclear Information System (INIS)

    Silva, Hamilton P. da; Evseev, Ivan; Schelin, Hugo R.; Paschuk, Sergei A.; Milhoretto, Edney; Setti, Joao A.P.; Zibetti, Marcelo; Hormaza, Joel M.; Lopes, Ricardo T.

    2009-01-01

    Full text: The timing factor is very important for medical imaging systems, which can nowadays be synchronized by vital human signals, like heartbeats or breath. The use of hardware implemented devices in such a system has advantages considering the high speed of information treatment combined with arbitrary low cost on the market. This article refers to a hardware system which is based on electronic programmable logic called FPGA, model Cyclone II from ALTERA Corporation. The hardware was implemented on the UP3 ALTERA Kit. A partially connected neural network with unitary weights was programmed. The system was tested with 60 topographic projections, 100 points in each, of the Shepp and Logan phantom created by MATLAB. The main restriction was found to be the memory size available on the device: the dynamic range of reconstructed image was limited to 0 65535. Also, the normalization factor must be observed in order to do not saturate the image during the reconstruction and filtering process. The test shows a principal possibility to build CT image reconstruction systems for any reasonable amount of input data by arranging the parallel work of the hardware units like we have tested. However, further studies are necessary for better understanding of the error propagation from topographic projections to reconstructed image within the implemented method. (author)

  4. 21 CFR 892.1550 - Ultrasonic pulsed doppler imaging system.

    Science.gov (United States)

    2010-04-01

    ... system. (a) Identification. An ultrasonic pulsed doppler imaging system is a device that combines the... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ultrasonic pulsed doppler imaging system. 892.1550... include signal analysis and display equipment, patient and equipment supports, component parts, and...

  5. Comparison of the perceived image quality between two digital imaging systems for neonatal bedside radiography – A case study

    International Nuclear Information System (INIS)

    Zyl, S.A. van; Kekana, R.M.

    2015-01-01

    Background: Chest X-rays are performed daily in the neonatal intensive care and high care units. The skill of the radiographer is critical for obtaining the best image quality and limiting the patient's radiation exposure. The literature states that indirect flat panel detectors produce images of superior quality in comparison to computed radiography systems. At Steve Biko Academic Hospital a decision was made to revert from the direct digital radiography (DR) system to the computed radiography (CR) system, due to poor image quality experienced. Method: The case study objective was to conduct a comparative analysis describing key technical factors contributing to image quality. The analysis entailed retrospectively comparing the images obtained during 2010 and 2011. An image analysis form was utilised in evaluating the technical aspects of the image. A total of 160 images were viewed by 16 participants sampled from the radiography, radiology and paediatric departments. The participants were asked to re-evaluate two of their allotted images after five days to determine their reliability. Results: Findings were that the DR system provides significantly better image quality than the CR system (p < 0.05) for all the technical factors evaluated. However technical improvements are recommended. A wide variance in intra-observer reliability was also found. Conclusion: This case study demonstrated that DR images were considered to be superior to CR images. Recommendations include: a standardised technique for imaging the neonates; optimisation of the imaging software for the digital detectors, improved feedback systems in terms of exposure index values, and the training of radiographers and referring physicians in technical image analysis. - Highlights: • DR system provides better image quality than the CR system for all technical factors evaluated. • The average values obtained from the VAS showed that the DR system still needs to be optimised. • There is need

  6. A gamma cammera image processing system

    International Nuclear Information System (INIS)

    Chen Weihua; Mei Jufang; Jiang Wenchuan; Guo Zhenxiang

    1987-01-01

    A microcomputer based gamma camera image processing system has been introduced. Comparing with other systems, the feature of this system is that an inexpensive microcomputer has been combined with specially developed hardware, such as, data acquisition controller, data processor and dynamic display controller, ect. Thus the process of picture processing has been speeded up and the function expense ratio of the system raised

  7. Sampling system for in vivo ultrasound images

    DEFF Research Database (Denmark)

    Jensen, Jorgen Arendt; Mathorne, Jan

    1991-01-01

    Newly developed algorithms for processing medical ultrasound images use the high frequency sampled transducer signal. This paper describes demands imposed on a sampling system suitable for acquiring such data and gives details about a prototype constructed. It acquires full clinical images...... at a sampling frequency of 20 MHz with a resolution of 12 bits. The prototype can be used for real time image processing. An example of a clinical in vivo image is shown and various aspects of the data acquisition process are discussed....

  8. Portable multispectral imaging system for oral cancer diagnosis

    Science.gov (United States)

    Hsieh, Yao-Fang; Ou-Yang, Mang; Lee, Cheng-Chung

    2013-09-01

    This study presents the portable multispectral imaging system that can acquire the image of specific spectrum in vivo for oral cancer diagnosis. According to the research literature, the autofluorescence of cells and tissue have been widely applied to diagnose oral cancer. The spectral distribution is difference for lesions of epithelial cells and normal cells after excited fluorescence. We have been developed the hyperspectral and multispectral techniques for oral cancer diagnosis in three generations. This research is the third generation. The excited and emission spectrum for the diagnosis are acquired from the research of first generation. The portable system for detection of oral cancer is modified for existing handheld microscope. The UV LED is used to illuminate the surface of oral cavity and excite the cells to produce fluorescent. The image passes through the central channel and filters out unwanted spectrum by the selection of filter, and focused by the focus lens on the image sensor. Therefore, we can achieve the specific wavelength image via fluorescence reaction. The specificity and sensitivity of the system are 85% and 90%, respectively.

  9. Parallel asynchronous systems and image processing algorithms

    Science.gov (United States)

    Coon, D. D.; Perera, A. G. U.

    1989-01-01

    A new hardware approach to implementation of image processing algorithms is described. The approach is based on silicon devices which would permit an independent analog processing channel to be dedicated to evey pixel. A laminar architecture consisting of a stack of planar arrays of the device would form a two-dimensional array processor with a 2-D array of inputs located directly behind a focal plane detector array. A 2-D image data stream would propagate in neuronlike asynchronous pulse coded form through the laminar processor. Such systems would integrate image acquisition and image processing. Acquisition and processing would be performed concurrently as in natural vision systems. The research is aimed at implementation of algorithms, such as the intensity dependent summation algorithm and pyramid processing structures, which are motivated by the operation of natural vision systems. Implementation of natural vision algorithms would benefit from the use of neuronlike information coding and the laminar, 2-D parallel, vision system type architecture. Besides providing a neural network framework for implementation of natural vision algorithms, a 2-D parallel approach could eliminate the serial bottleneck of conventional processing systems. Conversion to serial format would occur only after raw intensity data has been substantially processed. An interesting challenge arises from the fact that the mathematical formulation of natural vision algorithms does not specify the means of implementation, so that hardware implementation poses intriguing questions involving vision science.

  10. A computerized tomography system for transcranial ultrasound imaging.

    Science.gov (United States)

    Tang, Sai Chun; Clement, Gregory T

    Hardware for tomographic imaging presents both challenge and opportunity for simplification when compared with traditional pulse-echo imaging systems. Specifically, point diffraction tomography does not require simultaneous powering of elements, in theory allowing just a single transmit channel and a single receive channel to be coupled with a switching or multiplexing network. In our ongoing work on transcranial imaging, we have developed a 512-channel system designed to transmit and/or receive a high voltage signal from/to arbitrary elements of an imaging array. The overall design follows a hierarchy of modules including a software interface, microcontroller, pulse generator, pulse amplifier, high-voltage power converter, switching mother board, switching daughter board, receiver amplifier, analog-to-digital converter, peak detector, memory, and USB communication. Two pulse amplifiers are included, each capable of producing up to 400Vpp via power MOSFETS. Switching is based around mechanical relays that allow passage of 200V, while still achieving switching times of under 2ms, with an operating frequency ranging from below 100kHz to 10MHz. The system is demonstrated through ex vivo human skulls using 1MHz transducers. The overall system design is applicable to planned human studies in transcranial image acquisition, and may have additional tomographic applications for other materials necessitating a high signal output.

  11. Improvement of the image quality of a high-temperature vision system

    International Nuclear Information System (INIS)

    Fabijańska, Anna; Sankowski, Dominik

    2009-01-01

    In this paper, the issues of controlling and improving the image quality of a high-temperature vision system are considered. The image quality improvement is needed to measure the surface properties of metals and alloys. Two levels of image quality control and improvement are defined in the system. The first level in hardware aims at adjusting the system configuration to obtain the highest contrast and weakest aura images. When optimal configuration is obtained, the second level in software is applied. In this stage, image enhancement algorithms are applied which have been developed with consideration of distortions arising from the vision system components and specificity of images acquired during the measurement process. The developed algorithms have been applied in the vision system to images. The influence on the accuracy of wetting angles and surface tension determination are considered

  12. Characteristics of a New X-Ray Imaging System for Interventional Procedures: Improved Image Quality and Reduced Radiation Dose.

    Science.gov (United States)

    Schernthaner, Ruediger E; Haroun, Reham R; Nguyen, Sonny; Duran, Rafael; Sohn, Jae Ho; Sahu, Sonia; Chapiro, Julius; Zhao, Yan; Radaelli, Alessandro; van der Bom, Imramsjah M; Mauti, Maria; Hong, Kelvin; Geschwind, Jean-François H; Lin, MingDe

    2018-03-01

    To compare image quality and radiation exposure between a new angiographic imaging system and the preceding generation system during uterine artery embolization (UAE). In this retrospective, IRB-approved two-arm study, 54 patients with symptomatic uterine fibroids were treated with UAE on two different angiographic imaging systems. The new system includes optimized acquisition parameters and real-time image processing algorithms. Air kerma (AK), dose area product (DAP) and acquisition time for digital fluoroscopy (DF) and digital subtraction angiography (DSA) were recorded. Body mass index was noted as well. DF image quality was assessed objectively by image noise measurements. DSA image quality was rated by two blinded, independent readers on a four-rank scale. Statistical differences were assessed with unpaired t tests and Wilcoxon rank-sum tests. There was no significant difference between the patients treated on the new (n = 36) and the old system (n = 18) regarding age (p = 0.10), BMI (p = 0.18), DF time (p = 0.35) and DSA time (p = 0.17). The new system significantly reduced the cumulative AK and DAP by 64 and 72%, respectively (median 0.58 Gy and 145.9 Gy*cm 2 vs. 1.62 Gy and 526.8 Gy*cm 2 , p < 0.01 for both). Specifically, DAP for DF and DSA decreased by 59% (75.3 vs. 181.9 Gy*cm 2 , p < 0.01) and 78% (67.6 vs. 312.2 Gy*cm 2 , p < 0.01), respectively. The new system achieved a significant decrease in DF image noise (p < 0.01) and a significantly better DSA image quality (p < 0.01). The new angiographic imaging system significantly improved image quality and reduced radiation exposure during UAE procedures.

  13. TU-A-201-01: Introduction to In-Room Imaging System Characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Chang, J. [Northwell Health (United States)

    2016-06-15

    Recent years have seen a widespread proliferation of available in-room image guidance systems for radiation therapy target localization with many centers having multiple in-room options. In this session, available imaging systems for in-room IGRT will be reviewed highlighting the main differences in workflow efficiency, targeting accuracy and image quality as it relates to target visualization. Decision-making strategies for integrating these tools into clinical image guidance protocols that are tailored to specific disease sites like H&N, lung, pelvis, and spine SBRT will be discussed. Learning Objectives: Major system characteristics of a wide range of available in-room imaging systems for IGRT. Advantages / disadvantages of different systems for site-specific IGRT considerations. Concepts of targeting accuracy and time efficiency in designing clinical imaging protocols.

  14. 21 CFR 892.1560 - Ultrasonic pulsed echo imaging system.

    Science.gov (United States)

    2010-04-01

    ... system. (a) Identification. An ultrasonic pulsed echo imaging system is a device intended to project a... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ultrasonic pulsed echo imaging system. 892.1560... receiver. This generic type of device may include signal analysis and display equipment, patient and...

  15. Development of a new electronic neutron imaging system

    CERN Document Server

    Brenizer, J S; Gibbs, K M; Mengers, P; Stebbings, C T; Polansky, D; Rogerson, D J

    1999-01-01

    An electronic neutron imaging camera system was developed for use with thermal, epithermal, and fast neutrons in applications that include nondestructive inspection of explosives, corrosion, turbine blades, electronics, low Z components, etc. The neutron images are expected to provide information to supplement that available from X-ray tests. The primary camera image area was a 30x30 cm field-of-view with a spatial resolution approaching 1.6 line pairs/mm (lp/mm). The camera had a remotely changeable second lens to limit the field-of-view to 7.6x7.6 cm for high spatial resolution (at least 4 lp/mm) thermal neutron imaging, but neutron and light scatter will limit resolution for fast neutrons to about 0.5 lp/mm. Remote focus capability enhanced camera set-up for optimum operation. The 75 dB dynamic range camera system included sup 6 Li-based screens for imaging of thermal and epithermal neutrons and ZnS(Ag)-based screens for fast neutron imaging. The fast optics was input to a Super S-25 Gen II image intensifi...

  16. Fiducial-Based Translational Localization Accuracy of Electromagnetic Tracking System and On-Board Kilovoltage Imaging System

    International Nuclear Information System (INIS)

    Santanam, Lakshmi; Malinowski, Kathleen; Hubenshmidt, James; Dimmer, Steve; Mayse, Martin L.; Bradley, Jeffrey; Chaudhari, Amir; Lechleiter, Kirsten; Goddu, Sree Krishna Murty; Esthappan, Jacqueline; Mutic, Sasa; Low, Daniel A.; Parikh, Parag

    2008-01-01

    Purpose: The Calypso medical four-dimensional localization system uses AC electromagnetics, which do not require ionizing radiation, for accurate, real-time tumor tracking. This investigation compared the static and dynamic tracking accuracy of this system to that of an on-board imaging kilovoltage X-ray system for concurrent use of the two systems. Methods and Materials: The localization accuracies of a kilovoltage imaging system and a continuous electromagnetic tracking system were compared. Using an in-house developed four-dimensional stage, quality-assurance fixture containing three radiofrequency transponders was positioned at a series of static locations and then moved through the ellipsoidal and nonuniform continuous paths. The transponder positions were tracked concurrently by the Calypso system. For static localization, the transponders were localized using portal images and digitally reconstructed radiographs by commercial matching software. For dynamic localization, the transponders were fluoroscopically imaged, and their positions were determined retrospectively using custom-written image processing programs. The localization data sets were synchronized with and compared to the known quality assurance fixture positions. The experiment was repeated to retrospectively track three transponders implanted in a canine lung. Results: The root mean square error of the on-board imaging and Calypso systems was 0.1 cm and 0.0 cm, respectively, for static localization, 0.22 mm and 0.33 mm for dynamic phantom positioning, and 0.42 mm for the canine study. Conclusion: The results showed that both localization systems provide submillimeter accuracy. The Calypso and on-board imaging tracking systems offer distinct sets of advantages and, given their compatibility, patients could benefit from the complementary nature of the two systems when used concurrently

  17. Coded aperture imaging system for nuclear fuel motion detection

    International Nuclear Information System (INIS)

    Stalker, K.T.; Kelly, J.G.

    1980-01-01

    A Coded Aperature Imaging System (CAIS) has been developed at Sandia National Laboratories to image the motion of nuclear fuel rods undergoing tests simulating accident conditions within a liquid metal fast breeder reactor. The tests require that the motion of the test fuel be monitored while it is immersed in a liquid sodium coolant precluding the use of normal optical means of imaging. However, using the fission gamma rays emitted by the fuel itself and coded aperture techniques, images with 1.5 mm radial and 5 mm axial resolution have been attained. Using an electro-optical detection system coupled to a high speed motion picture camera a time resolution of one millisecond can be achieved. This paper will discuss the application of coded aperture imaging to the problem, including the design of the one-dimensional Fresnel zone plate apertures used and the special problems arising from the reactor environment and use of high energy gamma ray photons to form the coded image. Also to be discussed will be the reconstruction techniques employed and the effect of various noise sources on system performance. Finally, some experimental results obtained using the system will be presented

  18. A luminescence imaging system based on a CCD camera

    DEFF Research Database (Denmark)

    Duller, G.A.T.; Bøtter-Jensen, L.; Markey, B.G.

    1997-01-01

    Stimulated luminescence arising from naturally occurring minerals is likely to be spatially heterogeneous. Standard luminescence detection systems are unable to resolve this variability. Several research groups have attempted to use imaging photon detectors, or image intensifiers linked...... to photographic systems, in order to obtain spatially resolved data. However, the former option is extremely expensive and it is difficult to obtain quantitative data from the latter. This paper describes the use of a CCD camera for imaging both thermoluminescence and optically stimulated luminescence. The system...

  19. Development of a THz spectroscopic imaging system

    International Nuclear Information System (INIS)

    Usami, M; Iwamoto, T; Fukasawa, R; Tani, M; Watanabe, M; Sakai, K

    2002-01-01

    We have developed a real-time THz imaging system based on the two-dimensional (2D) electro-optic (EO) sampling technique. Employing the 2D EO-sampling technique, we can obtain THz images using a CCD camera at a video rate of up to 30 frames per second. A spatial resolution of 1.4 mm was achieved. This resolution was reasonably close to the theoretical limit determined by diffraction. We observed not only static objects but also moving ones. To acquire spectroscopic information, time-domain images were collected. By processing these images on a computer, we can obtain spectroscopic images. Spectroscopy for silicon wafers was demonstrated

  20. PARAGON-IPS: A Portable Imaging Software System For Multiple Generations Of Image Processing Hardware

    Science.gov (United States)

    Montelione, John

    1989-07-01

    Paragon-IPS is a comprehensive software system which is available on virtually all generations of image processing hardware. It is designed for an image processing department or a scientist and engineer who is doing image processing full-time. It is being used by leading R&D labs in government agencies and Fortune 500 companies. Applications include reconnaissance, non-destructive testing, remote sensing, medical imaging, etc.

  1. Image based rendering of iterated function systems

    NARCIS (Netherlands)

    Wijk, van J.J.; Saupe, D.

    2004-01-01

    A fast method to generate fractal imagery is presented. Iterated function systems (IFS) are based on repeatedly copying transformed images. We show that this can be directly translated into standard graphics operations: Each image is generated by texture mapping and blending copies of the previous

  2. Image quality improvement in megavoltage cone beam CT using an imaging beam line and a sintered pixelated array system

    International Nuclear Information System (INIS)

    Breitbach, Elizabeth K.; Maltz, Jonathan S.; Gangadharan, Bijumon; Bani-Hashemi, Ali; Anderson, Carryn M.; Bhatia, Sudershan K.; Stiles, Jared; Edwards, Drake S.; Flynn, Ryan T.

    2011-01-01

    Purpose: To quantify the improvement in megavoltage cone beam computed tomography (MVCBCT) image quality enabled by the combination of a 4.2 MV imaging beam line (IBL) with a carbon electron target and a detector system equipped with a novel sintered pixelated array (SPA) of translucent Gd 2 O 2 S ceramic scintillator. Clinical MVCBCT images are traditionally acquired with the same 6 MV treatment beam line (TBL) that is used for cancer treatment, a standard amorphous Si (a-Si) flat panel imager, and the Kodak Lanex Fast-B (LFB) scintillator. The IBL produces a greater fluence of keV-range photons than the TBL, to which the detector response is more optimal, and the SPA is a more efficient scintillator than the LFB. Methods: A prototype IBL + SPA system was installed on a Siemens Oncor linear accelerator equipped with the MVision TM image guided radiation therapy (IGRT) system. A SPA strip consisting of four neighboring tiles and measuring 40 cm by 10.96 cm in the crossplane and inplane directions, respectively, was installed in the flat panel imager. Head- and pelvis-sized phantom images were acquired at doses ranging from 3 to 60 cGy with three MVCBCT configurations: TBL + LFB, IBL + LFB, and IBL + SPA. Phantom image quality at each dose was quantified using the contrast-to-noise ratio (CNR) and modulation transfer function (MTF) metrics. Head and neck, thoracic, and pelvic (prostate) cancer patients were imaged with the three imaging system configurations at multiple doses ranging from 3 to 15 cGy. The systems were assessed qualitatively from the patient image data. Results: For head and neck and pelvis-sized phantom images, imaging doses of 3 cGy or greater, and relative electron densities of 1.09 and 1.48, the CNR average improvement factors for imaging system change of TBL + LFB to IBL + LFB, IBL + LFB to IBL + SPA, and TBL + LFB to IBL + SPA were 1.63 (p -8 ), 1.64 (p -13 ), 2.66 (p -9 ), respectively. For all imaging doses, soft tissue contrast was more

  3. An implementation of wireless medical image transmission system on mobile devices.

    Science.gov (United States)

    Lee, SangBock; Lee, Taesoo; Jin, Gyehwan; Hong, Juhyun

    2008-12-01

    The advanced technology of computing system was followed by the rapid improvement of medical instrumentation and patient record management system. The typical examples are hospital information system (HIS) and picture archiving and communication system (PACS), which computerized the management procedure of medical records and images in hospital. Because these systems were built and used in hospitals, doctors out of hospital have problems to access them immediately on emergent cases. To solve these problems, this paper addressed the realization of system that could transmit the images acquired by medical imaging systems in hospital to the remote doctors' handheld PDA's using CDMA cellular phone network. The system consists of server and PDA. The server was developed to manage the accounts of doctors and patients and allocate the patient images to each doctor. The PDA was developed to display patient images through remote server connection. To authenticate the personal user, remote data access (RDA) method was used in PDA accessing the server database and file transfer protocol (FTP) was used to download patient images from the remove server. In laboratory experiments, it was calculated to take ninety seconds to transmit thirty images with 832 x 488 resolution and 24 bit depth and 0.37 Mb size. This result showed that the developed system has no problems for remote doctors to receive and review the patient images immediately on emergent cases.

  4. A simple polarized-based diffused reflectance colour imaging system

    African Journals Online (AJOL)

    A simple polarized-based diffuse reflectance imaging system has been developed. The system is designed for both in vivo and in vitro imaging of agricultural specimen in the visible region. The system uses a commercial web camera and a halogen lamp that makes it relatively simple and less expensive for diagnostic ...

  5. Assessing the impact of a medical image access system

    Science.gov (United States)

    McNeill, Kevin M.; Maloney, Kris; Parra, Miguel V.; Ovitt, Theron W.; Dallas, William J.

    1994-05-01

    We have developed and installed a Medical Image Access System in an intensive care unit. Images are acquired and transmitted automatically to this system, thus expanding on the previous results of Shile et. al. It is our goal to determine what effect regular, sustained availability of image data in the clinic has on the Intensive Care Unit and the Department of Radiology. Our system is installed and has been in regular use in the hospital since late August of 1993. Since the time of installation we have been collecting usage information from both the manual and automated systems. From this data we are performing the standard measures established by DeSimone et. al. Our initial results support the original findings that image availability in the clinic leads to earlier patient care decision based on the image data. However, our findings do not seem to indicate that there is a breakdown of communication between the clinician and the radiologist as a result of the use of the clinical display system. In addition to the established measure we are investigating other criteria to measure time saved by both the clinician and radiologist. The results are reported in this paper.

  6. Image-based fingerprint verification system using LabVIEW

    Directory of Open Access Journals (Sweden)

    Sunil K. Singla

    2008-09-01

    Full Text Available Biometric-based identification/verification systems provide a solution to the security concerns in the modern world where machine is replacing human in every aspect of life. Fingerprints, because of their uniqueness, are the most widely used and highly accepted biometrics. Fingerprint biometric systems are either minutiae-based or pattern learning (image based. The minutiae-based algorithm depends upon the local discontinuities in the ridge flow pattern and are used when template size is important while image-based matching algorithm uses both the micro and macro feature of a fingerprint and is used if fast response is required. In the present paper an image-based fingerprint verification system is discussed. The proposed method uses a learning phase, which is not present in conventional image-based systems. The learning phase uses pseudo random sub-sampling, which reduces the number of comparisons needed in the matching stage. This system has been developed using LabVIEW (Laboratory Virtual Instrument Engineering Workbench toolbox version 6i. The availability of datalog files in LabVIEW makes it one of the most promising candidates for its usage as a database. Datalog files can access and manipulate data and complex data structures quickly and easily. It makes writing and reading much faster. After extensive experimentation involving a large number of samples and different learning sizes, high accuracy with learning image size of 100 100 and a threshold value of 700 (1000 being the perfect match has been achieved.

  7. Image quality assessment for video stream recognition systems

    Science.gov (United States)

    Chernov, Timofey S.; Razumnuy, Nikita P.; Kozharinov, Alexander S.; Nikolaev, Dmitry P.; Arlazarov, Vladimir V.

    2018-04-01

    Recognition and machine vision systems have long been widely used in many disciplines to automate various processes of life and industry. Input images of optical recognition systems can be subjected to a large number of different distortions, especially in uncontrolled or natural shooting conditions, which leads to unpredictable results of recognition systems, making it impossible to assess their reliability. For this reason, it is necessary to perform quality control of the input data of recognition systems, which is facilitated by modern progress in the field of image quality evaluation. In this paper, we investigate the approach to designing optical recognition systems with built-in input image quality estimation modules and feedback, for which the necessary definitions are introduced and a model for describing such systems is constructed. The efficiency of this approach is illustrated by the example of solving the problem of selecting the best frames for recognition in a video stream for a system with limited resources. Experimental results are presented for the system for identity documents recognition, showing a significant increase in the accuracy and speed of the system under simulated conditions of automatic camera focusing, leading to blurring of frames.

  8. Laser-induced fluorescence imaging of subsurface tissue structures with a volume holographic spatial-spectral imaging system.

    Science.gov (United States)

    Luo, Yuan; Gelsinger-Austin, Paul J; Watson, Jonathan M; Barbastathis, George; Barton, Jennifer K; Kostuk, Raymond K

    2008-09-15

    A three-dimensional imaging system incorporating multiplexed holographic gratings to visualize fluorescence tissue structures is presented. Holographic gratings formed in volume recording materials such as a phenanthrenquinone poly(methyl methacrylate) photopolymer have narrowband angular and spectral transmittance filtering properties that enable obtaining spatial-spectral information within an object. We demonstrate this imaging system's ability to obtain multiple depth-resolved fluorescence images simultaneously.

  9. Reliability of case definitions for public health surveillance assessed by Round-Robin test methodology

    Directory of Open Access Journals (Sweden)

    Claus Hermann

    2006-05-01

    Full Text Available Abstract Background Case definitions have been recognized to be important elements of public health surveillance systems. They are to assure comparability and consistency of surveillance data and have crucial impact on the sensitivity and the positive predictive value of a surveillance system. The reliability of case definitions has rarely been investigated systematically. Methods We conducted a Round-Robin test by asking all 425 local health departments (LHD and the 16 state health departments (SHD in Germany to classify a selection of 68 case examples using case definitions. By multivariate analysis we investigated factors linked to classification agreement with a gold standard, which was defined by an expert panel. Results A total of 7870 classifications were done by 396 LHD (93% and all SHD. Reporting sensitivity was 90.0%, positive predictive value 76.6%. Polio case examples had the lowest reporting precision, salmonellosis case examples the highest (OR = 0.008; CI: 0.005–0.013. Case definitions with a check-list format of clinical criteria resulted in higher reporting precision than case definitions with a narrative description (OR = 3.08; CI: 2.47–3.83. Reporting precision was higher among SHD compared to LHD (OR = 1.52; CI: 1.14–2.02. Conclusion Our findings led to a systematic revision of the German case definitions and build the basis for general recommendations for the creation of case definitions. These include, among others, that testable yes/no criteria in a check-list format is likely to improve reliability, and that software used for data transmission should be designed in strict accordance with the case definitions. The findings of this study are largely applicable to case definitions in many other countries or international networks as they share the same structural and editorial characteristics of the case definitions evaluated in this study before their revision.

  10. Fibre laser based broadband THz imaging systems

    DEFF Research Database (Denmark)

    Eichhorn, Finn

    imaging techniques. This thesis exhibits that fiber technology can improve the robustness and the flexibility of terahertz imaging systems both by the use of fiber-optic light sources and the employment of optical fibers as light distribution medium. The main focus is placed on multi-element terahertz...

  11. High speed imaging system for nuclear diagnostics

    International Nuclear Information System (INIS)

    Eyer, H.H.

    1976-01-01

    A high speed imaging system based on state-of-the-art photosensor arrays has been designed for use in nuclear diagnostics. The system is comprised of a front-end rapid-scan solid-state camera, a high speed digitizer, and a PCM line driver in a downhole package and a memory buffer system in a uphole trailer. The downhole camera takes a ''snapshot'' of a nuclear device created flux stream, digitizes the image and transmits it to the uphole memory system before being destroyed. The memory system performs two functions: it retains the data for local display and processing by a microprocessor, and it buffers the data for retransmission at slower rates to the LLL computational facility (NADS). The impetus for such a system as well as its operation are discussed. Also discussed are new systems under development which incorporate higher data rates and more resolution

  12. High speed imaging system for nuclear diagnostics

    International Nuclear Information System (INIS)

    Eyer, H.H.

    1976-01-01

    A high speed imaging system based on state-of-the-art photosensor arrays has been designed for use in nuclear diagnostics. The system is comprised of a front-end rapid-scan solid-state camera, a high speed digitizer, and a PCM line driver in a downhole package and a memory buffer system in an uphole trailer. The downhole camera takes a ''snapshot'' of a nuclear device created flux stream, digitizes the image and transmits it to the uphole memory system before being destroyed. The memory system performs two functions: it retains the data for local display and processing by a microprocessor, and it buffers the data for retransmission at slower rates to the LLL computational facility (NADS). The impetus for such a system as well as its operation is discussed. Also discussed are new systems under development which incorporate higher data rates and more resolution

  13. A Practical and Portable Solids-State Electronic Terahertz Imaging System

    Directory of Open Access Journals (Sweden)

    Ken Smart

    2016-04-01

    Full Text Available A practical compact solid-state terahertz imaging system is presented. Various beam guiding architectures were explored and hardware performance assessed to improve its compactness, robustness, multi-functionality and simplicity of operation. The system performance in terms of image resolution, signal-to-noise ratio, the electronic signal modulation versus optical chopper, is evaluated and discussed. The system can be conveniently switched between transmission and reflection mode according to the application. A range of imaging application scenarios was explored and images of high visual quality were obtained in both transmission and reflection mode.

  14. Ion beam induced fluorescence imaging in biological systems

    International Nuclear Information System (INIS)

    Bettiol, Andrew A.; Mi, Zhaohong; Vanga, Sudheer Kumar; Chen, Ce-belle; Tao, Ye; Watt, Frank

    2015-01-01

    Imaging fluorescence generated by MeV ions in biological systems such as cells and tissue sections requires a high resolution beam (<100 nm), a sensitive detection system and a fluorescent probe that has a high quantum efficiency and low bleaching rate. For cutting edge applications in bioimaging, the fluorescence imaging technique needs to break the optical diffraction limit allowing for sub-cellular structure to be visualized, leading to a better understanding of cellular function. In a nuclear microprobe this resolution requirement can be readily achieved utilizing low beam current techniques such as Scanning Transmission Ion Microscopy (STIM). In recent times, we have been able to extend this capability to fluorescence imaging through the development of a new high efficiency fluorescence detection system, and through the use of new novel fluorescent probes that are resistant to ion beam damage (bleaching). In this paper we demonstrate ion beam induced fluorescence imaging in several biological samples, highlighting the advantages and challenges associated with using this technique

  15. SPECTRAL FILTRATION OF IMAGES BY MEANS OF DISPERSIVE SYSTEMS

    Directory of Open Access Journals (Sweden)

    I. M. Gulis

    2016-01-01

    Full Text Available Instruments for spectral filtration of images are an important element of the systems used in remote sensing, medical diagnostics, in-process measurements. The aim of this study is analysis of the functional features and characteristics of the proposed two image monochromator versions which are based on dispersive spectral filtering. The first is based on the use of a dispersive monochromator, where collimating and camera lenses form a telescopic system, the dispersive element of which is within the intermediate image plane. The second version is based on an imaging double monochromator with dispersion subtraction by back propagation. For the telescopic system version, the spectral and spatial resolutions are estimated, the latter being limited by aberrations and diffraction from the entrance slit. The device has been numerically simulated and prototyped. It is shown that for the spectral bandwidth 10 nm (visible spectral range, the aberration-limited spot size is from 10–20 μm at the image center to about 30 μm at the image periphery for the image size 23–27 mm. The monochromator with dispersion subtraction enables one to vary the spectral resolution (up to 1 nm and higher by changing the intermediate slit width. But the distinctive feature is a significant change in the selected central wavelength over the image field. The considered designs of dispersive image monochromators look very promising due to the particular advantages over the systems based on tunable filters as regards the spectral resolution, fast tuning, and the spectral contrast. The monochromator based on a telescopic system has a simple design and a rather large image field but it also has a limited light throughput due to small aperture size. The monochromator with dispersion subtraction has higher light throughput, can provide high spectral resolution when recording a full data cube in a series of measuring acts for different dispersive element positions. 

  16. Automated Image Acquisition System for the Verification of Copper-Brass Seal Images

    International Nuclear Information System (INIS)

    Stringa, E.; Bergonzi, C.; Littmann, F.; ); Marszalek, Y.; Tempesta, S.; )

    2015-01-01

    This paper describes a system for the verification of copper-brass seals realized by JRC according to DG ENER requirements. DG ENER processes about 20,000 metal seals per year. The verification of metal seals consists in visually checking the identity of a removed seal. The identity of a copper-brass seal is defined by a random stain pattern realized by the seal producer together with random scratches engraved when the seals are initialized ('seal production'). In order to verify that the seal returned from the field is the expected one its pattern is compared with an image taken during seal production. Formerly, seal initialization and verification were very heavy tasks as seal pictures were acquired with a camera one by one both in the initialization and verification stages. During the initialization the Nuclear Safeguards technicians had to place one by one new seals under a camera and acquire the related reference images. During the verification, the technician had to take used seals and place them one by one under a camera to take new pictures. The new images were presented to the technicians without any preprocessing and the technicians had to recognize the seal. The new station described in this paper has an automated image acquisition system allowing to easily process seals in batches of 100 seals. To simplify the verification, a software automatically centres and rotates the newly acquired seal image in order to perfectly overlap with the reference image acquired during the production phase. The new system significantly speeds up seal production and helps particularly with the demanding task of seal verification. As a large part of the seals is dealt with by a joint Euratom-IAEA team, the IAEA directly profits from this development. The new tool has been in routine use since mid 2013. (author)

  17. Simulation of continuously logical base cells (CL BC) with advanced functions for analog-to-digital converters and image processors

    Science.gov (United States)

    Krasilenko, Vladimir G.; Lazarev, Alexander A.; Nikitovich, Diana V.

    2017-10-01

    The paper considers results of design and modeling of continuously logical base cells (CL BC) based on current mirrors (CM) with functions of preliminary analogue and subsequent analogue-digital processing for creating sensor multichannel analog-to-digital converters (SMC ADCs) and image processors (IP). For such with vector or matrix parallel inputs-outputs IP and SMC ADCs it is needed active basic photosensitive cells with an extended electronic circuit, which are considered in paper. Such basic cells and ADCs based on them have a number of advantages: high speed and reliability, simplicity, small power consumption, high integration level for linear and matrix structures. We show design of the CL BC and ADC of photocurrents and their various possible implementations and its simulations. We consider CL BC for methods of selection and rank preprocessing and linear array of ADCs with conversion to binary codes and Gray codes. In contrast to our previous works here we will dwell more on analogue preprocessing schemes for signals of neighboring cells. Let us show how the introduction of simple nodes based on current mirrors extends the range of functions performed by the image processor. Each channel of the structure consists of several digital-analog cells (DC) on 15-35 CMOS. The amount of DC does not exceed the number of digits of the formed code, and for an iteration type, only one cell of DC, complemented by the device of selection and holding (SHD), is required. One channel of ADC with iteration is based on one DC-(G) and SHD, and it has only 35 CMOS transistors. In such ADCs easily parallel code can be realized and also serial-parallel output code. The circuits and simulation results of their design with OrCAD are shown. The supply voltage of the DC is 1.8÷3.3V, the range of an input photocurrent is 0.1÷24μA, the transformation time is 20÷30nS at 6-8 bit binary or Gray codes. The general power consumption of the ADC with iteration is only 50÷100μW, if the

  18. apART: system for the acquisition, processing, archiving, and retrieval of digital images in an open, distributed imaging environment

    Science.gov (United States)

    Schneider, Uwe; Strack, Ruediger

    1992-04-01

    apART reflects the structure of an open, distributed environment. According to the general trend in the area of imaging, network-capable, general purpose workstations with capabilities of open system image communication and image input are used. Several heterogeneous components like CCD cameras, slide scanners, and image archives can be accessed. The system is driven by an object-oriented user interface where devices (image sources and destinations), operators (derived from a commercial image processing library), and images (of different data types) are managed and presented uniformly to the user. Browsing mechanisms are used to traverse devices, operators, and images. An audit trail mechanism is offered to record interactive operations on low-resolution image derivatives. These operations are processed off-line on the original image. Thus, the processing of extremely high-resolution raster images is possible, and the performance of resolution dependent operations is enhanced significantly during interaction. An object-oriented database system (APRIL), which can be browsed, is integrated into the system. Attribute retrieval is supported by the user interface. Other essential features of the system include: implementation on top of the X Window System (X11R4) and the OSF/Motif widget set; a SUN4 general purpose workstation, inclusive ethernet, magneto optical disc, etc., as the hardware platform for the user interface; complete graphical-interactive parametrization of all operators; support of different image interchange formats (GIF, TIFF, IIF, etc.); consideration of current IPI standard activities within ISO/IEC for further refinement and extensions.

  19. Space imaging measurement system based on fixed lens and moving detector

    Science.gov (United States)

    Akiyama, Akira; Doshida, Minoru; Mutoh, Eiichiro; Kumagai, Hideo; Yamada, Hirofumi; Ishii, Hiromitsu

    2006-08-01

    We have developed the Space Imaging Measurement System based on the fixed lens and fast moving detector to the control of the autonomous ground vehicle. The space measurement is the most important task in the development of the autonomous ground vehicle. In this study we move the detector back and forth along the optical axis at the fast rate to measure the three-dimensional image data. This system is just appropriate to the autonomous ground vehicle because this system does not send out any optical energy to measure the distance and keep the safety. And we use the digital camera of the visible ray range. Therefore it gives us the cost reduction of the three-dimensional image data acquisition with respect to the imaging laser system. We can combine many pieces of the narrow space imaging measurement data to construct the wide range three-dimensional data. This gives us the improvement of the image recognition with respect to the object space. To develop the fast movement of the detector, we build the counter mass balance in the mechanical crank system of the Space Imaging Measurement System. And then we set up the duct to prevent the optical noise due to the ray not coming through lens. The object distance is derived from the focus distance which related to the best focused image data. The best focused image data is selected from the image of the maximum standard deviation in the standard deviations of series images.

  20. The neutron imaging system fielded at the National Ignition Facility

    Directory of Open Access Journals (Sweden)

    Fittinghoff D.N.

    2013-11-01

    Full Text Available We have fielded a neutron imaging system at the National Ignition Facility to collect images of fusion neutrons produced in the implosion of inertial confinement fusion experiments and scattered neutrons from (n, n′ reactions of the source neutrons in the surrounding dense material. A description of the neutron imaging system is presented, including the pinhole array aperture, the line-of-sight collimation, the scintillator-based detection system and the alignment systems and methods. Discussion of the alignment and resolution of the system is presented. We also discuss future improvements to the system hardware.

  1. The construction and evaluation of a prototype system for an image intensifier-based volume computed tomography imager

    International Nuclear Information System (INIS)

    Ning, R.

    1989-01-01

    A volumetric reconstruction of a three-dimensional (3-D) object has been at the forefront of exploration in medical applications for a long time. To achieve this goal, a prototype system for an image intensifier(II)-based volume computed tomography (CT) imager has been constructed. This research has been concerned with constructing and evaluating such a prototype system by phantom studies. The prototype system consists of a fixed x-ray tube, a specially designed aluminum filter that will reduce the dynamic range of projection data, an antiscatter grid, a conventional image intensifier optically coupled to a charge-coupled device (CCC) camera, a computer controlled turntable on which phantoms are placed, a digital computer including an A/D converter and a graphic station that displays the reconstructed images. In this study, three different phantoms were used: a vascular phantom, a resolution phantom and a Humanoid reg-sign chest phantom. The direct 3-D reconstruction from the projections was performed using a cone beam algorithm and vascular reconstruction algorithms. The image performance of the system for the direct 3-D reconstruction was evaluated. The spatial resolution limits of the system were estimated through observing the reconstructed images of the resolution phantom. By observing the images reconstructed from the projections, it can be determined that the image performance of the prototype system for a direct 3-D reconstruction is reasonably good and that the vascular reconstruction algorithms work very well. The results also indicate that the 3-D reconstructions obtained with the 11-based volume CT imager have nearly equally good resolution in x, y and z directions and are superior to a conventional CT in the resolution of the z direction

  2. ATR/OTR-SY Tank Camera Purge System and in Tank Color Video Imaging System

    International Nuclear Information System (INIS)

    Werry, S.M.

    1995-01-01

    This procedure will document the satisfactory operation of the 101-SY tank Camera Purge System (CPS) and 101-SY in tank Color Camera Video Imaging System (CCVIS). Included in the CPRS is the nitrogen purging system safety interlock which shuts down all the color video imaging system electronics within the 101-SY tank vapor space during loss of nitrogen purge pressure

  3. A moving image system for cardiovascular nuclear medicine. A dedicated auxiliary device for the total capacity imaging system for multiple plane dynamic colour display

    International Nuclear Information System (INIS)

    Iio, M.; Toyama, H.; Murata, H.; Takaoka, S.

    1981-01-01

    The recent device of the authors, the dedicated multiplane dynamic colour image display system for nuclear medicine, is discussed. This new device is a hardware-based auxiliary moving image system (AMIS) attached to the total capacity image processing system of the authors' department. The major purpose of this study is to develop the dedicated device so that cardiovascular nuclear medicine and other dynamic studies will include the ability to assess the real time delicate processing of the colour selection, edge detection, phased analysis, etc. The auxiliary system consists of the interface for image transferring, four IC refresh memories of 64x64 matrix with 10 bit count depth, a digital 20-in colour TV monitor, a control keyboard and a control panel with potentiometers. This system has five major functions for colour display: (1) A microcomputer board can select any one of 40 different colour tables preset in the colour transformation RAM. This key also provides edge detection at a certain level of the count by leaving the optional colour and setting the rest of the levels at 0 (black); (2) The arithmetic processing circuit performs the operation of the fundamental rules, permitting arithmetic processes of the two images; (3) The colour level control circuit is operated independently by four potentiometers for four refresh image memories, so that the gain and offset of the colour level can be manually and visually controlled to the satisfaction of the operator; (4) The simultaneous CRT display of the maximum four images with or without cinematic motion is possible; (5) The real time movie interval is also adjustable by hardware, and certain frames can be freezed with overlapping of the dynamic frames. Since this system of AMIS is linked with the whole capacity image processing system of the CPU size of 128kW, etc., clinical applications are not limited to cardiovascular nuclear medicine. (author)

  4. Experimental single-chip color HDTV image acquisition system with 8M-pixel CMOS image sensor

    Science.gov (United States)

    Shimamoto, Hiroshi; Yamashita, Takayuki; Funatsu, Ryohei; Mitani, Kohji; Nojiri, Yuji

    2006-02-01

    We have developed an experimental single-chip color HDTV image acquisition system using 8M-pixel CMOS image sensor. The sensor has 3840 × 2160 effective pixels and is progressively scanned at 60 frames per second. We describe the color filter array and interpolation method to improve image quality with a high-pixel-count single-chip sensor. We also describe an experimental image acquisition system we used to measured spatial frequency characteristics in the horizontal direction. The results indicate good prospects for achieving a high quality single chip HDTV camera that reduces pseudo signals and maintains high spatial frequency characteristics within the frequency band for HDTV.

  5. Facial fluid synthesis for assessment of acne vulgaris using luminescent visualization system through optical imaging and integration of fluorescent imaging system

    Science.gov (United States)

    Balbin, Jessie R.; Dela Cruz, Jennifer C.; Camba, Clarisse O.; Gozo, Angelo D.; Jimenez, Sheena Mariz B.; Tribiana, Aivje C.

    2017-06-01

    Acne vulgaris, commonly called as acne, is a skin problem that occurs when oil and dead skin cells clog up in a person's pores. This is because hormones change which makes the skin oilier. The problem is people really do not know the real assessment of sensitivity of their skin in terms of fluid development on their faces that tends to develop acne vulgaris, thus having more complications. This research aims to assess Acne Vulgaris using luminescent visualization system through optical imaging and integration of image processing algorithms. Specifically, this research aims to design a prototype for facial fluid analysis using luminescent visualization system through optical imaging and integration of fluorescent imaging system, and to classify different facial fluids present in each person. Throughout the process, some structures and layers of the face will be excluded, leaving only a mapped facial structure with acne regions. Facial fluid regions are distinguished from the acne region as they are characterized differently.

  6. A Total Information Management System For All Medical Images

    Science.gov (United States)

    Ouimette, Donald; Nudelman, Sol; Ramsby, Gale; Spackman, Thomas

    1985-09-01

    A PACS has been designed for the University of Connecticut Health Center to serve all departments acquiring images for diagnosis, surgery and therapy. It incorporates a multiple community communications architecture to provide complete information management for medical images, medical data and departmental administrative matter. The system is modular and expandable. It permits an initial installation for radiology and subsequent expansion to include other departments at the Health Center, beginning with internal medicine, surgery, ophthalmology and dentistry. The design permits sufficient expansion to offer the potential for accepting the additional burden of a hospital information system. Primary parameters that led to this system design were based on the anticipation that departments in time could achieve generating 60 to 90% of their images suited to insertion in a PACS, that a high network throughput for large block image transfers would be essen-tial and that total system reliability was fundamental to success.

  7. Physical image quality of computed radiography in mammography system

    International Nuclear Information System (INIS)

    Norriza Mohd Isa; Muhammad Jamal Isa; Wan Muhamad Saridan Wan Hassan; Fatimah Othman

    2013-01-01

    Full-text: Mammography is a screening procedure that mostly used for early detection of breast cancer. In digital imaging system, Computed Radiography is a cost-effective technology that applied indirect conversion detector. The paper presents physical image quality parameter measurements namely modulation transfer function (MTF), normalized noise power spectrum (NNPS) and detective quantum efficiency (DQE) of Computed Radiography in mammography system. MTF was calculated from two different orientations of slanted images of an edge test device and NNPS was estimated using flat-field image. Both images were acquired using a standard mammography beam quality. DQE was determined by applying the MTF and NNPS values into our developed software program. Both orientations have similar DQE characteristics. (author)

  8. Devices for Evaluating Imaging Systems. Chapter 15

    Energy Technology Data Exchange (ETDEWEB)

    Demirkaya, O.; Al-Mazrou, R. [Department of Biomedical Physics, King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia)

    2014-12-15

    A quality management system (QMS) has three main components: (a) Quality assurance (QA); (b) Quality improvement; (c) Quality control (QC). The aim of a QMS is to ensure that the deliverables meet the requirements set forth by the users. The deliverables can be, in general, all the services provided in a nuclear medicine department, and the diagnostic imaging services in particular. In this section, the primary focus is the diagnostic imaging equipment and images produced by them.

  9. Infrared laser transillumination CT imaging system using parallel fiber arrays and optical switches for finger joint imaging

    Science.gov (United States)

    Sasaki, Yoshiaki; Emori, Ryota; Inage, Hiroki; Goto, Masaki; Takahashi, Ryo; Yuasa, Tetsuya; Taniguchi, Hiroshi; Devaraj, Balasigamani; Akatsuka, Takao

    2004-05-01

    The heterodyne detection technique, on which the coherent detection imaging (CDI) method founds, can discriminate and select very weak, highly directional forward scattered, and coherence retaining photons that emerge from scattering media in spite of their complex and highly scattering nature. That property enables us to reconstruct tomographic images using the same reconstruction technique as that of X-Ray CT, i.e., the filtered backprojection method. Our group had so far developed a transillumination laser CT imaging method based on the CDI method in the visible and near-infrared regions and reconstruction from projections, and reported a variety of tomographic images both in vitro and in vivo of biological objects to demonstrate the effectiveness to biomedical use. Since the previous system was not optimized, it took several hours to obtain a single image. For a practical use, we developed a prototype CDI-based imaging system using parallel fiber array and optical switches to reduce the measurement time significantly. Here, we describe a prototype transillumination laser CT imaging system using fiber-optic based on optical heterodyne detection for early diagnosis of rheumatoid arthritis (RA), by demonstrating the tomographic imaging of acrylic phantom as well as the fundamental imaging properties. We expect that further refinements of the fiber-optic-based laser CT imaging system could lead to a novel and practical diagnostic tool for rheumatoid arthritis and other joint- and bone-related diseases in human finger.

  10. Diagnostic Utility of High Sensitivity Troponins for Echocardiographic Markers of Structural Heart Disease.

    Science.gov (United States)

    Wang, Tom Kai Ming; Dugo, Clementina; Gillian, Yvonne; Yvonne, Wynne; Heather, Semple; Kevin, Smith; Peter, Cleave; Jonathan, Christiansen; Andrew, To; Nezar, Amir; Scott, Tony; Ross, Boswell; Patrick, Gladding

    2018-02-15

    The conventional use of high-sensitivity troponins (hs-troponins) is for diagnosing myocardial infarction however they also have a role in chronic disease management. This pilot study assessed the relationship of hs-troponins with echocardiographic markers of left ventricular hypertrophy (LVH) and structural heart disease (SHD). Patients undergoing computer gomography (CT) coronary angiogram for low-intermediate risk chest pain and healthy volunteers were recruited. Hs-troponins Singulex I, Abbott I and Roche T and N-terminal pro-brain natriuretic peptide (NT-proBNP) were evaluated in relation to SHD parameters including left ventricular hypertrophy (LVH Echo ) and left atrial enlargement (LAE Echo ) on echocardiography. 78 subjects who underwent echocardiography were included in this study. C-statistics (95% confidence interval) of the four biomarkers for predicting LVH Echo were 0.84 (0.72-0.92), 0.84 (0.73-0.92), 0.75 (0.63-0.85) and 0.62 (0.49-0.74); for LAE Echo 0.74 (0.6-0.85), 0.78 (0.66-0.88), 0.55 (0.42-0.67) and 0.68 (0.62-0.85); and composite SHD 0.79 (0.66-0.88), 0.87 (0.75-0.94), 0.62 (0.49-0.73) and 0.74 (0.62-0.84) respectively. Optimal cut points for SHD were >1.2 ng/L, >1.6 ng/L, >8 ng/L and >18 pmol/L respectively. These results advocate the potential role of hs-troponins as screening tools for structural heart disease with theranostic implications.

  11. Lateral resolution testing of a novel developed confocal microscopic imaging system

    Science.gov (United States)

    Zhang, Xin; Zhang, Yunhai; Chang, Jian; Huang, Wei; Xue, Xiaojun; Xiao, Yun

    2015-10-01

    Laser scanning confocal microscope has been widely used in biology, medicine and material science owing to its advantages of high resolution and tomographic imaging. Based on a set of confirmatory experiments and system design, a novel confocal microscopic imaging system is developed. The system is composed of a conventional fluorescence microscope and a confocal scanning unit. In the scanning unit a laser beam coupling module provides four different wavelengths 405nm 488nm 561nm and 638nm which can excite a variety of dyes. The system works in spot-to-spot scanning mode with a two-dimensional galvanometer. A 50 microns pinhole is used to guarantee that stray light is blocked and only the fluorescence signal from the focal point can be received . The three-channel spectral splitter is used to perform fluorescence imaging at three different working wavelengths simultaneously. The rat kidney tissue slice is imaged using the developed confocal microscopic imaging system. Nucleues labeled by DAPI and kidney spherule curved pipe labeled by Alexa Fluor 488 can be imaged clearly and respectively, realizing the distinction between the different components of mouse kidney tissue. The three-dimensional tomographic imaging of mouse kidney tissue is reconstructed by several two-dimensional images obtained in different depths. At last the resolution of the confocal microscopic imaging system is tested quantitatively. The experimental result shows that the system can achieve lateral resolution priority to 230nm.

  12. Tomographic imaging system

    International Nuclear Information System (INIS)

    Hayakawa, T.; Horiba, I.; Kohno, H.; Nakaya, C.; Sekihara, K.; Shiono, H.; Tomura, T.; Yamamoto, S.; Yanaka, S.

    1980-01-01

    A tomographic imaging system comprising: irradiating means for irradating a cross-section of an object under consideration with radiation rays from plural directions; detector means for detecting the radiation rays transmitted through the cross-section of said object to produce an output signal; first memory means for storing the output signal of said detector means; and an image jreconstructing section for performing a convolution integral operation on the contents of said first memory means by means of a first weighting function to reconstruct a three-dimensional image of the cross-section of said object, said image reconstructing section including (I) second memory means for storing a second weighting function, said second weighting function being provided with a predetermined positive and negative (N-1)th order when the output signal of said detector means produced by the irradiation of the cross-section of said object from one of said plural directions is sampled by N points, the value of the (N-1)th order of said second weighting function being an integration of said first weighting function from the (N-1)th order to positive infinity and the value of -(N-1)th order of said second weighting function being an integration of said first weighting function from the -(N-1)th order to negative infinity, (II) control means for successively reading out the contents of said first and second memory means, and (III) operational means for performing multiplying and summing operations on the read-out contents of said first and second memory means, said operational means producing the product of the values fo the (N-1)th and -(N-1)th orders of said second weighting function and a component of the output signal of said detector means relating to the radiation rays free from the absorption thereof by said object

  13. Thermoluminescence dosimetry in quality imaging in CR mammography systems

    Energy Technology Data Exchange (ETDEWEB)

    Gaona, E.; Franco E, J.G. [UAM-Xochimilco, 04960 Mexico D.F. (Mexico); Azorin N, J. [UAM-Iztapalapa, 09340 Mexico D.F. (Mexico); Diaz G, J.A.I. [CICATA, Unidad Legaria, Av. Legaria 694, 11599 mexico D.F. (Mexico); Arreola, M. [Department of Radiology, Shands Hospital at UF, PO Box 100374, Gainesville, FL 32610-0374 (United States)

    2006-07-01

    The aim of this work is to estimate the average glandular dose with Thermoluminescence Dosimetry (TLD) and comparison with quality imaging in CR mammography. For measuring dose, FDA and ACR use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, Full Field Digital Mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one CR mammography system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium fluoro halide. We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated x-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose that overcomes 3.0 mGy and it doesn't improve the image quality and dose to the breast will be excessive. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement. (Author)

  14. Thermoluminescence dosimetry in quality imaging in CR mammography systems

    International Nuclear Information System (INIS)

    Gaona, E.; Franco E, J.G.; Azorin N, J.; Diaz G, J.A.I.; Arreola, M.

    2006-01-01

    The aim of this work is to estimate the average glandular dose with Thermoluminescence Dosimetry (TLD) and comparison with quality imaging in CR mammography. For measuring dose, FDA and ACR use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, Full Field Digital Mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one CR mammography system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium fluoro halide. We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated x-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose that overcomes 3.0 mGy and it doesn't improve the image quality and dose to the breast will be excessive. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement. (Author)

  15. Image sensor system with bio-inspired efficient coding and adaptation.

    Science.gov (United States)

    Okuno, Hirotsugu; Yagi, Tetsuya

    2012-08-01

    We designed and implemented an image sensor system equipped with three bio-inspired coding and adaptation strategies: logarithmic transform, local average subtraction, and feedback gain control. The system comprises a field-programmable gate array (FPGA), a resistive network, and active pixel sensors (APS), whose light intensity-voltage characteristics are controllable. The system employs multiple time-varying reset voltage signals for APS in order to realize multiple logarithmic intensity-voltage characteristics, which are controlled so that the entropy of the output image is maximized. The system also employs local average subtraction and gain control in order to obtain images with an appropriate contrast. The local average is calculated by the resistive network instantaneously. The designed system was successfully used to obtain appropriate images of objects that were subjected to large changes in illumination.

  16. Imaging systems for medical diagnostics

    International Nuclear Information System (INIS)

    Krestel, E.

    1990-01-01

    This book provides physicians and clinical physicists with detailed information on today's imaging modalities and assists them in selecting the optimal system for each clinical application. Physicists, engineers and computer specialists engaged in research and development and sales departments will also find this book to be of considerable use. It may also be employed at universities, training centers and in technical seminars. The physiological and physical fundamentals are explained in part 1. The technical solutions contained in part 2 illustrate the numerous possibilities available in X-ray diagnostics, computed tomography, nuclear medical diagnostics, magnetic resonance imaging, sonography and biomagnetic diagnostics. (orig.)

  17. Network based multi-channel digital flash X-ray imaging system

    International Nuclear Information System (INIS)

    Wang Jingjin; Yuan Jie; Liu Yaqiang; Lin Yong; Song Zheng; Liu Keyin; Zhang Qi; Zheng Futang

    2000-01-01

    A network based multi-channel digital flash X-ray imaging system has been developed. It can be used to acquire and digitize orthogonal flash X-ray images in multi-interval, and to distribute the images on the network. There is no need of films and chemical process, no anxiety of waiting and no trouble of film archiving. This system is useful for testing ballistics, jet, explode, armour-piercing and fast running machines. The system composing and acquired images are presented. The software for object separating, mass calculating, 3D positioning, speed determining and cavity reconstruction are described

  18. Network based multi-channel digital flash X-ray imaging system

    International Nuclear Information System (INIS)

    Wang Jingjin; Yuan Jie; Liu Yaqiang; Lin Yong; Song Zheng; Liu Keyin

    2003-01-01

    A network based multi-channel digital flash X-ray imaging system has been developed. It can be used to acquire and digitize orthogonal flash X-ray images in multi-interval, and to distribute the images on the network. There is no need of films and chemical process, no anxiety of waiting and no trouble of film archiving. This system is useful for testing ballistics, jet, explode, armour-piercing and fast running machines. The system composing and acquired images of terminal ballistics are presented. The software for object separating, profile calculating and 3D cavity reconstruction are described

  19. Digital image processing software system using an array processor

    International Nuclear Information System (INIS)

    Sherwood, R.J.; Portnoff, M.R.; Journeay, C.H.; Twogood, R.E.

    1981-01-01

    A versatile array processor-based system for general-purpose image processing was developed. At the heart of this system is an extensive, flexible software package that incorporates the array processor for effective interactive image processing. The software system is described in detail, and its application to a diverse set of applications at LLNL is briefly discussed. 4 figures, 1 table

  20. A novel track imaging system as a range counter

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Z. [National Institute of Radiological Sciences (Japan); Matsufuji, N. [National Institute of Radiological Sciences (Japan); Tokyo Institute of Technology (Japan); Kanayama, S. [Chiba University (Japan); Ishida, A. [National Institute of Radiological Sciences (Japan); Tokyo Institute of Technology (Japan); Kohno, T. [Tokyo Institute of Technology (Japan); Koba, Y.; Sekiguchi, M.; Kitagawa, A.; Murakami, T. [National Institute of Radiological Sciences (Japan)

    2016-05-01

    An image-intensified, camera-based track imaging system has been developed to measure the tracks of ions in a scintillator block. To study the performance of the detector unit in the system, two types of scintillators, a dosimetrically tissue-equivalent plastic scintillator EJ-240 and a CsI(Tl) scintillator, were separately irradiated with carbon ion ({sup 12}C) beams of therapeutic energy from HIMAC at NIRS. The images of individual ion tracks in the scintillators were acquired by the newly developed track imaging system. The ranges reconstructed from the images are reported here. The range resolution of the measurements is 1.8 mm for 290 MeV/u carbon ions, which is considered a significant improvement on the energy resolution of the conventional ΔE/E method. The detector is compact and easy to handle, and it can fit inside treatment rooms for in-situ studies, as well as satisfy clinical quality assurance purposes.

  1. Excitation-scanning hyperspectral imaging system for microscopic and endoscopic applications

    Science.gov (United States)

    Mayes, Sam A.; Leavesley, Silas J.; Rich, Thomas C.

    2016-04-01

    Current microscopic and endoscopic technologies for cancer screening utilize white-light illumination sources. Hyper-spectral imaging has been shown to improve sensitivity while retaining specificity when compared to white-light imaging in both microscopy and in vivo imaging. However, hyperspectral imaging methods have historically suffered from slow acquisition times due to the narrow bandwidth of spectral filters. Often minutes are required to gather a full image stack. We have developed a novel approach called excitation-scanning hyperspectral imaging that provides 2-3 orders of magnitude increased signal strength. This reduces acquisition times significantly, allowing for live video acquisition. Here, we describe a preliminary prototype excitation-scanning hyperspectral imaging system that can be coupled with endoscopes or microscopes for hyperspectral imaging of tissues and cells. Our system is comprised of three subsystems: illumination, transmission, and imaging. The illumination subsystem employs light-emitting diode arrays to illuminate at different wavelengths. The transmission subsystem utilizes a unique geometry of optics and a liquid light guide. Software controls allow us to interface with and control the subsystems and components. Digital and analog signals are used to coordinate wavelength intensity, cycling and camera triggering. Testing of the system shows it can cycle 16 wavelengths at as fast as 1 ms per cycle. Additionally, more than 18% of the light transmits through the system. Our setup should allow for hyperspectral imaging of tissue and cells in real time.

  2. Imaging systems and methods for obtaining and using biometric information

    Science.gov (United States)

    McMakin, Douglas L [Richland, WA; Kennedy, Mike O [Richland, WA

    2010-11-30

    Disclosed herein are exemplary embodiments of imaging systems and methods of using such systems. In one exemplary embodiment, one or more direct images of the body of a clothed subject are received, and a motion signature is determined from the one or more images. In this embodiment, the one or more images show movement of the body of the subject over time, and the motion signature is associated with the movement of the subject's body. In certain implementations, the subject can be identified based at least in part on the motion signature. Imaging systems for performing any of the disclosed methods are also disclosed herein. Furthermore, the disclosed imaging, rendering, and analysis methods can be implemented, at least in part, as one or more computer-readable media comprising computer-executable instructions for causing a computer to perform the respective methods.

  3. Designing a wearable navigation system for image-guided cancer resection surgery.

    Science.gov (United States)

    Shao, Pengfei; Ding, Houzhu; Wang, Jinkun; Liu, Peng; Ling, Qiang; Chen, Jiayu; Xu, Junbin; Zhang, Shiwu; Xu, Ronald

    2014-11-01

    A wearable surgical navigation system is developed for intraoperative imaging of surgical margin in cancer resection surgery. The system consists of an excitation light source, a monochromatic CCD camera, a host computer, and a wearable headset unit in either of the following two modes: head-mounted display (HMD) and Google glass. In the HMD mode, a CMOS camera is installed on a personal cinema system to capture the surgical scene in real-time and transmit the image to the host computer through a USB port. In the Google glass mode, a wireless connection is established between the glass and the host computer for image acquisition and data transport tasks. A software program is written in Python to call OpenCV functions for image calibration, co-registration, fusion, and display with augmented reality. The imaging performance of the surgical navigation system is characterized in a tumor simulating phantom. Image-guided surgical resection is demonstrated in an ex vivo tissue model. Surgical margins identified by the wearable navigation system are co-incident with those acquired by a standard small animal imaging system, indicating the technical feasibility for intraoperative surgical margin detection. The proposed surgical navigation system combines the sensitivity and specificity of a fluorescence imaging system and the mobility of a wearable goggle. It can be potentially used by a surgeon to identify the residual tumor foci and reduce the risk of recurrent diseases without interfering with the regular resection procedure.

  4. Robot-assisted ultrasound imaging: overview and development of a parallel telerobotic system.

    Science.gov (United States)

    Monfaredi, Reza; Wilson, Emmanuel; Azizi Koutenaei, Bamshad; Labrecque, Brendan; Leroy, Kristen; Goldie, James; Louis, Eric; Swerdlow, Daniel; Cleary, Kevin

    2015-02-01

    Ultrasound imaging is frequently used in medicine. The quality of ultrasound images is often dependent on the skill of the sonographer. Several researchers have proposed robotic systems to aid in ultrasound image acquisition. In this paper we first provide a short overview of robot-assisted ultrasound imaging (US). We categorize robot-assisted US imaging systems into three approaches: autonomous US imaging, teleoperated US imaging, and human-robot cooperation. For each approach several systems are introduced and briefly discussed. We then describe a compact six degree of freedom parallel mechanism telerobotic system for ultrasound imaging developed by our research team. The long-term goal of this work is to enable remote ultrasound scanning through teleoperation. This parallel mechanism allows for both translation and rotation of an ultrasound probe mounted on the top plate along with force control. Our experimental results confirmed good mechanical system performance with a positioning error of < 1 mm. Phantom experiments by a radiologist showed promising results with good image quality.

  5. Four-Mirror Freeform Reflective Imaging Systems

    Data.gov (United States)

    National Aeronautics and Space Administration — Central Objectives: The research involves a revelation of the solution space for revolutionary families of four-mirror freeform reflective imaging systems. A...

  6. Generating color terrain images in an emergency response system

    International Nuclear Information System (INIS)

    Belles, R.D.

    1985-08-01

    The Atmospheric Release Advisory Capability (ARAC) provides real-time assessments of the consequences resulting from an atmospheric release of radioactive material. In support of this operation, a system has been created which integrates numerical models, data acquisition systems, data analysis techniques, and professional staff. Of particular importance is the rapid generation of graphical images of the terrain surface in the vicinity of the accident site. A terrain data base and an associated acquisition system have been developed that provide the required terrain data. This data is then used as input to a collection of graphics programs which create and display realistic color images of the terrain. The graphics system currently has the capability of generating color shaded relief images from both overhead and perspective viewpoints within minutes. These images serve to quickly familiarize ARAC assessors with the terrain near the release location, and thus permit them to make better informed decisions in modeling the behavior of the released material. 7 refs., 8 figs

  7. Visidep (TM): A Three-Dimensional Imaging System For The Unaided Eye

    Science.gov (United States)

    McLaurin, A. Porter; Jones, Edwin R.; Cathey, LeConte

    1984-05-01

    The VISIDEP process for creating images in three dimensions on flat screens is suitable for photographic, electrographic and computer generated imaging systems. Procedures for generating these images vary from medium to medium due to the specific requirements of each technology. Imaging requirements for photographic and electrographic media are more directly tied to the hardware than are computer based systems. Applications of these technologies are not limited to entertainment, but have implications for training, interactive computer/video systems, medical imaging, and inspection equipment. Through minor modification the system can provide three-dimensional images with accurately measureable relationships for robotics and adds this factor for future developments in artificial intelligence. In almost any area requiring image analysis or critical review, VISIDEP provides the added advantage of three-dimensionality. All of this is readily accomplished without aids to the human eye. The system can be viewed in full color, false-color infra-red, and monochromatic modalities from any angle and is also viewable with a single eye. Thus, the potential of application for this developing system is extensive and covers the broad spectrum of human endeavor from entertainment to scientific study.

  8. Image change detection systems, methods, and articles of manufacture

    Science.gov (United States)

    Jones, James L.; Lassahn, Gordon D.; Lancaster, Gregory D.

    2010-01-05

    Aspects of the invention relate to image change detection systems, methods, and articles of manufacture. According to one aspect, a method of identifying differences between a plurality of images is described. The method includes loading a source image and a target image into memory of a computer, constructing source and target edge images from the source and target images to enable processing of multiband images, displaying the source and target images on a display device of the computer, aligning the source and target edge images, switching displaying of the source image and the target image on the display device, to enable identification of differences between the source image and the target image.

  9. Image-based surveillance and security systems using personal computers for device aiming and digital image comparison

    International Nuclear Information System (INIS)

    Quiett, S.; Axtell, L.H.

    1987-01-01

    A detection-type security system using enhanced capability cameras or other imaging devices can aid in maintaining security from long distance and/or for large areas. To do so requires that the imaging device(s) be repeatedly and accurately positioned so that no areas are overlooked. Digital control using personal computers is the simplest method of achieving positional accuracy. The monitoring of large areas and/or a large number of areas also requires that a substantial quantity of visual information be catalogued and evaluated for potential security problems. While security personnel alone are typically used for such monitoring, as the quantity of visual information increases, the likelihood that potential security threats will be missed also increases. The ability of an image-based security system to detect potential security problems can be further increased with the use of selected image processing techniques. Utilizing personal computers for both imaging device position control as well as image processing, surveillance of large areas can be performed by a limited number of individuals with a high level of system confidence

  10. Imaging of dopaminergic system in movement disorders

    International Nuclear Information System (INIS)

    Kim, Yu Kyeong; Kim, Sang Eun

    2007-01-01

    Parkinson's disease is a common neurodegenerative disorder that is mainly caused by dopaminergic neuron loss in the substantia nigra. Several radiopharmaceutics have been developed to evaluated the integrity of dopaminergic neuronal system. In vivo PET and SPECT imaging of presynaptic dopamine imaging are already applied to Parkinson's disease and other parkinsonism, and can demonstrate the dopaminergic dysfunction. This review summarized the use of the presynaptic dopaminergic imaging in PD as biomarkers in evaluation of disease progression as well as in diagnosis of PD

  11. Neutron imaging system based on a video camera

    International Nuclear Information System (INIS)

    Dinca, M.

    2004-01-01

    The non-destructive testing with cold, thermal, epithermal or fast neutrons is nowadays more and more useful because the world-wide level of industrial development requires considerably higher standards of quality of manufactured products and reliability of technological processes especially where any deviation from standards could result in large-scale catastrophic consequences or human loses. Thanks to their properties, easily obtained and very good discrimination of the materials that penetrate, the thermal neutrons are the most used probe. The methods involved for this technique have advanced from neutron radiography based on converter screens and radiological films to neutron radioscopy based on video cameras, that is, from static images to dynamic images. Many neutron radioscopy systems have been used in the past with various levels of success. The quality of an image depends on the quality of the neutron beam and the type of the neutron imaging system. For real time investigations there are involved tube type cameras, CCD cameras and recently CID cameras that capture the image from an appropriate scintillator through the agency of a mirror. The analog signal of the camera is then converted into digital signal by the signal processing technology included into the camera. The image acquisition card or frame grabber from a PC converts the digital signal into an image. The image is formatted and processed by image analysis software. The scanning position of the object is controlled by the computer that commands the electrical motors that move horizontally, vertically and rotate the table of the object. Based on this system, a lot of static image acquisitions, real time non-destructive investigations of dynamic processes and finally, tomographic investigations of the small objects are done in a short time. A system based on a CID camera is presented. Fundamental differences between CCD and CID cameras lie in their pixel readout structure and technique. CIDs

  12. PSF Estimation of Space-Variant Ultra-Wide Field of View Imaging Systems

    Directory of Open Access Journals (Sweden)

    Petr Janout

    2017-02-01

    Full Text Available Ultra-wide-field of view (UWFOV imaging systems are affected by various aberrations, most of which are highly angle-dependent. A description of UWFOV imaging systems, such as microscopy optics, security camera systems and other special space-variant imaging systems, is a difficult task that can be achieved by estimating the Point Spread Function (PSF of the system. This paper proposes a novel method for modeling the space-variant PSF of an imaging system using the Zernike polynomials wavefront description. The PSF estimation algorithm is based on obtaining field-dependent expansion coefficients of the Zernike polynomials by fitting real image data of the analyzed imaging system using an iterative approach in an initial estimate of the fitting parameters to ensure convergence robustness. The method is promising as an alternative to the standard approach based on Shack–Hartmann interferometry, since the estimate of the aberration coefficients is processed directly in the image plane. This approach is tested on simulated and laboratory-acquired image data that generally show good agreement. The resulting data are compared with the results of other modeling methods. The proposed PSF estimation method provides around 5% accuracy of the optical system model.

  13. The characterization of an economic and portable LED-based photoacoustic imaging system to facilitate molecular imaging

    Directory of Open Access Journals (Sweden)

    Ali Hariri

    2018-03-01

    Full Text Available Photoacoustic imaging (PAI is a non-invasive, high-resolution hybrid imaging modality that combines optical excitation and ultrasound detection. PAI can image endogenous chromophores (melanin, hemoglobin, etc. and exogenous contrast agents in different medical applications. However, most current equipment uses sophisticated and complicated OPO lasers with tuning and stability features inconsistent with broad clinical deployment. As the number of applications of PAI in medicine increases, there is an urgent need to make the imaging equipment more compact, portable, and affordable. Here, portable light emitting diode – based photoacoustic imaging (PLED-PAI was introduced and characterized in terms of system specifications, light source characterizations, photoacoustic spatial/temporal resolution, and penetration. The system uses two LED arrays attached to the sides of a conventional ultrasound transducer. The LED pulse repetition rate is tunable between 1 K Hz, 2 K Hz, 3 K Hz, and 4 K Hz. The axial resolution was 0.268 mm, and the lateral resolution was between 0.55 and 0.59 mm. The system could detect optical absorber (pencil lead at a depth of 3.2 cm and the detection limits of indocyanine green (ICG and methylene blue (MB were 9 μM and 0.78 mM. In vivo imaging of labeled human mesenchymal stem cells was achieved to confirm compatibility with small animal imaging. The characterization we report here may have value to other groups evaluating commercially available photoacoustic imaging equipment. Keywords: Portable photoacoustic imaging, LED, Optoacoustic imaging, Molecular imaging

  14. Dynamic Raman imaging system with high spatial and temporal resolution

    Science.gov (United States)

    Wang, Lei; Dai, Yinzhen; He, Hao; Lv, Ruiqi; Zong, Cheng; Ren, Bin

    2017-09-01

    There is an increasing need to study dynamic changing systems with significantly high spatial and temporal resolutions. In this work, we integrated point-scanning, line-scanning, and wide-field Raman imaging techniques into a single system. By using an Electron Multiplying CCD (EMCCD) with a high gain and high frame rate, we significantly reduced the time required for wide-field imaging, making it possible to monitor the electrochemical reactions in situ. The highest frame rate of EMCDD was ˜50 fps, and the Raman images for a specific Raman peak can be obtained by passing the signal from the sample through the Liquid Crystal Tunable Filter. The spatial resolutions of scanning imaging and wide-field imaging with a 100× objective (NA = 0.9) are 0.5 × 0.5 μm2 and 0.36 × 0.36 μm2, respectively. The system was used to study the surface plasmon resonance of Au nanorods, the surface-enhanced Raman scattering signal distribution for Au Nanoparticle aggregates, and dynamic Raman imaging of an electrochemical reacting system.

  15. Millimeter-wave imaging diagnostics systems on the EAST tokamak (invited)

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Y. L.; Xie, J. L., E-mail: jlxie@ustc.edu.cn; Yu, C. X.; Zhao, Z. L.; Gao, B. X.; Chen, D. X.; Liu, W. D.; Liao, W.; Qu, C. M.; Luo, C. [School of Physics, University of Science and Technology of China, Anhui 230026 (China); Hu, X.; Spear, A. G.; Luhmann, N. C.; Domier, C. W.; Chen, M.; Ren, X. [University of California, Davis, California 95616 (United States); Tobias, B. J. [Princeton Plasma Physics Laboratory, Princeton, New Jersey 08543 (United States)

    2016-11-15

    Millimeter-wave imaging diagnostics, with large poloidal span and wide radial range, have been developed on the EAST tokamak for visualization of 2D electron temperature and density fluctuations. A 384 channel (24 poloidal × 16 radial) Electron Cyclotron Emission Imaging (ECEI) system in F-band (90-140 GHz) was installed on the EAST tokamak in 2012 to provide 2D electron temperature fluctuation images with high spatial and temporal resolution. A co-located Microwave Imaging Reflectometry (MIR) will be installed for imaging of density fluctuations by December 2016. This “4th generation” MIR system has eight independent frequency illumination beams in W-band (75-110 GHz) driven by fast tuning synthesizers and active multipliers. Both of these advanced millimeter-wave imaging diagnostic systems have applied the latest techniques. A novel design philosophy “general optics structure” has been employed for the design of the ECEI and MIR receiver optics with large aperture. The extended radial and poloidal coverage of ECEI on EAST is made possible by innovations in the design of front-end optics. The front-end optical structures of the two imaging diagnostics, ECEI and MIR, have been integrated into a compact system, including the ECEI receiver and MIR transmitter and receiver. Two imaging systems share the same mid-plane port for simultaneous, co-located 2D fluctuation measurements of electron density and temperature. An intelligent remote-control is utilized in the MIR electronics systems to maintain focusing at the desired radial region even with density variations by remotely tuning the probe frequencies in about 200 μs. A similar intelligent technique has also been applied on the ECEI IF system, with remote configuration of the attenuations for each channel.

  16. Directional x-ray dark-field imaging of strongly ordered systems

    Science.gov (United States)

    Jensen, Torben Haugaard; Bech, Martin; Zanette, Irene; Weitkamp, Timm; David, Christian; Deyhle, Hans; Rutishauser, Simon; Reznikova, Elena; Mohr, Jürgen; Feidenhans'L, Robert; Pfeiffer, Franz

    2010-12-01

    Recently a novel grating based x-ray imaging approach called directional x-ray dark-field imaging was introduced. Directional x-ray dark-field imaging yields information about the local texture of structures smaller than the pixel size of the imaging system. In this work we extend the theoretical description and data processing schemes for directional dark-field imaging to strongly scattering systems, which could not be described previously. We develop a simple scattering model to account for these recent observations and subsequently demonstrate the model using experimental data. The experimental data includes directional dark-field images of polypropylene fibers and a human tooth slice.

  17. pyBSM: A Python package for modeling imaging systems

    Science.gov (United States)

    LeMaster, Daniel A.; Eismann, Michael T.

    2017-05-01

    There are components that are common to all electro-optical and infrared imaging system performance models. The purpose of the Python Based Sensor Model (pyBSM) is to provide open source access to these functions for other researchers to build upon. Specifically, pyBSM implements much of the capability found in the ERIM Image Based Sensor Model (IBSM) V2.0 along with some improvements. The paper also includes two use-case examples. First, performance of an airborne imaging system is modeled using the General Image Quality Equation (GIQE). The results are then decomposed into factors affecting noise and resolution. Second, pyBSM is paired with openCV to evaluate performance of an algorithm used to detect objects in an image.

  18. A single-image method of aberration retrieval for imaging systems under partially coherent illumination

    International Nuclear Information System (INIS)

    Xu, Shuang; Liu, Shiyuan; Zhang, Chuanwei; Wei, Haiqing

    2014-01-01

    We propose a method for retrieving small lens aberrations in optical imaging systems under partially coherent illumination, which only requires to measure one single defocused image of intensity. By deriving a linear theory of imaging systems, we obtain a generalized formulation of aberration sensitivity in a matrix form, which provides a set of analytic kernels that relate the measured intensity distribution directly to the unknown Zernike coefficients. Sensitivity analysis is performed and test patterns are optimized to ensure well-posedness of the inverse problem. Optical lithography simulations have validated the theoretical derivation and confirmed its simplicity and superior performance in retrieving small lens aberrations. (fast track communication)

  19. Remote Cherenkov imaging-based quality assurance of a magnetic resonance image-guided radiotherapy system.

    Science.gov (United States)

    Andreozzi, Jacqueline M; Mooney, Karen E; Brůža, Petr; Curcuru, Austen; Gladstone, David J; Pogue, Brian W; Green, Olga

    2018-06-01

    Tools to perform regular quality assurance of magnetic resonance image-guided radiotherapy (MRIgRT) systems should ideally be independent of interference from the magnetic fields. Remotely acquired optical Cherenkov imaging-based dosimetry measurements in water were investigated for this purpose, comparing measures of dose accuracy, temporal dynamics, and overall integrated IMRT delivery. A 40 × 30.5 × 37.5 cm 3 water tank doped with 1 g/L of quinine sulfate was imaged using an intensified charge-coupled device (ICCD) to capture the Cherenkov emission while being irradiated by a commercial MRIgRT system (ViewRay™). The ICCD was placed down-bore at the end of the couch, 4 m from treatment isocenter and behind the 5-Gauss line of the 0.35-T MRI. After establishing optimal camera acquisition settings, square beams of increasing size (4.2 × 4.2 cm 2 , 10.5 × 10.5 cm 2 , and 14.7 × 14.7 cm 2 ) were imaged at 0.93 frames per second, from an individual cobalt-60 treatment head, to develop projection measures related to percent depth dose (PDD) curves and cross beam profiles (CPB). These Cherenkov-derived measurements were compared to ionization chamber (IC) and radiographic film dosimetry data, as well as simulation data from the treatment planning system (TPS). An intensity-modulated radiotherapy (IMRT) commissioning plan from AAPM TG-119 (C4:C-Shape) was also imaged at 2.1 frames per second, and the single linear sum image from 509 s of plan delivery was compared to the dose volume prediction generated by the TPS using gamma index analysis. Analysis of standardized test target images (1024 × 1024 pixels) yielded a pixel resolution of 0.37 mm/pixel. The beam width measured from the Cherenkov image-generated projection CBPs was within 1 mm accuracy when compared to film measurements for all beams. The 502 point measurements (i.e., pixels) of the Cherenkov image-based projection percent depth dose curves (pPDDs) were compared to p

  20. An adaptive optics imaging system designed for clinical use

    Science.gov (United States)

    Zhang, Jie; Yang, Qiang; Saito, Kenichi; Nozato, Koji; Williams, David R.; Rossi, Ethan A.

    2015-01-01

    Here we demonstrate a new imaging system that addresses several major problems limiting the clinical utility of conventional adaptive optics scanning light ophthalmoscopy (AOSLO), including its small field of view (FOV), reliance on patient fixation for targeting imaging, and substantial post-processing time. We previously showed an efficient image based eye tracking method for real-time optical stabilization and image registration in AOSLO. However, in patients with poor fixation, eye motion causes the FOV to drift substantially, causing this approach to fail. We solve that problem here by tracking eye motion at multiple spatial scales simultaneously by optically and electronically integrating a wide FOV SLO (WFSLO) with an AOSLO. This multi-scale approach, implemented with fast tip/tilt mirrors, has a large stabilization range of ± 5.6°. Our method consists of three stages implemented in parallel: 1) coarse optical stabilization driven by a WFSLO image, 2) fine optical stabilization driven by an AOSLO image, and 3) sub-pixel digital registration of the AOSLO image. We evaluated system performance in normal eyes and diseased eyes with poor fixation. Residual image motion with incremental compensation after each stage was: 1) ~2–3 arc minutes, (arcmin) 2) ~0.5–0.8 arcmin and, 3) ~0.05–0.07 arcmin, for normal eyes. Performance in eyes with poor fixation was: 1) ~3–5 arcmin, 2) ~0.7–1.1 arcmin and 3) ~0.07–0.14 arcmin. We demonstrate that this system is capable of reducing image motion by a factor of ~400, on average. This new optical design provides additional benefits for clinical imaging, including a steering subsystem for AOSLO that can be guided by the WFSLO to target specific regions of interest such as retinal pathology and real-time averaging of registered images to eliminate image post-processing. PMID:26114033

  1. Digital approximation to extended depth of field in no telecentric imaging systems

    International Nuclear Information System (INIS)

    Meneses, J E; Contreras, C R

    2011-01-01

    A method used to digitally extend the depth of field of an imaging system consists to move the object of study along the optical axis of the system and different images will contain different areas that are sharp; those images are stored and processed digitally to obtain a fused image, in that image will be sharp all regions of the object. The implementation of this method, although widely used, imposes certain experimental conditions that should be evaluated for to study the degree of validity of the image final obtained. An experimental condition is related with the conservation of the geometric magnification factor when there is a relative movement between the object and the observation system; this implies that the system must be telecentric, which leads to a reduction of the observation field and the use of expensive systems if the application includes microscopic observation. This paper presents a technique that makes possible to extend depth of filed of an imaging system non telecentric; this system is used to realize applications in Optical Metrology with systems that have great observation field.

  2. Wavelet analysis enables system-independent texture analysis of optical coherence tomography images

    Science.gov (United States)

    Lingley-Papadopoulos, Colleen A.; Loew, Murray H.; Zara, Jason M.

    2009-07-01

    Texture analysis for tissue characterization is a current area of optical coherence tomography (OCT) research. We discuss some of the differences between OCT systems and the effects those differences have on the resulting images and subsequent image analysis. In addition, as an example, two algorithms for the automatic recognition of bladder cancer are compared: one that was developed on a single system with no consideration for system differences, and one that was developed to address the issues associated with system differences. The first algorithm had a sensitivity of 73% and specificity of 69% when tested using leave-one-out cross-validation on data taken from a single system. When tested on images from another system with a different central wavelength, however, the method classified all images as cancerous regardless of the true pathology. By contrast, with the use of wavelet analysis and the removal of system-dependent features, the second algorithm reported sensitivity and specificity values of 87 and 58%, respectively, when trained on images taken with one imaging system and tested on images taken with another.

  3. Wavelet analysis enables system-independent texture analysis of optical coherence tomography images.

    Science.gov (United States)

    Lingley-Papadopoulos, Colleen A; Loew, Murray H; Zara, Jason M

    2009-01-01

    Texture analysis for tissue characterization is a current area of optical coherence tomography (OCT) research. We discuss some of the differences between OCT systems and the effects those differences have on the resulting images and subsequent image analysis. In addition, as an example, two algorithms for the automatic recognition of bladder cancer are compared: one that was developed on a single system with no consideration for system differences, and one that was developed to address the issues associated with system differences. The first algorithm had a sensitivity of 73% and specificity of 69% when tested using leave-one-out cross-validation on data taken from a single system. When tested on images from another system with a different central wavelength, however, the method classified all images as cancerous regardless of the true pathology. By contrast, with the use of wavelet analysis and the removal of system-dependent features, the second algorithm reported sensitivity and specificity values of 87 and 58%, respectively, when trained on images taken with one imaging system and tested on images taken with another.

  4. Quality Assurance of Onboard Megavoltage Computed Tomography Imaging and Target Localization Systems for On- and Off-Line Image-Guided Radiotherapy

    International Nuclear Information System (INIS)

    Langen, Katja M.; Meeks, Sanford L.; Pouliot, Jean

    2008-01-01

    We reviewed the quality assurance procedures that have been used to test fan- and cone-beam megavoltage-based in-room imaging systems. Phantom-based tests have been used to establish the geometric accuracy and precision of megavoltage-based systems. However, the clinical implementation of any system is accompanied by challenges that are best tested in a clinical setting using clinical images. To objectively judge and monitor image quality, a set of standard tests and phantoms can be used. The image noise and spatial and contrast resolution have been assessed using standard computed tomography phantoms. The dose to the patient resulting from the imaging procedure can be determined using calculations or measurements. The off-line use of patient images is of interest for the evaluation of dosimetric changes throughout the treatment course. The accuracy of the dosimetric calculations based on the megavoltage images has been tested for the fan- and cone-beam systems. Some of the described tests are typically performed before the clinical implementation of the imaging system; others are suited to monitor the system's performances

  5. Automated alignment system for optical wireless communication systems using image recognition.

    Science.gov (United States)

    Brandl, Paul; Weiss, Alexander; Zimmermann, Horst

    2014-07-01

    In this Letter, we describe the realization of a tracked line-of-sight optical wireless communication system for indoor data distribution. We built a laser-based transmitter with adaptive focus and ray steering by a microelectromechanical systems mirror. To execute the alignment procedure, we used a CMOS image sensor at the transmitter side and developed an algorithm for image recognition to localize the receiver's position. The receiver is based on a self-developed optoelectronic integrated chip with low requirements on the receiver optics to make the system economically attractive. With this system, we were able to set up the communication link automatically without any back channel and to perform error-free (bit error rate <10⁻⁹) data transmission over a distance of 3.5 m with a data rate of 3 Gbit/s.

  6. Indirect gonioscopy system for imaging iridocorneal angle of eye

    Science.gov (United States)

    Perinchery, Sandeep M.; Fu, Chan Yiu; Baskaran, Mani; Aung, Tin; Murukeshan, V. M.

    2017-08-01

    Current clinical optical imaging systems do not provide sufficient structural information of trabecular meshwork (TM) in the iridocorneal angle (ICA) of the eye due to their low resolution. Increase in the intraocular pressure (IOP) can occur due to the abnormalities in TM, which could subsequently lead to glaucoma. Here, we present an indirect gonioscopy based imaging probe with significantly improved visualization of structures in the ICA including TM region, compared to the currently available tools. Imaging quality of the developed system was tested in porcine samples. Improved direct high quality visualization of the TM region through this system can be used for Laser trabeculoplasty, which is a primary treatment of glaucoma. This system is expected to be used complementary to angle photography and gonioscopy.

  7. Image-Based 3D Face Modeling System

    Directory of Open Access Journals (Sweden)

    Vladimir Vezhnevets

    2005-08-01

    Full Text Available This paper describes an automatic system for 3D face modeling using frontal and profile images taken by an ordinary digital camera. The system consists of four subsystems including frontal feature detection, profile feature detection, shape deformation, and texture generation modules. The frontal and profile feature detection modules automatically extract the facial parts such as the eye, nose, mouth, and ear. The shape deformation module utilizes the detected features to deform the generic head mesh model such that the deformed model coincides with the detected features. A texture is created by combining the facial textures augmented from the input images and the synthesized texture and mapped onto the deformed generic head model. This paper provides a practical system for 3D face modeling, which is highly automated by aggregating, customizing, and optimizing a bunch of individual computer vision algorithms. The experimental results show a highly automated process of modeling, which is sufficiently robust to various imaging conditions. The whole model creation including all the optional manual corrections takes only 2∼3 minutes.

  8. Polarization information processing and software system design for simultaneously imaging polarimetry

    Science.gov (United States)

    Wang, Yahui; Liu, Jing; Jin, Weiqi; Wen, Renjie

    2015-08-01

    Simultaneous imaging polarimetry can realize real-time polarization imaging of the dynamic scene, which has wide application prospect. This paper first briefly illustrates the design of the double separate Wollaston Prism simultaneous imaging polarimetry, and then emphases are put on the polarization information processing methods and software system design for the designed polarimetry. Polarization information processing methods consist of adaptive image segmentation, high-accuracy image registration, instrument matrix calibration. Morphological image processing was used for image segmentation by taking dilation of an image; The accuracy of image registration can reach 0.1 pixel based on the spatial and frequency domain cross-correlation; Instrument matrix calibration adopted four-point calibration method. The software system was implemented under Windows environment based on C++ programming language, which realized synchronous polarization images acquisition and preservation, image processing and polarization information extraction and display. Polarization data obtained with the designed polarimetry shows that: the polarization information processing methods and its software system effectively performs live realize polarization measurement of the four Stokes parameters of a scene. The polarization information processing methods effectively improved the polarization detection accuracy.

  9. Pattern recognition and expert image analysis systems in biomedical image processing (Invited Paper)

    Science.gov (United States)

    Oosterlinck, A.; Suetens, P.; Wu, Q.; Baird, M.; F. M., C.

    1987-09-01

    This paper gives an overview of pattern recoanition techniques (P.R.) used in biomedical image processing and problems related to the different P.R. solutions. Also the use of knowledge based systems to overcome P.R. difficulties, is described. This is illustrated by a common example ofabiomedical image processing application.

  10. 110 °C range athermalization of wavefront coding infrared imaging systems

    Science.gov (United States)

    Feng, Bin; Shi, Zelin; Chang, Zheng; Liu, Haizheng; Zhao, Yaohong

    2017-09-01

    110 °C range athermalization is significant but difficult for designing infrared imaging systems. Our wavefront coding athermalized infrared imaging system adopts an optical phase mask with less manufacturing errors and a decoding method based on shrinkage function. The qualitative experiments prove that our wavefront coding athermalized infrared imaging system has three prominent merits: (1) working well over a temperature range of 110 °C; (2) extending the focal depth up to 15.2 times; (3) achieving a decoded image being approximate to its corresponding in-focus infrared image, with a mean structural similarity index (MSSIM) value greater than 0.85.

  11. Planetary Data Systems (PDS) Imaging Node Atlas II

    Science.gov (United States)

    Stanboli, Alice; McAuley, James M.

    2013-01-01

    The Planetary Image Atlas (PIA) is a Rich Internet Application (RIA) that serves planetary imaging data to the science community and the general public. PIA also utilizes the USGS Unified Planetary Coordinate system (UPC) and the on-Mars map server. The Atlas was designed to provide the ability to search and filter through greater than 8 million planetary image files. This software is a three-tier Web application that contains a search engine backend (MySQL, JAVA), Web service interface (SOAP) between server and client, and a GWT Google Maps API client front end. This application allows for the search, retrieval, and download of planetary images and associated meta-data from the following missions: 2001 Mars Odyssey, Cassini, Galileo, LCROSS, Lunar Reconnaissance Orbiter, Mars Exploration Rover, Mars Express, Magellan, Mars Global Surveyor, Mars Pathfinder, Mars Reconnaissance Orbiter, MESSENGER, Phoe nix, Viking Lander, Viking Orbiter, and Voyager. The Atlas utilizes the UPC to translate mission-specific coordinate systems into a unified coordinate system, allowing the end user to query across missions of similar targets. If desired, the end user can also use a mission-specific view of the Atlas. The mission-specific views rely on the same code base. This application is a major improvement over the initial version of the Planetary Image Atlas. It is a multi-mission search engine. This tool includes both basic and advanced search capabilities, providing a product search tool to interrogate the collection of planetary images. This tool lets the end user query information about each image, and ignores the data that the user has no interest in. Users can reduce the number of images to look at by defining an area of interest with latitude and longitude ranges.

  12. Suppression of fixed pattern noise for infrared image system

    Science.gov (United States)

    Park, Changhan; Han, Jungsoo; Bae, Kyung-Hoon

    2008-04-01

    In this paper, we propose suppression of fixed pattern noise (FPN) and compensation of soft defect for improvement of object tracking in cooled staring infrared focal plane array (IRFPA) imaging system. FPN appears an observable image which applies to non-uniformity compensation (NUC) by temperature. Soft defect appears glittering black and white point by characteristics of non-uniformity for IR detector by time. This problem is very important because it happen serious problem for object tracking as well as degradation for image quality. Signal processing architecture in cooled staring IRFPA imaging system consists of three tables: low, normal, high temperature for reference gain and offset values. Proposed method operates two offset tables for each table. This is method which operates six term of temperature on the whole. Proposed method of soft defect compensation consists of three stages: (1) separates sub-image for an image, (2) decides a motion distribution of object between each sub-image, (3) analyzes for statistical characteristic from each stationary fixed pixel. Based on experimental results, the proposed method shows an improved image which suppresses FPN by change of temperature distribution from an observational image in real-time.

  13. Development of a SiPM-based PET imaging system for small animals

    International Nuclear Information System (INIS)

    Lu, Yanye; Yang, Kun; Zhou, Kedi; Zhang, Qiushi; Pang, Bo; Ren, Qiushi

    2014-01-01

    Advances in small animal positron emission tomography (PET) imaging have been accelerated by many new technologies such as the successful incorporation of silicon photomultiplier (SiPM). In this paper, we have developed a compact, lightweight PET imaging system that is based on SiPM detectors for small animals imaging, which could be integrated into a multi-modality imaging system. This PET imaging system consists of a stationary detector gantry, a motor-controlled animal bed module, electronics modules, and power supply modules. The PET detector, which was designed as a multi-slice circular ring geometry of 27 discrete block detectors, is composed of a cerium doped lutetium–yttrium oxyorthosilicate (LYSO) scintillation crystal and SiPM arrays. The system has a 60 mm transaxial field of view (FOV) and a 26 mm axial FOV. Performance tests (e.g. spatial resolution, energy resolution, and sensitivity) and phantom and animal imaging studies were performed to evaluate the imaging performance of the PET imaging system. The performance tests and animal imaging results demonstrate the feasibility of an animal PET system based on SiPM detectors and indicate that SiPM detectors can be promising photodetectors in animal PET instrumentation development

  14. Development of a SiPM-based PET imaging system for small animals

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Yanye [Department of Biomedicine and Engineering, College of Engineering, Peking University, Beijing 100871 (China); Yang, Kun, E-mail: yangkun9999@hotmail.com [Department of Control Technology and Instrumentation, College of Quality and Technical Supervision, Hebei University, Baoding, 071000 (China); Zhou, Kedi; Zhang, Qiushi; Pang, Bo [Department of Biomedicine and Engineering, College of Engineering, Peking University, Beijing 100871 (China); Ren, Qiushi, E-mail: renqsh@coe.pku.edu.cn [Department of Biomedicine and Engineering, College of Engineering, Peking University, Beijing 100871 (China)

    2014-04-11

    Advances in small animal positron emission tomography (PET) imaging have been accelerated by many new technologies such as the successful incorporation of silicon photomultiplier (SiPM). In this paper, we have developed a compact, lightweight PET imaging system that is based on SiPM detectors for small animals imaging, which could be integrated into a multi-modality imaging system. This PET imaging system consists of a stationary detector gantry, a motor-controlled animal bed module, electronics modules, and power supply modules. The PET detector, which was designed as a multi-slice circular ring geometry of 27 discrete block detectors, is composed of a cerium doped lutetium–yttrium oxyorthosilicate (LYSO) scintillation crystal and SiPM arrays. The system has a 60 mm transaxial field of view (FOV) and a 26 mm axial FOV. Performance tests (e.g. spatial resolution, energy resolution, and sensitivity) and phantom and animal imaging studies were performed to evaluate the imaging performance of the PET imaging system. The performance tests and animal imaging results demonstrate the feasibility of an animal PET system based on SiPM detectors and indicate that SiPM detectors can be promising photodetectors in animal PET instrumentation development.

  15. Hyperspectral imaging system for disease scanning on banana plants

    Science.gov (United States)

    Ochoa, Daniel; Cevallos, Juan; Vargas, German; Criollo, Ronald; Romero, Dennis; Castro, Rodrigo; Bayona, Oswaldo

    2016-05-01

    Black Sigatoka (BS) is a banana plant disease caused by the fungus Mycosphaerella fijiensis. BS symptoms can be observed at late infection stages. By that time, BS has probably spread to other plants. In this paper, we present our current work on building an hyper-spectral (HS) imaging system aimed at in-vivo detection of BS pre-symptomatic responses in banana leaves. The proposed imaging system comprises a motorized stage, a high-sensitivity VIS-NIR camera and an optical spectrograph. To capture images of the banana leaf, the stage's speed and camera's frame rate must be computed to reduce motion blur and to obtain the same resolution along both spatial dimensions of the resulting HS cube. Our continuous leaf scanning approach allows imaging leaves of arbitrary length with minimum frame loss. Once the images are captured, a denoising step is performed to improve HS image quality and spectral profile extraction.

  16. Computer-Aided Diagnosis Systems for Brain Diseases in Magnetic Resonance Images

    Directory of Open Access Journals (Sweden)

    Yasuo Yamashita

    2009-07-01

    Full Text Available This paper reviews the basics and recent researches of computer-aided diagnosis (CAD systems for assisting neuroradiologists in detection of brain diseases, e.g., asymptomatic unruptured aneurysms, Alzheimer's disease, vascular dementia, and multiple sclerosis (MS, in magnetic resonance (MR images. The CAD systems consist of image feature extraction based on image processing techniques and machine learning classifiers such as linear discriminant analysis, artificial neural networks, and support vector machines. We introduce useful examples of the CAD systems in the neuroradiology, and conclude with possibilities in the future of the CAD systems for brain diseases in MR images.

  17. Impulse radar imaging system for concealed object detection

    Science.gov (United States)

    Podd, F. J. W.; David, M.; Iqbal, G.; Hussain, F.; Morris, D.; Osakue, E.; Yeow, Y.; Zahir, S.; Armitage, D. W.; Peyton, A. J.

    2013-10-01

    Electromagnetic systems for imaging concealed objects at checkpoints typically employ radiation at millimetre and terahertz frequencies. These systems have been shown to be effective and provide a sufficiently high resolution image. However there are difficulties and current electromagnetic systems have limitations particularly in accurately differentiating between threat and innocuous objects based on shape, surface emissivity or reflectivity, which are indicative parameters. In addition, water has a high absorption coefficient at millimetre wavelength and terahertz frequencies, which makes it more difficult for these frequencies to image through thick damp clothing. This paper considers the potential of using ultra wideband (UWB) in the low gigahertz range. The application of this frequency band to security screening appears to be a relatively new field. The business case for implementing the UWB system has been made financially viable by the recent availability of low-cost integrated circuits operating at these frequencies. Although designed for the communication sector, these devices can perform the required UWB radar measurements as well. This paper reports the implementation of a 2 to 5 GHz bandwidth linear array scanner. The paper describes the design and fabrication of transmitter and receiver antenna arrays whose individual elements are a type of antipodal Vivaldi antenna. The antenna's frequency and angular response were simulated in CST Microwave Studio and compared with laboratory measurements. The data pre-processing methods of background subtraction and deconvolution are implemented to improve the image quality. The background subtraction method uses a reference dataset to remove antenna crosstalk and room reflections from the dataset. The deconvolution method uses a Wiener filter to "sharpen" the returned echoes which improves the resolution of the reconstructed image. The filter uses an impulse response reference dataset and a signal

  18. Shimadzu magnetic resonance imaging system, SMT-50X

    International Nuclear Information System (INIS)

    Kohno, Kazuhiro; Yamauchi, Mikio; Shimizu, Koji; Fujio, Yasuo

    1990-01-01

    We have already had the passage of five years, since 0.5 T MRI system named SMT-50A had been announced. On the other hand, many severe efforts in the fields of both technic and diagnosis have been done to get higher image quality having more informations and they caused recent abrupt progress in MRI. To reply these demands, we have developed new 0.5T super-conductive MRI system 'SMT-50X', having the following features in the points of image quality, operability and economy. (1) RF antenna, called multipolarization has been developed. (2) Compact gantry having a large bore size has been designed for patient to get enough view in it. (3) Easier operation could be done by means of multitask software system. This paper introduces the outline, features and clinical images acquired by SMT-50X. (author)

  19. Imaging of primary central nervous system lymphoma

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Y.Z., E-mail: yenzhitang@doctors.net.uk [Royal Free Hospital, London (United Kingdom); Booth, T.C.; Bhogal, P.; Malhotra, A.; Wilhelm, T. [Royal Free Hospital, London (United Kingdom)

    2011-08-15

    Primary central nervous system lymphoma (PCNSL) comprises 5% of all primary brain tumours. PCNSL demonstrates a variety of well-documented imaging findings, which can vary depending on immune status and histological type. Imaging features of PCNSL may overlap with other tumours and infection making definitive diagnosis challenging. In addition, several rare variants of PCNSL have been described, each with their own imaging characteristics. Advanced imaging techniques including 2-[{sup 18}F]-fluoro-2-deoxy-D-glucose ({sup 18}FDG) and {sup 11}C positron-emission tomography (PET), {sup 201}Tl single-photon emission computed tomography (SPECT), {sup 1}H-magnetic resonance spectroscopy (MRS), and MR perfusion, have been used to aid differentiation of PCNSL from other tumours. Ultimately, no imaging method can definitively diagnose PCNSL, and histology is required.

  20. 21 CFR 892.1650 - Image-intensified fluoroscopic x-ray system.

    Science.gov (United States)

    2010-04-01

    ... fluoroscopic x-ray system. (a) Identification. An image-intensified fluoroscopic x-ray system is a device... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Image-intensified fluoroscopic x-ray system. 892... equipment, patient and equipment supports, component parts, and accessories. (b) Classification. Class II...

  1. Imaging of 1.0-mm-diameter radiopaque markers with megavoltage X-rays: an improved online imaging system

    International Nuclear Information System (INIS)

    Pang, G.; Beachey, D.J.; O'Brien, P.F.; Rowlands, J.A.

    2002-01-01

    Purpose: To improve an online portal imaging system such that implanted cylindrical gold markers of small diameter (no more than 1.0 mm) can be visualized. These small markers would make the implantation procedure much less traumatic for the patient than the large markers (1.6 mm in diameter), which are usually used today to monitor prostate interfraction motion during radiation therapy. Methods and Materials: Several changes have been made to a mirror-video based online imaging system to improve image quality. First, the conventional camera tube was replaced by an avalanche-multiplication-based video tube. This new camera tube has very high gain at the target such that the camera noise, which is one of the main causes of image degradation of online portal imaging systems, was overcome and effectively eliminated. Second, the conventional linear-accelerator (linac) target was replaced with a low atomic number (low-Z) target such that more diagnostic X-rays are present in the megavoltage X-ray beam. Third, the copper plate buildup layer for the phosphor screen was replaced by a thin plastic layer for detection of the diagnostic X-ray components in the beam generated by the low-Z target. Results: Radiopaque fiducial gold markers of different sizes, i.e., 1.0 mm (diameter) x 5 mm (length) and 0.8 mm (diameter) x 3 mm (length), embedded in an Alderson Rando phantom, can be clearly seen on the images acquired with our improved system. These markers could not be seen on images obtained with any commercial system available in our clinic. Conclusion: This work demonstrates the visibility of small-diameter radiopaque markers with an improved online portal imaging system. These markers can be easily implanted into the prostate and used to monitor the interfraction motion of the prostate

  2. Imaging Systems in TLE Research

    DEFF Research Database (Denmark)

    Allin, Thomas Højgaard; Neubert, Torsten; Laursen, Steen

    2006-01-01

    documented using the right equipment in the right way. This chapter provides an introduction to the concepts of low light imagers, and how they can be successfully applied in TLE research. As examples, we describe the 2003 and 2004 Spritewatch systems, which integrate low-light cameras with a digital...

  3. Breast imaging and reporting data system (BIRADS): Magnetic resonance imaging

    International Nuclear Information System (INIS)

    Tardivon, Anne A.; Athanasiou, Alexandra; Thibault, Fabienne; El Khoury, Carl

    2007-01-01

    This article reviews the technical aspects and interpretation criteria in breast MR imaging based on the first edition of breast imaging and reporting data system (BIRADS) published by the American College of Radiology (ACR) in 2003. In a second article, practical cases will be proposed for training the readers. The major aims of using this lexicon are: first to use a logical and standardized description of MR lesions, secondly to obtain a structured MR report with a clear final impression (BIRADS assessment categories), and thirdly to help comparison between different clinical studies based on similar breast MRI terminology

  4. Systematic Calibration for a Backpacked Spherical Photogrammetry Imaging System

    Science.gov (United States)

    Rau, J. Y.; Su, B. W.; Hsiao, K. W.; Jhan, J. P.

    2016-06-01

    A spherical camera can observe the environment for almost 720 degrees' field of view in one shoot, which is useful for augmented reality, environment documentation, or mobile mapping applications. This paper aims to develop a spherical photogrammetry imaging system for the purpose of 3D measurement through a backpacked mobile mapping system (MMS). The used equipment contains a Ladybug-5 spherical camera, a tactical grade positioning and orientation system (POS), i.e. SPAN-CPT, and an odometer, etc. This research aims to directly apply photogrammetric space intersection technique for 3D mapping from a spherical image stereo-pair. For this purpose, several systematic calibration procedures are required, including lens distortion calibration, relative orientation calibration, boresight calibration for direct georeferencing, and spherical image calibration. The lens distortion is serious on the ladybug-5 camera's original 6 images. Meanwhile, for spherical image mosaicking from these original 6 images, we propose the use of their relative orientation and correct their lens distortion at the same time. However, the constructed spherical image still contains systematic error, which will reduce the 3D measurement accuracy. Later for direct georeferencing purpose, we need to establish a ground control field for boresight/lever-arm calibration. Then, we can apply the calibrated parameters to obtain the exterior orientation parameters (EOPs) of all spherical images. In the end, the 3D positioning accuracy after space intersection will be evaluated, including EOPs obtained by structure from motion method.

  5. Television imaging system for fast neutron radiography using baby cyclotron

    International Nuclear Information System (INIS)

    Yoshii, Koji; Miya, Kenzo; Katoh, Norihiko.

    1993-01-01

    A television imaging system for fast neutron radiography (FNR-TV) developed using the fast neutron source reactor YAYOI was applied to the baby-cyclotron based fast neutron source to get images of thick objects quickly. In the system the same technique as a current television imaging system of thermal neutron radiography was applied, while the luminescent converter was used to detect fast neutrons. Using the CR39 track etch method it took about 7 h to get an image, while the FNR-TV only 20 s enough for taking the same object. However the FNR-TV imaging result of the simulation model of a large explosive device for the space launch vehicle of H-2 type was not so good as the image taken with the CR39 track etch method. The reason was that the luminescence intensity of the FNR-TV converter was a quarter of that in the YAYOI. (author)

  6. Diversification in an image retrieval system based on text and image processing

    Directory of Open Access Journals (Sweden)

    Adrian Iftene

    2014-11-01

    Full Text Available In this paper we present an image retrieval system created within the research project MUCKE (Multimedia and User Credibility Knowledge Extraction, a CHIST-ERA research project where UAIC{\\footnote{"Alexandru Ioan Cuza" University of Iasi}} is one of the partners{\\footnote{Together with Technical University from Wienna, Austria, CEA-LIST Institute from Paris, France and BILKENT University from Ankara, Turkey}}. Our discussion in this work will focus mainly on components that are part of our image retrieval system proposed in MUCKE, and we present the work done by the UAIC group. MUCKE incorporates modules for processing multimedia content in different modes and languages (like English, French, German and Romanian and UAIC is responsible with text processing tasks (for Romanian and English. One of the problems addressed by our work is related to search results diversification. In order to solve this problem, we first process the user queries in both languages and secondly, we create clusters of similar images.

  7. Dependency of image quality on system configuration parameters in a stationary digital breast tomosynthesis system

    Science.gov (United States)

    Tucker, Andrew W.; Lu, Jianping; Zhou, Otto

    2013-01-01

    Purpose: In principle, a stationary digital breast tomosynthesis (s-DBT) system has better image quality when compared to continuous motion DBT systems due to zero motion blur of the source. The authors have developed a s-DBT system by using a linear carbon nanotube x-ray source array. The purpose of the current study was to quantitatively evaluate the performance of the s-DBT system; and investigate the dependence of imaging quality on the system configuration parameters. Methods: Physical phantoms were used to assess the image quality of each configuration including inplane resolution as measured by the modulation transfer function (MTF), inplane contrast as measured by the signal difference to noise ratio (SdNR), and depth resolution as measured by the z-axis artifact spread function. Five parameters were varied to create five groups of configurations: (1) total angular span; (2) total number of projection images; (3) distribution of exposure (mAs) across the projection images; (4) entrance dose; (5) detector pixel size. Results: It was found that the z-axis depth resolution increased with the total angular span but was insensitive to the number of projection images, mAs distribution, entrance dose, and detector pixel size. The SdNR was not affected by the angular span or the number of projection images. A decrease in SdNR was observed when the mAs was not evenly distributed across the projection images. As expected, the SdNR increased with entrance dose and when larger pixel sizes were used. For a given detector pixel size, the inplane resolution was found to be insensitive to the total angular span, number of projection images, mAs distribution, and entrance dose. A 25% increase in the MTF was observed when the detector was operating in full resolution mode (70 μm pixel size) compared to 2 × 2 binned mode (140 μm pixel size). Conclusions: The results suggest that the optimal imaging configuration for a s-DBT system is a large angular span, an intermittent

  8. Advances in Small Animal Imaging Systems

    International Nuclear Information System (INIS)

    Loudos, George K.

    2007-01-01

    The rapid growth in genetics and molecular biology combined with the development of techniques for genetically engineering small animals has led to an increased interest in in vivo laboratory animal imaging during the past few years. For this purpose, new instrumentation, data acquisition strategies, and image processing and reconstruction techniques are being developed, researched and evaluated. The aim of this article is to give a short overview of the state of the art technologies for high resolution and high sensitivity molecular imaging techniques, primarily positron emission tomography (PET) and single photon emission computed tomography (SPECT). The basic needs of small animal imaging will be described. The evolution in instrumentation in the past two decades, as well as the commercially available systems will be overviewed. Finally, the new trends in detector technology and preliminary results from challenging applications will be presented. For more details a number of references are provided

  9. A Gimbal-Stabilized Compact Hyperspectral Imaging System, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The Gimbal-stabilized Compact Hyperspectral Imaging System (GCHIS) fully integrates multi-sensor spectral imaging, stereovision, GPS and inertial measurement,...

  10. Intelligence, mapping, and geospatial exploitation system (IMAGES)

    Science.gov (United States)

    Moellman, Dennis E.; Cain, Joel M.

    1998-08-01

    This paper provides further detail to one facet of the battlespace visualization concept described in last year's paper Battlespace Situation Awareness for Force XXI. It focuses on the National Imagery and Mapping Agency (NIMA) goal to 'provide customers seamless access to tailorable imagery, imagery intelligence, and geospatial information.' This paper describes Intelligence, Mapping, and Geospatial Exploitation System (IMAGES), an exploitation element capable of CONUS baseplant operations or field deployment to provide NIMA geospatial information collaboratively into a reconnaissance, surveillance, and target acquisition (RSTA) environment through the United States Imagery and Geospatial Information System (USIGS). In a baseplant CONUS setting IMAGES could be used to produce foundation data to support mission planning. In the field it could be directly associated with a tactical sensor receiver or ground station (e.g. UAV or UGV) to provide near real-time and mission specific RSTA to support mission execution. This paper provides IMAGES functional level design; describes the technologies, their interactions and interdependencies; and presents a notional operational scenario to illustrate the system flexibility. Using as a system backbone an intelligent software agent technology, called Open Agent ArchitectureTM (OAATM), IMAGES combines multimodal data entry, natural language understanding, and perceptual and evidential reasoning for system management. Configured to be DII COE compliant, it would utilize, to the extent possible, COTS applications software for data management, processing, fusion, exploitation, and reporting. It would also be modular, scaleable, and reconfigurable. This paper describes how the OAATM achieves data synchronization and enables the necessary level of information to be rapidly available to various command echelons for making informed decisions. The reasoning component will provide for the best information to be developed in the timeline

  11. Performance of a video-image-subtraction-based patient positioning system

    International Nuclear Information System (INIS)

    Milliken, Barrett D.; Rubin, Steven J.; Hamilton, Russell J.; Johnson, L. Scott; Chen, George T.Y.

    1997-01-01

    Purpose: We have developed and tested an interactive video system that utilizes image subtraction techniques to enable high precision patient repositioning using surface features. We report quantitative measurements of system performance characteristics. Methods and Materials: Video images can provide a high precision, low cost measure of patient position. Image subtraction techniques enable one to incorporate detailed information contained in the image of a carefully verified reference position into real-time images. We have developed a system using video cameras providing orthogonal images of the treatment setup. The images are acquired, processed and viewed using an inexpensive frame grabber and a PC. The subtraction images provide the interactive guidance needed to quickly and accurately place a patient in the same position for each treatment session. We describe the design and implementation of our system, and its quantitative performance, using images both to measure changes in position, and to achieve accurate setup reproducibility. Results: Under clinical conditions (60 cm field of view, 3.6 m object distance), the position of static, high contrast objects could be measured with a resolution of 0.04 mm (rms) in each of two dimensions. The two-dimensional position could be reproduced using the real-time image display with a resolution of 0.15 mm (rms). Two-dimensional measurement resolution of the head of a patient undergoing treatment for head and neck cancer was 0.1 mm (rms), using a lateral view, measuring the variation in position of the nose and the ear over the course of a single radiation treatment. Three-dimensional repositioning accuracy of the head of a healthy volunteer using orthogonal camera views was less than 0.7 mm (systematic error) with an rms variation of 1.2 mm. Setup adjustments based on the video images were typically performed within a few minutes. The higher precision achieved using the system to measure objects than to reposition

  12. Low-Speed Fingerprint Image Capture System User`s Guide, June 1, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Whitus, B.R.; Goddard, J.S.; Jatko, W.B.; Manges, W.W.; Treece, D.A.

    1993-06-01

    The Low-Speed Fingerprint Image Capture System (LS-FICS) uses a Sun workstation controlling a Lenzar ElectroOptics Opacity 1000 imaging system to digitize fingerprint card images to support the Federal Bureau of Investigation`s (FBI`s) Automated Fingerprint Identification System (AFIS) program. The system also supports the operations performed by the Oak Ridge National Laboratory- (ORNL-) developed Image Transmission Network (ITN) prototype card scanning system. The input to the system is a single FBI fingerprint card of the agreed-upon standard format and a user-specified identification number. The output is a file formatted to be compatible with the National Institute of Standards and Technology (NIST) draft standard for fingerprint data exchange dated June 10, 1992. These NIST compatible files contain the required print and text images. The LS-FICS is designed to provide the FBI with the capability of scanning fingerprint cards into a digital format. The FBI will replicate the system to generate a data base of test images. The Host Workstation contains the image data paths and the compression algorithm. A local area network interface, disk storage, and tape drive are used for the image storage and retrieval, and the Lenzar Opacity 1000 scanner is used to acquire the image. The scanner is capable of resolving 500 pixels/in. in both x and y directions. The print images are maintained in full 8-bit gray scale and compressed with an FBI-approved wavelet-based compression algorithm. The text fields are downsampled to 250 pixels/in. and 2-bit gray scale. The text images are then compressed using a lossless Huffman coding scheme. The text fields retrieved from the output files are easily interpreted when displayed on the screen. Detailed procedures are provided for system calibration and operation. Software tools are provided to verify proper system operation.

  13. Effect of oblique ray on image quality of direct digitized radiography system

    International Nuclear Information System (INIS)

    Song Yuquan; Wu Xiaomei; Deng Yu; He Jianxun; Xiao Shaoping; He Zhecheng; Yu Cixi

    2005-01-01

    Objective: To evaluate the effec on image quality of DDR system caused by oblique ray. Methods: (1) Experiment group: A sphere was taken radiographes repeatedly using DDR system, the respective incidence were vertical (0 degree), 15 degree, 30 degree, 45 degree, and all images were printed into laser films. (2) Comparison group: By way of self comparing, conventional films were radio graphed under all conditions as in experiment group with screen-film system instead of flat-panel detector. (3) To evaluate the edge fog of sphere image, micro-density of image edge. Both groups were measured separately. Results: (1) The image edge fog in both experiment group and comparison group increased along with increase of X-ray incidence, the more large angle was, the more amplitude of image fog was. And the amplitude of experiment group was more distinct while with large incidence. When incidence was 45 degree, the edge fog value of experiment group went up to (0.9240±0.0033) mm, while only (0.4840±0.0033) mm of comparison group contrarily. (2) When projecting with 15 degree inclination of tube, the amplitude of variation of image edge fog in both DDR system and screen-film system had no distinct difference (P>0.05); when the lean angle were 30 degree and 45 degree, it had distinct difference (P<0.05). Conclusion: (1) The image edge fog of DDR system has no distinctly difference from screen-film system and better image gotten while the inclination of tube is vertical or small angle. (2) The amplitude of variation of image edge fog have distinctly difference that it of DDR system is visibly over screen-film system, when the inclination of tube is big, the imaging quality will be affected. (authors)

  14. Web Based Distributed Coastal Image Analysis System, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This project develops Web based distributed image analysis system processing the Moderate Resolution Imaging Spectroradiometer (MODIS) data to provide decision...

  15. Small-animal whole-body imaging using a photoacoustic full ring array system

    Science.gov (United States)

    Xia, Jun; Guo, Zijian; Aguirre, Andres; Zhu, Quing; Wang, Lihong V.

    2011-03-01

    In this report, we present a novel 3D photoacoustic computed tomography (PACT) system for small-animal whole-body imaging. The PACT system, based on a 512-element full-ring transducer array, received photoacoustic signals primarily from a 2-mm-thick slice. The light was generated by a pulse laser, and can either illuminate from the top or be reshaped to illuminate the sample from the side, using a conical lens and an optical condenser. The PACT system was capable of acquiring an in-plane image in 1.6 s; by scanning the sample in the elevational direction, a 3D tomographic image could be constructed. We tested the system by imaging a cylindrical phantom made of human hairs immersed in a scattering medium. The reconstructed image achieved an in-plane resolution of 0.1 mm and an elevational resolution of 1 mm. After deconvolution in the elevational direction, the 3D image was found to match well with the phantom. The system was also used to image a baby mouse in situ; the spinal cord and ribs can be seen easily in the reconstructed image. Our results demonstrate that the PACT system has the potential to be used for fast small-animal whole-body tomographic imaging.

  16. A real time S-parameter imaging system

    International Nuclear Information System (INIS)

    Naik, P.S.; Cheung, C.K.; Beling, C.D.; Fung, S.

    2005-01-01

    Obtaining a lateral S-parameter image scan from positrons implanted into semiconductor devices can be a helpful research tool both for localizing device structures and in diagnosing defect patterns that could help interpret function. S-parameter images can be obtained by electromagnetically rastering a variable energy positron beam of small spot size across the sample. Here we describe a general hardware and software architecture of relatively low cost that has recently been developed in our laboratory which allows the whole sub-surface S-parameter image of a sample or device to be obtained in real time. This system has the advantage over more conventional sequential scanning techniques of allowing the operator to terminate data collection once the quality of the image is deemed sufficient. As an example of the usefulness of this type of imaging architecture, S-parameter images of a representative sample are presented at two different position implantation energies. (author)

  17. Nondestructive Imaging of an Object Using the Compact Continuous-Wave Sub-Terahertz Imaging System

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Jin Seok; Kwon, Il Bub; Yoon, Dong Jin; Seo, Dae Cheol [Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of)

    2010-08-15

    This paper presented compact CW sub-THz imaging system using the terahertz transmitter(Tx) that generating 0.34 THz electromagnetic wave on based electronic device. Using 0.34 THz electromagnetic wave generated by Tx, we transmitted to sample by point by point scan method and measured transmitting terahertz wave magnitude and phase information respectively with terahertz receiver(Rx) based on sub harmonic mixer. This paper measured and compared images of several samples to obtain better imaging results by changing time delay and step distance of scanning stage which affect image resolution. Also, through the imaging measurement of various samples, we were able to assure possibility of application of terahertz wave

  18. Nondestructive Imaging of an Object Using the Compact Continuous-Wave Sub-Terahertz Imaging System

    International Nuclear Information System (INIS)

    Jang, Jin Seok; Kwon, Il Bub; Yoon, Dong Jin; Seo, Dae Cheol

    2010-01-01

    This paper presented compact CW sub-THz imaging system using the terahertz transmitter(Tx) that generating 0.34 THz electromagnetic wave on based electronic device. Using 0.34 THz electromagnetic wave generated by Tx, we transmitted to sample by point by point scan method and measured transmitting terahertz wave magnitude and phase information respectively with terahertz receiver(Rx) based on sub harmonic mixer. This paper measured and compared images of several samples to obtain better imaging results by changing time delay and step distance of scanning stage which affect image resolution. Also, through the imaging measurement of various samples, we were able to assure possibility of application of terahertz wave

  19. Phantom evaluation of a commercially available three modality image guided radiation therapy system

    International Nuclear Information System (INIS)

    Ploquin, Nicolas; Rangel, Alejandra; Dunscombe, Peter

    2008-01-01

    The authors describe a detailed evaluation of the capabilities of imaging and image registration systems available with Varian linear accelerators for image guided radiation therapy (IGRT). Specifically, they present modulation transfer function curves for megavoltage planar, kilovoltage (kV) planar, and cone beam computed tomography imaging systems and compare these with conventional computed tomography. While kV planar imaging displayed the highest spatial resolution, all IGRT imaging techniques were assessed as adequate for their intended purpose. They have also characterized the image registration software available for use in conjunction with these imaging systems through a comprehensive phantom study involving translations in three orthogonal directions. All combinations of imaging systems and image registration software were found to be accurate, although the planar kV imaging system with automatic registration was generally superior, with both accuracy and precision of the order of 1 mm, under the conditions tested. Based on their phantom study, the attainable accuracy for rigid body translations using any of the features available with Varian equipment will more likely be limited by the resolution of the couch readouts than by inherent limitations in the imaging systems and image registration software. Overall, the accuracy and precision of currently available IGRT technology exceed published experience with the accuracy and precision of contouring for planning.

  20. Microwave Breast Imaging System Prototype with Integrated Numerical Characterization

    Directory of Open Access Journals (Sweden)

    Mark Haynes

    2012-01-01

    Full Text Available The increasing number of experimental microwave breast imaging systems and the need to properly model them have motivated our development of an integrated numerical characterization technique. We use Ansoft HFSS and a formalism we developed previously to numerically characterize an S-parameter- based breast imaging system and link it to an inverse scattering algorithm. We show successful reconstructions of simple test objects using synthetic and experimental data. We demonstrate the sensitivity of image reconstructions to knowledge of the background dielectric properties and show the limits of the current model.

  1. Occupational and patient exposure as well as image quality for full spine examinations with the EOS imaging system

    International Nuclear Information System (INIS)

    Damet, J.; Fournier, P.; Monnin, P.; Sans-Merce, M.; Verdun, F. R.; Baechler, S.; Ceroni, D.; Zand, T.

    2014-01-01

    Purpose: EOS (EOS imaging S.A, Paris, France) is an x-ray imaging system that uses slot-scanning technology in order to optimize the trade-off between image quality and dose. The goal of this study was to characterize the EOS system in terms of occupational exposure, organ doses to patients as well as image quality for full spine examinations. Methods: Occupational exposure was determined by measuring the ambient dose equivalents in the radiological room during a standard full spine examination. The patient dosimetry was performed using anthropomorphic phantoms representing an adolescent and a five-year-old child. The organ doses were measured with thermoluminescent detectors and then used to calculate effective doses. Patient exposure with EOS was then compared to dose levels reported for conventional radiological systems. Image quality was assessed in terms of spatial resolution and different noise contributions to evaluate the detector's performances of the system. The spatial-frequency signal transfer efficiency of the imaging system was quantified by the detective quantum efficiency (DQE). Results: The use of a protective apron when the medical staff or parents have to stand near to the cubicle in the radiological room is recommended. The estimated effective dose to patients undergoing a full spine examination with the EOS system was 290μSv for an adult and 200 μSv for a child. MTF and NPS are nonisotropic, with higher values in the scanning direction; they are in addition energy-dependent, but scanning speed independent. The system was shown to be quantum-limited, with a maximum DQE of 13%. The relevance of the DQE for slot-scanning system has been addressed. Conclusions: As a summary, the estimated effective dose was 290μSv for an adult; the image quality remains comparable to conventional systems

  2. Occupational and patient exposure as well as image quality for full spine examinations with the EOS imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Damet, J., E-mail: jerome.damet@chuv.ch; Fournier, P.; Monnin, P.; Sans-Merce, M.; Verdun, F. R.; Baechler, S. [Institute of Radiation Physics, Lausanne University Hospital, Lausanne 1007 (Switzerland); Ceroni, D. [Department of Paediatrics, Division of paediatric orthopaedic, University Hospitals of Geneva, Geneva 1205 (Switzerland); Zand, T. [Department of Radiology, Division of paediatric radiology, University Hospitals of Geneva, Geneva 1205 (Switzerland)

    2014-06-15

    Purpose: EOS (EOS imaging S.A, Paris, France) is an x-ray imaging system that uses slot-scanning technology in order to optimize the trade-off between image quality and dose. The goal of this study was to characterize the EOS system in terms of occupational exposure, organ doses to patients as well as image quality for full spine examinations. Methods: Occupational exposure was determined by measuring the ambient dose equivalents in the radiological room during a standard full spine examination. The patient dosimetry was performed using anthropomorphic phantoms representing an adolescent and a five-year-old child. The organ doses were measured with thermoluminescent detectors and then used to calculate effective doses. Patient exposure with EOS was then compared to dose levels reported for conventional radiological systems. Image quality was assessed in terms of spatial resolution and different noise contributions to evaluate the detector's performances of the system. The spatial-frequency signal transfer efficiency of the imaging system was quantified by the detective quantum efficiency (DQE). Results: The use of a protective apron when the medical staff or parents have to stand near to the cubicle in the radiological room is recommended. The estimated effective dose to patients undergoing a full spine examination with the EOS system was 290μSv for an adult and 200 μSv for a child. MTF and NPS are nonisotropic, with higher values in the scanning direction; they are in addition energy-dependent, but scanning speed independent. The system was shown to be quantum-limited, with a maximum DQE of 13%. The relevance of the DQE for slot-scanning system has been addressed. Conclusions: As a summary, the estimated effective dose was 290μSv for an adult; the image quality remains comparable to conventional systems.

  3. A Hybrid DWT-SVD Image-Coding System (HDWTSVD for Color Images

    Directory of Open Access Journals (Sweden)

    Humberto Ochoa

    2003-04-01

    Full Text Available In this paper, we propose the HDWTSVD system to encode color images. Before encoding, the color components (RGB are transformed into YCbCr. Cb and Cr components are downsampled by a factor of two, both horizontally and vertically, before sending them through the encoder. A criterion based on the average standard deviation of 8x8 subblocks of the Y component is used to choose DWT or SVD for all the components. Standard test images are compressed based on the proposed algorithm.

  4. Influence of Atmospheric Propagation on Performance of Laser Active Imaging System

    International Nuclear Information System (INIS)

    Li Yingchun; Sun Huayan; Guo Huichao; Zhao Yun

    2011-01-01

    Atmospheric propagation has serious influence on the performance of a good designed laser active imaging system. Atmospheric attenuation and turbulence are two main effects on laser atmospheric propagation. Imaging SNR (Signal-Noise-Ratio) and resolution are two key indexes to describe the performance of a laser active imaging system. Establishing the relation between system performance index and atmospheric propagation effect is significant. The paper analyzed the relation between imaging performance and atmospheric attenuation and turbulence through simulation. And also the experiments were done under different weather to validate the conclusion of simulation.

  5. Real-Time Implementation of Medical Ultrasound Strain Imaging System

    International Nuclear Information System (INIS)

    Jeong, Mok Kun; Kwon, Sung Jae; Bae, Moo Ho

    2008-01-01

    Strain imaging in a medical ultrasound imaging system can differentiate the cancer or tumor in a lesion that is stiffer than the surrounding tissue. In this paper, a strain imaging technique using quasistatic compression is implemented that estimates the displacement between pre- and postcompression ultrasound echoes and obtains strain by differentiating it in the spatial direction. Displacements are computed from the phase difference of complex baseband signals obtained using their autocorrelation, and errors associated with converting the phase difference into time or distance are compensated for by taking into the center frequency variation. Also, to reduce the effect of operator's hand motion, the displacements of all scanlines are normalized with the result that satisfactory strain image quality has been obtained. These techniques have been incorporated into implementing a medical ultrasound strain imaging system that operates in real time.

  6. Toward a unified view of radiological imaging systems. Part II: Noisy images

    International Nuclear Information System (INIS)

    Wagner, R.F.

    1977-01-01

    ''The imaging process is fundamentally a sampling process.'' This philosophy of Otto Schade, utilizing the concepts of sample number and sampling aperture, is applied to a systems analysis of radiographic imaging, including some aspects of vision. It leads to a simple modification of the Rose statistical model; this results in excellent fits to the Blackwell data on the detectability of disks as a function of contrast and size. It gives a straightforward prescription for calculating a signal-to-noise ratio, which is applicable to the detection of low-contrast detail in screen--film imaging, including the effects of magnification. The model lies between the optimistic extreme of the Rose model and the pessimistic extreme of the Morgan model. For high-contrast detail, the rules for the evaluation of noiseless images are recovered

  7. The Use of QBIC Content-Based Image Retrieval System

    Directory of Open Access Journals (Sweden)

    Ching-Yi Wu

    2004-03-01

    Full Text Available The fast increase in digital images has caught increasing attention on the development of image retrieval technologies. Content-based image retrieval (CBIR has become an important approach in retrieving image data from a large collection. This article reports our results on the use and users study of a CBIR system. Thirty-eight students majored in art and design were invited to use the IBM’s OBIC (Query by Image Content system through the Internet. Data from their information needs, behaviors, and retrieval strategies were collected through an in-depth interview, observation, and self-described think-aloud process. Important conclusions are:(1)There are four types of information needs for image data: implicit, inspirational, ever-changing, and purposive. The types of needs may change during the retrieval process. (2)CBIR is suitable for the example-type query, text retrieval is suitable for the scenario-type query, and image browsing is suitable for the symbolic query. (3)Different from text retrieval, detailed description of the query condition may lead to retrieval failure more easily. (4)CBIR is suitable for the domain-specific image collection, not for the images on the Word-Wide Web.[Article content in Chinese

  8. Stellar Image Interpretation System using Artificial Neural Networks: Unipolar Function Case

    Directory of Open Access Journals (Sweden)

    F. I. Younis

    2001-01-01

    Full Text Available An artificial neural network based system for interpreting astronomical images has been developed. The system is based on feed-forward Artificial Neural Networks (ANNs with error back-propagation learning. Knowledge about images of stars, cosmic ray events and noise found in images is used to prepare two sets of input patterns to train and test our approach. The system has been developed and implemented to scan astronomical digital images in order to segregate stellar images from other entities. It has been coded in C language for users of personal computers. An astronomical image of a star cluster from other objects is undertaken as a test case. The obtained results are found to be in very good agreement with those derived from the DAOPHOTII package, which is widely used in the astronomical community. It is proved that our system is simpler, much faster and more reliable. Moreover, no prior knowledge, or initial data from the frame to be analysed is required.

  9. A Time of Flight Fast Neutron Imaging System Design Study

    Science.gov (United States)

    Canion, Bonnie; Glenn, Andrew; Sheets, Steven; Wurtz, Ron; Nakae, Les; Hausladen, Paul; McConchie, Seth; Blackston, Matthew; Fabris, Lorenzo; Newby, Jason

    2017-09-01

    LLNL and ORNL are designing an active/passive fast neutron imaging system that is flexible to non-ideal detector positioning. It is often not possible to move an inspection object in fieldable imager applications such as safeguards, arms control treaty verification, and emergency response. Particularly, we are interested in scenarios which inspectors do not have access to all sides of an inspection object, due to interfering objects or walls. This paper will present the results of a simulation-based design parameter study, that will determine the optimum system design parameters for a fieldable system to perform time-of-flight based imaging analysis. The imaging analysis is based on the use of an associated particle imaging deuterium-tritium (API DT) neutron generator to get the time-of-flight of radiation induced within an inspection object. This design study will investigate the optimum design parameters for such a system (e.g. detector size, ideal placement, etc.), as well as the upper and lower feasible design parameters that the system can expect to provide results within a reasonable amount of time (e.g. minimum/maximum detector efficiency, detector standoff, etc.). Ideally the final prototype from this project will be capable of using full-access techniques, such as transmission imaging, when the measurement circumstances allow, but with the additional capability of producing results at reduced accessibility.

  10. The characterization of an economic and portable LED-based photoacoustic imaging system to facilitate molecular imaging.

    Science.gov (United States)

    Hariri, Ali; Lemaster, Jeanne; Wang, Junxin; Jeevarathinam, AnanthaKrishnan S; Chao, Daniel L; Jokerst, Jesse V

    2018-03-01

    Photoacoustic imaging (PAI) is a non-invasive, high-resolution hybrid imaging modality that combines optical excitation and ultrasound detection. PAI can image endogenous chromophores (melanin, hemoglobin, etc.) and exogenous contrast agents in different medical applications. However, most current equipment uses sophisticated and complicated OPO lasers with tuning and stability features inconsistent with broad clinical deployment. As the number of applications of PAI in medicine increases, there is an urgent need to make the imaging equipment more compact, portable, and affordable. Here, portable light emitting diode - based photoacoustic imaging (PLED-PAI) was introduced and characterized in terms of system specifications, light source characterizations, photoacoustic spatial/temporal resolution, and penetration. The system uses two LED arrays attached to the sides of a conventional ultrasound transducer. The LED pulse repetition rate is tunable between 1 K Hz, 2 K Hz, 3 K Hz, and 4 K Hz. The axial resolution was 0.268 mm, and the lateral resolution was between 0.55 and 0.59 mm. The system could detect optical absorber (pencil lead) at a depth of 3.2 cm and the detection limits of indocyanine green (ICG) and methylene blue (MB) were 9 μM and 0.78 mM. In vivo imaging of labeled human mesenchymal stem cells was achieved to confirm compatibility with small animal imaging. The characterization we report here may have value to other groups evaluating commercially available photoacoustic imaging equipment.

  11. Self-imaging in first-order optical systems

    NARCIS (Netherlands)

    Alieva, T.; Bastiaans, M.J.; Nijhawan, O.P.; Guota, A.K.; Musla, A.K.; Singh, Kehar

    1998-01-01

    The structure and main properties of coherent and partially coherent optical fields that are self-reproducible under propagation through a first-order optical system are investigated. A phase space description of self-imaging in first-order optical systems is presented. The Wigner distribution

  12. Expandable image compression system: A modular approach

    International Nuclear Information System (INIS)

    Ho, B.K.T.; Chan, K.K.; Ishimitsu, Y.; Lo, S.C.; Huang, H.K.

    1987-01-01

    The full-frame bit allocation algorithm for radiological image compression developed in the authors' laboratory can achieve compression ratios as high as 30:1. The software development and clinical evaluation of this algorithm has been completed. It involves two stages of operations: a two-dimensional discrete cosine transform and pixel quantization in the transform space with pixel depth kept accountable by a bit allocation table. Their design took an expandable modular approach based on the VME bus system which has a maximum data transfer rate of 48 Mbytes per second and a Motorola 68020 microprocessor as the master controller. The transform modules are based on advanced digital signal processor (DSP) chips microprogrammed to perform fast cosine transforms. Four DSP's built into a single-board transform module can process an 1K x 1K image in 1.7 seconds. Additional transform modules working in parallel can be added if even greater speeds are desired. The flexibility inherent in the microcode extends the capabilities of the system to incorporate images of variable sizes. Their design allows for a maximum image size of 2K x 2K

  13. MR imaging system evaluation and quality assurance using a new phantom set

    International Nuclear Information System (INIS)

    Tsui, B.M.W.; Jaszczak, R.J.; Todd-Pokropek, A.E.; Jaszczak, N.J.

    1986-01-01

    A phantom set with interchangeable modular inserts was used in the evaluation of a number of MR imaging systems. The system characteristics measured included uniformity, linearity and distortion of the image field, thickness and profile of an image section, spatial resolution, pixel calibration, signal-to-noise ratio, and variations of contiguous section thicknesses and section-to-section separations in multiple-section imaging. Also evaluated were the accuracy in quantitative measurement of MR imaging parameters and oblique angle measurement capability. Based on these measurements, protocols for MR imaging system evaluation, acceptance testing, and quality assurance were developed

  14. SPECIAL ASPECTS OF INITIAL OPTICAL SCHEME SELECTION FOR DESIGN OF NON-IMAGING OPTICAL SYSTEMS

    Directory of Open Access Journals (Sweden)

    R. V. Anitropov

    2016-01-01

    Full Text Available Subject of Research. The research results, structural composition analysis and the parametric synthesis of the projected imaging and non-imaging optical systems were presented. We made an attempt to use the gained experience about imaging systems while designing non-imaging systems, by adapting the composition theory for the calculations of non-imaging systems. Several patterns were revealed, which provide a deeper understanding of the design process of non-imaging optical systems; measures of its optimization were proposed. Method. We investigated the applicability of the theory of composition and synthesis of non-imaging optical systems. The main provisions of the theory of composition are based on the division of all available optical elements in four types depending on their functionality, which corresponds to a modular design. Similar items were identified in non-imaging optical systems and adaptation of composition theory to their design became possible. Main Results. General design patterns of imaging and non-imaging optical systems were studied. Classification of systems, components, as well as technical and generic characteristics of imaging and non-imaging optical systems was determined. Search mechanism of the initial optical system by means of structural and parametric synthesis of non-imaging optical system was formalized. The basic elements were determined included in non-imaging systems and their classification by functionality was done. They were subdivided into basic, corrective, wide angle and high aperture ones. The rules for formation of these elements and their composition were determined: surface reflecting, refracting, spherical and nonspherical elements with total internal reflection. The foundations of composition theory for non-imaging optical systems were laid. The approbation of this method was carried out on the example of the illumination system calculation for surgical room. A 3D model of an illumination optical

  15. Progress and monitoring system on compression and transmission technologies of dynamic image

    International Nuclear Information System (INIS)

    Kobayashi, Hiroyuki; Saijo, Nobuyuki; Nakajo, Ken

    2001-01-01

    The Toshiba Corporation developed a real-time dynamic image transmission matched with quality of transmission circuit by using MPEG-4 which was recent international standard system for the dynamic image coding system. Concretely, this system made possible on real-time dynamic image transmission even at transmission on wireless circuit such as portable telephone, PHS, wireless LAN, and so on, at viewpoint of the mobile communication. And, by using the wireless circuit, it could be built without any limit of transmission cable, to realize its layout-free establishment. In addition, this system uses only image for communication without using voice, and some devices were carried out to upgrade image and frame speed as possible. Here were described on outlines of transmission system and principle of detection MPEG-4, and function and application of monitoring system using this system. (G.K.)

  16. Monte Carlo modeling of neutron and gamma-ray imaging systems

    International Nuclear Information System (INIS)

    Hall, J.

    1996-04-01

    Detailed numerical prototypes are essential to design of efficient and cost-effective neutron and gamma-ray imaging systems. We have exploited the unique capabilities of an LLNL-developed radiation transport code (COG) to develop code modules capable of simulating the performance of neutron and gamma-ray imaging systems over a wide range of source energies. COG allows us to simulate complex, energy-, angle-, and time-dependent radiation sources, model 3-dimensional system geometries with ''real world'' complexity, specify detailed elemental and isotopic distributions and predict the responses of various types of imaging detectors with full Monte Carlo accuray. COG references detailed, evaluated nuclear interaction databases allowingusers to account for multiple scattering, energy straggling, and secondary particle production phenomena which may significantly effect the performance of an imaging system by may be difficult or even impossible to estimate using simple analytical models. This work presents examples illustrating the use of these routines in the analysis of industrial radiographic systems for thick target inspection, nonintrusive luggage and cargoscanning systems, and international treaty verification

  17. Development of a Dual-Particle Imaging System for Nonproliferation Applications

    Science.gov (United States)

    Poitrasson-Riviere, Alexis Pierre Valere

    A rising concern in our society is preventing the proliferation of nuclear weapons and fissionable material. This prevention can be incorporated at multiple levels, from the use of nuclear safeguards in nuclear facilities to the detection of threat objects in the field. At any level, systems used for such tasks need to be specially designed for use with Special Nuclear Material (SNM) which is defined by the NRC as plutonium and uranium enriched in U-233 or U-235 isotopes. These radioactive materials have the particularity of emitting both fast neutrons and gamma rays; thus, systems able to detect both particles simultaneously are particularly desirable. In the field of nuclear nonproliferation and safeguards, detection systems capable of accurately imaging various sources of radiation can greatly simplify any monitoring or detection task. The localization of the radiation sources can allow users of the system to focus their efforts on the areas of interest, whether it be for radiation detection or radiation characterization. This thesis describes the development of a dual-particle imaging system at the University of Michigan to address these technical challenges. The imaging system relies on the use of organic liquid scintillators that can detect both fast neutrons and gamma rays, and inorganic NaI(Tl) scintillators that are not very sensitive to neutrons yet yield photoelectric absorptions from gamma rays. A prototype of the imaging system has been constructed and operated. The system will aid the remote monitoring of nuclear materials within facilities, and it has the scalability for standoff detection in the field. A software suite has been developed to analyze measured data in real time, in an effort to obtain a system as close to field-ready as possible. The system's performance has been tested with various materials of interest, such as MOX and plutonium metal, measured at the PERLA facility of the Joint Research Center in Ispra, Italy. The robust and

  18. Molecular Imaging with Activatable Reporter Systems

    Directory of Open Access Journals (Sweden)

    Gang Niu, Xiaoyuan Chen

    2012-01-01

    Full Text Available Molecular imaging is a newly emerged multiple disciplinary field that aims to visualize, characterize and quantitatively measure biological processes at cellular and molecular levels in humans and other living systems. A reporter gene is a piece of DNA encoding reporter protein, which presents as a readily measurable phenotype that can be distinguished easily from the background of endogenous protein. After being transferred into cells of organ systems (transgenes, the reporter gene can be utilized to visualize transcriptional and posttranscriptional regulation of gene expression, protein-protein interactions, or trafficking of proteins or cells in living subjects. Herein, we review previous classification of reporter genes and regroup the reporter gene based imaging as basic, inducible and activatable, based on the regulation of reporter gene transcription and post-translational modification of reporter proteins. We then focus on activatable reporters, in which the signal can be activated at the posttranslational level for visualizing protein-protein interactions, protein phosphorylation or tertiary structure changes. The applications of several types of activatable reporters will also be summarized. We conclude that activatable reporter imaging can benefit both basic biomedical research and drug development.

  19. Calibration, Projection, and Final Image Products of MESSENGER's Mercury Dual Imaging System

    Science.gov (United States)

    Denevi, Brett W.; Chabot, Nancy L.; Murchie, Scott L.; Becker, Kris J.; Blewett, David T.; Domingue, Deborah L.; Ernst, Carolyn M.; Hash, Christopher D.; Hawkins, S. Edward; Keller, Mary R.; Laslo, Nori R.; Nair, Hari; Robinson, Mark S.; Seelos, Frank P.; Stephens, Grant K.; Turner, F. Scott; Solomon, Sean C.

    2018-02-01

    We present an overview of the operations, calibration, geodetic control, photometric standardization, and processing of images from the Mercury Dual Imaging System (MDIS) acquired during the orbital phase of the MESSENGER spacecraft's mission at Mercury (18 March 2011-30 April 2015). We also provide a summary of all of the MDIS products that are available in NASA's Planetary Data System (PDS). Updates to the radiometric calibration included slight modification of the frame-transfer smear correction, updates to the flat fields of some wide-angle camera (WAC) filters, a new model for the temperature dependence of narrow-angle camera (NAC) and WAC sensitivity, and an empirical correction for temporal changes in WAC responsivity. Further, efforts to characterize scattered light in the WAC system are described, along with a mosaic-dependent correction for scattered light that was derived for two regional mosaics. Updates to the geometric calibration focused on the focal lengths and distortions of the NAC and all WAC filters, NAC-WAC alignment, and calibration of the MDIS pivot angle and base. Additionally, two control networks were derived so that the majority of MDIS images can be co-registered with sub-pixel accuracy; the larger of the two control networks was also used to create a global digital elevation model. Finally, we describe the image processing and photometric standardization parameters used in the creation of the MDIS advanced products in the PDS, which include seven large-scale mosaics, numerous targeted local mosaics, and a set of digital elevation models ranging in scale from local to global.

  20. SPECIAL ASPECTS OF INITIAL OPTICAL SCHEME SELECTION FOR DESIGN OF NON-IMAGING OPTICAL SYSTEMS

    OpenAIRE

    R. V. Anitropov; P. Benitez; I. L. Livshits S. K. Stafeev; S. K. Stafeev; V. N. Vasilev; M. V. Letunovskaya; A. S. Zaitceva

    2016-01-01

    Subject of Research. The research results, structural composition analysis and the parametric synthesis of the projected imaging and non-imaging optical systems were presented. We made an attempt to use the gained experience about imaging systems while designing non-imaging systems, by adapting the composition theory for the calculations of non-imaging systems. Several patterns were revealed, which provide a deeper understanding of the design process of non-imaging optical systems; measures ...

  1. X-ray imaging system

    International Nuclear Information System (INIS)

    Houston, J.M.

    1980-01-01

    A novel, high-speed apparatus for use in X-ray computerised tomography is described in detail. It consists of a semi-circular array of X-ray sources, collimators and an ion chamber array for detection of the X-rays. The X-ray sources may be pulsed in salvos such that the corresponding detectors in the array are only illuminated by one source. The use of computer controlled salvos speeds up the image processing by at least a factor of two. The ion chamber array is designed to have a constant detection efficiency for varying angles of X-ray incidence. A detailed description of the detector construction and suggested gaseous fillings are given. It is claimed that the present tomographic system allows fast and accurate imaging of internal body organs and is insensitive to the blurring effects which motion of these organs tends to produce. (UK)

  2. Introduction of Renal Key Performance Indicators Associated with Increased Uptake of Peritoneal Dialysis in a Publicly Funded Health Service.

    Science.gov (United States)

    Toussaint, Nigel D; McMahon, Lawrence P; Dowling, Gregory; Holt, Stephen G; Smith, Gillian; Safe, Maria; Knight, Richard; Fair, Kathleen; Linehan, Leanne; Walker, Rowan G; Power, David A

    2017-01-01

    ♦ BACKGROUND: Increased demand for treatment of end-stage kidney disease has largely been accommodated by a costly increase in satellite hemodialysis (SHD) in most jurisdictions. In the Australian State of Victoria, a marked regional variation in the uptake of home-based dialysis suggests that use of home therapies could be increased as an alternative to SHD. An earlier strategy based solely on increased remuneration had failed to increase uptake of home therapies. Therefore, the public dialysis funder adopted the incidence and prevalence of home-based dialysis therapies as a key performance indicator (KPI) for its health services to encourage greater uptake of home therapies. ♦ METHODS: A KPI data collection and bench-marking program was established in 2012 by the Victorian Department of Health and Human Services, with data provided monthly by all renal units in Victoria using a purpose-designed website portal. A KPI Working Group was responsible for analyzing data each quarter and ensuring indicators remained accurate and relevant and each KPI had clear definitions and targets. We present a prospective, observational study of all dialysis patients in Victoria over a 4-year period following the introduction of the renal KPI program, with descriptive analyses to evaluate the proportion of patients using home therapies as well as home dialysis modality survival. ♦ RESULTS: Following the introduction of the KPI program, the net growth of dialysis patient numbers in Victoria remained stable over 4 years, at 75 - 80 per year (approximately 4%). However, unlike the previous decade, about 40% of this growth was through an increase in home dialysis, which was almost exclusively peritoneal dialysis (PD). The increase was identified particularly in the young (20 - 49) and the elderly (> 80). Disappointingly, however, 67% of these incident patients ceased PD within 2 years of commencement, 46% of whom transferred to SHD. ♦ CONCLUSIONS: Introduction of a KPI program

  3. Ultra-high-resolution photoelectronic digital radiographic imaging system for medicine

    International Nuclear Information System (INIS)

    Bamford, B.R.; Nudelman, S.; Quimette, D.R.; Ovitt, T.W.; Reisken, A.B.; Spackman, T.J.; Zaccheo, T.S.

    1989-01-01

    The authors report the development of a new type of digital radiographic imaging system for medicine. Unlike previous digital radiographic systems that could not match the spatial resolution of film-screen systems, this system has higher spatial resolution and wider dynamic range than film-screen-based systems. There are three components to the system: a microfocal spot x-ray tube, a camera consisting of a Tektronix TK-2048M 2048 x 2048 CCD image sensor in direct contact with a Kodak Min-R intensifying screen, and a Gould IP-9000 with 2048 x 2048 processing and display capabilities. The CCD image sensor is a large-area integrated circuit and is 55.3 mm x 55.3 mm. It has a linear dynamic range of 12 bits or 4,096 gray levels

  4. A portable fluorescence microscopic imaging system for cholecystectomy

    Science.gov (United States)

    Ye, Jian; Yang, Chaoyu; Gan, Qi; Ma, Rong; Zhang, Zeshu; Chang, Shufang; Shao, Pengfei; Zhang, Shiwu; Liu, Chenhai; Xu, Ronald

    2016-03-01

    In this paper we proposed a portable fluorescence microscopic imaging system to prevent iatrogenic biliary injuries from occurring during cholecystectomy due to misidentification of the cystic structures. The system consisted of a light source module, a CMOS camera, a Raspberry Pi computer and a 5 inch HDMI LCD. Specifically, the light source module was composed of 690 nm and 850 nm LEDs, allowing the CMOS camera to simultaneously acquire both fluorescence and background images. The system was controlled by Raspberry Pi using Python programming with the OpenCV library under Linux. We chose Indocyanine green(ICG) as a fluorescent contrast agent and then tested fluorescence intensities of the ICG aqueous solution at different concentration levels by our fluorescence microscopic system compared with the commercial Xenogen IVIS system. The spatial resolution of the proposed fluorescence microscopic imaging system was measured by a 1951 USAF resolution target and the dynamic response was evaluated quantitatively with an automatic displacement platform. Finally, we verified the technical feasibility of the proposed system in mouse models of bile duct, performing both correct and incorrect gallbladder resection. Our experiments showed that the proposed system can provide clear visualization of the confluence between the cystic duct and common bile duct or common hepatic duct, suggesting that this is a potential method for guiding cholecystectomy. The proposed portable system only cost a total of $300, potentially promoting its use in resource-limited settings.

  5. Towards eye-safe standoff Raman imaging systems

    Science.gov (United States)

    Glimtoft, Martin; Bââth, Petra; Saari, Heikki; Mäkynen, Jussi; Näsilä, Antti; Östmark, Henric

    2014-05-01

    Standoff Raman imaging systems have shown the ability to detect single explosives particles. However, in many cases, the laser intensities needed restrict the applications where they can be safely used. A new generation imaging Raman system has been developed based on a 355 nm UV laser that, in addition to eye safety, allows discrete and invisible measurements. Non-dangerous exposure levels for the eye are several orders of magnitude higher in UVA than in the visible range that previously has been used. The UV Raman system has been built based on an UV Fabry-Perot Interferometer (UV-FPI) developed by VTT. The design allows for precise selection of Raman shifts in combination with high out-of-band blocking. The stable operation of the UV-FPI module under varying environmental conditions is arranged by controlling the temperature of the module and using a closed loop control of the FPI air gap based on capacitive measurement. The system presented consists of a 3rd harmonics Nd:YAG laser with 1.5 W average output at 1000 Hz, a 200 mm Schmidt-Cassegrain telescope, UV-FPI filter and an ICCD camera for signal gating and detection. The design principal leads to a Raman spectrum in each image pixel. The system is designed for field use and easy manoeuvring. Preliminary results show that in measurements of <60 s on 10 m distance, single AN particles of <300 μm diameter can be identified.

  6. Symmetries of the 2D magnetic particle imaging system matrix

    International Nuclear Information System (INIS)

    Weber, A; Knopp, T

    2015-01-01

    In magnetic particle imaging (MPI), the relation between the particle distribution and the measurement signal can be described by a linear system of equations. For 1D imaging, it can be shown that the system matrix can be expressed as a product of a convolution matrix and a Chebyshev transformation matrix. For multidimensional imaging, the structure of the MPI system matrix is not yet fully explored as the sampling trajectory complicates the physical model. It has been experimentally found that the MPI system matrix rows have symmetries and look similar to the tensor products of Chebyshev polynomials. In this work we will mathematically prove that the 2D MPI system matrix has symmetries that can be used for matrix compression. (paper)

  7. Picture archiving and communications systems in radiation oncology (PACSRO): tools for a physician-based digital image review system

    International Nuclear Information System (INIS)

    McGee, K.P.; Das, I.J.; Fein, D.A.; Martin, E.E.; Schultheiss, T.E.; Hanks, G.E.

    1995-01-01

    Digital imaging is becoming more and more important in the diagnosis, staging, and treatment of patients in radiation oncology. In order to facilitate the most efficient interface of this technology to physicians and other users of this information, a medical image display system (MID) has been developed at the Fox Chase Cancer Center (FCCC). The system runs on 20 personal computers situated in physicians offices as well as a modified system located in the radiation oncology conference room. Access to CT, MRI, and EPID information is achieved through an Ethernet connection to the hospital picture archiving and communications system (PACS). Over a 1-year period a total of 503 patients and 3845 images have been stored on the system. Physician approval using the MID system (without conventional films) was performed on 106 patients. Of these, 22%, 16%, 11%, 10%, and 9% consisted of breast, prostate, pelvic, lung, and head and neck patients, respectively. Digital images sent from a variety of image sources to the MID system take up to 15 s to process and format while image access and display can take 2-5 s, dependent upon image size and speed of the host computer

  8. Modulation transfer function cascade model for a sampled IR imaging system.

    Science.gov (United States)

    de Luca, L; Cardone, G

    1991-05-01

    The performance of the infrared scanning radiometer (IRSR) is strongly stressed in convective heat transfer applications where high spatial frequencies in the signal that describes the thermal image are present. The need to characterize more deeply the system spatial resolution has led to the formulation of a cascade model for the evaluation of the actual modulation transfer function of a sampled IR imaging system. The model can yield both the aliasing band and the averaged modulation response for a general sampling subsystem. For a line scan imaging system, which is the case of a typical IRSR, a rule of thumb that states whether the combined sampling-imaging system is either imaging-dependent or sampling-dependent is proposed. The model is tested by comparing it with other noncascade models as well as by ad hoc measurements performed on a commercial digitized IRSR.

  9. A high-resolution optical imaging system for obtaining the serial transverse section images of biologic tissue

    Science.gov (United States)

    Wu, Li; Zhang, Bin; Wu, Ping; Liu, Qian; Gong, Hui

    2007-05-01

    A high-resolution optical imaging system was designed and developed to obtain the serial transverse section images of the biologic tissue, such as the mouse brain, in which new knife-edge imaging technology, high-speed and high-sensitive line-scan CCD and linear air bearing stages were adopted and incorporated with an OLYMPUS microscope. The section images on the tip of the knife-edge were synchronously captured by the reflection imaging in the microscope while cutting the biologic tissue. The biologic tissue can be sectioned at interval of 250 nm with the same resolution of the transverse section images obtained in x and y plane. And the cutting job can be automatically finished based on the control program wrote specially in advance, so we save the mass labor of the registration of the vast images data. In addition, by using this system a larger sample can be cut than conventional ultramicrotome so as to avoid the loss of the tissue structure information because of splitting the tissue sample to meet the size request of the ultramicrotome.

  10. Origin and Quenching of Novel ultraviolet and blue emission in NdGaO3: Concept of Super-Hydrogenic Dopants.

    Science.gov (United States)

    Ghosh, Siddhartha; Saha, Surajit; Liu, Zhiqi; Motapothula, M; Patra, Abhijeet; Yakovlev, Nikolai; Cai, Yao; Prakash, Saurav; Huang, Xiao Hu; Tay, Chuan Beng; Cong, Chun Xiao; Bhatt, Thirumaleshwara; Dolmanan, Surani B; Chen, Jianqiang; Lü, Weiming; Huang, Zhen; Tripathy, Sudhiranjan; Chua, Soo Jin; Yu, Ting; Asta, Mark; Ariando, A; Venkatesan, T

    2016-11-03

    In this study we report the existence of novel ultraviolet (UV) and blue emission in rare-earth based perovskite NdGaO 3 (NGO) and the systematic quench of the NGO photoluminescence (PL) by Ce doping. Study of room temperature PL was performed in both single-crystal and polycrystalline NGO (substrates and pellets) respectively. Several NGO pellets were prepared with varying Ce concentration and their room temperature PL was studied using 325 nm laser. It was found that the PL intensity shows a systematic quench with increasing Ce concentration. XPS measurements indicated that nearly 50% of Ce atoms are in the 4+ state. The PL quench was attributed to the novel concept of super hydrogenic dopant (SHD)", where each Ce 4+ ion contributes an electron which forms a super hydrogenic atom with an enhanced Bohr radius, due to the large dielectric constant of the host. Based on the critical Ce concentration for complete quenching this SHD radius was estimated to be within a range of 0.85 nm and 1.15 nm whereas the predicted theoretical value of SHD radius for NdGaO3 is ~1.01 nm.

  11. Experimental ultrasound system for real-time synthetic imaging

    DEFF Research Database (Denmark)

    Jensen, Jørgen Arendt; Holm, Ole; Jensen, Lars Joost

    1999-01-01

    Digital signal processing is being employed more and more in modern ultrasound scanners. This has made it possible to do dynamic receive focusing for each sample and implement other advanced imaging methods. The processing, however, has to be very fast and cost-effective at the same time. Dedicated...... for synthetic aperture imaging, 2D and 3D B-mode and velocity imaging. The system can be used with 128 element transducers and can excite 128 channels and receive and sample data from 64 channels simultaneously at 40 MHz with 12 bits precision. Data can be processed in real time using the system's 80 signal...... chips are used in order to do real time processing. This often makes it difficult to implement radically different imaging strategies on one platform and makes the scanners less accessible for research purposes. Here flexibility is the prime concern, and the storage of data from all transducer elements...

  12. Design and laboratory calibration of the compact pushbroom hyperspectral imaging system

    Science.gov (United States)

    Zhou, Jiankang; Ji, Yiqun; Chen, Yuheng; Chen, Xinhua; Shen, Weimin

    2009-11-01

    The designed hyperspectral imaging system is composed of three main parts, that is, optical subsystem, electronic subsystem and capturing subsystem. And a three-dimensional "image cube" can be obtained through push-broom. The fore-optics is commercial-off-the-shelf with high speed and three continuous zoom ratios. Since the dispersive imaging part is based on Offner relay configuration with an aberration-corrected convex grating, high power of light collection and variable view field are obtained. The holographic recording parameters of the convex grating are optimized, and the aberration of the Offner configuration dispersive system is balanced. The electronic system adopts module design, which can minimize size, mass, and power consumption. Frame transfer area-array CCD is chosen as the image sensor and the spectral line can be binned to achieve better SNR and sensitivity without any deterioration in spatial resolution. The capturing system based on the computer can set the capturing parameters, calibrate the spectrometer, process and display spectral imaging data. Laboratory calibrations are prerequisite for using precise spectral data. The spatial and spectral calibration minimize smile and keystone distortion caused by optical system, assembly and so on and fix positions of spatial and spectral line on the frame area-array CCD. Gases excitation lamp is used in smile calibration and the keystone calculation is carried out by different viewing field point source created by a series of narrow slit. The laboratory and field imaging results show that this pushbroom hyperspectral imaging system can acquire high quality spectral images.

  13. A combination chaotic system and application in color image encryption

    Science.gov (United States)

    Parvaz, R.; Zarebnia, M.

    2018-05-01

    In this paper, by using Logistic, Sine and Tent systems we define a combination chaotic system. Some properties of the chaotic system are studied by using figures and numerical results. A color image encryption algorithm is introduced based on new chaotic system. Also this encryption algorithm can be used for gray scale or binary images. The experimental results of the encryption algorithm show that the encryption algorithm is secure and practical.

  14. Image restoration for civil engineering structure monitoring using imaging system embedded on UAV

    Science.gov (United States)

    Vozel, Benoit; Dumoulin, Jean; Chehdi, Kacem

    2013-04-01

    Nowadays, civil engineering structures are periodically surveyed by qualified technicians (i.e. alpinist) operating visual inspection using heavy mechanical pods. This method is far to be safe, not only for civil engineering structures monitoring staff, but also for users. Due to the unceasing traffic increase, making diversions or closing lanes on bridge becomes more and more difficult. New inspection methods have to be found. One of the most promising technique is to develop inspection method using images acquired by a dedicated monitoring system operating around the civil engineering structures, without disturbing the traffic. In that context, the use of images acquired with an UAV, which fly around the structures is of particular interest. The UAV can be equipped with different vision system (digital camera, infrared sensor, video, etc.). Nonetheless, detection of small distresses on images (like cracks of 1 mm or less) depends on image quality, which is sensitive to internal parameters of the UAV (vibration modes, video exposure times, etc.) and to external parameters (turbulence, bad illumination of the scene, etc.). Though progresses were made at UAV level and at sensor level (i.e. optics), image deterioration is still an open problem. These deteriorations are mainly represented by motion blur that can be coupled with out-of-focus blur and observation noise on acquired images. In practice, deteriorations are unknown if no a priori information is available or dedicated additional instrumentation is set-up at UAV level. Image restoration processing is therefore required. This is a difficult problem [1-3] which has been intensively studied over last decades [4-12]. Image restoration can be addressed by following a blind approach or a myopic one. In both cases, it includes two processing steps that can be implemented in sequential or alternate mode. The first step carries out the identification of the blur impulse response and the second one makes use of this

  15. Cf-252 based neutron radiography using real-time image processing system

    International Nuclear Information System (INIS)

    Mochiki, Koh-ichi; Koiso, Manabu; Yamaji, Akihiro; Iwata, Hideki; Kihara, Yoshitaka; Sano, Shigeru; Murata, Yutaka

    2001-01-01

    For compact Cf-252 based neutron radiography, a real-time image processing system by particle counting technique has been developed. The electronic imaging system consists of a supersensitive imaging camera, a real-time corrector, a real-time binary converter, a real-time calculator for centroid, a display monitor and a computer. Three types of accumulated NR image; ordinary, binary and centroid images, can be observed during a measurement. Accumulated NR images were taken by the centroid mode, the binary mode and ordinary mode using of Cf-252 neutron source and those images were compared. The centroid mode presented the sharpest image and its statistical characteristics followed the Poisson distribution, while the ordinary mode showed the smoothest image as the averaging effect by particle bright spots with distributed brightness was most dominant. (author)

  16. Comparative evaluation of image quality in computed radiology systems using imaging plates with different usage time

    International Nuclear Information System (INIS)

    Lazzaro, M.V.; Luz, R.M. da; Capaverde, A.S.; Silva, A.M. Marques da

    2015-01-01

    Computed Radiology (CR) systems use imaging plates (IPs) for latent image acquisition. Taking into account the quality control (QC) of these systems, imaging plates usage time is undetermined. Different recommendations and publications on the subject suggest tests to evaluate these systems. The objective of this study is to compare the image quality of IPs of a CR system, in a mammography service, considering the usage time and consistency of assessments. 8 IPs were used divided into two groups: the first group included 4 IPs with 3 years of use (Group A); the second group consisted of 4 new IPs with no previous exposure (Group B). The tests used to assess the IP's quality were: Uniformity, Differential Signal to Noise Ratio (SDNR), Ghost Effect and Figure of Merit (FOM). Statistical results show that the proposed tests are shown efficient in assessing the conditions of image quality obtained in CR systems in mammography and can be used as determining factors for the replacement of IP's. Moreover, comparing the two sets of IP, results led to the replacement of all the set of IP’s with 3 years of use. This work demonstrates the importance of an efficient quality control, not only with regard to the quality of IP's used, but in the acquisition system as a whole. From this work, these tests will be conducted on an annual basis, already targeting as future work, monitoring the wear of IP's Group B and the creation of a baseline for analysis and future replacements. (author)

  17. Penn State astronomical image processing system

    International Nuclear Information System (INIS)

    Truax, R.J.; Nousek, J.A.; Feigelson, E.D.; Lonsdale, C.J.

    1987-01-01

    The needs of modern astronomy for image processing set demanding standards in simultaneously requiring fast computation speed, high-quality graphic display, large data storage, and interactive response. An innovative image processing system was designed, integrated, and used; it is based on a supermicro architecture which is tailored specifically for astronomy, which provides a highly cost-effective alternative to the traditional minicomputer installation. The paper describes the design rationale, equipment selection, and software developed to allow other astronomers with similar needs to benefit from the present experience. 9 references

  18. High-resolution imaging using a wideband MIMO radar system with two distributed arrays.

    Science.gov (United States)

    Wang, Dang-wei; Ma, Xiao-yan; Chen, A-Lei; Su, Yi

    2010-05-01

    Imaging a fast maneuvering target has been an active research area in past decades. Usually, an array antenna with multiple elements is implemented to avoid the motion compensations involved in the inverse synthetic aperture radar (ISAR) imaging. Nevertheless, there is a price dilemma due to the high level of hardware complexity compared to complex algorithm implemented in the ISAR imaging system with only one antenna. In this paper, a wideband multiple-input multiple-output (MIMO) radar system with two distributed arrays is proposed to reduce the hardware complexity of the system. Furthermore, the system model, the equivalent array production method and the imaging procedure are presented. As compared with the classical real aperture radar (RAR) imaging system, there is a very important contribution in our method that the lower hardware complexity can be involved in the imaging system since many additive virtual array elements can be obtained. Numerical simulations are provided for testing our system and imaging method.

  19. Value of the asymmetric film-screen system InSight HC in chest imaging

    International Nuclear Information System (INIS)

    Haeussler, M.D.; Lenzen, H.; Reckels, C.; Peters, P.E.

    1994-01-01

    The asymmetric film-screen system InSight HC represents a development to optimize chest imaging. The purpose of the study was to compare the exposure range and the image quality of this new system with a conventional film-screen system. The optical density of images in both techniques was measured and the image quality of 100 chest images from 50 intensive-care patients was evaluated. 4 observers graded the image quality of organic, non-organic and pathological structures. Statistical evaluation was performed by interobserver analysis. The asymmetric film-screen system shows a larger exposure range and a superior image quality in the mediastinal field. The image quality in the peripheral field must be judged critically and improved especially because of the poor recognizability of pneumothoraces. (orig.) [de

  20. Brain dopaminergic systems : imaging with positron tomography

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J C [University of Caen/INSERM U, Caen (France). CYCERON; Comar, D [E.E.C. Concerted Action on P.E.T. Investigations of Cellular Regeneration and Degeneration, Orsay (France) CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot; Farde, L [Karolinska Sjukhuset, Stockholm (Sweden); Martinot, J L; Mazoyer, B [CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot Paris-

    1991-01-01

    Imaging of the dopaminergic system in the human brain with the in vivo use of Positron Emission Tomography emerged in the late 1980s as a tool of major importance in clinical neurosciences and pharmacology. The last few years have witnessed rapid development of new radiotracers specific to receptors, reuptake sites and enzymes of the dopamine system; the application of these radiotracers has led to major break-troughs in the pathophysiology and therapy of movement disorders and schizophrenic-like psychoses. This book is the first to collect, in a single volume, state-of-the-art contributions to the various aspects of this research. Its contents address methodological issues related to the design, labelling, quantitative imaging and compartmental modeli-sation of radioligands of the post-synaptic, pre-synaptic and enzyme sites of the dopamine system and to their use in clinical research in the fields of Parkinson's disease as well as other movement disorders, psychoses and neuroleptic receptor occupancy. The chapters were written by leading European scientists in the field of PET, gathered together in Caen (France, November 1990) under the aegis of the EEC Concerted Action on PET Investigations of Cellular Regeneration and Degeneration. This book provides a current and comprehensive overview on PET studies of the brain dopamine system which should aid and interest neurologists , psychiatrists, pharmacologists and medical imaging scientists. (author). refs.; figs.; tabs.

  1. Model-based restoration using light vein for range-gated imaging systems.

    Science.gov (United States)

    Wang, Canjin; Sun, Tao; Wang, Tingfeng; Wang, Rui; Guo, Jin; Tian, Yuzhen

    2016-09-10

    The images captured by an airborne range-gated imaging system are degraded by many factors, such as light scattering, noise, defocus of the optical system, atmospheric disturbances, platform vibrations, and so on. The characteristics of low illumination, few details, and high noise make the state-of-the-art restoration method fail. In this paper, we present a restoration method especially for range-gated imaging systems. The degradation process is divided into two parts: the static part and the dynamic part. For the static part, we establish the physical model of the imaging system according to the laser transmission theory, and estimate the static point spread function (PSF). For the dynamic part, a so-called light vein feature extraction method is presented to estimate the fuzzy parameter of the atmospheric disturbance and platform movement, which make contributions to the dynamic PSF. Finally, combined with the static and dynamic PSF, an iterative updating framework is used to restore the image. Compared with the state-of-the-art methods, the proposed method can effectively suppress ringing artifacts and achieve better performance in a range-gated imaging system.

  2. Toward a Low-Cost System for High-Throughput Image-Based Phenotyping of Root System Architecture

    Science.gov (United States)

    Davis, T. W.; Schneider, D. J.; Cheng, H.; Shaw, N.; Kochian, L. V.; Shaff, J. E.

    2015-12-01

    Root system architecture is being studied more closely for improved nutrient acquisition, stress tolerance and carbon sequestration by relating the genetic material that corresponds to preferential physical features. This information can help direct plant breeders in addressing the growing concerns regarding the global demand on crops and fossil fuels. To help support this incentive comes a need to make high-throughput image-based phenotyping of plant roots, at the individual plant scale, simpler and more affordable. Our goal is to create an affordable and portable product for simple image collection, processing and management that will extend root phenotyping to institutions with limited funding (e.g., in developing countries). Thus, a new integrated system has been developed using the Raspberry Pi single-board computer. Similar to other 3D-based imaging platforms, the system utilizes a stationary camera to photograph a rotating crop root system (e.g., rice, maize or sorghum) that is suspended either in a gel or on a mesh (for hydroponics). In contrast, the new design takes advantage of powerful open-source hardware and software to reduce the system costs, simplify the imaging process, and manage the large datasets produced by the high-resolution photographs. A newly designed graphical user interface (GUI) unifies the system controls (e.g., adjusting camera and motor settings and orchestrating the motor motion with image capture), making it easier to accommodate a variety of experiments. During each imaging session, integral metadata necessary for reproducing experiment results are collected (e.g., plant type and age, growing conditions and treatments, camera settings) using hierarchical data format files. These metadata are searchable within the GUI and can be selected and extracted for further analysis. The GUI also supports an image previewer that performs limited image processing (e.g., thresholding and cropping). Root skeletonization, 3D reconstruction and

  3. Modulation of the semantic system by word imageability.

    Science.gov (United States)

    Sabsevitz, D S; Medler, D A; Seidenberg, M; Binder, J R

    2005-08-01

    A prevailing neurobiological theory of semantic memory proposes that part of our knowledge about concrete, highly imageable concepts is stored in the form of sensory-motor representations. While this theory predicts differential activation of the semantic system by concrete and abstract words, previous functional imaging studies employing this contrast have provided relatively little supporting evidence. We acquired event-related functional magnetic resonance imaging (fMRI) data while participants performed a semantic similarity judgment task on a large number of concrete and abstract noun triads. Task difficulty was manipulated by varying the degree to which the words in the triad were similar in meaning. Concrete nouns, relative to abstract nouns, produced greater activation in a bilateral network of multimodal and heteromodal association areas, including ventral and medial temporal, posterior-inferior parietal, dorsal prefrontal, and posterior cingulate cortex. In contrast, abstract nouns produced greater activation almost exclusively in the left hemisphere in superior temporal and inferior frontal cortex. Increasing task difficulty modulated activation mainly in attention, working memory, and response monitoring systems, with almost no effect on areas that were modulated by imageability. These data provide critical support for the hypothesis that concrete, imageable concepts activate perceptually based representations not available to abstract concepts. In contrast, processing abstract concepts makes greater demands on left perisylvian phonological and lexical retrieval systems. The findings are compatible with dual coding theory and less consistent with single-code models of conceptual representation. The lack of overlap between imageability and task difficulty effects suggests that once the neural representation of a concept is activated, further maintenance and manipulation of that information in working memory does not further increase neural activation in

  4. Image processing system design for microcantilever-based optical readout infrared arrays

    Science.gov (United States)

    Tong, Qiang; Dong, Liquan; Zhao, Yuejin; Gong, Cheng; Liu, Xiaohua; Yu, Xiaomei; Yang, Lei; Liu, Weiyu

    2012-12-01

    Compared with the traditional infrared imaging technology, the new type of optical-readout uncooled infrared imaging technology based on MEMS has many advantages, such as low cost, small size, producing simple. In addition, the theory proves that the technology's high thermal detection sensitivity. So it has a very broad application prospects in the field of high performance infrared detection. The paper mainly focuses on an image capturing and processing system in the new type of optical-readout uncooled infrared imaging technology based on MEMS. The image capturing and processing system consists of software and hardware. We build our image processing core hardware platform based on TI's high performance DSP chip which is the TMS320DM642, and then design our image capturing board based on the MT9P031. MT9P031 is Micron's company high frame rate, low power consumption CMOS chip. Last we use Intel's company network transceiver devices-LXT971A to design the network output board. The software system is built on the real-time operating system DSP/BIOS. We design our video capture driver program based on TI's class-mini driver and network output program based on the NDK kit for image capturing and processing and transmitting. The experiment shows that the system has the advantages of high capturing resolution and fast processing speed. The speed of the network transmission is up to 100Mbps.

  5. Semiautomatic digital imaging system for cytogenetic analysis

    International Nuclear Information System (INIS)

    Chaubey, R.C.; Chauhan, P.C.; Bannur, S.V.; Kulgod, S.V.; Chadda, V.K.; Nigam, R.K.

    1999-08-01

    The paper describes a digital image processing system, developed indigenously at BARC for size measurement of microscopic biological objects such as cell, nucleus and micronucleus in mouse bone marrow; cytochalasin-B blocked human lymphocytes in-vitro; numerical counting and karyotyping of metaphase chromosomes of human lymphocytes. Errors in karyotyping of chromosomes by the imaging system may creep in due to lack of well-defined position of centromere or extensive bending of chromosomes, which may result due to poor quality of preparation. Good metaphase preparations are mandatory for precise and accurate analysis by the system. Additional new morphological parameters about each chromosome have to be incorporated to improve the accuracy of karyotyping. Though the experienced cytogenetisist is the final judge; however, the system assists him/her to carryout analysis much faster as compared to manual scoring. Further, experimental studies are in progress to validate different software packages developed for various cytogenetic applications. (author)

  6. Usefulness of a Small-Field Digital Mammographic Imaging System Using Parabolic Polycapillary Optics as a Diagnostic Imaging Tool: a Preliminary Study

    International Nuclear Information System (INIS)

    Chon, Kwon Su; Park, Jeong Gon; Son, Hyun Hwa; Kang, Sung Hoon; Park, Seong Hoon; Kim, Hye Won; Kim, Hun Soo; Yoon, Kwon Ha

    2009-01-01

    To evaluate the efficacy for spatial resolution and radiation dose of a small-field digital mammographic imaging system using parabolic polycapillary optics. We developed a small-field digital mammographic imaging system composed of a CCD (charge coupled device) detector and an Xray source coupled with parabolic polycapillary optics. The spatial resolution and radiation dose according to various filters were evaluated for a small-field digital mammographic imaging system. The images of a test standard phantom and breast cancer tissue sample were obtained. The small-field digital mammographic imaging system had spatial resolutions of 12 lp/mm with molybdenum and rhodium filters with a 25-μm thickness. With a thicker molybdenum filter (100 μm thick), the system had a higher spatial resolution of 11 lp/mm and contrast of 0.48. The radiation dose for a rhodium filter with a 25-μm thickness was 0.13 mGy within a 10-mm-diameter local field. A larger field image greater than 10 mm in diameter could be obtained by scanning an object. On the small-field mammographic imaging system, microcalcifications of breast cancer tissue were clearly observed. A small-field digital mammographic imaging system with parabolic polycapillary optics may be a useful diagnostic tool for providing high-resolution imaging with a low radiation dose for examination of local volumes of breast tissue

  7. Usefulness of a Small-Field Digital Mammographic Imaging System Using Parabolic Polycapillary Optics as a Diagnostic Imaging Tool: a Preliminary Study

    Energy Technology Data Exchange (ETDEWEB)

    Chon, Kwon Su [Catholic University of Daegu, Daegu (Korea, Republic of); Park, Jeong Gon; Son, Hyun Hwa; Kang, Sung Hoon; Park, Seong Hoon; Kim, Hye Won; Kim, Hun Soo; Yoon, Kwon Ha [Wonkwang University, Iksan (Korea, Republic of)

    2009-12-15

    To evaluate the efficacy for spatial resolution and radiation dose of a small-field digital mammographic imaging system using parabolic polycapillary optics. We developed a small-field digital mammographic imaging system composed of a CCD (charge coupled device) detector and an Xray source coupled with parabolic polycapillary optics. The spatial resolution and radiation dose according to various filters were evaluated for a small-field digital mammographic imaging system. The images of a test standard phantom and breast cancer tissue sample were obtained. The small-field digital mammographic imaging system had spatial resolutions of 12 lp/mm with molybdenum and rhodium filters with a 25-{mu}m thickness. With a thicker molybdenum filter (100 {mu}m thick), the system had a higher spatial resolution of 11 lp/mm and contrast of 0.48. The radiation dose for a rhodium filter with a 25-{mu}m thickness was 0.13 mGy within a 10-mm-diameter local field. A larger field image greater than 10 mm in diameter could be obtained by scanning an object. On the small-field mammographic imaging system, microcalcifications of breast cancer tissue were clearly observed. A small-field digital mammographic imaging system with parabolic polycapillary optics may be a useful diagnostic tool for providing high-resolution imaging with a low radiation dose for examination of local volumes of breast tissue.

  8. Optical methods and integrated systems for brain imaging in awake, untethered animals

    Science.gov (United States)

    Murari, Kartikeya

    Imaging is a powerful tool for biomedical research offering non-contact and minimally or non-invasive means of investigating at multiple scales---from single molecules to large populations of cells. Imaging in awake, behaving animals is an emerging field that offers the additional advantage of being able to study physiological processes and structures in a more natural state than what is possible in tissue slices or even in anesthetized animals. To date, most imaging in awake animals has used optical fiber bundles or electrical cables to transfer signals to traditional imaging-system components. However, the fibers or cables tether the animal and greatly limit the kind and duration of animal behavior that can be studied using imaging methods. This work involves three distinct yet related approaches to fulfill the goal of imaging in unanesthetized, unrestrained animals---optical techniques for functional and structural imaging, development of novel photodetectors and the design of miniaturized imaging systems. I hypothesized that the flow within vessels might act as a contrast-enhancing agent and improve the visualization of vascular architecture using laser speckle imaging. When imaging rodent cerebral vasculature I saw a two to four fold increase in the contrast-to-noise ratios and was able to visualize 10--30% more vascular features over reflectance techniques. I designed a complementary metal oxide semiconductor (CMOS) photodetector array that was comparable in sensitivity and noise performance to cooled CCD sensors, able to image fluorescence from a single cell, while running at faster frame rates. Next, I designed an imaging system weighing under 6 grams and occupying less than 4 cm3. The system incorporated multispectral illumination, adjustable focusing optics and the high-sensitivity CMOS imager. I was able to implement a variety of optical modalities with the system and performed reflectance, fluorescence, spectroscopic and laser speckle imaging with my

  9. Wavelet crosstalk matrix and its application to assessment of shift-variant imaging systems

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Jinyi; Huesman, Ronald H.

    2002-11-01

    The objective assessment of image quality is essential for design of imaging systems. Barrett and Gifford [1] introduced the Fourier cross talk matrix. Because it is diagonal for continuous linear shift-invariant imaging systems, the Fourier cross talk matrix is a powerful technique for discrete imaging systems that are close to shift invariant. However, for a system that is intrinsically shift variant, Fourier techniques are not particularly effective. Because Fourier bases have no localization property, the shift-variance of the imaging system cannot be shown by the response of individual Fourier bases; rather, it is shown in the correlation between the Fourier coefficients. This makes the analysis and optimization quite difficult. In this paper, we introduce a wavelet cross talk matrix based on wavelet series expansions. The wavelet cross talk matrix allows simultaneous study of the imaging system in both the frequency and spatial domains. Hence it is well suited for shift variant systems. We compared the wavelet cross talk matrix with the Fourier cross talk matrix for several simulated imaging systems, namely the interior and exterior tomography problems, limited angle tomography, and a rectangular geometry positron emission tomograph. The results demonstrate the advantages of the wavelet cross talk matrix in analyzing shift-variant imaging systems.

  10. Wavelet crosstalk matrix and its application to assessment of shift-variant imaging systems

    International Nuclear Information System (INIS)

    Qi, Jinyi; Huesman, Ronald H.

    2002-01-01

    The objective assessment of image quality is essential for design of imaging systems. Barrett and Gifford [1] introduced the Fourier cross talk matrix. Because it is diagonal for continuous linear shift-invariant imaging systems, the Fourier cross talk matrix is a powerful technique for discrete imaging systems that are close to shift invariant. However, for a system that is intrinsically shift variant, Fourier techniques are not particularly effective. Because Fourier bases have no localization property, the shift-variance of the imaging system cannot be shown by the response of individual Fourier bases; rather, it is shown in the correlation between the Fourier coefficients. This makes the analysis and optimization quite difficult. In this paper, we introduce a wavelet cross talk matrix based on wavelet series expansions. The wavelet cross talk matrix allows simultaneous study of the imaging system in both the frequency and spatial domains. Hence it is well suited for shift variant systems. We compared the wavelet cross talk matrix with the Fourier cross talk matrix for several simulated imaging systems, namely the interior and exterior tomography problems, limited angle tomography, and a rectangular geometry positron emission tomograph. The results demonstrate the advantages of the wavelet cross talk matrix in analyzing shift-variant imaging systems

  11. Online hyperspectral imaging system for evaluating quality of agricultural products

    Science.gov (United States)

    Mo, Changyeun; Kim, Giyoung; Lim, Jongguk

    2017-06-01

    The consumption of fresh-cut agricultural produce in Korea has been growing. The browning of fresh-cut vegetables that occurs during storage and foreign substances such as worms and slugs are some of the main causes of consumers' concerns with respect to safety and hygiene. The purpose of this study is to develop an on-line system for evaluating quality of agricultural products using hyperspectral imaging technology. The online evaluation system with single visible-near infrared hyperspectral camera in the range of 400 nm to 1000 nm that can assess quality of both surfaces of agricultural products such as fresh-cut lettuce was designed. Algorithms to detect browning surface were developed for this system. The optimal wavebands for discriminating between browning and sound lettuce as well as between browning lettuce and the conveyor belt were investigated using the correlation analysis and the one-way analysis of variance method. The imaging algorithms to discriminate the browning lettuces were developed using the optimal wavebands. The ratio image (RI) algorithm of the 533 nm and 697 nm images (RI533/697) for abaxial surface lettuce and the ratio image algorithm (RI533/697) and subtraction image (SI) algorithm (SI538-697) for adaxial surface lettuce had the highest classification accuracies. The classification accuracy of browning and sound lettuce was 100.0% and above 96.0%, respectively, for the both surfaces. The overall results show that the online hyperspectral imaging system could potentially be used to assess quality of agricultural products.

  12. Electro-optical system for the high speed reconstruction of computed tomography images

    International Nuclear Information System (INIS)

    Tresp, V.

    1989-01-01

    An electro-optical system for the high-speed reconstruction of computed tomography (CT) images has been built and studied. The system is capable of reconstructing high-contrast and high-resolution images at video rate (30 images per second), which is more than two orders of magnitude faster than the reconstruction rate achieved by special purpose digital computers used in commercial CT systems. The filtered back-projection algorithm which was implemented in the reconstruction system requires the filtering of all projections with a prescribed filter function. A space-integrating acousto-optical convolver, a surface acoustic wave filter and a digital finite-impulse response filter were used for this purpose and their performances were compared. The second part of the reconstruction, the back projection of the filtered projections, is computationally very expensive. An optical back projector has been built which maps the filtered projections onto the two-dimensional image space using an anamorphic lens system and a prism image rotator. The reconstructed image is viewed by a video camera, routed through a real-time image-enhancement system, and displayed on a TV monitor. The system reconstructs parallel-beam projection data, and in a modified version, is also capable of reconstructing fan-beam projection data. This extension is important since the latter are the kind of projection data actually acquired in high-speed X-ray CT scanners. The reconstruction system was tested by reconstructing precomputed projection data of phantom images. These were stored in a special purpose projection memory and transmitted to the reconstruction system as an electronic signal. In this way, a projection measurement system that acquires projections sequentially was simulated

  13. A hybrid optical system for broadband imaging in guidance and control

    Science.gov (United States)

    Wu, Xiaofang; Jiang, Yuesong; Shen, Chunyan; Zhao, Yiming

    2006-11-01

    A binary optics method has been adopted to improve upon a conventional optical system in guidance and control, and a hybrid broadband imaging system that includes a binary surface is analyzed and evaluated by optical design software ZEMAX. The practical design shows that the introduction of binary optics can simplify the structure of the imaging system and reduce the size and weight of the broadband guidance and control system. Moreover, it can help to acquire images of radiation of different wavelengths from targets; hence it will result in improved overall performance of missiles in wars.

  14. Neuro-fuzzy Classification System for Wireless-Capsule Endoscopic Images

    OpenAIRE

    Vassilis S. Kodogiannis; John N. Lygouras

    2008-01-01

    In this research study, an intelligent detection system to support medical diagnosis and detection of abnormal lesions by processing endoscopic images is presented. The images used in this study have been obtained using the M2A Swallowable Imaging Capsule - a patented, video color-imaging disposable capsule. Schemes have been developed to extract texture features from the fuzzy texture spectra in the chromatic and achromatic domains for a selected region of interest from ...

  15. Imaging and image restoration of an on-axis three-mirror Cassegrain system with wavefront coding technology.

    Science.gov (United States)

    Guo, Xiaohu; Dong, Liquan; Zhao, Yuejin; Jia, Wei; Kong, Lingqin; Wu, Yijian; Li, Bing

    2015-04-01

    Wavefront coding (WFC) technology is adopted in the space optical system to resolve the problem of defocus caused by temperature difference or vibration of satellite motion. According to the theory of WFC, we calculate and optimize the phase mask parameter of the cubic phase mask plate, which is used in an on-axis three-mirror Cassegrain (TMC) telescope system. The simulation analysis and the experimental results indicate that the defocused modulation transfer function curves and the corresponding blurred images have a perfect consistency in the range of 10 times the depth of focus (DOF) of the original TMC system. After digital image processing by a Wiener filter, the spatial resolution of the restored images is up to 57.14 line pairs/mm. The results demonstrate that the WFC technology in the TMC system has superior performance in extending the DOF and less sensitivity to defocus, which has great value in resolving the problem of defocus in the space optical system.

  16. Signal to noise ratio (SNR) and image uniformity: an estimate of performance of magnetic resonance imaging (MRI) system

    International Nuclear Information System (INIS)

    Narayan, P.; Suri, S.; Choudhary, S.R.

    2001-01-01

    In most general definition, noise in an image, is any variation that represents a deviation from truth. Noise sources in MRI can be systematic or random and statistical in nature. Data processing algorithms that smooth and enhance the edges by non-linear intensity assignments among other factors can affect the distribution of statistical noise. The SNR and image uniformity depends on the various parameters of NMR imaging system (viz. General system calibration, Gain coil tuning, AF shielding, coil loading, image processing and scan parameters like TE, TR, interslice distance, slice thickness, pixel size and matrix size). A study on SNR and image uniformity have been performed using standard head AF coil with different TR and the estimates of their variation are presented. A comparison between different techniques has also been evaluated using standard protocol of the Siemens Magnetom Vision Plus MRI system

  17. System for objective assessment of image differences in digital cinema

    Science.gov (United States)

    Fliegel, Karel; Krasula, Lukáš; Páta, Petr; Myslík, Jiří; Pecák, Josef; Jícha, Marek

    2014-09-01

    There is high demand for quick digitization and subsequent image restoration of archived film records. Digitization is very urgent in many cases because various invaluable pieces of cultural heritage are stored on aging media. Only selected records can be reconstructed perfectly using painstaking manual or semi-automatic procedures. This paper aims to answer the question what are the quality requirements on the restoration process in order to obtain acceptably close visual perception of the digitally restored film in comparison to the original analog film copy. This knowledge is very important to preserve the original artistic intention of the movie producers. Subjective experiment with artificially distorted images has been conducted in order to answer the question what is the visual impact of common image distortions in digital cinema. Typical color and contrast distortions were introduced and test images were presented to viewers using digital projector. Based on the outcome of this subjective evaluation a system for objective assessment of image distortions has been developed and its performance tested. The system utilizes calibrated digital single-lens reflex camera and subsequent analysis of suitable features of images captured from the projection screen. The evaluation of captured image data has been optimized in order to obtain predicted differences between the reference and distorted images while achieving high correlation with the results of subjective assessment. The system can be used to objectively determine the difference between analog film and digital cinema images on the projection screen.

  18. Illumination Effect of Laser Light in Foggy Objects Using an Active Imaging System

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Seong-Ouk; Park, Seung-Kyu; Ahn, Yong-Jin; Baik, Sung-Hoon; Choi, Young-Soo; Jeong, Kyung-Min [KAERI, Daejeon (Korea, Republic of)

    2015-05-15

    Active imaging techniques usually provide improved image information when compared to passive imaging techniques. Active vision is a direct visualization technique using an artificial illuminant. Range-gated imaging (RGI) technique is one of active vision technologies. The RGI technique extracts vision information by summing time sliced vision images. In the RGI system, objects are illuminated for ultra-short time by a high intensity illuminant and then the light reflected from objects is captured by a highly sensitive image sensor with the exposure of ultra-short time. The Range-gated imaging is an emerging technology in the field of surveillance for security application, especially in the visualization of darken night or foggy environment. Although RGI viewing was discovered in the 1960's, this technology is currently more applicable by virtue of the rapid development of optical and sensor technologies, such as highly sensitive imaging sensor and ultra-short pulse laser light. Especially, this system can be adopted in robot-vision system by virtue of the compact system configuration. During the past decades, several applications of this technology have been applied in target recognition and in harsh environments, such as fog, underwater vision. Also, this technology has been demonstrated range imaging based on range-gated imaging. Laser light having a short pulse width is usually used for the range-gated imaging system. In this paper, an illumination effect of laser light in foggy objects is studied using a range-gated imaging system. The used imaging system consists of an ultra-short pulse (0.35 ns) laser light and a gated imaging sensor. The experiment is carried out to monitor objects in a box filled by fog. In this paper, the effects by fog particles in range-gated imaging technique are studied. Edge blurring and range distortion are the generated by fog particles.

  19. Illumination Effect of Laser Light in Foggy Objects Using an Active Imaging System

    International Nuclear Information System (INIS)

    Kwon, Seong-Ouk; Park, Seung-Kyu; Ahn, Yong-Jin; Baik, Sung-Hoon; Choi, Young-Soo; Jeong, Kyung-Min

    2015-01-01

    Active imaging techniques usually provide improved image information when compared to passive imaging techniques. Active vision is a direct visualization technique using an artificial illuminant. Range-gated imaging (RGI) technique is one of active vision technologies. The RGI technique extracts vision information by summing time sliced vision images. In the RGI system, objects are illuminated for ultra-short time by a high intensity illuminant and then the light reflected from objects is captured by a highly sensitive image sensor with the exposure of ultra-short time. The Range-gated imaging is an emerging technology in the field of surveillance for security application, especially in the visualization of darken night or foggy environment. Although RGI viewing was discovered in the 1960's, this technology is currently more applicable by virtue of the rapid development of optical and sensor technologies, such as highly sensitive imaging sensor and ultra-short pulse laser light. Especially, this system can be adopted in robot-vision system by virtue of the compact system configuration. During the past decades, several applications of this technology have been applied in target recognition and in harsh environments, such as fog, underwater vision. Also, this technology has been demonstrated range imaging based on range-gated imaging. Laser light having a short pulse width is usually used for the range-gated imaging system. In this paper, an illumination effect of laser light in foggy objects is studied using a range-gated imaging system. The used imaging system consists of an ultra-short pulse (0.35 ns) laser light and a gated imaging sensor. The experiment is carried out to monitor objects in a box filled by fog. In this paper, the effects by fog particles in range-gated imaging technique are studied. Edge blurring and range distortion are the generated by fog particles

  20. A novel secret image sharing scheme based on chaotic system

    Science.gov (United States)

    Li, Li; Abd El-Latif, Ahmed A.; Wang, Chuanjun; Li, Qiong; Niu, Xiamu

    2012-04-01

    In this paper, we propose a new secret image sharing scheme based on chaotic system and Shamir's method. The new scheme protects the shadow images with confidentiality and loss-tolerance simultaneously. In the new scheme, we generate the key sequence based on chaotic system and then encrypt the original image during the sharing phase. Experimental results and analysis of the proposed scheme demonstrate a better performance than other schemes and confirm a high probability to resist brute force attack.

  1. Diagnostic information management system for the evaluation of medical images

    Energy Technology Data Exchange (ETDEWEB)

    Higa, Toshiaki; Torizuka, Kanji; Minato, Kotaro; Komori, Masaru; Hirakawa, Akina

    1985-04-01

    A practical, small and low-cost diagnostic information management system has been developed for a comparative study of various medical imaging procedures, including ordinary radiography, X-ray computed tomography, emission computed tomography, and so forth. The purpose of the system is to effectively manage the original image data files and diagnostic descriptions during the various imaging procedures. A diagnostic description of each imaging procedure for each patient is made on a hand-sort punched-card with line-drawings and ordinary medical terminology and then coded and computerized using Index for Roentgen Diagnoses (American College of Radiology). A database management software (DB Master) on a personal computer (Apple II) is used for searching for patients' records on hand-sort punched-cards and finally original medical images. Discussed are realistic use of medical images and an effective form of diagnostic descriptions.

  2. Diagnostic information management system for the evaluation of medical images

    International Nuclear Information System (INIS)

    Higa, Toshiaki; Torizuka, Kanji; Minato, Kotaro; Komori, Masaru; Hirakawa, Akina.

    1985-01-01

    A practical, small and low-cost diagnostic information management system has been developed for a comparative study of various medical imaging procedures, including ordinary radiography, X-ray computed tomography, emission computed tomography, and so forth. The purpose of the system is to effectively manage the original image data files and diagnostic descriptions during the various imaging procedures. A diagnostic description of each imaging procedure for each patient is made on a hand-sort punched-card with line-drawings and ordinary medical terminology and then coded and computerized using Index for Roentgen Diagnoses (American College of Radiology). A database management software (DB Master) on a personal computer (Apple II) is used for searching for patients' records on hand-sort punched-cards and finally original medical images. Discussed are realistic use of medical images and an effective form of diagnostic descriptions. (author)

  3. A real-time dynamic imaging system for centrifugal microflow platforms

    International Nuclear Information System (INIS)

    Chang, Hsing-Cheng; Tsou, Chingfu; Lai, Chi-Chih; Wun, Guo-Hong

    2008-01-01

    Based on the operational concept of quasi-static state and optoelectronic measurement technology, this research develops a real-time dynamic imaging system for centrifugal microfluidic platforms. Unlike the conventional centrifugal inspection system, which can only be used for examination of the final steady stage in microflow analysis, the developed system with a multi-speed controller and object tracking design is fabricated with low cost to recognize dynamic microflow patterns for different kinds of compact disc-type centrifugal microstructures. The characteristics of rotational control efficiency and image acquisition quality are obtained from fluidic microvalve experiments that are achieved in measuring microflow dynamic responses and in visualizing transient microflow patterns. A man–machine interface was connected with a computer to perform the control and alignment adjustments to catch exact image data for following analysis. The rotation stability of the system has been evaluated, and the rotation speed up to 4500 rpm with vertical vibration less than ±0.2 mm is achieved measured at radial distance of 5 cm. The image acquisition is transferred via USB 2.0 at a speed of up to 30 images per second to the display and memory module

  4. Single-Trial Event-Related Potential Based Rapid Image Triage System

    Directory of Open Access Journals (Sweden)

    Ke Yu

    2011-06-01

    Full Text Available Searching for points of interest (POI in large-volume imagery is a challenging problem with few good solutions. In this work, a neural engineering approach called rapid image triage (RIT which could offer about a ten-fold speed up in POI searching is developed. It is essentially a cortically-coupled computer vision technique, whereby the user is presented bursts of images at a speed of 6–15 images per second and then neural signals called event-related potential (ERP is used as the ‘cue’ for user seeing images of high relevance likelihood. Compared to past efforts, the implemented system has several unique features: (1 it applies overlapping frames in image chip preparation, to ensure rapid image triage performance; (2 a novel common spatial-temporal pattern (CSTP algorithm that makes use of both spatial and temporal patterns of ERP topography is proposed for high-accuracy single-trial ERP detection; (3 a weighted version of probabilistic support-vector-machine (SVM is used to address the inherent unbalanced nature of single-trial ERP detection for RIT. High accuracy, fast learning, and real-time capability of the developed system shown on 20 subjects demonstrate the feasibility of a brainmachine integrated rapid image triage system for fast detection of POI from large-volume imagery.

  5. Image acquisition system using on sensor compressed sampling technique

    Science.gov (United States)

    Gupta, Pravir Singh; Choi, Gwan Seong

    2018-01-01

    Advances in CMOS technology have made high-resolution image sensors possible. These image sensors pose significant challenges in terms of the amount of raw data generated, energy efficiency, and frame rate. This paper presents a design methodology for an imaging system and a simplified image sensor pixel design to be used in the system so that the compressed sensing (CS) technique can be implemented easily at the sensor level. This results in significant energy savings as it not only cuts the raw data rate but also reduces transistor count per pixel; decreases pixel size; increases fill factor; simplifies analog-to-digital converter, JPEG encoder, and JPEG decoder design; decreases wiring; and reduces the decoder size by half. Thus, CS has the potential to increase the resolution of image sensors for a given technology and die size while significantly decreasing the power consumption and design complexity. We show that it has potential to reduce power consumption by about 23% to 65%.

  6. An automated digital imaging system for environmental monitoring applications

    Science.gov (United States)

    Bogle, Rian; Velasco, Miguel; Vogel, John

    2013-01-01

    Recent improvements in the affordability and availability of high-resolution digital cameras, data loggers, embedded computers, and radio/cellular modems have advanced the development of sophisticated automated systems for remote imaging. Researchers have successfully placed and operated automated digital cameras in remote locations and in extremes of temperature and humidity, ranging from the islands of the South Pacific to the Mojave Desert and the Grand Canyon. With the integration of environmental sensors, these automated systems are able to respond to local conditions and modify their imaging regimes as needed. In this report we describe in detail the design of one type of automated imaging system developed by our group. It is easily replicated, low-cost, highly robust, and is a stand-alone automated camera designed to be placed in remote locations, without wireless connectivity.

  7. Raster Scan Computer Image Generation (CIG) System Based On Refresh Memory

    Science.gov (United States)

    Dichter, W.; Doris, K.; Conkling, C.

    1982-06-01

    A full color, Computer Image Generation (CIG) raster visual system has been developed which provides a high level of training sophistication by utilizing advanced semiconductor technology and innovative hardware and firmware techniques. Double buffered refresh memory and efficient algorithms eliminate the problem of conventional raster line ordering by allowing the generated image to be stored in a random fashion. Modular design techniques and simplified architecture provide significant advantages in reduced system cost, standardization of parts, and high reliability. The major system components are a general purpose computer to perform interfacing and data base functions; a geometric processor to define the instantaneous scene image; a display generator to convert the image to a video signal; an illumination control unit which provides final image processing; and a CRT monitor for display of the completed image. Additional optional enhancements include texture generators, increased edge and occultation capability, curved surface shading, and data base extensions.

  8. Image/video understanding systems based on network-symbolic models

    Science.gov (United States)

    Kuvich, Gary

    2004-03-01

    Vision is a part of a larger information system that converts visual information into knowledge structures. These structures drive vision process, resolve ambiguity and uncertainty via feedback projections, and provide image understanding that is an interpretation of visual information in terms of such knowledge models. Computer simulation models are built on the basis of graphs/networks. The ability of human brain to emulate similar graph/network models is found. Symbols, predicates and grammars naturally emerge in such networks, and logic is simply a way of restructuring such models. Brain analyzes an image as a graph-type relational structure created via multilevel hierarchical compression of visual information. Primary areas provide active fusion of image features on a spatial grid-like structure, where nodes are cortical columns. Spatial logic and topology naturally present in such structures. Mid-level vision processes like perceptual grouping, separation of figure from ground, are special kinds of network transformations. They convert primary image structure into the set of more abstract ones, which represent objects and visual scene, making them easy for analysis by higher-level knowledge structures. Higher-level vision phenomena are results of such analysis. Composition of network-symbolic models combines learning, classification, and analogy together with higher-level model-based reasoning into a single framework, and it works similar to frames and agents. Computational intelligence methods transform images into model-based knowledge representation. Based on such principles, an Image/Video Understanding system can convert images into the knowledge models, and resolve uncertainty and ambiguity. This allows creating intelligent computer vision systems for design and manufacturing.

  9. Artificial neural net system for interactive tissue classification with MR imaging and image segmentation

    International Nuclear Information System (INIS)

    Clarke, L.P.; Silbiger, M.; Naylor, C.; Brown, K.

    1990-01-01

    This paper reports on the development of interactive methods for MR tissue classification that permit mathematically rigorous methods for three-dimensional image segmentation and automatic organ/tumor contouring, as required for surgical and RTP planning. The authors investigate a number of image-intensity based tissue- classification methods that make no implicit assumptions on the MR parameters and hence are not limited by image data set. Similarly, we have trained artificial neural net (ANN) systems for both supervised and unsupervised tissue classification

  10. Incubator embedded cell culture imaging system (EmSight) based on Fourier ptychographic microscopy.

    Science.gov (United States)

    Kim, Jinho; Henley, Beverley M; Kim, Charlene H; Lester, Henry A; Yang, Changhuei

    2016-08-01

    Multi-day tracking of cells in culture systems can provide valuable information in bioscience experiments. We report the development of a cell culture imaging system, named EmSight, which incorporates multiple compact Fourier ptychographic microscopes with a standard multiwell imaging plate. The system is housed in an incubator and presently incorporates six microscopes. By using the same low magnification objective lenses as the objective and the tube lens, the EmSight is configured as a 1:1 imaging system that, providing large field-of-view (FOV) imaging onto a low-cost CMOS imaging sensor. The EmSight improves the image resolution by capturing a series of images of the sample at varying illumination angles; the instrument reconstructs a higher-resolution image by using the iterative Fourier ptychographic algorithm. In addition to providing high-resolution brightfield and phase imaging, the EmSight is also capable of fluorescence imaging at the native resolution of the objectives. We characterized the system using a phase Siemens star target, and show four-fold improved coherent resolution (synthetic NA of 0.42) and a depth of field of 0.2 mm. To conduct live, long-term dopaminergic neuron imaging, we cultured ventral midbrain from mice driving eGFP from the tyrosine hydroxylase promoter. The EmSight system tracks movements of dopaminergic neurons over a 21 day period.

  11. Commissioning and quality assurance of the x-ray volume imaging system of an image-guided radiotherapy capable linear accelerator

    International Nuclear Information System (INIS)

    Muralidhar, K.R.; Narayana Murthy, P.; Kumar, Rajneesh

    2008-01-01

    An Image-Guided Radiotherapy-capable linear accelerator (Elekta Synergy) was installed at our hospital, which is equipped with a kV x-ray volume imaging (XVI) system and electronic portal imaging device (iViewGT). The objective of this presentation is to describe the results of commissioning measurements carried out on the XVI facility to verify the manufacturer's specifications and also to evolve a QA schedule which can be used to test its performance routinely. The QA program consists of a series of tests (safety features, geometric accuracy, and image quality). These tests were found to be useful to assess the performance of the XVI system and also proved that XVI system is very suitable for image-guided high-precision radiation therapy. (author)

  12. Commissioning and quality assurance of the X-ray volume Imaging system of an image-guided radiotherapy capable linear accelerator

    Directory of Open Access Journals (Sweden)

    Muralidhar K

    2008-01-01

    Full Text Available An Image-Guided Radiotherapy-capable linear accelerator (Elekta Synergy was installed at our hospital, which is equipped with a kV x-ray volume imaging (XVI system and electronic portal imaging device (iViewGT. The objective of this presentation is to describe the results of commissioning measurements carried out on the XVI facility to verify the manufacturer′s specifications and also to evolve a QA schedule which can be used to test its performance routinely. The QA program consists of a series of tests (safety features, geometric accuracy, and image quality. These tests were found to be useful to assess the performance of the XVI system and also proved that XVI system is very suitable for image-guided high-precision radiation therapy.

  13. System for digitalization of medical images based on DICOM standard

    Directory of Open Access Journals (Sweden)

    Čabarkapa Slobodan

    2009-01-01

    Full Text Available According to DICOM standard, which defines both medical image information and user information, a new system for digitalizing medical images is involved as a part of the main system for archiving and retrieving medical databases. The basic characteristics of this system are described in this paper. Furthermore, the analysis of some important DICOM header's tags which are used in this system, are presented, too. Having chosen the appropriate tags in order to preserve important information, the efficient system has been created. .

  14. Design of a practical model-observer-based image quality assessment method for CT imaging systems

    Science.gov (United States)

    Tseng, Hsin-Wu; Fan, Jiahua; Cao, Guangzhi; Kupinski, Matthew A.; Sainath, Paavana

    2014-03-01

    The channelized Hotelling observer (CHO) is a powerful method for quantitative image quality evaluations of CT systems and their image reconstruction algorithms. It has recently been used to validate the dose reduction capability of iterative image-reconstruction algorithms implemented on CT imaging systems. The use of the CHO for routine and frequent system evaluations is desirable both for quality assurance evaluations as well as further system optimizations. The use of channels substantially reduces the amount of data required to achieve accurate estimates of observer performance. However, the number of scans required is still large even with the use of channels. This work explores different data reduction schemes and designs a new approach that requires only a few CT scans of a phantom. For this work, the leave-one-out likelihood (LOOL) method developed by Hoffbeck and Landgrebe is studied as an efficient method of estimating the covariance matrices needed to compute CHO performance. Three different kinds of approaches are included in the study: a conventional CHO estimation technique with a large sample size, a conventional technique with fewer samples, and the new LOOL-based approach with fewer samples. The mean value and standard deviation of area under ROC curve (AUC) is estimated by shuffle method. Both simulation and real data results indicate that an 80% data reduction can be achieved without loss of accuracy. This data reduction makes the proposed approach a practical tool for routine CT system assessment.

  15. The Advanced Gamma-Ray Imaging System (AGIS)

    Science.gov (United States)

    Otte, Nepomuk

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.

  16. Simultaneous Microwave Imaging System for Density and Temperature Fluctuation Measurements on TEXTOR

    International Nuclear Information System (INIS)

    Park, H.; Mazzucato, E.; Munsat, T.; Domier, C.W.; Johnson, M.; Luhmann, N.C. Jr.; Wang, J.; Xia, Z.; Classen, I.G.J.; Donne, A.J.H.; Pol, M.J. van de

    2004-01-01

    Diagnostic systems for fluctuation measurements in plasmas have, of necessity, evolved from simple 1-D systems to multi-dimensional systems due to the complexity of the MHD and turbulence physics of plasmas illustrated by advanced numerical simulations. Using the recent significant advancements in millimeter wave imaging technology, Microwave Imaging Reflectometry (MIR) and Electron Cyclotron Emission Imaging (ECEI), simultaneously measuring density and temperature fluctuations, are developed for TEXTOR. The MIR system was installed on TEXTOR and the first experiment was performed in September, 2003. Subsequent MIR campaigns have yielded poloidally resolved spectra and assessments of poloidal velocity. The new 2-D ECE Imaging system (with a total of 128 channels), installed on TEXTOR in December, 2003, successfully captured a true 2-D images of Te fluctuations of m=1 oscillation (''sawteeth'') near the q ∼ 1 surface for the first time

  17. A digital fluoroscopic imaging system for verification during external beam radiotherapy

    International Nuclear Information System (INIS)

    Takai, Michikatsu

    1990-01-01

    A digital fluoroscopic (DF) imaging system has been constructed to obtain portal images for verification during external beam radiotherapy. The imaging device consists of a fluorescent screen viewed by a highly sensitive video camera through a mirror. The video signal is digitized and processed by an image processor which is linked on-line with a host microcomputer. The image quality of the DF system was compared with that of film for portal images of the Burger phantom and the Alderson anthropomorphic phantom using 10 MV X-rays. Contrast resolution of the DF image integrated for 8.5 sec. was superior to the film resolution, while spatial resolution was slightly inferior. The DF image of the Alderson phantom processed by the adaptive histogram equalization was better in showing anatomical landmarks than the film portal image. The DF image integrated for 1 sec. which is used for movie mode can show patient movement during treatment. (author)

  18. HALO: a reconfigurable image enhancement and multisensor fusion system

    Science.gov (United States)

    Wu, F.; Hickman, D. L.; Parker, Steve J.

    2014-06-01

    Contemporary high definition (HD) cameras and affordable infrared (IR) imagers are set to dramatically improve the effectiveness of security, surveillance and military vision systems. However, the quality of imagery is often compromised by camera shake, or poor scene visibility due to inadequate illumination or bad atmospheric conditions. A versatile vision processing system called HALO™ is presented that can address these issues, by providing flexible image processing functionality on a low size, weight and power (SWaP) platform. Example processing functions include video distortion correction, stabilisation, multi-sensor fusion and image contrast enhancement (ICE). The system is based around an all-programmable system-on-a-chip (SoC), which combines the computational power of a field-programmable gate array (FPGA) with the flexibility of a CPU. The FPGA accelerates computationally intensive real-time processes, whereas the CPU provides management and decision making functions that can automatically reconfigure the platform based on user input and scene content. These capabilities enable a HALO™ equipped reconnaissance or surveillance system to operate in poor visibility, providing potentially critical operational advantages in visually complex and challenging usage scenarios. The choice of an FPGA based SoC is discussed, and the HALO™ architecture and its implementation are described. The capabilities of image distortion correction, stabilisation, fusion and ICE are illustrated using laboratory and trials data.

  19. Design and development of an airborne multispectral imaging system

    Science.gov (United States)

    Kulkarni, Rahul R.; Bachnak, Rafic; Lyle, Stacey; Steidley, Carl W.

    2002-08-01

    Advances in imaging technology and sensors have made airborne remote sensing systems viable for many applications that require reasonably good resolution at low cost. Digital cameras are making their mark on the market by providing high resolution at very high rates. This paper describes an aircraft-mounted imaging system (AMIS) that is being designed and developed at Texas A&M University-Corpus Christi (A&M-CC) with the support of a grant from NASA. The approach is to first develop and test a one-camera system that will be upgraded into a five-camera system that offers multi-spectral capabilities. AMIS will be low cost, rugged, portable and has its own battery power source. Its immediate use will be to acquire images of the Coastal area in the Gulf of Mexico for a variety of studies covering vast spectra from near ultraviolet region to near infrared region. This paper describes AMIS and its characteristics, discusses the process for selecting the major components, and presents the progress.

  20. Microcomputer-based image processing system for CT/MRI scans II

    International Nuclear Information System (INIS)

    Kwok, J.C.K.; Yu, P.K.N.; Cheng, A.Y.S.; Ho, W.C.

    1991-01-01

    This paper reports that a microcomputer-based image processing system is used to digitize and process serial sections of CT/MRI scan and reconstruct three-dimensional images of brain structures and brain lesions. The images grabbed also serve as templates and different vital regions with different risk values are also traced out for 3D reconstruction. A knowledge-based system employing rule-based programming has been built to help identifying brain lesions and to help planning trajectory for operations. The volumes of the lesions are also automatically determined. Such system is very useful for medical skills archival, tumor size monitoring, survival and outcome forecasting, and consistent neurosurgical planning

  1. Automation of chromosomes analysis. Automatic system for image processing

    International Nuclear Information System (INIS)

    Le Go, R.; Cosnac, B. de; Spiwack, A.

    1975-01-01

    The A.S.T.I. is an automatic system relating to the fast conversational processing of all kinds of images (cells, chromosomes) converted to a numerical data set (120000 points, 16 grey levels stored in a MOS memory) through a fast D.O. analyzer. The system performs automatically the isolation of any individual image, the area and weighted area of which are computed. These results are directly displayed on the command panel and can be transferred to a mini-computer for further computations. A bright spot allows parts of an image to be picked out and the results to be displayed. This study is particularly directed towards automatic karyo-typing [fr

  2. TL dosimetry for quality control of CR mammography imaging systems

    Science.gov (United States)

    Gaona, E.; Nieto, J. A.; Góngora, J. A. I. D.; Arreola, M.; Enríquez, J. G. F.

    The aim of this work is to estimate the average glandular dose with thermoluminescent (TL) dosimetry and comparison with quality imaging in computed radiography (CR) mammography. For a measuring dose, the Food and Drug Administration (FDA) and the American College of Radiology (ACR) use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, full field digital mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium flourohalideE We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated X-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose greater than 3.0 mGy without demonstrating improved image quality. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement for X-rays with a HVL (0.35-0.38 mmAl) and kVp (24-26) used in quality control procedures with ACR Mammography Accreditation Phantom.

  3. 21 CFR 892.1660 - Non-image-intensified fluoroscopic x-ray system.

    Science.gov (United States)

    2010-04-01

    ... fluoroscopic x-ray system. (a) Identification. A non-image-intensified fluoroscopic x-ray system is a device... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-image-intensified fluoroscopic x-ray system... display equipment, patient and equipment supports, component parts, and accessories. (b) Classification...

  4. A High-resolution Multi-wavelength Simultaneous Imaging System with Solar Adaptive Optics

    Energy Technology Data Exchange (ETDEWEB)

    Rao, Changhui; Zhu, Lei; Gu, Naiting; Rao, Xuejun; Zhang, Lanqiang; Bao, Hua; Kong, Lin; Guo, Youming; Zhong, Libo; Ma, Xue’an; Li, Mei; Wang, Cheng; Zhang, Xiaojun; Fan, Xinlong; Chen, Donghong; Feng, Zhongyi; Wang, Xiaoyun; Wang, Zhiyong, E-mail: gunaiting@ioe.ac.cn [The Key Laboratory on Adaptive Optics, Chinese Academy of Sciences, P.O. Box 350, Shuangliu, Chengdu 610209, Sichuan (China)

    2017-10-01

    A high-resolution multi-wavelength simultaneous imaging system from visible to near-infrared bands with a solar adaptive optics system, in which seven imaging channels, including the G band (430.5 nm), the Na i line (589 nm), the H α line (656.3 nm), the TiO band (705.7 nm), the Ca ii IR line (854.2 nm), the He i line (1083 nm), and the Fe i line (1565.3 nm), are chosen, is developed to image the solar atmosphere from the photosphere layer to the chromosphere layer. To our knowledge, this is the solar high-resolution imaging system with the widest spectral coverage. This system was demonstrated at the 1 m New Vaccum Solar Telescope and the on-sky high-resolution observational results were acquired. In this paper, we will illustrate the design and performance of the imaging system. The calibration and the data reduction of the system are also presented.

  5. Image Acquisition of Robust Vision Systems to Monitor Blurred Objects in Hazy Smoking Environments

    International Nuclear Information System (INIS)

    Ahn, Yongjin; Park, Seungkyu; Baik, Sunghoon; Kim, Donglyul; Nam, Sungmo; Jeong, Kyungmin

    2014-01-01

    Image information in disaster area or radiation area of nuclear industry is an important data for safety inspection and preparing appropriate damage control plans. So, robust vision system for structures and facilities in blurred smoking environments, such as the places of a fire and detonation, is essential in remote monitoring. Vision systems can't acquire an image when the illumination light is blocked by disturbance materials, such as smoke, fog, dust. The vision system based on wavefront correction can be applied to blurred imaging environments and the range-gated imaging system can be applied to both of blurred imaging and darken light environments. Wavefront control is a widely used technique to improve the performance of optical systems by actively correcting wavefront distortions, such as atmospheric turbulence, thermally-induced distortions, and laser or laser device aberrations, which can reduce the peak intensity and smear an acquired image. The principal applications of wavefront control are for improving the image quality in optical imaging systems such as infrared astronomical telescopes, in imaging and tracking rapidly moving space objects, and in compensating for laser beam distortion through the atmosphere. A conventional wavefront correction system consists of a wavefront sensor, a deformable mirror and a control computer. The control computer measures the wavefront distortions using a wavefront sensor and corrects it using a deformable mirror in a closed-loop. Range-gated imaging (RGI) is a direct active visualization technique using a highly sensitive image sensor and a high intensity illuminant. Currently, the range-gated imaging technique providing 2D and 3D images is one of emerging active vision technologies. The range-gated imaging system gets vision information by summing time sliced vision images. In the RGI system, a high intensity illuminant illuminates for ultra-short time and a highly sensitive image sensor is gated by ultra

  6. Image Acquisition of Robust Vision Systems to Monitor Blurred Objects in Hazy Smoking Environments

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Yongjin; Park, Seungkyu; Baik, Sunghoon; Kim, Donglyul; Nam, Sungmo; Jeong, Kyungmin [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-05-15

    Image information in disaster area or radiation area of nuclear industry is an important data for safety inspection and preparing appropriate damage control plans. So, robust vision system for structures and facilities in blurred smoking environments, such as the places of a fire and detonation, is essential in remote monitoring. Vision systems can't acquire an image when the illumination light is blocked by disturbance materials, such as smoke, fog, dust. The vision system based on wavefront correction can be applied to blurred imaging environments and the range-gated imaging system can be applied to both of blurred imaging and darken light environments. Wavefront control is a widely used technique to improve the performance of optical systems by actively correcting wavefront distortions, such as atmospheric turbulence, thermally-induced distortions, and laser or laser device aberrations, which can reduce the peak intensity and smear an acquired image. The principal applications of wavefront control are for improving the image quality in optical imaging systems such as infrared astronomical telescopes, in imaging and tracking rapidly moving space objects, and in compensating for laser beam distortion through the atmosphere. A conventional wavefront correction system consists of a wavefront sensor, a deformable mirror and a control computer. The control computer measures the wavefront distortions using a wavefront sensor and corrects it using a deformable mirror in a closed-loop. Range-gated imaging (RGI) is a direct active visualization technique using a highly sensitive image sensor and a high intensity illuminant. Currently, the range-gated imaging technique providing 2D and 3D images is one of emerging active vision technologies. The range-gated imaging system gets vision information by summing time sliced vision images. In the RGI system, a high intensity illuminant illuminates for ultra-short time and a highly sensitive image sensor is gated by ultra

  7. Efficient Lossy Compression for Compressive Sensing Acquisition of Images in Compressive Sensing Imaging Systems

    Directory of Open Access Journals (Sweden)

    Xiangwei Li

    2014-12-01

    Full Text Available Compressive Sensing Imaging (CSI is a new framework for image acquisition, which enables the simultaneous acquisition and compression of a scene. Since the characteristics of Compressive Sensing (CS acquisition are very different from traditional image acquisition, the general image compression solution may not work well. In this paper, we propose an efficient lossy compression solution for CS acquisition of images by considering the distinctive features of the CSI. First, we design an adaptive compressive sensing acquisition method for images according to the sampling rate, which could achieve better CS reconstruction quality for the acquired image. Second, we develop a universal quantization for the obtained CS measurements from CS acquisition without knowing any a priori information about the captured image. Finally, we apply these two methods in the CSI system for efficient lossy compression of CS acquisition. Simulation results demonstrate that the proposed solution improves the rate-distortion performance by 0.4~2 dB comparing with current state-of-the-art, while maintaining a low computational complexity.

  8. Special feature on imaging systems and techniques

    Science.gov (United States)

    Yang, Wuqiang; Giakos, George

    2013-07-01

    The IEEE International Conference on Imaging Systems and Techniques (IST'2012) was held in Manchester, UK, on 16-17 July 2012. The participants came from 26 countries or regions: Austria, Brazil, Canada, China, Denmark, France, Germany, Greece, India, Iran, Iraq, Italy, Japan, Korea, Latvia, Malaysia, Norway, Poland, Portugal, Sweden, Switzerland, Taiwan, Tunisia, UAE, UK and USA. The technical program of the conference consisted of a series of scientific and technical sessions, exploring physical principles, engineering and applications of new imaging systems and techniques, as reflected by the diversity of the submitted papers. Following a rigorous review process, a total of 123 papers were accepted, and they were organized into 30 oral presentation sessions and a poster session. In addition, six invited keynotes were arranged. The conference not only provided the participants with a unique opportunity to exchange ideas and disseminate research outcomes but also paved a way to establish global collaboration. Following the IST'2012, a total of 55 papers, which were technically extended substantially from their versions in the conference proceeding, were submitted as regular papers to this special feature of Measurement Science and Technology . Following a rigorous reviewing process, 25 papers have been finally accepted for publication in this special feature and they are organized into three categories: (1) industrial tomography, (2) imaging systems and techniques and (3) image processing. These papers not only present the latest developments in the field of imaging systems and techniques but also offer potential solutions to existing problems. We hope that this special feature provides a good reference for researchers who are active in the field and will serve as a catalyst to trigger further research. It has been our great pleasure to be the guest editors of this special feature. We would like to thank the authors for their contributions, without which it would

  9. Singular value decomposition analysis of a photoacoustic imaging system and 3D imaging at 0.7 FPS.

    Science.gov (United States)

    Roumeliotis, Michael B; Stodilka, Robert Z; Anastasio, Mark A; Ng, Eldon; Carson, Jeffrey J L

    2011-07-04

    Photoacoustic imaging is a non-ionizing imaging modality that provides contrast consistent with optical imaging techniques while the resolution and penetration depth is similar to ultrasound techniques. In a previous publication [Opt. Express 18, 11406 (2010)], a technique was introduced to experimentally acquire the imaging operator for a photoacoustic imaging system. While this was an important foundation for future work, we have recently improved the experimental procedure allowing for a more densely populated imaging operator to be acquired. Subsets of the imaging operator were produced by varying the transducer count as well as the measurement space temporal sampling rate. Examination of the matrix rank and the effect of contributing object space singular vectors to image reconstruction were performed. For a PAI system collecting only limited data projections, matrix rank increased linearly with transducer count and measurement space temporal sampling rate. Image reconstruction using a regularized pseudoinverse of the imaging operator was performed on photoacoustic signals from a point source, line source, and an array of point sources derived from the imaging operator. As expected, image quality increased for each object with increasing transducer count and measurement space temporal sampling rate. Using the same approach, but on experimentally sampled photoacoustic signals from a moving point-like source, acquisition, data transfer, reconstruction and image display took 1.4 s using one laser pulse per 3D frame. With relatively simple hardware improvements to data transfer and computation speed, our current imaging results imply that acquisition and display of 3D photoacoustic images at laser repetition rates of 10Hz is easily achieved.

  10. Adaptive Image Transmission Scheme over Wavelet-Based OFDM System

    Institute of Scientific and Technical Information of China (English)

    GAOXinying; YUANDongfeng; ZHANGHaixia

    2005-01-01

    In this paper an adaptive image transmission scheme is proposed over Wavelet-based OFDM (WOFDM) system with Unequal error protection (UEP) by the design of non-uniform signal constellation in MLC. Two different data division schemes: byte-based and bitbased, are analyzed and compared. Different bits are protected unequally according to their different contribution to the image quality in bit-based data division scheme, which causes UEP combined with this scheme more powerful than that with byte-based scheme. Simulation results demonstrate that image transmission by UEP with bit-based data division scheme presents much higher PSNR values and surprisingly better image quality. Furthermore, by considering the tradeoff of complexity and BER performance, Haar wavelet with the shortest compactly supported filter length is the most suitable one among orthogonal Daubechies wavelet series in our proposed system.

  11. An expert image analysis system for chromosome analysis application

    International Nuclear Information System (INIS)

    Wu, Q.; Suetens, P.; Oosterlinck, A.; Van den Berghe, H.

    1987-01-01

    This paper reports a recent study on applying a knowledge-based system approach as a new attempt to solve the problem of chromosome classification. A theoretical framework of an expert image analysis system is proposed, based on such a study. In this scheme, chromosome classification can be carried out under a hypothesize-and-verify paradigm, by integrating a rule-based component, in which the expertise of chromosome karyotyping is formulated with an existing image analysis system which uses conventional pattern recognition techniques. Results from the existing system can be used to bring in hypotheses, and with the rule-based verification and modification procedures, improvement of the classification performance can be excepted

  12. 3D gamma-ray imaging systems in nuclear medicine and collimator purposes

    International Nuclear Information System (INIS)

    Strocovsky, S.G.; Otero, D.

    2013-01-01

    Single photon gamma-ray imaging systems, currently used in Nuclear Medicine, are fundamentally based on the Gamma Camera (CG) and their associated SPECT technique. The modern CG presents no essential changes in the method used to form the image compared to the camera designed by H. O. Anger (Pat US 3.011.057, 1961).The current CG, as well as the proposed by Anger, uses a collimator for the formation of images. However, this element imposes a severe limit on the maximum attainable spatial resolution and dramatically decreases the sensitivity of the whole system. As a result, CG images are, generally, low quality with high Poisson noise. On the other hand, Strocovsky, S. and D. Otero, have presented the principles of a new technique, called Full Aperture Imaging (FAI) based on a novel coded imaging technique and differential detection. FAI does not use a collimator and outperforms the CG, in sensitivity and spatial resolution. In addition, FAI allows to register 3D information in a single acquisition, while SPECT requires sequential acquisition of images for the same purpose. In this paper, a review of the gamma-ray imaging systems developed to the present is made. Several types of SPECT systems, coded imaging systems, diffractive lenses, Compton camera, multiple no-planar detectors/collimators modules and the new FAI system are included. The role of collimators in the formation of CG images is critically examined and compared to the method used in FAI. Simulated Monte Carlo Images that allow to compare CG versus FAI in identical conditions are shown. We propose a novel use of collimators in FAI, for reduction of the field of view, with 100% collection efficiency. FAI is based on data-intensive computing and in proven conventional planar detectors of CG technology, so FAI surpasses the other described systems in the combination of sensitivity, spatial resolution, 3D information acquisition, and simplicity of design. (author)

  13. Imaging cytometry in a plastic ultra-mobile system

    Science.gov (United States)

    Martínez Vázquez, R.; Trotta, G.; Paturzo, M.; Volpe, A.; Bernava, G.; Basile, V.; Ancona, A.; Ferraro, P.; Fassi, I.; Osellame, R.

    2017-03-01

    We present a cost-effective and highly-portable plastic prototype that can be interfaced with a cell phone to implement an optofluidic imaging cytometry platform. It is based on a PMMA microfluidic chip that fits inside an opto-mechanical platform fabricated by a 3D printer. The fluorescence excitation and imaging is performed using the LED and the CMOS from the cell phone increasing the compactness of the system. A custom developed application is used to analyze the images and provide a value of particle concentration.

  14. Microvax-based data management and reduction system for the regional planetary image facilities

    Science.gov (United States)

    Arvidson, R.; Guinness, E.; Slavney, S.; Weiss, B.

    1987-01-01

    Presented is a progress report for the Regional Planetary Image Facilities (RPIF) prototype image data management and reduction system being jointly implemented by Washington University and the USGS, Flagstaff. The system will consist of a MicroVAX with a high capacity (approx 300 megabyte) disk drive, a compact disk player, an image display buffer, a videodisk player, USGS image processing software, and SYSTEM 1032 - a commercial relational database management package. The USGS, Flagstaff, will transfer their image processing software including radiometric and geometric calibration routines, to the MicroVAX environment. Washington University will have primary responsibility for developing the database management aspects of the system and for integrating the various aspects into a working system.

  15. MO-G-17A-01: Innovative High-Performance PET Imaging System for Preclinical Imaging and Translational Researches

    Energy Technology Data Exchange (ETDEWEB)

    Sun, X [University of Texas MD Anderson Cancer Center, Houston, TX (United States); Lou, K [University of Texas MD Anderson Cancer Center, Houston, TX (United States); Rice University, Houston, TX (United States); Deng, Z [Tsinghua University, Beijing (China); Shao, Y

    2014-06-15

    Purpose: To develop a practical and compact preclinical PET with innovative technologies for substantially improved imaging performance required for the advanced imaging applications. Methods: Several key components of detector, readout electronics and data acquisition have been developed and evaluated for achieving leapfrogged imaging performance over a prototype animal PET we had developed. The new detector module consists of an 8×8 array of 1.5×1.5×30 mm{sup 3} LYSO scintillators with each end coupled to a latest 4×4 array of 3×3 mm{sup 2} Silicon Photomultipliers (with ∼0.2 mm insensitive gap between pixels) through a 2.0 mm thick transparent light spreader. Scintillator surface and reflector/coupling were designed and fabricated to reserve air-gap to achieve higher depth-of-interaction (DOI) resolution and other detector performance. Front-end readout electronics with upgraded 16-ch ASIC was newly developed and tested, so as the compact and high density FPGA based data acquisition and transfer system targeting 10M/s coincidence counting rate with low power consumption. The new detector module performance of energy, timing and DOI resolutions with the data acquisition system were evaluated. Initial Na-22 point source image was acquired with 2 rotating detectors to assess the system imaging capability. Results: No insensitive gaps at the detector edge and thus it is capable for tiling to a large-scale detector panel. All 64 crystals inside the detector were clearly separated from a flood-source image. Measured energy, timing, and DOI resolutions are around 17%, 2.7 ns and 1.96 mm (mean value). Point source image is acquired successfully without detector/electronics calibration and data correction. Conclusion: Newly developed advanced detector and readout electronics will be enable achieving targeted scalable and compact PET system in stationary configuration with >15% sensitivity, ∼1.3 mm uniform imaging resolution, and fast acquisition counting rate

  16. MO-G-17A-01: Innovative High-Performance PET Imaging System for Preclinical Imaging and Translational Researches

    International Nuclear Information System (INIS)

    Sun, X; Lou, K; Deng, Z; Shao, Y

    2014-01-01

    Purpose: To develop a practical and compact preclinical PET with innovative technologies for substantially improved imaging performance required for the advanced imaging applications. Methods: Several key components of detector, readout electronics and data acquisition have been developed and evaluated for achieving leapfrogged imaging performance over a prototype animal PET we had developed. The new detector module consists of an 8×8 array of 1.5×1.5×30 mm 3 LYSO scintillators with each end coupled to a latest 4×4 array of 3×3 mm 2 Silicon Photomultipliers (with ∼0.2 mm insensitive gap between pixels) through a 2.0 mm thick transparent light spreader. Scintillator surface and reflector/coupling were designed and fabricated to reserve air-gap to achieve higher depth-of-interaction (DOI) resolution and other detector performance. Front-end readout electronics with upgraded 16-ch ASIC was newly developed and tested, so as the compact and high density FPGA based data acquisition and transfer system targeting 10M/s coincidence counting rate with low power consumption. The new detector module performance of energy, timing and DOI resolutions with the data acquisition system were evaluated. Initial Na-22 point source image was acquired with 2 rotating detectors to assess the system imaging capability. Results: No insensitive gaps at the detector edge and thus it is capable for tiling to a large-scale detector panel. All 64 crystals inside the detector were clearly separated from a flood-source image. Measured energy, timing, and DOI resolutions are around 17%, 2.7 ns and 1.96 mm (mean value). Point source image is acquired successfully without detector/electronics calibration and data correction. Conclusion: Newly developed advanced detector and readout electronics will be enable achieving targeted scalable and compact PET system in stationary configuration with >15% sensitivity, ∼1.3 mm uniform imaging resolution, and fast acquisition counting rate capability

  17. Development of EPSILON. A gamma ray imaging system for the nuclear industry

    International Nuclear Information System (INIS)

    Durrant, P.T.

    1999-06-01

    In recent years, much effort has been focused on the need to characterise, stabilise, decontaminate and eventually decommission radioactively contaminated nuclear facilities. These tasks can be complex and hazardous and are often hampered by a lack of knowledge of the nature and distribution of the contamination. A gamma-ray imaging system, capable of remotely mapping a contaminated scene, could be a useful tool in many tasks related to the decommissioning of nuclear facilities. This thesis describes and discusses the design, development, commissioning and characterisation of EPSILON, a multipurpose gamma-ray imaging system designed to meet the needs of a range of applications in the nuclear industry. Following a review of the range of potential applications and a critical assessment of the imaging systems available at the time, a set of design criteria for a multi-purpose gamma-ray imaging system are identified. The design and development of an imaging system to meet these criteria is described in detail. Suitable image-formation techniques are discussed and a pinhole collimator selected as the most appropriate. Consideration is given to the use of a scintillator-photodiode array as the imager detection plane but this option is rejected in favour of a position-sensitive photomultiplier tube (PSPMT). The development of two data-acquisition systems is described and comparisons made between the performance of these two techniques. The factors affecting the performance and image quality of this pinhole imaging system are discussed and a prototype design presented for a well-shielded, high-sensitivity imager. Experimental results obtained with this prototype are presented. These results demonstrate a good angular resolution of 1.6 deg across a 12.8 deg FOV and a factor of 7 improvement in sensitivity over a comparable resolution, single-pixel scanning-system. The spectral resolution of this prototype imager did not meet the design criteria. A modified design is

  18. [Current situations and problems of quality control for medical imaging display systems].

    Science.gov (United States)

    Shibutani, Takayuki; Setojima, Tsuyoshi; Ueda, Katsumi; Takada, Katsumi; Okuno, Teiichi; Onoguchi, Masahisa; Nakajima, Tadashi; Fujisawa, Ichiro

    2015-04-01

    Diagnostic imaging has been shifted rapidly from film to monitor diagnostic. Consequently, Japan medical imaging and radiological systems industries association (JIRA) have recommended methods of quality control (QC) for medical imaging display systems. However, in spite of its need by majority of people, executing rate is low. The purpose of this study was to validate the problem including check items about QC for medical imaging display systems. We performed acceptance test of medical imaging display monitors based on Japanese engineering standards of radiological apparatus (JESRA) X-0093*A-2005 to 2009, and performed constancy test based on JESRA X-0093*A-2010 from 2010 to 2012. Furthermore, we investigated the cause of trouble and repaired number. Medical imaging display monitors had 23 inappropriate monitors about visual estimation, and all these monitors were not criteria of JESRA about luminance uniformity. Max luminance was significantly lower year-by-year about measurement estimation, and the 29 monitors did not meet the criteria of JESRA about luminance deviation. Repaired number of medical imaging display monitors had 25, and the cause was failure liquid crystal panel. We suggested the problems about medical imaging display systems.

  19. Gamma–neutron imaging system utilizing pulse shape discrimination with CLYC

    International Nuclear Information System (INIS)

    Whitney, Chad M.; Soundara-Pandian, Lakshmi; Johnson, Erik B.; Vogel, Sam; Vinci, Bob; Squillante, Michael; Glodo, Jarek; Christian, James F.

    2015-01-01

    Recently, RMD has investigated the use of CLYC (Cs 2 LiYCl 6 :Ce), a new and emerging scintillation material, in a gamma–neutron coded aperture imaging system based on RMD's commercial RadCam TM instrument. CLYC offers efficient thermal neutron detection, fast neutron detection capabilities, excellent pulse shape discrimination (PSD), and gamma-ray energy resolution as good as 4% at 662 keV. PSD improves the isolation of higher energy gammas from thermal neutron interactions (>3 MeV electron equivalent peak), compared to conventional pulse height techniques. The scintillation emission time in CLYC provides the basis for PSD; where neutron interactions result in a slower emission rise and decay components while gamma interactions result in a faster emission components. By creating a population plot based on the ratio of the decay tail compared to the total integral amplitude (PSD ratio), discrimination of gammas, thermal neutrons, and fast neutrons is possible. Previously, we characterized the CLYC-based RadCam system for imaging gammas and neutrons using a layered W-Cd coded aperture mask and employing only pulse height discrimination. In this paper, we present the latest results which investigate gamma-neutron imaging capabilities using PSD. An FPGA system is used to acquire the CLYC–PSPMT last dynode signals, determine a PSD ratio for each event, and compare it to a calibrated PSD cutoff. Each event is assigned either a gamma (low) or neutron (high) flag signal which is then correlated with the imaging information for each event. - Highlights: • The latest results are presented for our CLYC RadCam-2 system which investigate gamma–neutron imaging using pulse shape discrimination. • CLYC RadCam-2 system successfully discriminates gammas, thermal neutrons, and fast neutrons by employing a fully integrated, FPGA-based PSD system. • Imaging of our 252 Cf source was possible using both pulse height and pulse shape discrimination with CLYC. • Imaging

  20. Automated radial basis function neural network based image classification system for diabetic retinopathy detection in retinal images

    Science.gov (United States)

    Anitha, J.; Vijila, C. Kezi Selva; Hemanth, D. Jude

    2010-02-01

    Diabetic retinopathy (DR) is a chronic eye disease for which early detection is highly essential to avoid any fatal results. Image processing of retinal images emerge as a feasible tool for this early diagnosis. Digital image processing techniques involve image classification which is a significant technique to detect the abnormality in the eye. Various automated classification systems have been developed in the recent years but most of them lack high classification accuracy. Artificial neural networks are the widely preferred artificial intelligence technique since it yields superior results in terms of classification accuracy. In this work, Radial Basis function (RBF) neural network based bi-level classification system is proposed to differentiate abnormal DR Images and normal retinal images. The results are analyzed in terms of classification accuracy, sensitivity and specificity. A comparative analysis is performed with the results of the probabilistic classifier namely Bayesian classifier to show the superior nature of neural classifier. Experimental results show promising results for the neural classifier in terms of the performance measures.

  1. Three-dimensional image acquisition and reconstruction system on a mobile device based on computer-generated integral imaging.

    Science.gov (United States)

    Erdenebat, Munkh-Uchral; Kim, Byeong-Jun; Piao, Yan-Ling; Park, Seo-Yeon; Kwon, Ki-Chul; Piao, Mei-Lan; Yoo, Kwan-Hee; Kim, Nam

    2017-10-01

    A mobile three-dimensional image acquisition and reconstruction system using a computer-generated integral imaging technique is proposed. A depth camera connected to the mobile device acquires the color and depth data of a real object simultaneously, and an elemental image array is generated based on the original three-dimensional information for the object, with lens array specifications input into the mobile device. The three-dimensional visualization of the real object is reconstructed on the mobile display through optical or digital reconstruction methods. The proposed system is implemented successfully and the experimental results certify that the system is an effective and interesting method of displaying real three-dimensional content on a mobile device.

  2. Fusion of Images from Dissimilar Sensor Systems

    National Research Council Canada - National Science Library

    Chow, Khin

    2004-01-01

    Different sensors exploit different regions of the electromagnetic spectrum; therefore a multi-sensor image fusion system can take full advantage of the complementary capabilities of individual sensors in the suit...

  3. Development of a personalized training system using the Lung Image Database Consortium and Image Database resource Initiative Database.

    Science.gov (United States)

    Lin, Hongli; Wang, Weisheng; Luo, Jiawei; Yang, Xuedong

    2014-12-01

    The aim of this study was to develop a personalized training system using the Lung Image Database Consortium (LIDC) and Image Database resource Initiative (IDRI) Database, because collecting, annotating, and marking a large number of appropriate computed tomography (CT) scans, and providing the capability of dynamically selecting suitable training cases based on the performance levels of trainees and the characteristics of cases are critical for developing a efficient training system. A novel approach is proposed to develop a personalized radiology training system for the interpretation of lung nodules in CT scans using the Lung Image Database Consortium (LIDC) and Image Database Resource Initiative (IDRI) database, which provides a Content-Boosted Collaborative Filtering (CBCF) algorithm for predicting the difficulty level of each case of each trainee when selecting suitable cases to meet individual needs, and a diagnostic simulation tool to enable trainees to analyze and diagnose lung nodules with the help of an image processing tool and a nodule retrieval tool. Preliminary evaluation of the system shows that developing a personalized training system for interpretation of lung nodules is needed and useful to enhance the professional skills of trainees. The approach of developing personalized training systems using the LIDC/IDRL database is a feasible solution to the challenges of constructing specific training program in terms of cost and training efficiency. Copyright © 2014 AUR. Published by Elsevier Inc. All rights reserved.

  4. PET imaging of the autonomic nervous system

    International Nuclear Information System (INIS)

    THACKERAY, James T.; BENGEL, Frank M.

    2016-01-01

    The autonomic nervous system is the primary extrinsic control of heart rate and contractility, and is subject to adaptive and maladaptive changes in cardiovascular disease. Consequently, noninvasive assessment of neuronal activity and function is an attractive target for molecular imaging. A myriad of targeted radiotracers have been developed over the last 25 years for imaging various components of the sympathetic and parasympathetic signal cascades. While routine clinical use remains somewhat limited, a number of larger scale studies in recent years have supplied momentum to molecular imaging of autonomic signaling. Specifically, the findings of the ADMIRE HF trial directly led to United States Food and Drug Administration approval of 123I-metaiodobenzylguanidine (MIBG) for Single Photon Emission Computed Tomography (SPECT) assessment of sympathetic neuronal innervation, and comparable results have been reported using the analogous PET agent 11C-meta-hydroxyephedrine (HED). Due to the inherent capacity for dynamic quantification and higher spatial resolution, regional analysis may be better served by PET. In addition, preliminary clinical and extensive preclinical experience has provided a broad foundation of cardiovascular applications for PET imaging of the autonomic nervous system. Recent years have witnessed the growth of novel quantification techniques, expansion of multiple tracer studies, and improved understanding of the uptake of different radiotracers, such that the transitional biology of dysfunctional subcellular catecholamine handling can be distinguished from complete denervation. As a result, sympathetic neuronal molecular imaging is poised to play a role in individualized patient care, by stratifying cardiovascular risk, visualizing underlying biology, and guiding and monitoring therapy.

  5. An asynchronous, pipelined, electronic acquisition system for Active Matrix Flat-Panel Imagers (AMFPIs)

    Energy Technology Data Exchange (ETDEWEB)

    Huang, W.; Antonuk, L.E. E-mail: antonuk@umich.edu; Berry, J.; Maolinbay, M.; Martelli, C.; Mody, P.; Nassif, S.; Yeakey, M

    1999-07-11

    The development of a full-custom electronic acquisition system designed for readout of large-area active matrix flat-panel imaging arrays is reported. The arrays, which comprise two-dimensional matrices of pixels utilizing amorphous silicon thin-film transistors, are themselves under development for a wide variety of X-ray imaging applications. The acquisition system was specifically designed to facilitate detailed, quantitative investigations of the properties of these novel imaging arrays and contains significant enhancements compared to a previously developed acquisition system. These enhancements include pipelined preamplifier circuits to allow faster readout speed, expanded addressing capabilities allowing a maximum of 4096 array data lines, and on-board summing of image frames. The values of many acquisition system parameters, including timings and voltages, may be specified and downloaded from a host computer. Once acquisition is enabled, the system operates asynchronously of its host computer. The system allows image capture in both radiographic mode (corresponding to the capture of individual X-ray images), and fluoroscopic mode (corresponding to the capture of a continual series of X-ray images). A detailed description of the system architecture and the underlying motivations for the design is reported in this paper. (author)

  6. An Imaging System for Automated Characteristic Length Measurement of Debrisat Fragments

    Science.gov (United States)

    Moraguez, Mathew; Patankar, Kunal; Fitz-Coy, Norman; Liou, J.-C.; Sorge, Marlon; Cowardin, Heather; Opiela, John; Krisko, Paula H.

    2015-01-01

    The debris fragments generated by DebriSat's hypervelocity impact test are currently being processed and characterized through an effort of NASA and USAF. The debris characteristics will be used to update satellite breakup models. In particular, the physical dimensions of the debris fragments must be measured to provide characteristic lengths for use in these models. Calipers and commercial 3D scanners were considered as measurement options, but an automated imaging system was ultimately developed to measure debris fragments. By automating the entire process, the measurement results are made repeatable and the human factor associated with calipers and 3D scanning is eliminated. Unlike using calipers to measure, the imaging system obtains non-contact measurements to avoid damaging delicate fragments. Furthermore, this fully automated measurement system minimizes fragment handling, which reduces the potential for fragment damage during the characterization process. In addition, the imaging system reduces the time required to determine the characteristic length of the debris fragment. In this way, the imaging system can measure the tens of thousands of DebriSat fragments at a rate of about six minutes per fragment, compared to hours per fragment in NASA's current 3D scanning measurement approach. The imaging system utilizes a space carving algorithm to generate a 3D point cloud of the article being measured and a custom developed algorithm then extracts the characteristic length from the point cloud. This paper describes the measurement process, results, challenges, and future work of the imaging system used for automated characteristic length measurement of DebriSat fragments.

  7. Intelligent Luminance Control of Lighting Systems Based on Imaging Sensor Feedback

    Directory of Open Access Journals (Sweden)

    Haoting Liu

    2017-02-01

    Full Text Available An imaging sensor-based intelligent Light Emitting Diode (LED lighting system for desk use is proposed. In contrast to the traditional intelligent lighting system, such as the photosensitive resistance sensor-based or the infrared sensor-based system, the imaging sensor can realize a finer perception of the environmental light; thus it can guide a more precise lighting control. Before this system works, first lots of typical imaging lighting data of the desk application are accumulated. Second, a series of subjective and objective Lighting Effect Evaluation Metrics (LEEMs are defined and assessed for these datasets above. Then the cluster benchmarks of these objective LEEMs can be obtained. Third, both a single LEEM-based control and a multiple LEEMs-based control are developed to realize a kind of optimal luminance tuning. When this system works, first it captures the lighting image using a wearable camera. Then it computes the objective LEEMs of the captured image and compares them with the cluster benchmarks of the objective LEEMs. Finally, the single LEEM-based or the multiple LEEMs-based control can be implemented to get a kind of optimal lighting effect. Many experiment results have shown the proposed system can tune the LED lamp automatically according to environment luminance changes.

  8. Imaging systems and materials characterization

    International Nuclear Information System (INIS)

    Murr, L.E.

    2009-01-01

    This paper provides a broad background for the historical development and modern applications of light optical metallography, scanning and transmission electron microscopy, field-ion microscopy and several forms of scanning probe microscopes. Numerous case examples illustrating especially synergistic applications of these imaging systems are provided to demonstrate materials characterization especially in the context of structure-property-performance issues which define materials science and engineering

  9. Research on Image Reconstruction Algorithms for Tuber Electrical Resistance Tomography System

    Directory of Open Access Journals (Sweden)

    Jiang Zili

    2016-01-01

    Full Text Available The application of electrical resistance tomography (ERT technology has been expanded to the field of agriculture, and the concept of TERT (Tuber Electrical Resistance Tomography is proposed. On the basis of the research on the forward and the inverse problems of the TERT system, a hybrid algorithm based on genetic algorithm is proposed, which can be used in TERT system to monitor the growth status of the plant tubers. The image reconstruction of TERT system is different from the conventional ERT system for two phase-flow measurement. Imaging of TERT needs more precision measurement and the conventional ERT cares more about the image reconstruction speed. A variety of algorithms are analyzed and optimized for the purpose of making them suitable for TERT system. For example: linear back projection, modified Newton-Raphson and genetic algorithm. Experimental results showed that the novel hybrid algorithm is superior to other algorithm and it can effectively improve the image reconstruction quality.

  10. Developing standard transmission system for radiology reporting including key images

    International Nuclear Information System (INIS)

    Kim, Seon Chil

    2007-01-01

    Development of hospital information system and Picture Archiving Communication System is not new in the medical field, and the development of internet and information technology are also universal. In the course of such development, however, it is hard to share medical information without a refined standard format. Especially in the department of radiology, the role of PACS has become very important in interchanging information with other disparate hospital information systems. A specific system needs to be developed that radiological reports are archived into a database efficiently. This includes sharing of medical images. A model is suggested in this study in which an internal system is developed where radiologists store necessary images and transmit them is the standard international clinical format, Clinical Document Architecture, and share the information with hospitals. CDA document generator was made to generate a new file format and separate the existing storage system from the new system. This was to ensure the access to required data in XML documents. The model presented in this study added a process where crucial images in reading are inserted in the CDA radiological report generator. Therefore, this study suggests a storage and transmission model for CDA documents, which is different from the existing DICOM SR. Radiological reports could be better shared, when the application function for inserting images and the analysis of standard clinical terms are completed

  11. New imaging systems in nuclear medicine

    International Nuclear Information System (INIS)

    1989-01-01

    PCR-I, an analog coded single ring positron tomograph, demonstrates the concepts of analog coding and the utility of high resolution systems. PCR-I, with a resolution of 4.5mm, has been employed in a series of biological studies using small animals that have been highly successful and will lead to clinical application. The emphasis now is turning to even higher sensitivity instruments in order to provide adequate number of events to populate a volume image. For this purpose, we have designed and are constructing PCR-II, a cylindrical analog coded positron tomograph incorporating 12,800 small detectors coded to 1760 phototubes. The increased sensitivity is achieved by recording all events within a cylindrical source that produce annihilation radiation striking any point on the cylindrical detector. PCR-II is projected to have a sensitivity of 1.6 million counts per second for a 20 centimeter diameter sphere uniformly filled with activity at 1 μCi/cm 3 . This system, with a resolution of 3mm, will approach the limits of sensitivity and resolution for positron tomographs. It is our opinion that this system will revolutionize the concept of positron imaging

  12. System for accessing a collection of histology images using content-based strategies

    International Nuclear Information System (INIS)

    Gonzalez F; Caicedo J C; Cruz Roa A; Camargo, J; Spinel, C

    2010-01-01

    Histology images are an important resource for research, education and medical practice. The availability of image collections with reference purposes is limited to printed formats such as books and specialized journals. When histology image sets are published in digital formats, they are composed of some tens of images that do not represent the wide diversity of biological structures that can be found in fundamental tissues; making a complete histology image collection available to the general public having a great impact on research and education in different areas such as medicine, biology and natural sciences. This work presents the acquisition process of a histology image collection with 20,000 samples in digital format, from tissue processing to digital image capturing. The main purpose of collecting these images is to make them available as reference material to the academic community. In addition, this paper presents the design and architecture of a system to query and explore the image collection, using content-based image retrieval tools and text-based search on the annotations provided by experts. The system also offers novel image visualization methods to allow easy identification of interesting images among hundreds of possible pictures. The system has been developed using a service-oriented architecture and allows web-based access in http://www.informed.unal.edu.co

  13. Echocardiography Criteria for Structural Heart Disease in Patients With End-Stage Renal Disease Initiating Hemodialysis.

    Science.gov (United States)

    Hickson, LaTonya J; Negrotto, Sara M; Onuigbo, Macaulay; Scott, Christopher G; Rule, Andrew D; Norby, Suzanne M; Albright, Robert C; Casey, Edward T; Dillon, John J; Pellikka, Patricia A; Pislaru, Sorin V; Best, Patricia J M; Villarraga, Hector R; Lin, Grace; Williams, Amy W; Nkomo, Vuyisile T

    2016-03-15

    Cardiovascular disease among hemodialysis (HD) patients is linked to poor outcomes. The Acute Dialysis Quality Initiative Workgroup proposed echocardiographic (ECHO) criteria for structural heart disease (SHD) in dialysis patients. The association of SHD with important patient outcomes is not well defined. This study sought to determine prevalence of ECHO-determined SHD and its association with survival among incident HD patients. We analyzed patients who began chronic HD from 2001 to 2013 who underwent ECHO ≤1 month prior to or ≤3 months following initiation of HD (n = 654). Mean patient age was 66 ± 16 years, and 60% of patients were male. ECHO findings that met 1 or more and ≥3 of the new criteria were discovered in 87% and 54% of patients, respectively. Over a median of 2.4 years, 415 patients died: 108 (26%) died within 6 months. Five-year mortality was 62%. Age- and sex-adjusted structural heart disease variables associated with death were left ventricular ejection fraction (LVEF) ≤45% (hazard ratio [HR]: 1.48; confidence interval [CI]: 1.20 to 1.83) and right ventricular (RV) systolic dysfunction (HR: 1.68; CI: 1.35 to 2.07). An additive of higher death risk included LVEF ≤45% and RV systolic dysfunction rather than neither (HR: 2.04; CI: 1.57 to 2.67; p = 0.53 for test for interaction). Following adjustment for age, sex, race, diabetic kidney disease, and dialysis access, RV dysfunction was independently associated with death (HR: 1.66; CI 1.34 to 2.06; p < 0.001). SHD was common in our HD study population, and RV systolic dysfunction independently predicted mortality. Copyright © 2016 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  14. A study of television imaging system for fast neutron radiography

    International Nuclear Information System (INIS)

    Yoshii, Koji

    1992-01-01

    The neutron radiography with fast neutron beam is a very useful imaging technique for thicker objects, especially those composed of hydrogen-rich materials which are sometimes difficult to image by thermal neutron radiography. The fast neutron radiography has not been studied so much as the thermal neutron radiography. The fast neutron radiography has been studied at the fast neutron source reactor 'Yayoi' of the University of Tokyo built in Tokai-mura. The average neutron energy of the Yayoi is about 1 MeV, and the peak neutron flux at the core center is 0.8 x 10 12 at the maximum operating power of 2 kW. In the experiment on fast neutron radiography, a CR39 nuclear track detector has been used successfully. But in the Yayoi radiography procedure, about 24 hours were required for obtaining an imaging result. To get a prompt imaging result and a real-time imaging result, it is necessary to develop a fast neutron television system, and in this paper, a new fast neutron TV system is proposed. The main difference is the converter material sensitive to fast neutrons. The study on the fast neutron TV system was carried out by using the Baby Cyclotron of Japan Steel Works, and the good images were realized. (K.I.)

  15. Survey of on-road image projection with pixel light systems

    Science.gov (United States)

    Rizvi, Sadiq; Knöchelmann, Marvin; Ley, Peer-Phillip; Lachmayer, Roland

    2017-12-01

    HID, LED and laser-based high resolution automotive headlamps, as of late known as `pixel light systems', are at the forefront of the developing technologies paving the way for autonomous driving. In addition to light distribution capabilities that outperform Adaptive Front Lighting and Matrix Beam systems, pixel light systems provide the possibility of image projection directly onto the street. The underlying objective is to improve the driving experience, in any given scenario, in terms of safety, comfort and interaction for all road users. The focus of this work is to conduct a short survey on this state-of-the-art image projection functionality. A holistic research regarding the image projection functionality can be divided into three major categories: scenario selection, technological development and evaluation design. Consequently, the work presented in this paper is divided into three short studies. Section 1 provides a brief introduction to pixel light systems and a justification for the approach adopted for this study. Section 2 deals with the selection of scenarios (and driving maneuvers) where image projection can play a critical role. Section 3 discusses high power LED and LED array based prototypes that are currently under development. Section 4 demonstrates results from an experiment conducted to evaluate the illuminance of an image space projected using a pixel light system prototype developed at the Institute of Product Development (IPeG). Findings from this work can help to identify and advance future research work relating to: further development of pixel light systems, scenario planning, examination of optimal light sources, behavioral response studies etc.

  16. Analysis of high-throughput plant image data with the information system IAP

    Directory of Open Access Journals (Sweden)

    Klukas Christian

    2012-06-01

    Full Text Available This work presents a sophisticated information system, the Integrated Analysis Platform (IAP, an approach supporting large-scale image analysis for different species and imaging systems. In its current form, IAP supports the investigation of Maize, Barley and Arabidopsis plants based on images obtained in different spectra.

  17. Reflective optical imaging system for extreme ultraviolet wavelengths

    Science.gov (United States)

    Viswanathan, V.K.; Newnam, B.E.

    1993-05-18

    A projection reflection optical system has two mirrors in a coaxial, four reflection configuration to reproduce the image of an object. The mirrors have spherical reflection surfaces to provide a very high resolution of object feature wavelengths less than 200 [mu]m, and preferably less than 100 [mu]m. An image resolution of features less than 0.05-0.1 [mu]m, is obtained over a large area field; i.e., 25.4 mm [times] 25.4 mm, with a distortion less than 0.1 of the resolution over the image field.

  18. DIANE stationary neutron radiography system image quality and industrial applications

    International Nuclear Information System (INIS)

    Cluzeau, S.; Huet, J.; Tourneur, P. le

    1994-01-01

    The SODERN neutron radiography laboratory has operated since February 1993 using a sealed tube generator (GENIE 46). An experimental programme of characterization (dosimetry, spectroscopy) has confirmed the expected performances concerning: neutron flux intensity, neutron energy range, residual gamma flux. Results are given in a specific report [2]. This paper is devoted to the image performance reporting. ASTM and specific indicators have been used to test the image quality with various converters and films. The corresponding modulation transfer functions are to be determined from image processing. Some industrial applications have demonstrated the capabilities of the system: corrosion detection in aircraft parts, ammunitions filling testing, detection of polymer lacks in sandwich steel sheets, detection of moisture in a probe for geophysics, residual ceramic cores imaging in turbine blades. Various computerized electronic imaging systems will be tested to improve the industrial capabilities. (orig.)

  19. Dual-Particle Imaging System with Neutron Spectroscopy for Safeguard Applications

    Energy Technology Data Exchange (ETDEWEB)

    Hamel, Michael C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Weber, Thomas M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-11-01

    A dual-particle imager (DPI) has been designed that is capable of detecting gamma-ray and neutron signatures from shielded SNM. The system combines liquid organic and NaI(Tl) scintillators to form a combined Compton and neutron scatter camera. Effective image reconstruction of detected particles is a crucial component for maximizing the performance of the system; however, a key deficiency exists in the widely used iterative list-mode maximum-likelihood estimation-maximization (MLEM) image reconstruction technique. For MLEM a stopping condition is required to achieve a good quality solution but these conditions fail to achieve maximum image quality. Stochastic origin ensembles (SOE) imaging is a good candidate to address this problem as it uses Markov chain Monte Carlo to reach a stochastic steady-state solution. The application of SOE to the DPI is presented in this work.

  20. Range-Image Acquisition for Discriminated Objects in a Range-gated Robot Vision System

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seung-Kyu; Ahn, Yong-Jin; Park, Nak-Kyu; Baik, Sung-Hoon; Choi, Young-Soo; Jeong, Kyung-Min [KAERI, Daejeon (Korea, Republic of)

    2015-05-15

    The imaging capability of a surveillance vision system from harsh low-visibility environments such as in fire and detonation areas is a key function to monitor the safety of the facilities. 2D and range image data acquired from low-visibility environment are important data to assess the safety and prepare appropriate countermeasures. Passive vision systems, such as conventional camera and binocular stereo vision systems usually cannot acquire image information when the reflected light is highly scattered and absorbed by airborne particles such as fog. In addition, the image resolution captured through low-density airborne particles is decreased because the image is blurred and dimmed by the scattering, emission and absorption. Active vision systems, such as structured light vision and projected stereo vision are usually more robust for harsh environment than passive vision systems. However, the performance is considerably decreased in proportion to the density of the particles. The RGI system provides 2D and range image data from several RGI images and it moreover provides clear images from low-visibility fog and smoke environment by using the sum of time-sliced images. Nowadays, the Range-gated (RG) imaging is an emerging technology in the field of surveillance for security applications, especially in the visualization of invisible night and fog environment. Although RGI viewing was discovered in the 1960's, this technology is, nowadays becoming more applicable by virtue of the rapid development of optical and sensor technologies. Especially, this system can be adopted in robot-vision system by virtue of its compact portable configuration. In contrast to passive vision systems, this technology enables operation even in harsh environments like fog and smoke. During the past decades, several applications of this technology have been applied in target recognition and in harsh environments, such as fog, underwater vision. Also, this technology has been

  1. Range-Image Acquisition for Discriminated Objects in a Range-gated Robot Vision System

    International Nuclear Information System (INIS)

    Park, Seung-Kyu; Ahn, Yong-Jin; Park, Nak-Kyu; Baik, Sung-Hoon; Choi, Young-Soo; Jeong, Kyung-Min

    2015-01-01

    The imaging capability of a surveillance vision system from harsh low-visibility environments such as in fire and detonation areas is a key function to monitor the safety of the facilities. 2D and range image data acquired from low-visibility environment are important data to assess the safety and prepare appropriate countermeasures. Passive vision systems, such as conventional camera and binocular stereo vision systems usually cannot acquire image information when the reflected light is highly scattered and absorbed by airborne particles such as fog. In addition, the image resolution captured through low-density airborne particles is decreased because the image is blurred and dimmed by the scattering, emission and absorption. Active vision systems, such as structured light vision and projected stereo vision are usually more robust for harsh environment than passive vision systems. However, the performance is considerably decreased in proportion to the density of the particles. The RGI system provides 2D and range image data from several RGI images and it moreover provides clear images from low-visibility fog and smoke environment by using the sum of time-sliced images. Nowadays, the Range-gated (RG) imaging is an emerging technology in the field of surveillance for security applications, especially in the visualization of invisible night and fog environment. Although RGI viewing was discovered in the 1960's, this technology is, nowadays becoming more applicable by virtue of the rapid development of optical and sensor technologies. Especially, this system can be adopted in robot-vision system by virtue of its compact portable configuration. In contrast to passive vision systems, this technology enables operation even in harsh environments like fog and smoke. During the past decades, several applications of this technology have been applied in target recognition and in harsh environments, such as fog, underwater vision. Also, this technology has been

  2. 47 CFR 15.513 - Technical requirements for medical imaging systems.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Technical requirements for medical imaging... DEVICES Ultra-Wideband Operation § 15.513 Technical requirements for medical imaging systems. (a) The UWB... MHz and 10,600 MHz. (b) Operation under the provisions of this section is limited to medical imaging...

  3. TH-A-207B-02: QIBA Ultrasound Elasticity Imaging System Biomarker Qualification and User Testing of Systems

    International Nuclear Information System (INIS)

    Garra, B.

    2016-01-01

    Imaging of tissue elastic properties is a relatively new and powerful approach to one of the oldest and most important diagnostic tools. Imaging of shear wave speed with ultrasound is has been added to most high-end ultrasound systems. Understanding this exciting imaging mode aiding its most effective use in medicine can be a rewarding effort for medical physicists and other medical imaging and treatment professionals. Assuring consistent, quantitative measurements across the many ultrasound systems in a typical imaging department will constitute a major step toward realizing the great potential of this technique and other quantitative imaging. This session will target these two goals with two presentations. A. Basics and Current Implementations of Ultrasound Imaging of Shear Wave Speed and Elasticity - Shigao Chen, Ph.D. Learning objectives-To understand: Introduction: Importance of tissue elasticity measurement Strain vs. shear wave elastography (SWE), beneficial features of SWE The link between shear wave speed and material properties, influence of viscosity Generation of shear waves External vibration (Fibroscan) ultrasound radiation force Point push Supersonic push (Aixplorer) Comb push (GE Logiq E9) Detection of shear waves Motion detection from pulse-echo ultrasound Importance of frame rate for shear wave imaging Plane wave imaging detection How to achieve high effective frame rate using line-by-line scanners Shear wave speed calculation Time to peak Random sample consensus (RANSAC) Cross correlation Sources of bias and variation in SWE Tissue viscosity Transducer compression or internal pressure of organ Reflection of shear waves at boundaries B. Elasticity Imaging System Biomarker Qualification and User Testing of Systems – Brian Garra, M.D. Learning objectives-To understand: Goals Review the need for quantitative medical imaging Provide examples of quantitative imaging biomarkers Acquaint the participant with the purpose of the RSNA Quantitative Imaging

  4. TH-A-207B-02: QIBA Ultrasound Elasticity Imaging System Biomarker Qualification and User Testing of Systems

    Energy Technology Data Exchange (ETDEWEB)

    Garra, B. [FDA, Silver Spring, MD (United States)

    2016-06-15

    Imaging of tissue elastic properties is a relatively new and powerful approach to one of the oldest and most important diagnostic tools. Imaging of shear wave speed with ultrasound is has been added to most high-end ultrasound systems. Understanding this exciting imaging mode aiding its most effective use in medicine can be a rewarding effort for medical physicists and other medical imaging and treatment professionals. Assuring consistent, quantitative measurements across the many ultrasound systems in a typical imaging department will constitute a major step toward realizing the great potential of this technique and other quantitative imaging. This session will target these two goals with two presentations. A. Basics and Current Implementations of Ultrasound Imaging of Shear Wave Speed and Elasticity - Shigao Chen, Ph.D. Learning objectives-To understand: Introduction: Importance of tissue elasticity measurement Strain vs. shear wave elastography (SWE), beneficial features of SWE The link between shear wave speed and material properties, influence of viscosity Generation of shear waves External vibration (Fibroscan) ultrasound radiation force Point push Supersonic push (Aixplorer) Comb push (GE Logiq E9) Detection of shear waves Motion detection from pulse-echo ultrasound Importance of frame rate for shear wave imaging Plane wave imaging detection How to achieve high effective frame rate using line-by-line scanners Shear wave speed calculation Time to peak Random sample consensus (RANSAC) Cross correlation Sources of bias and variation in SWE Tissue viscosity Transducer compression or internal pressure of organ Reflection of shear waves at boundaries B. Elasticity Imaging System Biomarker Qualification and User Testing of Systems – Brian Garra, M.D. Learning objectives-To understand: Goals Review the need for quantitative medical imaging Provide examples of quantitative imaging biomarkers Acquaint the participant with the purpose of the RSNA Quantitative Imaging

  5. Autonomous control systems: applications to remote sensing and image processing

    Science.gov (United States)

    Jamshidi, Mohammad

    2001-11-01

    One of the main challenges of any control (or image processing) paradigm is being able to handle complex systems under unforeseen uncertainties. A system may be called complex here if its dimension (order) is too high and its model (if available) is nonlinear, interconnected, and information on the system is uncertain such that classical techniques cannot easily handle the problem. Examples of complex systems are power networks, space robotic colonies, national air traffic control system, and integrated manufacturing plant, the Hubble Telescope, the International Space Station, etc. Soft computing, a consortia of methodologies such as fuzzy logic, neuro-computing, genetic algorithms and genetic programming, has proven to be powerful tools for adding autonomy and semi-autonomy to many complex systems. For such systems the size of soft computing control architecture will be nearly infinite. In this paper new paradigms using soft computing approaches are utilized to design autonomous controllers and image enhancers for a number of application areas. These applications are satellite array formations for synthetic aperture radar interferometry (InSAR) and enhancement of analog and digital images.

  6. Imaging system models for small-bore DOI-PET scanners

    International Nuclear Information System (INIS)

    Takahashi, Hisashi; Kobayashi, Tetsuya; Yamaya, Taiga; Murayama, Hideo; Kitamura, Keishi; Hasegawa, Tomoyuki; Suga, Mikio

    2006-01-01

    Depth-of-interaction (DOI) information, which improves resolution uniformity in the field of view (FOV), is expected to lead to high-sensitivity PET scanners with small-bore detector rings. We are developing small-bore PET scanners with DOI detectors arranged in hexagonal or overlapped tetragonal patterns for small animal imaging or mammography. It is necessary to optimize the imaging system model because these scanners exhibit irregular detector sampling. In this work, we compared two imaging system models: (a) a parallel sub-LOR model in which the detector response functions (DRFs) are assumed to be uniform along the line of responses (LORs) and (b) a sub-crystal model in which each crystal is divided into a set of smaller volumes. These two models were applied to the overlapped tetragonal scanner (FOV 38.1 mm in diameter) and the hexagonal scanner (FOV 85.2 mm in diameter) simulated by GATE. We showed that the resolution non-uniformity of system model (b) was improved by 40% compared with that of system model (a) in the overlapped tetragonal scanner and that the resolution non-uniformity of system model (a) was improved by 18% compared with that of system model (b) in the hexagonal scanner. These results indicate that system model (b) should be applied to the overlapped tetragonal scanner and system model (a) should be applied to the hexagonal scanner. (author)

  7. Flexibility analysis in adolescent idiopathic scoliosis on side-bending images using the EOS imaging system.

    Science.gov (United States)

    Hirsch, C; Ilharreborde, B; Mazda, K

    2016-06-01

    Analysis of preoperative flexibility in adolescent idiopathic scoliosis (AIS) is essential to classify the curves, determine their structurality, and select the fusion levels during preoperative planning. Side-bending x-rays are the gold standard for the analysis of preoperative flexibility. The objective of this study was to examine the feasibility and performance of side-bending images taken in the standing position using the EOS imaging system. All patients who underwent preoperative assessment between April 2012 and January 2013 for AIS were prospectively included in the study. The work-up included standing AP and lateral EOS x-rays of the spine, standard side-bending x-rays in the supine position, and standing bending x-rays in the EOS booth. The irradiation dose was measured for each of the tests. Two-dimensional reducibility of the Cobb angle was measured on both types of bending x-rays. The results were based on the 50 patients in the study. No significant difference was demonstrated for reducibility of the Cobb angle between the standing side-bending images with the EOS imaging system and those in the supine position for all types of Lenke deformation. The irradiation dose was five times lower during the EOS bending imaging. The standing side-bending images in the EOS device contributed the same results as the supine images, with five times less irradiation. They should therefore be used in clinical routine. 2. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  8. Image quality of a Konica Regius 336 digital system in chest radiography

    International Nuclear Information System (INIS)

    Ostinelli, A.; Frigerio, M.; Monti, A.F.; Gelosa, S.; Tognoli, P.; Perniola, N.; Gozzi, G.

    2000-01-01

    Digital radiographic systems permit to optimize execution, depiction and storage of radiological images. Since a Regius 336 digital system (Konica Corp. Tokyo, Japan) devoted to chest radiography Department of S. Anna Hospital in Como, Italy, it was investigated its performance relative to image quality. Konica Regius 336 is a computed radiography system made of a phosphorescence detector plate which is scanned with an infrared semiconductor laser beam. The radiographic image obtained from the detector is subjected to image processing, which allows a stable output and the nonlinear curve typical of conventional radiographic systems. Image quality was assessed based on the following parameters: dose, contrast, noise and spatial resolution. As reference, it was assessed the same parameters on a Cronex 88 analogic chest-changer (DuPont Pharma, North Billerica, Mass, USA). The Regius 336 air kerma values were always higher than the analogic ones (about 10%), both with and without a chest phantom; noise was also greater than in analogic images, sometimes even doubled. The optical densities of a step wedge and the spatial resolution of the digital chest-changer are independent of the X-ray tube voltage consequent to broader optical latitude. Inversely, the analogic images of the wedges show great optical density variability as a function of the X-ray tube voltage (in a range of 2). The modulation transfer functions of the two systems have the same trend. The performance of the Konica Regius 336 is nearly equivalent to that of an analogic system. The main advantages of the digital system are a standard output, lower consumption of radiographic films, higher productiveness and better image quality standard level [it

  9. Development of Optical Molecular Imaging System for the Acquisition of Bioluminescence Signals from Small Animals

    International Nuclear Information System (INIS)

    Lee, Byeong Il; Kim, Hyeon Sik; Jeong, Hye Jin; Lee, Hyung Jae; Moon, Seung Min; Kwon, Seung Young; Jeong, Shin Young; Bom, Hee Seung; Min, Jung Joon; Choi, Eun Seo

    2009-01-01

    Optical imaging is providing great advance and improvement in genetic and molecular imaging of animals and humans. Optical imaging system consists of optical imaging devices, which carry out major function for monitoring, tracing, and imaging in most of molecular in-vivo researches. In bio-luminescent imaging, small animals containing luciferase gene locally irradiate light, and emitted photons transmitted through skin of the small animals are imaged by using a high sensitive charged coupled device (CCD) camera. In this paper, we introduced optical imaging system for the image acquisition of bio-luminescent signals emitted from small animals. In the system, Nikon lens and four LED light sources were mounted at the inside of a dark box. A cooled CCD camera equipped with a control module was used. We tested the performance of the optical imaging system using effendorf tube and light emitting bacteria which injected intravenously into CT26 tumor bearing nude mouse. The performance of implemented optical imaging system for bio-luminescence imaging was demonstrated and the feasibility of the system in small animal imaging application was proved. We anticipate this system could be a useful tool for the molecular imaging of small animals adaptable for various experimental conditions in future

  10. A photomultiplier-based secondary electron imaging system for a nuclear microprobe

    International Nuclear Information System (INIS)

    Alves, L.C.; Breese, M.B.H.; Silva, M.F. da; Soares, J.C.

    2002-01-01

    The ability to define, or recognise particular regions of interest or surface features is vital to the analysis and interpretation of spatially-resolved images collected with a nuclear microprobe. However, good topographic image contrast is difficult to accomplish using PIXE or RBS images due to their inherent insensitivity to topography, lack of elemental variation or poor statistics. Topographic image contrast is commonly obtained in scanning electron microscopy (SEM) by detecting a large flux of secondary electrons produced by the focused keV electron beam. Similar systems have not been widely used on nuclear microprobes due to ion beam intensity fluctuations, which limit the minimum resolvable contrast and present a major limitation for this technique. This paper describes a secondary electron imaging system which has been developed on the Lisbon microprobe. It is based on a scintillator, a photomultiplier operated in a pulsed mode, a pulse shaping electronic chain and ADC, and requires no changes to the existing data acquisition system. Examples of the images obtained from materials such as patterned SiGe wafers and hydrogen-implanted silicon are given, and compared with SEM or optical images

  11. Design and implementation of typical target image database system

    International Nuclear Information System (INIS)

    Qin Kai; Zhao Yingjun

    2010-01-01

    It is necessary to provide essential background data and thematic data timely in image processing and application. In fact, application is an integrating and analyzing procedure with different kinds of data. In this paper, the authors describe an image database system which classifies, stores, manages and analyzes database of different types, such as image database, vector database, spatial database, spatial target characteristics database, its design and structure. (authors)

  12. Information system for administrating and distributing color images through internet

    Directory of Open Access Journals (Sweden)

    2007-01-01

    Full Text Available The information system for administrating and distributing color images through the Internet ensures the consistent replication of color images, their storage - in an on-line data base - and predictable distribution, by means of a digitally distributed flow, based on Windows platform and POD (Print On Demand technology. The consistent replication of color images inde-pendently from the parameters of the processing equipment and from the features of the programs composing the technological flow, is ensured by the standard color management sys-tem defined by ICC (International Color Consortium, which is integrated by the Windows operation system and by the POD technology. The latter minimize the noticeable differences between the colors captured, displayed or printed by various replication equipments and/or edited by various graphical applications. The system integrated web application ensures the uploading of the color images in an on-line database and their administration and distribution among the users via the Internet. For the preservation of the data expressed by the color im-ages during their transfer along a digitally distributed flow, the software application includes an original tool ensuring the accurate replication of colors on computer displays or when printing them by means of various color printers or presses. For development and use, this application employs a hardware platform based on PC support and a competitive software platform, based on: the Windows operation system, the .NET. Development medium and the C# programming language. This information system is beneficial for creators and users of color images, the success of the printed or on-line (Internet publications depending on the sizeable, predictable and accurate replication of colors employed for the visual expression of information in every activity fields of the modern society. The herein introduced information system enables all interested persons to access the

  13. Implementing An Image Understanding System Architecture Using Pipe

    Science.gov (United States)

    Luck, Randall L.

    1988-03-01

    This paper will describe PIPE and how it can be used to implement an image understanding system. Image understanding is the process of developing a description of an image in order to make decisions about its contents. The tasks of image understanding are generally split into low level vision and high level vision. Low level vision is performed by PIPE -a high performance parallel processor with an architecture specifically designed for processing video images at up to 60 fields per second. High level vision is performed by one of several types of serial or parallel computers - depending on the application. An additional processor called ISMAP performs the conversion from iconic image space to symbolic feature space. ISMAP plugs into one of PIPE's slots and is memory mapped into the high level processor. Thus it forms the high speed link between the low and high level vision processors. The mechanisms for bottom-up, data driven processing and top-down, model driven processing are discussed.

  14. Fast MR imaging for evaluating the pancreaticobiliary system

    International Nuclear Information System (INIS)

    Takehara, Yasuo

    1999-01-01

    Due to physiological movement clinical MR applications for abdominal organs got off to a very slow start compared to MR imaging of other organs. However, with recent cutting-edge hardware technologies such as high performance gradient systems and phased-array capability, as well as software innovations including short TR fast spoiled gradient recalled acquisition in the steady state (GRASS), snapshot imaging such as single shot fast spin echo sequence (SSFSE) and echo planar imaging (EPI), scan times have been further reduced to make breath-hold imaging clinically viable and to enable semi-fluoroscopic, kinematic imaging recognition. The elimination of physiological motion has contributed to the significant improvement in image quality, or more specifically, the physiological motion that had long been problematic has been turned into a source of physiological information about pancreaticobiliary pathologies. In this article, the author reviewed the current status of fast MR technologies for examining pancreaticobiliary pathologies, stressing the functional and physiological aspects of the corresponding anatomy. The technologies included secretin MRCP, which became a powerful tool when combined with kinematic imaging

  15. Design and evaluation of a mobile bedside PET/SPECT imaging system

    Science.gov (United States)

    Studenski, Matthew Thomas

    Patients confined to an intensive care unit, the emergency room, or a surgical suite are managed without nuclear medicine procedures such as positron emission tomography (PET) or single photon emission computed tomography (SPECT). These studies have diagnostic value which can greatly benefit the physician's treatment of the patient but require that the patient is moved to a scanner. This dissertation examines the feasibility of an economical PET/SPECT system that can be brought to the bedside of an immobile patient for imaging. We chose to focus on cardiac SPECT imaging including perfusion imaging using 99mTc tracers and viability imaging using 18F tracers first because of problems arising from positioning a detector beneath a patient's bed, a requirement for the opposed detector orientation in PET imaging. Second, SPECT imaging acquiring over the anterior 180 degrees of the patient results in reduced attenuation effects due to the heart's location in the anterior portion of the body. Four studies were done to assess the clinical feasibility of the mobile system; 1) the performance of the system was evaluated in SPECT mode at both 140 keV (99mTc tracers) and 511 keV (positron emitting tracers), 2) a dynamic cardiac phantom was used to develop and test image acquisition and processing methods for the system at both energies, 3) a high energy pinhole collimator was designed to reduce the effects of high energy photon penetration through the parallel hole collimator, and 4) we estimated the radiation dose to persons that would be in the vicinity of a patient to ensure that the effective dose is below the regulatory limit. With these studies, we show that the mobile system provides an economical means of bringing nuclear medicine to an immobile patient while staying below the regulatory dose limit to other persons. The system performed well at both 140 keV and 511 keV and provided viable images of a phantom myocardium at both energies. The system does not achieve the

  16. Tank 241-C-106 in-tank imaging system operational test report

    International Nuclear Information System (INIS)

    Pedersen, L.T.

    1998-01-01

    This document presents the results of operational testing of the 241-C-106 In-Tank Video Camera Imaging System. This imaging system was installed as a component of Project W-320 to monitor sluicing and waste retrieval activities in Tank 241-C-106

  17. On-line video image processing system for real-time neutron radiography

    Energy Technology Data Exchange (ETDEWEB)

    Fujine, S; Yoneda, K; Kanda, K [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.

    1983-09-15

    The neutron radiography system installed at the E-2 experimental hole of the KUR (Kyoto University Reactor) has been used for some NDT applications in the nuclear field. The on-line video image processing system of this facility is introduced in this paper. A 0.5 mm resolution in images was obtained by using a super high quality TV camera developed for X-radiography viewing a NE-426 neutron-sensitive scintillator. The image of the NE-426 on a CRT can be observed directly and visually, thus many test samples can be sequentially observed when necessary for industrial purposes. The video image signals from the TV camera are digitized, with a 33 ms delay, through a video A/D converter (ADC) and can be stored in the image buffer (32 KB DRAM) of a microcomputer (Z-80) system. The digitized pictures are taken with 16 levels of gray scale and resolved to 240 x 256 picture elements (pixels) on a monochrome CRT, with the capability also to display 16 distinct colors on a RGB video display. The direct image of this system could be satisfactory for penetrating the side plates to test MTR type reactor fuels and for the investigation of moving objects.

  18. Improvement on image quality of single photon ECT with converging collimator system

    International Nuclear Information System (INIS)

    Murayama, Hideo; Nohara, Norimasa; Tanaka, Eiichi

    1986-01-01

    Single photon emission computed tomography (SPECT) with converging collimator system was proposed to improve quality of reconstructed images. The collimator system was designed to enhance sensitivity at the center region of field-of-view, where the probability photons escape the attenuating medium is smaller than at the off-center region. In order to evaluate efficiency of the improvement on image quality, the weighting function of projection, which is defined as relative sensitivity to the average on the lateral sampling of projection, was adopted to the image reconstruction algorithm of Radial Post Correction method. Statistical mean square noise in a reconstructed image was formulated in this method. Simulation studies using typical weighting function showed that center-enhanced weighting function brings effective improvement on image quality, especially, at the center region of cold area surrounded by annularly distributed activity. A new SPECT system was proposed as one example of the converging collimator systems. The system is composed of four gamma cameras with four fan-beam collimators, which have different focal distances one another. Simple simulation studies showed that the proposed system has reasonable center-enhanced weighting function, and the image quality based on the proposed system was fairly improved as compared with one based on uniform weighting function at the center region of the field-of-view. (author)

  19. An investigation of cerebrograph imaging system

    International Nuclear Information System (INIS)

    Chen Lianxiang; Zhang Qingling; Wang Xinhui; Luo Qikun

    1994-01-01

    A cerebrograph imaging system was investigated for the diagnosis of cerebrovascular diseases. This system can quantitatively analyse and map the regional cerebral blood flow (rCBF) and also the electroencephalography (EEG). The mapping of cerebellum-brain stem area was also realized. This system is the first one to combine the technology of nuclear medicine with electrophysiology, and thereby provide a combined information about the rCBF and the function of brain with coloured rCBF mapping, topographical EEG mapping and quantitative data at the same time. It has important value for the early diagnosis of brain diseases, especially for the cerebral vascular accident

  20. Versatile quantitative phase imaging system applied to high-speed, low noise and multimodal imaging (Conference Presentation)

    Science.gov (United States)

    Federici, Antoine; Aknoun, Sherazade; Savatier, Julien; Wattellier, Benoit F.

    2017-02-01

    Quadriwave lateral shearing interferometry (QWLSI) is a well-established quantitative phase imaging (QPI) technique based on the analysis of interference patterns of four diffraction orders by an optical grating set in front of an array detector [1]. As a QPI modality, this is a non-invasive imaging technique which allow to measure the optical path difference (OPD) of semi-transparent samples. We present a system enabling QWLSI with high-performance sCMOS cameras [2] and apply it to perform high-speed imaging, low noise as well as multimodal imaging. This modified QWLSI system contains a versatile optomechanical device which images the optical grating near the detector plane. Such a device is coupled with any kind of camera by varying its magnification. In this paper, we study the use of a sCMOS Zyla5.5 camera from Andor along with our modified QWLSI system. We will present high-speed live cell imaging, up to 200Hz frame rate, in order to follow intracellular fast motions while measuring the quantitative phase information. The structural and density information extracted from the OPD signal is complementary to the specific and localized fluorescence signal [2]. In addition, QPI detects cells even when the fluorophore is not expressed. This is very useful to follow a protein expression with time. The 10 µm spatial pixel resolution of our modified QWLSI associated to the high sensitivity of the Zyla5.5 enabling to perform high quality fluorescence imaging, we have carried out multimodal imaging revealing fine structures cells, like actin filaments, merged with the morphological information of the phase. References [1]. P. Bon, G. Maucort, B. Wattellier, and S. Monneret, "Quadriwave lateral shearing interferometry for quantitative phase microscopy of living cells," Opt. Express, vol. 17, pp. 13080-13094, 2009. [2] P. Bon, S. Lécart, E. Fort and S. Lévêque-Fort, "Fast label-free cytoskeletal network imaging in living mammalian cells," Biophysical journal, 106

  1. Implementation of a dedicated digital projectional radiographic system in thoracic imaging

    International Nuclear Information System (INIS)

    Aberle, D.R.; Batra, P.; Hayrapetian, A.S.; Brown, K.; Morioka, C.A.; Steckel, R.J.

    1988-01-01

    An integrated digital radiographic system was evaluated with respect to image quality and impact on diagnosis relative to conventional chest radiographs for a variety of focal and diffuse lung processes. Digital images were acquired with a stimulable phosphor plate detector that was scanned by a semiconductor laser for immediate digitalization to a 2,048 X 2,464 X 10-bit image. Digital images were displayed on a 2,048-line monitor and printed on 14 X 17-inch film with use of a laser film printer (Kodak). Preliminary results with this system, including the effects of user interaction with the display monitor, inverse intensity display, and regional magnification techniques, indicate that it may be successfully implemented for thoracic imaging

  2. ECAT: a new computerized tomographic imaging system for position-emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Phelps, M.E.; Hoffman, E.J.; Huang, S.C.; Kuhl, D.E.

    1977-01-01

    The ECAT was designed and developed as a complete computerized positron radionuclide imaging system capable of providing high contrast, high resolution, quantitative images in 2 dimensional and tomographic formats. Flexibility, in its various image mode options, allows it to be used for a wide variety of imaging problems

  3. A Wildlife Monitoring System Based on Wireless Image Sensor Networks

    Directory of Open Access Journals (Sweden)

    Junguo Zhang

    2014-10-01

    Full Text Available Survival and development of wildlife sustains the balance and stability of the entire ecosystem. Wildlife monitoring can provide lots of information such as wildlife species, quantity, habits, quality of life and habitat conditions, to help researchers grasp the status and dynamics of wildlife resources, and to provide basis for the effective protection, sustainable use, and scientific management of wildlife resources. Wildlife monitoring is the foundation of wildlife protection and management. Wireless Sensor Networks (WSN technology has become the most popular technology in the field of information. With advance of the CMOS image sensor technology, wireless sensor networks combined with image sensors, namely Wireless Image Sensor Networks (WISN technology, has emerged as an alternative in monitoring applications. Monitoring wildlife is one of its most promising applications. In this paper, system architecture of the wildlife monitoring system based on the wireless image sensor networks was presented to overcome the shortcomings of the traditional monitoring methods. Specifically, some key issues including design of wireless image sensor nodes and software process design have been studied and presented. A self-powered rotatable wireless infrared image sensor node based on ARM and an aggregation node designed for large amounts of data were developed. In addition, their corresponding software was designed. The proposed system is able to monitor wildlife accurately, automatically, and remotely in all-weather condition, which lays foundations for applications of wireless image sensor networks in wildlife monitoring.

  4. Imaging Freeform Optical Systems Designed with NURBS Surfaces

    Science.gov (United States)

    2015-12-01

    reflective, anastigmat 1 Introduction The imaging freeform optical systems described here are designed using non-uniform rational basis-spline (NURBS...code, but to succeed in designing NURBS freeform optical systems an optimization code is required. The motivation for developing the optical design

  5. Benchmarking the performance of fixed-image receptor digital radiographic systems part 1: a novel method for image quality analysis.

    Science.gov (United States)

    Lee, Kam L; Ireland, Timothy A; Bernardo, Michael

    2016-06-01

    This is the first part of a two-part study in benchmarking the performance of fixed digital radiographic general X-ray systems. This paper concentrates on reporting findings related to quantitative analysis techniques used to establish comparative image quality metrics. A systematic technical comparison of the evaluated systems is presented in part two of this study. A novel quantitative image quality analysis method is presented with technical considerations addressed for peer review. The novel method was applied to seven general radiographic systems with four different makes of radiographic image receptor (12 image receptors in total). For the System Modulation Transfer Function (sMTF), the use of grid was found to reduce veiling glare and decrease roll-off. The major contributor in sMTF degradation was found to be focal spot blurring. For the System Normalised Noise Power Spectrum (sNNPS), it was found that all systems examined had similar sNNPS responses. A mathematical model is presented to explain how the use of stationary grid may cause a difference between horizontal and vertical sNNPS responses.

  6. Whole body imaging system mechanism

    International Nuclear Information System (INIS)

    Carman, R.W.; Doherty, E.J.

    1980-01-01

    A radioisotope scanning apparatus for use in nuclear medicine is described in detail. The apparatus enables the quantification and spatial location of the radioactivity in a body section of a patient to be determined with high sensitivity. It consists of an array of highly focussed collimators arranged such that adjacent collimators move in the same circumferential but opposite radial directions. The explicit movements of the gantry are described in detail and may be controlled by a general purpose computer. The use of highly focussed collimators allows both a reasonable solid angle of acceptance and also high target to background images; additionally, dual radionuclide pharmaceutical studies can be performed simultaneously. It is claimed that the high sensitivity of the system permits the early diagnosis of pathological changes and the images obtained show accurately the location and shape of physiological abnormalities. (U.K.)

  7. A prototype tap test imaging system: Initial field test results

    Science.gov (United States)

    Peters, J. J.; Barnard, D. J.; Hudelson, N. A.; Simpson, T. S.; Hsu, D. K.

    2000-05-01

    This paper describes a simple, field-worthy tap test imaging system that gives quantitative information about the size, shape, and severity of defects and damages. The system consists of an accelerometer, electronic circuits for conditioning the signal and measuring the impact duration, a laptop PC and data acquisition and processing software. The images are generated manually by tapping on a grid printed on a plastic sheet laid over the part's surface. A mechanized scanner is currently under development. The prototype has produced images for a variety of aircraft composite and metal honeycomb structures containing flaws, damages, and repairs. Images of the local contact stiffness, deduced from the impact duration using a spring model, revealed quantitatively the stiffness reduction due to flaws and damages, as well as the stiffness enhancement due to substructures. The system has been field tested on commercial and military aircraft as well as rotor blades and engine decks on helicopters. Field test results will be shown and the operation of the system will be demonstrated.—This material is based upon work supported by the Federal Aviation Administration under Contract #DTFA03-98-D-00008, Delivery Order No. IA016 and performed at Iowa State University's Center for NDE as part of the Center for Aviation Systems Reliability program.

  8. Biometric iris image acquisition system with wavefront coding technology

    Science.gov (United States)

    Hsieh, Sheng-Hsun; Yang, Hsi-Wen; Huang, Shao-Hung; Li, Yung-Hui; Tien, Chung-Hao

    2013-09-01

    Biometric signatures for identity recognition have been practiced for centuries. Basically, the personal attributes used for a biometric identification system can be classified into two areas: one is based on physiological attributes, such as DNA, facial features, retinal vasculature, fingerprint, hand geometry, iris texture and so on; the other scenario is dependent on the individual behavioral attributes, such as signature, keystroke, voice and gait style. Among these features, iris recognition is one of the most attractive approaches due to its nature of randomness, texture stability over a life time, high entropy density and non-invasive acquisition. While the performance of iris recognition on high quality image is well investigated, not too many studies addressed that how iris recognition performs subject to non-ideal image data, especially when the data is acquired in challenging conditions, such as long working distance, dynamical movement of subjects, uncontrolled illumination conditions and so on. There are three main contributions in this paper. Firstly, the optical system parameters, such as magnification and field of view, was optimally designed through the first-order optics. Secondly, the irradiance constraints was derived by optical conservation theorem. Through the relationship between the subject and the detector, we could estimate the limitation of working distance when the camera lens and CCD sensor were known. The working distance is set to 3m in our system with pupil diameter 86mm and CCD irradiance 0.3mW/cm2. Finally, We employed a hybrid scheme combining eye tracking with pan and tilt system, wavefront coding technology, filter optimization and post signal recognition to implement a robust iris recognition system in dynamic operation. The blurred image was restored to ensure recognition accuracy over 3m working distance with 400mm focal length and aperture F/6.3 optics. The simulation result as well as experiment validates the proposed code

  9. A Novel Reporting System to Improve Accuracy in Appendicitis Imaging

    Science.gov (United States)

    Godwin, Benjamin D.; Drake, Frederick T.; Simianu, Vlad V.; Shriki, Jabi E.; Hippe, Daniel S.; Dighe, Manjiri; Bastawrous, Sarah; Cuevas, Carlos; Flum, David; Bhargava, Puneet

    2015-01-01

    OBJECTIVE The purpose of this study was to ascertain if standardized radiologic reporting for appendicitis imaging increases diagnostic accuracy. MATERIALS AND METHODS We developed a standardized appendicitis reporting system that includes objective imaging findings common in appendicitis and a certainty score ranging from 1 (definitely not appendicitis) through 5 (definitely appendicitis). Four radiologists retrospectively reviewed the preoperative CT scans of 96 appendectomy patients using our reporting system. The presence of appendicitis-specific imaging findings and certainty scores were compared with final pathology. These comparisons were summarized using odds ratios (ORs) and the AUC. RESULTS The appendix was visualized on CT in 89 patients, of whom 71 (80%) had pathologically proven appendicitis. Imaging findings associated with appendicitis included appendiceal diameter (odds ratio [OR] = 14 [> 10 vs appendicitis. In this initially indeterminate group, using the standardized reporting system, radiologists assigned higher certainty scores (4 or 5) in 21 of the 28 patients with appendicitis (75%) and lower scores (1 or 2) in five of the seven patients without appendicitis (71%) (AUC = 0.90; p = 0.001). CONCLUSION Standardized reporting and grading of objective imaging findings correlated well with postoperative pathology and may decrease the number of CT findings reported as indeterminate for appendicitis. Prospective evaluation of this reporting system on a cohort of patients with clinically suspected appendicitis is currently under way. PMID:26001230

  10. Radiographic imaging system for high energy radiation

    International Nuclear Information System (INIS)

    Barrett, H.H.

    1976-01-01

    A radiographic imaging system for high energy radiation utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation interspersed among regions relatively opaque to such radiation is described. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  11. Radiographic imaging system for high energy radiation

    International Nuclear Information System (INIS)

    1975-01-01

    A radiographic imaging system for high energy radiation is described utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation and interspersed among regions relatively opaque to such radiation. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  12. Two digital X-ray imaging systems for applications in X-ray diffraction

    International Nuclear Information System (INIS)

    Bateman, J.E.; Connolly, J.F.; Stephenson, R.; Flesher, A.C.; Bryant, C.J.; Lincoln, A.D.; Tucker, P.A.; Swanton, S.W.

    1986-08-01

    Two digital X-ray imaging systems developed at the Rutherford Appleton Laboratory are described:- the Mark I and the Mark II. Both use a bidimensionally sensitive Multiwire proportional counter as the basic X-ray image transducer coupled to a digital microcomputer system. The Mark I system provides the advantages of high speed, high sensitivity digital imaging directly into the computer with the potential for software control of the sample orientation and environment. The Mark II system adds the novel features of signal averaging and multi-frame exposures. (author)

  13. Method used to test the imaging consistency of binocular camera's left-right optical system

    Science.gov (United States)

    Liu, Meiying; Wang, Hu; Liu, Jie; Xue, Yaoke; Yang, Shaodong; Zhao, Hui

    2016-09-01

    To binocular camera, the consistency of optical parameters of the left and the right optical system is an important factor that will influence the overall imaging consistency. In conventional testing procedure of optical system, there lacks specifications suitable for evaluating imaging consistency. In this paper, considering the special requirements of binocular optical imaging system, a method used to measure the imaging consistency of binocular camera is presented. Based on this method, a measurement system which is composed of an integrating sphere, a rotary table and a CMOS camera has been established. First, let the left and the right optical system capture images in normal exposure time under the same condition. Second, a contour image is obtained based on the multiple threshold segmentation result and the boundary is determined using the slope of contour lines near the pseudo-contour line. Third, the constraint of gray level based on the corresponding coordinates of left-right images is established and the imaging consistency could be evaluated through standard deviation σ of the imaging grayscale difference D (x, y) between the left and right optical system. The experiments demonstrate that the method is suitable for carrying out the imaging consistency testing for binocular camera. When the standard deviation 3σ distribution of imaging gray difference D (x, y) between the left and right optical system of the binocular camera does not exceed 5%, it is believed that the design requirements have been achieved. This method could be used effectively and paves the way for the imaging consistency testing of the binocular camera.

  14. Expandable image compression system: A modular approach

    International Nuclear Information System (INIS)

    Ho, B.K.T.; Lo, S.C.; Huang, H.K.

    1986-01-01

    The full-frame bit-allocation algorithm for radiological image compression can achieve an acceptable compression ratio as high as 30:1. It involves two stages of operation: a two-dimensional discrete cosine transform and pixel quantization in the transformed space with pixel depth kept accountable by a bit-allocation table. The cosine transform hardware design took an expandable modular approach based on the VME bus system with a maximum data transfer rate of 48 Mbytes/sec and a microprocessor (Motorola 68000 family). The modules are cascadable and microprogrammable to perform 1,024-point butterfly operations. A total of 18 stages would be required for transforming a 1,000 x 1,000 image. Multiplicative constants and addressing sequences are to be software loaded into the parameter buffers of each stage prior to streaming data through the processor stages. The compression rate for 1K x 1K images is expected to be faster than one image per sec

  15. Image and information management system

    Science.gov (United States)

    Robertson, Tina L. (Inventor); Raney, Michael C. (Inventor); Dougherty, Dennis M. (Inventor); Kent, Peter C. (Inventor); Brucker, Russell X. (Inventor); Lampert, Daryl A. (Inventor)

    2009-01-01

    A system and methods through which pictorial views of an object's configuration, arranged in a hierarchical fashion, are navigated by a person to establish a visual context within the configuration. The visual context is automatically translated by the system into a set of search parameters driving retrieval of structured data and content (images, documents, multimedia, etc.) associated with the specific context. The system places ''hot spots'', or actionable regions, on various portions of the pictorials representing the object. When a user interacts with an actionable region, a more detailed pictorial from the hierarchy is presented representing that portion of the object, along with real-time feedback in the form of a popup pane containing information about that region, and counts-by-type reflecting the number of items that are available within the system associated with the specific context and search filters established at that point in time.

  16. Results from the coded aperture neutron imaging system

    International Nuclear Information System (INIS)

    Brubaker, Erik; Steele, John T.; Brennan, James S.; Marleau, Peter

    2010-01-01

    Because of their penetrating power, energetic neutrons and gamma rays (∼1 MeV) offer the best possibility of detecting highly shielded or distant special nuclear material (SNM). Of these, fast neutrons offer the greatest advantage due to their very low and well understood natural background. We are investigating a new approach to fast-neutron imaging - a coded aperture neutron imaging system (CANIS). Coded aperture neutron imaging should offer a highly efficient solution for improved detection speed, range, and sensitivity. We have demonstrated fast neutron and gamma ray imaging with several different configurations of coded masks patterns and detectors including an 'active' mask that is composed of neutron detectors. Here we describe our prototype detector and present some initial results from laboratory tests and demonstrations.

  17. Intelligent System for Data Tracking in Image Editing Company

    Directory of Open Access Journals (Sweden)

    Kimlong Ngin

    2017-11-01

    Full Text Available The success of data transaction in a company largely depends on the intelligence system used in its database and application system. The complex and heterogeneous data in the log file make it more difficult for users to manage data effectively. Therefore, this paper creates an application system that can manage data from the log file. A sample was collected from an image editing company in Cambodia by interviewing five customers and seven operators, who worked on the data files for 300 images. This paper found two results: first, the agent script was used for retrieving data from the log file, classifying data, and inserting data into a database; and second, the web interface was used for the viewing of results by the users. The intelligence capabilities of our application, together with a friendly web-based and window-based experience, allow the users to easily acquire, manage, and access the data in an image editing company.

  18. The image database management system of teaching file using personal computer

    International Nuclear Information System (INIS)

    Shin, M. J.; Kim, G. W.; Chun, T. J.; Ahn, W. H.; Baik, S. K.; Choi, H. Y.; Kim, B. G.

    1995-01-01

    For the systemic management and easy using of teaching file in radiology department, the authors tried to do the setup of a database management system of teaching file using personal computer. We used a personal computer (IBM PC compatible, 486DX2) including a image capture card(Window vision, Dooin Elect, Seoul, Korea) and video camera recorder (8mm, CCD-TR105, Sony, Tokyo, Japan) for the acquisition and storage of images. We developed the database program by using Foxpro for Window 2.6(Microsoft, Seattle, USA) executed in the Window 3.1 (Microsoft, Seattle, USA). Each datum consisted of hospital number, name, sex, age, examination date, keyword, radiologic examination modalities, final diagnosis, radiologic findings, references and representative images. The images were acquired and stored as bitmap format (8 bitmap, 540 X 390 ∼ 545 X 414, 256 gray scale) and displayed on the 17 inch-flat monitor(1024 X 768, Samtron, Seoul, Korea). Without special devices, the images acquisition and storage could be done on the reading viewbox, simply. The image quality on the computer's monitor was less than the one of original film on the viewbox, but generally the characteristics of each lesions could be differentiated. Easy retrieval of data was possible for the purpose of teaching file system. Without high cost appliances, we could consummate the image database system of teaching file using personal computer with relatively inexpensive method

  19. Implementation of a near backscattering imaging system on the National Ignition Facility

    International Nuclear Information System (INIS)

    Mackinnon, A.J.; McCarville, T.; Piston, K.; Niemann, C.; Jones, G.; Reinbachs, I.; Costa, R.; Celeste, J.; Holtmeier, G.; Griffith, R.; Kirkwood, R.; MacGowan, B.; Glenzer, S.H.; Latta, M.R.

    2004-01-01

    A near backscattering imaging diagnostic system is being implemented on the first quad of beams on the National Ignition Facility. This diagnostic images diffusing scatter plates, placed around the final focus lenses on the National Ignition Facility target chamber, to quantitatively measure the fraction of light backscattered outside of the focusing cone angle of incident laser beam. A wide-angle imaging system relays an image of light scattered outside the lens onto a gated charge coupled device camera, providing 3 mm resolution over a 2 m field of view. To account for changes of the system throughput due to exposure to target debris the system will be routinely calibrated in situ at 532 and 355 nm using a dedicated pulsed laser source

  20. Development of gamma-photon/Cerenkov-light hybrid system for simultaneous imaging of I-131 radionuclide

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Seiichi; Suzuki, Mayumi; Kato, Katsuhiko [Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine (Japan); Watabe, Tadashi; Ikeda, Hayato; Kanai, Yasukazu [Department of Molecular Imaging in Medicine, Osaka University Graduate School of Medicine (Japan); Ogata, Yoshimune [Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine (Japan); Hatazawa, Jun [Department of Molecular Imaging in Medicine, Osaka University Graduate School of Medicine (Japan)

    2016-09-11

    Although iodine 131 (I-131) is used for radionuclide therapy, high resolution images are difficult to obtain with conventional gamma cameras because of the high energy of I-131 gamma photons (364 keV). Cerenkov-light imaging is a possible method for beta emitting radionuclides, and I-131 (606 MeV maximum beta energy) is a candidate to obtain high resolution images. We developed a high energy gamma camera system for I-131 radionuclide and combined it with a Cerenkov-light imaging system to form a gamma-photon/Cerenkov-light hybrid imaging system to compare the simultaneously measured images of these two modalities. The high energy gamma imaging detector used 0.85-mm×0.85-mm×10-mm thick GAGG scintillator pixels arranged in a 44×44 matrix with a 0.1-mm thick reflector and optical coupled to a Hamamatsu 2 in. square position sensitive photomultiplier tube (PSPMT: H12700 MOD). The gamma imaging detector was encased in a 2 cm thick tungsten shield, and a pinhole collimator was mounted on its top to form a gamma camera system. The Cerenkov-light imaging system was made of a high sensitivity cooled CCD camera. The Cerenkov-light imaging system was combined with the gamma camera using optical mirrors to image the same area of the subject. With this configuration, we simultaneously imaged the gamma photons and the Cerenkov-light from I-131 in the subjects. The spatial resolution and sensitivity of the gamma camera system for I-131 were respectively ~3 mm FWHM and ~10 cps/MBq for the high sensitivity collimator at 10 cm from the collimator surface. The spatial resolution of the Cerenkov-light imaging system was 0.64 mm FWHM at 10 cm from the system surface. Thyroid phantom and rat images were successfully obtained with the developed gamma-photon/Cerenkov-light hybrid imaging system, allowing direct comparison of these two modalities. Our developed gamma-photon/Cerenkov-light hybrid imaging system will be useful to evaluate the advantages and disadvantages of these two