
Sample records for shd imaging system

  1. Dicty_cDB: SHD492 [Dicty_cDB

    Full Text Available SH (Link to library) SHD492 (Link to dictyBase) - - - Contig-U16471-1 SHD492P (Link to Original site) SHD492...F 121 SHD492Z 819 SHD492P 920 - - Show SHD492 Library SH (Link to library) Clone ID SHD492... URL Representative seq. ID SHD492...P (Link to Original site) Representative DNA sequence >SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492....Seq.d/ 805 0.0 SHD613 (SHD613Q) /CSM/SH/SHD6-A/SHD613Q.Seq.d/ 805 0.0 SHD492 (SHD492Q) /CSM/SH/SHD4-D/SHD492

  2. Dicty_cDB: SHD573 [Dicty_cDB

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  3. Experience of slowly infused high-iodine-dose contrast computed tomography (SHD) of intracranial tumors

    Muraoka, Kiyoaki; Numata, Hideharu; Hokama, Yasuo


    A study was done on 20 patients with intracranial tumors by means of the slowly infused high-iodine-dose (SHD) contrast-enhancement technique. An intravenous drip infusion of 300 ml of Angiografin was given for three hours. Computerized tomograms were taken 1 hour, (2 hours), and 3 hours after the beginning of the drip infusion. The authors divided the lesions into four groups by analyzing the sequential changes in CT numbers using a histograms or profile of the region of interest. In group I, additional lesions were visible on the SHD scan (one case of metastatic brain tumors from lung cancer). In group 2, lesions were better displayed on the SHD scan due to increased enhancement (17 cases). In group 3, SHD scans showed no change (2 cases of fibrous astrocytoma). In group 4, the enhancement was diminished, but the lesion per se was still clealy identifiable (no case). Finally, in 18 cases out of 20 (90%), an additional or better display of the lesion was detected on SHD enhanced CT. The rational for doing the SHD enhancement is to detect a lesion with a minimally impaired blood-brain barrier by exposing a prolonged high blood-iodine level, and so the scanning is delayed until detectable levels of the contrast medium have accumulated within the vascular-channel pool or extravascular space of the lesion. SHD enhancement is useful: I) for revealing any additional lesion in a metastatic brain tumor; 2) for better displaying an obscure lesion on a usual scan; 3) for differentiating the quality of the lesion (for example, malignancy or cyst formation), and 4) for predicting the prognosis of the lesion. (J.P.N.)

  4. Development of a networked four-million-pixel pathological and radiological digital image presentation system and its application to medical conferences

    Sakano, Toshikazu; Furukawa, Isao; Okumura, Akira; Yamaguchi, Takahiro; Fujii, Tetsuro; Ono, Sadayasu; Suzuki, Junji; Matsuya, Shoji; Ishihara, Teruo


    The wide spread of digital technology in the medical field has led to a demand for the high-quality, high-speed, and user-friendly digital image presentation system in the daily medical conferences. To fulfill this demand, we developed a presentation system for radiological and pathological images. It is composed of a super-high-definition (SHD) imaging system, a radiological image database (R-DB), a pathological image database (P-DB), and the network interconnecting these three. The R-DB consists of a 270GB RAID, a database server workstation, and a film digitizer. The P-DB includes an optical microscope, a four-million-pixel digital camera, a 90GB RAID, and a database server workstation. A 100Mbps Ethernet LAN interconnects all the sub-systems. The Web-based system operation software was developed for easy operation. We installed the whole system in NTT East Kanto Hospital to evaluate it in the weekly case conferences. The SHD system could display digital full-color images of 2048 x 2048 pixels on a 28-inch CRT monitor. The doctors evaluated the image quality and size, and found them applicable to the actual medical diagnosis. They also appreciated short image switching time that contributed to smooth presentation. Thus, we confirmed that its characteristics met the requirements.

  5. Self-Homodyne Detection in Optical Communication Systems

    Benjamin J. Puttnam


    Full Text Available We review work on self-homodyne detection (SHD for optical communication systems. SHD uses a transmitted pilot-tone (PT, originating from the transmitter laser, to exploit phase noise cancellation at a coherent receiver and to enable transmitter linewidth tolerance and potential energy savings. We give an overview of SHD performance, outlining the key contributors to the optical signal-to-noise ratio penalty compared to equivalent intradyne systems, and summarize the advantages, differences and similarities between schemes using polarization-division multiplexed PTs (PDM-SHD and those using space-division multiplexed PTs (SDM-SHD. For PDM-SHD, we review the extensive work on the transmission of advanced modulation formats and techniques to minimize the trade-off with spectral efficiency, as well as recent work on digital SHD, where the SHD receiver is combined with an polarization-diversity ID front-end receiver to provide both polarization and modulation format alignment. We then focus on SDM-SHD systems, describing experimental results using multi-core fibers (MCFs with up to 19 cores, including high capacity transmission with broad-linewidth lasers and experiments incorporating SDM-SHD in networking. Additionally, we discuss the requirement for polarization tracking of the PTs at the receiver and path length alignment and review some variants of SHD before outlining the future challenges of self-homodyne optical transmission and gaps in current knowledge.

  6. Imaging system

    Froggatt, R.J.


    The invention provides a two dimensional imaging system in which a pattern of radiation falling on the system is detected to give electrical signals for each of a plurality of strips across the pattern. The detection is repeated for different orientations of the strips and the whole processed by compensated back projection. For a shadow x-ray system a plurality of strip x-ray detectors are rotated on a turntable. For lower frequencies the pattern may be rotated with a Dove prism and the strips condensed to suit smaller detectors with a cylindrical lens. (author)

  7. Imaging system

    Rushbrooke, J.G.; Ansorge, R.E.


    A moving object such as a container on a conveyor belt is imaged by an optical system onto a charge coupled device array in which the lines of the array are arranged perpendicular to the direction of motion of the object. The speed of movement of the object is sensed to generate electrical signals which are processed to provide shift signals enabling the shifting of data row to row in the array in synchronism with the movement of the container. The electrical charge associated with a given point on the array is transferred from one line to the other until it appears at the last line of the array, from which it is read out in known manner in conjunction with all other electrical charges associated with the row of charge coupled devices in the last line of the array. Due to the integrating effect achieved, the aperture of the imaging system can be much smaller than otherwise would be required, and/or the level of light illumination can be reduced. The imaging system can be applied to X-ray inspection devices, aerial surveillance or scanning of moving documents in copying processes. (author)

  8. Medical Imaging System


    The MD Image System, a true-color image processing system that serves as a diagnostic aid and tool for storage and distribution of images, was developed by Medical Image Management Systems, Huntsville, AL, as a "spinoff from a spinoff." The original spinoff, Geostar 8800, developed by Crystal Image Technologies, Huntsville, incorporates advanced UNIX versions of ELAS (developed by NASA's Earth Resources Laboratory for analysis of Landsat images) for general purpose image processing. The MD Image System is an application of this technology to a medical system that aids in the diagnosis of cancer, and can accept, store and analyze images from other sources such as Magnetic Resonance Imaging.

  9. Medical imaging systems

    Frangioni, John V


    A medical imaging system provides simultaneous rendering of visible light and diagnostic or functional images. The system may be portable, and may include adapters for connecting various light sources and cameras in open surgical environments or laparascopic or endoscopic environments. A user interface provides control over the functionality of the integrated imaging system. In one embodiment, the system provides a tool for surgical pathology.

  10. Multipurpose Hyperspectral Imaging System

    Mao, Chengye; Smith, David; Lanoue, Mark A.; Poole, Gavin H.; Heitschmidt, Jerry; Martinez, Luis; Windham, William A.; Lawrence, Kurt C.; Park, Bosoon


    A hyperspectral imaging system of high spectral and spatial resolution that incorporates several innovative features has been developed to incorporate a focal plane scanner (U.S. Patent 6,166,373). This feature enables the system to be used for both airborne/spaceborne and laboratory hyperspectral imaging with or without relative movement of the imaging system, and it can be used to scan a target of any size as long as the target can be imaged at the focal plane; for example, automated inspection of food items and identification of single-celled organisms. The spectral resolution of this system is greater than that of prior terrestrial multispectral imaging systems. Moreover, unlike prior high-spectral resolution airborne and spaceborne hyperspectral imaging systems, this system does not rely on relative movement of the target and the imaging system to sweep an imaging line across a scene. This compact system (see figure) consists of a front objective mounted at a translation stage with a motorized actuator, and a line-slit imaging spectrograph mounted within a rotary assembly with a rear adaptor to a charged-coupled-device (CCD) camera. Push-broom scanning is carried out by the motorized actuator which can be controlled either manually by an operator or automatically by a computer to drive the line-slit across an image at a focal plane of the front objective. To reduce the cost, the system has been designed to integrate as many as possible off-the-shelf components including the CCD camera and spectrograph. The system has achieved high spectral and spatial resolutions by using a high-quality CCD camera, spectrograph, and front objective lens. Fixtures for attachment of the system to a microscope (U.S. Patent 6,495,818 B1) make it possible to acquire multispectral images of single cells and other microscopic objects.

  11. Medical imaging systems

    Frangioni, John V [Wayland, MA


    A medical imaging system provides simultaneous rendering of visible light and fluorescent images. The system may employ dyes in a small-molecule form that remains in a subject's blood stream for several minutes, allowing real-time imaging of the subject's circulatory system superimposed upon a conventional, visible light image of the subject. The system may also employ dyes or other fluorescent substances associated with antibodies, antibody fragments, or ligands that accumulate within a region of diagnostic significance. In one embodiment, the system provides an excitation light source to excite the fluorescent substance and a visible light source for general illumination within the same optical guide that is used to capture images. In another embodiment, the system is configured for use in open surgical procedures by providing an operating area that is closed to ambient light. More broadly, the systems described herein may be used in imaging applications where a visible light image may be usefully supplemented by an image formed from fluorescent emissions from a fluorescent substance that marks areas of functional interest.

  12. Quantitative luminescence imaging system

    Erwin, David N.; Kiel, Johnathan L.; Batishko, Charles R.; Stahl, Kurt A.


    The QLIS images and quantifies low-level chemiluminescent reactions in an electromagnetic field. It is capable of real time nonperturbing measurement and simultaneous recording of many biochemical and chemical reactions such as luminescent immunoassays or enzyme assays. The system comprises image transfer optics, a low-light level digitizing camera with image intensifying microchannel plates, an image process or, and a control computer. The image transfer optics may be a fiber image guide with a bend, or a microscope, to take the light outside of the RF field. Output of the camera is transformed into a localized rate of cumulative digitalized data or enhanced video display or hard-copy images. The system may be used as a luminescent microdosimetry device for radiofrequency or microwave radiation, as a thermal dosimeter, or in the dosimetry of ultra-sound (sonoluminescence) or ionizing radiation. It provides a near-real-time system capable of measuring the extremely low light levels from luminescent reactions in electromagnetic fields in the areas of chemiluminescence assays and thermal microdosimetry, and is capable of near-real-time imaging of the sample to allow spatial distribution analysis of the reaction. It can be used to instrument three distinctly different irradiation configurations, comprising (1) RF waveguide irradiation of a small Petri-dish-shaped sample cell, (2) RF irradiation of samples in a microscope for the microscopie imaging and measurement, and (3) RF irradiation of small to human body-sized samples in an anechoic chamber.

  13. UV irradiation of Shigella Dysenteriae induced the transformation and excision of a presumed integrated lysogenic prophage Shd-4L10 into a lytic phase

    Rodrigues, F. K.; Addy, B.; Armah, G.; Fobil, J.; Steiner-Asiedu, M.; Efavi, J.


    Repeated exposures of Shigella dysenteriae strain A to ultra-violet radiation (253.7 nm) with intervening outgrowth of survivors gave rise to clear bacteriophage plaques. Isolation, propagation and partial purification of the new Shd-4LI0 phages showed that they are similar in morphology to the Myxobacteriaphage Mx-4 described earlier. The new phages retained the general characteristics of S. dystenteriae phageShd-4L3, including serological properties and phage typing. It is suggested that ultra-violet irradiation may have played a role in the transformation and excision of the presumed lysogen of S. dysenteriaestrain A into a lytic phase. PhageShd-4LI0 was subsequently partially characterized. It has a density of 1.61, a DNA: protein ratio of 0.42 and thus a cryptogram of D/2:54.3/32.5:X/X: B/O. The phage was further characterised by fractionation of its protein using SDS-polyacrilamide gel electrophoresis. DNA extracted from phages was hydrolysed with restriction endonuclease R., EcoR1. The restriction fragments were catalogued and their apparent molecular weights calculated from electrophoresis gels calibrated with fragments from DNA of coliphageλ λ. From the total fragments obtained with nuclease R., EcoR1, the apparent minimum molecular weight of phage Shd-4LI0DNA was found to be 54.3 x 10 6 Daltons. The molecular weight of the phage DNA was also calculated from measurements of contour length of purified DNA samples, using the formula MW = 1.97 x 10 10 1/(magnification), where 1 is the measured length of DNA in centimetres). The very close relatedness with phage Shd-4L3 was confirmed by these techniques. (au)

  14. Raster images vectorization system

    Genytė, Jurgita


    The problem of raster images vectorization was analyzed and researched in this work. Existing vectorization systems are quite expensive, the results are inaccurate, and the manual vectorization of a large number of drafts is impossible. That‘s why our goal was to design and develop a new raster images vectorization system using our suggested automatic vectorization algorithm and the way to record results in a new universal vectorial file format. The work consists of these main parts: analysis...

  15. Scorpion image segmentation system

    Joseph, E.; Aibinu, A. M.; Sadiq, B. A.; Bello Salau, H.; Salami, M. J. E.


    Death as a result of scorpion sting has been a major public health problem in developing countries. Despite the high rate of death as a result of scorpion sting, little report exists in literature of intelligent device and system for automatic detection of scorpion. This paper proposed a digital image processing approach based on the floresencing characteristics of Scorpion under Ultra-violet (UV) light for automatic detection and identification of scorpion. The acquired UV-based images undergo pre-processing to equalize uneven illumination and colour space channel separation. The extracted channels are then segmented into two non-overlapping classes. It has been observed that simple thresholding of the green channel of the acquired RGB UV-based image is sufficient for segmenting Scorpion from other background components in the acquired image. Two approaches to image segmentation have also been proposed in this work, namely, the simple average segmentation technique and K-means image segmentation. The proposed algorithm has been tested on over 40 UV scorpion images obtained from different part of the world and results obtained show an average accuracy of 97.7% in correctly classifying the pixel into two non-overlapping clusters. The proposed 1system will eliminate the problem associated with some of the existing manual approaches presently in use for scorpion detection.

  16. Nuclear imaging system

    Barrett, H.H.; Horrigan, F.A.


    This invention relates to a nuclear imaging system for mapping the source of high energy nuclear particles from a living organ which has selectively absorbed a radioactive compound by spatially coding the energy from the source in a Fresnel pattern on a detector and decoding the detector output to prouce an image of the source. The coding is produced by a Fresnel zone plate interposed between the nuclear energy source and the detector whose position is adjustable with respect to the detector to focus the slices of the nuclear source on the detector. By adjusting the zone plate to a plurality of positions, data from a plurality of cross-sectional slices are produced from which a three-dimensional image of the nuclear source may be obtained. (Patent Office Record)

  17. Radiographic imaging system

    Davis, L. Jr.; Barrett, H.H.


    This invention describes a system for imaging a subject, such as a human being, in which there has been injected a contrast agent which absorbs radiation of a predetermined frequency. The system utilizes a source of high energy radiation such as X or gamma radiation. The source is a composite of first and second radiating materials each of which is arranged in a predetermined pattern or code, each pattern having both luminous and dark regions. In one embodiment, the luminous regions of one pattern are in registration with the dark regions of the other pattern, these regions being spaced apart in an alternative embodiment. The characteristic frequencies of radiation emitted by the first and second materials are respectively lower and higher than the predetermined absorption frequency. A detector of radiation is positioned relative to the subject and the source such that radiation propagating through the subject is incident upon the detector. Since the absorption edge of the contrast agent lies between the two characteristic frequencies of radiation, radiation from the second material is preferentially absorbed by the contrast agent with the result that the contrast agent appears to be illuminated by a coded source while the remainder of the subject may be regarded as illuminated essentially by a uniform uncoded source. Imaging is accomplished by a decoding of a detected coded image. Substances within the subject having other absorption frequencies are not imaged since the radiations of both materials are essentially equally absorbed by the subject so that the source appears uncoded

  18. Heart Imaging System


    Johnson Space Flight Center's device to test astronauts' heart function in microgravity has led to the MultiWire Gamma Camera, which images heart conditions six times faster than conventional devices. Dr. Jeffrey Lacy, who developed the technology as a NASA researcher, later formed Proportional Technologies, Inc. to develop a commercially viable process that would enable use of Tantalum-178 (Ta-178), a radio-pharmaceutical. His company supplies the generator for the radioactive Ta-178 to Xenos Medical Systems, which markets the camera. Ta-178 can only be optimally imaged with the camera. Because the body is subjected to it for only nine minutes, the radiation dose is significantly reduced and the technique can be used more frequently. Ta-178 also enables the camera to be used on pediatric patients who are rarely studied with conventional isotopes because of the high radiation dosage.

  19. Tomographic imaging system

    Hayakawa, T.; Horiba, I.; Kohno, H.; Nakaya, C.; Sekihara, K.; Shiono, H.; Tomura, T.; Yamamoto, S.; Yanaka, S.


    A tomographic imaging system comprising: irradiating means for irradating a cross-section of an object under consideration with radiation rays from plural directions; detector means for detecting the radiation rays transmitted through the cross-section of said object to produce an output signal; first memory means for storing the output signal of said detector means; and an image jreconstructing section for performing a convolution integral operation on the contents of said first memory means by means of a first weighting function to reconstruct a three-dimensional image of the cross-section of said object, said image reconstructing section including (I) second memory means for storing a second weighting function, said second weighting function being provided with a predetermined positive and negative (N-1)th order when the output signal of said detector means produced by the irradiation of the cross-section of said object from one of said plural directions is sampled by N points, the value of the (N-1)th order of said second weighting function being an integration of said first weighting function from the (N-1)th order to positive infinity and the value of -(N-1)th order of said second weighting function being an integration of said first weighting function from the -(N-1)th order to negative infinity, (II) control means for successively reading out the contents of said first and second memory means, and (III) operational means for performing multiplying and summing operations on the read-out contents of said first and second memory means, said operational means producing the product of the values fo the (N-1)th and -(N-1)th orders of said second weighting function and a component of the output signal of said detector means relating to the radiation rays free from the absorption thereof by said object

  20. Acoustic imaging system

    Smith, Richard W.


    An acoustic imaging system for displaying an object viewed by a moving array of transducers as the array is pivoted about a fixed point within a given plane. A plurality of transducers are fixedly positioned and equally spaced within a laterally extending array and operatively directed to transmit and receive acoustic signals along substantially parallel transmission paths. The transducers are sequentially activated along the array to transmit and receive acoustic signals according to a preestablished sequence. Means are provided for generating output voltages for each reception of an acoustic signal, corresponding to the coordinate position of the object viewed as the array is pivoted. Receptions from each of the transducers are presented on the same display at coordinates corresponding to the actual position of the object viewed to form a plane view of the object scanned.

  1. Nuclear medicine imaging system

    Bennett, Gerald W.; Brill, A. Bertrand; Bizais, Yves J. C.; Rowe, R. Wanda; Zubal, I. George


    A nuclear medicine imaging system having two large field of view scintillation cameras mounted on a rotatable gantry and being movable diametrically toward or away from each other is disclosed. In addition, each camera may be rotated about an axis perpendicular to the diameter of the gantry. The movement of the cameras allows the system to be used for a variety of studies, including positron annihilation, and conventional single photon emission, as well as static orthogonal dual multi-pinhole tomography. In orthogonal dual multi-pinhole tomography, each camera is fitted with a seven pinhole collimator to provide seven views from slightly different perspectives. By using two cameras at an angle to each other, improved sensitivity and depth resolution is achieved. The computer system and interface acquires and stores a broad range of information in list mode, including patient physiological data, energy data over the full range detected by the cameras, and the camera position. The list mode acquisition permits the study of attenuation as a result of Compton scatter, as well as studies involving the isolation and correlation of energy with a range of physiological conditions.

  2. Experimental image alignment system

    Moyer, A. L.; Kowel, S. T.; Kornreich, P. G.


    A microcomputer-based instrument for image alignment with respect to a reference image is described which uses the DEFT sensor (Direct Electronic Fourier Transform) for image sensing and preprocessing. The instrument alignment algorithm which uses the two-dimensional Fourier transform as input is also described. It generates signals used to steer the stage carrying the test image into the correct orientation. This algorithm has computational advantages over algorithms which use image intensity data as input and is suitable for a microcomputer-based instrument since the two-dimensional Fourier transform is provided by the DEFT sensor.

  3. OSPACS: Ultrasound image management system

    Bessant Conrad


    Full Text Available Abstract Background Ultrasound scanning uses the medical imaging format, DICOM, for electronically storing the images and data associated with a particular scan. Large health care facilities typically use a picture archiving and communication system (PACS for storing and retrieving such images. However, these systems are usually not suitable for managing large collections of anonymized ultrasound images gathered during a clinical screening trial. Results We have developed a system enabling the accurate archiving and management of ultrasound images gathered during a clinical screening trial. It is based upon a Windows application utilizing an open-source DICOM image viewer and a relational database. The system automates the bulk import of DICOM files from removable media by cross-validating the patient information against an external database, anonymizing the data as well as the image, and then storing the contents of the file as a field in a database record. These image records may then be retrieved from the database and presented in a tree-view control so that the user can select particular images for display in a DICOM viewer or export them to external media. Conclusion This system provides error-free automation of ultrasound image archiving and management, suitable for use in a clinical trial. An open-source project has been established to promote continued development of the system.

  4. Central nervous system imaging



    Since its introduction in 1973, computed tomography (CT) of the brain has had a revolutionary impact on neuroradiologic diagnosis. It has largely replaced radionuclide brain imaging as the initial, noninvasive neurologic screening examination. Although conventional radionuclide brain imaging still contributes useful and unique diagnostic information in a few clinical situations, it appears that new technology and applications must be found if nuclear imaging is to play a prominent future role in neurologic diagnosis as it did in the past. One of the main advantages of CT over radionuclide brain imaging at present is CT's ability to demonstrate the size, shape, and position of the cerebral ventricles and subarachnoid spaces. Another important strength of CT is the ability to differentiate ischemic cerebral infarction from intracerebral hemorrhage. The overall sensitivity of CT in detecting intracranial neoplasms is also greater than that of radionuclide brain imaging, and CT is very useful in demonstrating the effects of head trauma. Magnetic resonance imaging appears superior to CT in the evaluation of neurologic disorders. A renewed interest in radionuclide brain imaging has developed because of recent advances in emission computed tomographic imaging. When tracer kinetic models are used, cerebral blood flow (CBF), blood volume, metabolic rate, and glucose and amino acid transport can be measured. Other applications involve investigation of receptor bindings, evaluation of the blood-brain barrier, brain blood-volume measurement, and cisternography

  5. Spatially modulated imaging system

    Barrett, H.H.


    Noncoherent radiation, such as x-rays, is spatially coded, directed through an object and spatially detected to form a spatially coded pattern, from which an image of the object may be reconstructed. The x-ray source may be formed by x-ray fluorescence and substration of the holographic images formed by two sources having energy levels predominantly above and below the maximum absorption range of an agent in the object may be used to enhance contrast in the reproduced image. (Patent Office Record)

  6. New image-stabilizing system

    Zhao, Yuejin


    In this paper, a new method for image stabilization with a three-axis image- stabilizing reflecting prism assembly is presented, and the principle of image stabilization in this prism assembly, formulae for image stabilization and working formulae with an approximation up to the third power are given in detail. In this image-stabilizing system, a single chip microcomputer is used to calculate value of compensating angles and thus to control the prism assembly. Two gyroscopes act as sensors from which information of angular perturbation is obtained, three stepping motors drive the prism assembly to compensate for the movement of image produced by angular perturbation. The image-stabilizing device so established is a multifold system which involves optics, mechanics, electronics and computer.

  7. Mechanics of bioinspired imaging systems

    Zhengwei Li


    Full Text Available Imaging systems in nature have attracted a lot of research interest due to their superior optical and imaging characteristics. Recent advancements in materials science, mechanics, and stretchable electronics have led to successful development of bioinspired cameras that resemble the structures and functions of biological light-sensing organs. In this review, we discuss some recent progresses in mechanics of bioinspired imaging systems, including tunable hemispherical eyeball camera and artificial compound eye camera. The mechanics models and results reviewed in this article can provide efficient tools for design and optimization of such systems, as well as other related optoelectronic systems that combine rigid elements with soft substrates.

  8. Army medical imaging system: ARMIS

    Siedband, M.P.; Kramp, D.C.


    Recent advances of stimulable phosphor screens, data cards using optical storage means, and new personal computers with image processing capability have made possible the design of economical filmless medical imaging systems. The addition of communication links means that remote interpretation of images is also possible. The Army Medical Imaging System uses stimulable phosphor screens, digital readout, a small computer, an optical digital data card device, and a DIN/PACS link. Up to 200 images can be stored in the computer hard disk for rapid recall and reading by the radiologist. The computer permits image processing, annotation, insertion of text, and control of the system. Each device contains an image storage RAM and communicates with the computer via the small computer systems interface. Data compression is used to reduce the required storage capacity and transmission times of the 1-mB images. The credit card-size optical data cards replace film and can store 12 or more images. The data cards can be read on an independent viewer. The research is supported by the U.S. Army Biomedical Research and Development Laboratory

  9. Imaging with PET system

    Das, B.K.; Noreen Norfaraheen Lee Abdullah


    PET deals with biochemistry and metabolic changes that occur at molecular level. Hence, PET differs fundamentally from other imaging modalities. CT imaging is based on tissue density, whereas MRI conveys anatomic information based on proton density and proton relaxation dynamics. CT and MRI are useful in clinical diagnosis only when disease process has caused significant anatomic alterations. However, in most disease conditions chemical changes precede anatomic changes, that can be detected by PET technology. Thus, PET can provide earliest and unique information about ongoing disease process long before anatomic or structural changes take place. There is no other modality available at present that can replace PET technology. Although PET produces cross-sectional images like that obtained in MRI or CT, they represent circulation, function and metabolism, and not anatomic structure. PET is extremely sensitive measuring quantitatively concentration of tracers in nano to pico-molar range. Thus, PET enables merger of biochemistry and biology in medicine giving birth to molecular medicine that focuses on identifying the molecular errors of disease leading to developing molecular corrections including gene therapy. Molecular imaging with PET has been playing a role in examining the biological nature of a disease condition and its characterization to guide selection and evaluation of treatment. (author)

  10. Underwater laser imaging system (UWLIS)

    DeLong, M. [Lawrence Livermore National Lab., CA (United States)


    Practical limitations with underwater imaging systems area reached when the noise in the back scattered radiation generated in the water between the imaging system and the target obscures the spatial contrast and resolution necessary for target discovery and identification. The advent of high power lasers operating in the blue-green portion of the visible spectrum (oceanic transmission window) has led to improved experimental illumination systems for underwater imaging. Range-gated and synchronously scanned devices take advantage of the unique temporal and spatial coherence properties of laser radiation, respectively, to overcome the deleterious effects of common volume back scatter.

  11. Stereoscopic medical imaging collaboration system

    Okuyama, Fumio; Hirano, Takenori; Nakabayasi, Yuusuke; Minoura, Hirohito; Tsuruoka, Shinji


    The computerization of the clinical record and the realization of the multimedia have brought improvement of the medical service in medical facilities. It is very important for the patients to obtain comprehensible informed consent. Therefore, the doctor should plainly explain the purpose and the content of the diagnoses and treatments for the patient. We propose and design a Telemedicine Imaging Collaboration System which presents a three dimensional medical image as X-ray CT, MRI with stereoscopic image by using virtual common information space and operating the image from a remote location. This system is composed of two personal computers, two 15 inches stereoscopic parallax barrier type LCD display (LL-151D, Sharp), one 1Gbps router and 1000base LAN cables. The software is composed of a DICOM format data transfer program, an operation program of the images, the communication program between two personal computers and a real time rendering program. Two identical images of 512×768 pixcels are displayed on two stereoscopic LCD display, and both images show an expansion, reduction by mouse operation. This system can offer a comprehensible three-dimensional image of the diseased part. Therefore, the doctor and the patient can easily understand it, depending on their needs.

  12. Artificial intelligence and medical imaging. Expert systems and image analysis

    Wackenheim, A.; Zoellner, G.; Horviller, S.; Jacqmain, T.


    This paper gives an overview on the existing systems for automated image analysis and interpretation in medical imaging, especially in radiology. The example of ORFEVRE, the system for the analysis of CAT-scan images of the cervical triplet (c3-c5) by image analysis and subsequent expert-system is given and discussed in detail. Possible extensions are described [fr

  13. A Diagnostic Ultrasound Imaging System

    Lee, Seong Woo


    The ability to see the internal organs of the human body in a noninvasive way is a powerful diagnostic tool of modern medicine. Among these imaging modalities such as X-ray, MRI, and ultrasound. MRI and ultrasound are presenting much less risk of undesirable damage of both patient and examiner. In fact, no deleterious effects have been reported as a result of clinical examination by using MRI and ultrasound diagnostic equipment. As a result, their market volume has been rapidly increased. MRI has a good resolution. but there are a few disadvantages such as high price. non-real-time imaging capability. and expensive diagnostic cost. On the other hand, the ultrasound imaging system has inherently poor resolution as compared with X-ray and MRI. In spite of its poor resolution, the ultrasound diagnostic equipment is lower in price and has an ability of real-time imaging as compared with the others. As a result, the ultrasound imaging system has become general and essential modality for imaging the internal organs of human body. In this review various researches and developments to enhance the resolution of the ultrasound images are explained and future trends of the ultrasound imaging technology are described

  14. Microprocessor based image processing system

    Mirza, M.I.; Siddiqui, M.N.; Rangoonwala, A.


    Rapid developments in the production of integrated circuits and introduction of sophisticated 8,16 and now 32 bit microprocessor based computers, have set new trends in computer applications. Nowadays the users by investing much less money can make optimal use of smaller systems by getting them custom-tailored according to their requirements. During the past decade there have been great advancements in the field of computer Graphics and consequently, 'Image Processing' has emerged as a separate independent field. Image Processing is being used in a number of disciplines. In the Medical Sciences, it is used to construct pseudo color images from computer aided tomography (CAT) or positron emission tomography (PET) scanners. Art, advertising and publishing people use pseudo colours in pursuit of more effective graphics. Structural engineers use Image Processing to examine weld X-rays to search for imperfections. Photographers use Image Processing for various enhancements which are difficult to achieve in a conventional dark room. (author)

  15. An XCT image database system

    Komori, Masaru; Minato, Kotaro; Koide, Harutoshi; Hirakawa, Akina; Nakano, Yoshihisa; Itoh, Harumi; Torizuka, Kanji; Yamasaki, Tetsuo; Kuwahara, Michiyoshi.


    In this paper, an expansion of X-ray CT (XCT) examination history database to XCT image database is discussed. The XCT examination history database has been constructed and used for daily examination and investigation in our hospital. This database consists of alpha-numeric information (locations, diagnosis and so on) of more than 15,000 cases, and for some of them, we add tree structured image data which has a flexibility for various types of image data. This database system is written by MUMPS database manipulation language. (author)

  16. High intensity radiation imaging system

    Barrett, H.H.


    A nuclear imaging system is described for mapping a spatially distributed source of high energy nuclear particles from a living organ which has selectively absorbed a radioactive compound in which the nuclear energy is spatially coded by a zone plate positioned between the source and a spatial detector, and a half tone screen is positioned between the source and the zone plate to increase the definition of the image

  17. Stepped scanner radiographic imaging system

    Lapidus, S.N.


    The imaging system includes a radiographic camera, a bed for supporting a subject in view of the camera, and a display system. The camera provides X and Y coordinate signals of each radiographic event. The position of the bed relative to the camera is altered sequentially by drive means, between each of a sequence of images provided by the camera. The sequentially occurring images are presented on the display system, each image being positioned on the display in correspondence with the location of the bed relative to the camera. The coordinates of each image point presented on the display is equal to the sum of the respective X and Y coordinate signals from the camera with X and Y coordinate signals provided by a timer which controls the drive means and defines the location of the bed relative to the camera. The camera is electronically decoupled from the display by a gate during movement of the bed relative to the camera from one location to the next location to prevent any smearing effect within the composite image presented on the display. (author)

  18. Intellectual system for images restoration

    Mardare, Igor


    Intelligence systems on basis of artificial neural networks and associative memory allow to solve effectively problems of recognition and restoration of images. However, within analytical technologies there are no dominating approaches of deciding of intellectual problems. Choice of the best technology depends on nature of problem, features of objects, volume of represented information about the object, number of classes of objects, etc. It is required to determine opportunities, preconditions and field of application of neural networks and associative memory for decision of problem of restoration of images and to use their supplementary benefits for further development of intelligence systems.

  19. The Groningen image processing system

    Allen, R.J.; Ekers, R.D.; Terlouw, J.P.


    This paper describes an interactive, integrated software and hardware computer system for the reduction and analysis of astronomical images. A short historical introduction is presented before some examples of the astonomical data currently handled by the system are shown. A description is given of the present hardware and software structure. The system is illustrated by describing its appearance to the user, to the applications programmer, and to the system manager. Some quantitative information on the size and cost of the system is given, and its good and bad features are discussed

  20. Musashi dynamic image processing system

    Murata, Yutaka; Mochiki, Koh-ichi; Taguchi, Akira


    In order to produce transmitted neutron dynamic images using neutron radiography, a real time system called Musashi dynamic image processing system (MDIPS) was developed to collect, process, display and record image data. The block diagram of the MDIPS is shown. The system consists of a highly sensitive, high resolution TV camera driven by a custom-made scanner, a TV camera deflection controller for optimal scanning, which adjusts to the luminous intensity and the moving speed of an object, a real-time corrector to perform the real time correction of dark current, shading distortion and field intensity fluctuation, a real time filter for increasing the image signal to noise ratio, a video recording unit and a pseudocolor monitor to realize recording in commercially available products and monitoring by means of the CRTs in standard TV scanning, respectively. The TV camera and the TV camera deflection controller utilized for producing still images can be applied to this case. The block diagram of the real-time corrector is shown. Its performance is explained. Linear filters and ranked order filters were developed. (K.I.)

  1. Scanning Terahertz Heterodyne Imaging Systems

    Siegel, Peter; Dengler, Robert


    Scanning terahertz heterodyne imaging systems are now at an early stage of development. In a basic scanning terahertz heterodyne imaging system, (see Figure 1) two far-infrared lasers generate beams denoted the local-oscillator (LO) and signal that differ in frequency by an amount, denoted the intermediate frequency (IF), chosen to suit the application. The LO beam is sent directly to a mixer as one of two inputs. The signal beam is focused to a spot on or in the specimen. After transmission through or reflection from the specimen, the beams are focused to a spot on a terahertz mixer, which extracts the IF outputs. The specimen is mounted on a translation stage, by means of which the focal spot is scanned across the specimen to build up an image.

  2. 3D Backscatter Imaging System

    Whitaker, Ross (Inventor); Turner, D. Clark (Inventor)


    Systems and methods for imaging an object using backscattered radiation are described. The imaging system comprises both a radiation source for irradiating an object that is rotationally movable about the object, and a detector for detecting backscattered radiation from the object that can be disposed on substantially the same side of the object as the source and which can be rotationally movable about the object. The detector can be separated into multiple detector segments with each segment having a single line of sight projection through the object and so detects radiation along that line of sight. Thus, each detector segment can isolate the desired component of the backscattered radiation. By moving independently of each other about the object, the source and detector can collect multiple images of the object at different angles of rotation and generate a three dimensional reconstruction of the object. Other embodiments are described.

  3. Image reconstruction of dynamic infrared single-pixel imaging system

    Tong, Qi; Jiang, Yilin; Wang, Haiyan; Guo, Limin


    Single-pixel imaging technique has recently received much attention. Most of the current single-pixel imaging is aimed at relatively static targets or the imaging system is fixed, which is limited by the number of measurements received through the single detector. In this paper, we proposed a novel dynamic compressive imaging method to solve the imaging problem, where exists imaging system motion behavior, for the infrared (IR) rosette scanning system. The relationship between adjacent target images and scene is analyzed under different system movement scenarios. These relationships are used to build dynamic compressive imaging models. Simulation results demonstrate that the proposed method can improve the reconstruction quality of IR image and enhance the contrast between the target and the background in the presence of system movement.

  4. Imaging Systems in TLE Research

    Allin, Thomas Højgaard; Neubert, Torsten; Laursen, Steen


    documented using the right equipment in the right way. This chapter provides an introduction to the concepts of low light imagers, and how they can be successfully applied in TLE research. As examples, we describe the 2003 and 2004 Spritewatch systems, which integrate low-light cameras with a digital...

  5. Imaging systems for medical diagnostics

    Krestel, E.


    This book provides physicians and clinical physicists with detailed information on today's imaging modalities and assists them in selecting the optimal system for each clinical application. Physicists, engineers and computer specialists engaged in research and development and sales departments will also find this book to be of considerable use. It may also be employed at universities, training centers and in technical seminars. The physiological and physical fundamentals are explained in part 1. The technical solutions contained in part 2 illustrate the numerous possibilities available in X-ray diagnostics, computed tomography, nuclear medical diagnostics, magnetic resonance imaging, sonography and biomagnetic diagnostics. (orig.)

  6. Imaging systems in nuclear medicine and image evaluation

    Beck, R.; Charleston, D.; Metz, C.


    This project deals with imaging systems in nuclear medicine and image evaluation and is presented as four subprojects. The goal of the first subproject is to improve diagnositc image quality by development of a general computer code for optimizing collimator design. The second subproject deals with a secondary emission and fluorescence technique for thyroid scanning while the third subproject emphasizes the need for more sophisticated image processing systems such as coherent optical spatial filtering systems and digital image processing. The fourth subproject presents a new approach for processing image data by taking into account the energy of each detected gamma-ray photon

  7. Multispectral Panoramic Imaging System, Phase I

    National Aeronautics and Space Administration — International Electronic Machines Corporation, a leader in the design of precision imaging systems, will develop an innovative multispectral, panoramic imaging...

  8. Imaging systems and materials characterization

    Murr, L.E.


    This paper provides a broad background for the historical development and modern applications of light optical metallography, scanning and transmission electron microscopy, field-ion microscopy and several forms of scanning probe microscopes. Numerous case examples illustrating especially synergistic applications of these imaging systems are provided to demonstrate materials characterization especially in the context of structure-property-performance issues which define materials science and engineering


    Héctor A. Pérez-Sánchez


    Full Text Available This paper has as general purpose develop and implementation of a system that allows the generation of flight routes for a drone, the acquisition of geographic location information (GPS during the flight and taking photographs of points of interest for creating georeferenced images, same that will be used to generate KML files (Keyhole Markup Language for the representation of geographical data in three dimensions to be displayed on the Google Earth tool.

  10. Image and information management system

    Robertson, Tina L. (Inventor); Raney, Michael C. (Inventor); Dougherty, Dennis M. (Inventor); Kent, Peter C. (Inventor); Brucker, Russell X. (Inventor); Lampert, Daryl A. (Inventor)


    A system and methods through which pictorial views of an object's configuration, arranged in a hierarchical fashion, are navigated by a person to establish a visual context within the configuration. The visual context is automatically translated by the system into a set of search parameters driving retrieval of structured data and content (images, documents, multimedia, etc.) associated with the specific context. The system places ''hot spots'', or actionable regions, on various portions of the pictorials representing the object. When a user interacts with an actionable region, a more detailed pictorial from the hierarchy is presented representing that portion of the object, along with real-time feedback in the form of a popup pane containing information about that region, and counts-by-type reflecting the number of items that are available within the system associated with the specific context and search filters established at that point in time.

  11. X-ray imaging system

    Houston, J.M.


    A novel, high-speed apparatus for use in X-ray computerised tomography is described in detail. It consists of a semi-circular array of X-ray sources, collimators and an ion chamber array for detection of the X-rays. The X-ray sources may be pulsed in salvos such that the corresponding detectors in the array are only illuminated by one source. The use of computer controlled salvos speeds up the image processing by at least a factor of two. The ion chamber array is designed to have a constant detection efficiency for varying angles of X-ray incidence. A detailed description of the detector construction and suggested gaseous fillings are given. It is claimed that the present tomographic system allows fast and accurate imaging of internal body organs and is insensitive to the blurring effects which motion of these organs tends to produce. (UK)

  12. Whole body imaging system mechanism

    Carman, R.W.; Doherty, E.J.


    A radioisotope scanning apparatus for use in nuclear medicine is described in detail. The apparatus enables the quantification and spatial location of the radioactivity in a body section of a patient to be determined with high sensitivity. It consists of an array of highly focussed collimators arranged such that adjacent collimators move in the same circumferential but opposite radial directions. The explicit movements of the gantry are described in detail and may be controlled by a general purpose computer. The use of highly focussed collimators allows both a reasonable solid angle of acceptance and also high target to background images; additionally, dual radionuclide pharmaceutical studies can be performed simultaneously. It is claimed that the high sensitivity of the system permits the early diagnosis of pathological changes and the images obtained show accurately the location and shape of physiological abnormalities. (U.K.)

  13. Design of low noise imaging system

    Hu, Bo; Chen, Xiaolai


    In order to meet the needs of engineering applications for low noise imaging system under the mode of global shutter, a complete imaging system is designed based on the SCMOS (Scientific CMOS) image sensor CIS2521F. The paper introduces hardware circuit and software system design. Based on the analysis of key indexes and technologies about the imaging system, the paper makes chips selection and decides SCMOS + FPGA+ DDRII+ Camera Link as processing architecture. Then it introduces the entire system workflow and power supply and distribution unit design. As for the software system, which consists of the SCMOS control module, image acquisition module, data cache control module and transmission control module, the paper designs in Verilog language and drives it to work properly based on Xilinx FPGA. The imaging experimental results show that the imaging system exhibits a 2560*2160 pixel resolution, has a maximum frame frequency of 50 fps. The imaging quality of the system satisfies the requirement of the index.

  14. Image BOSS: a biomedical object storage system

    Stacy, Mahlon C.; Augustine, Kurt E.; Robb, Richard A.


    Researchers using biomedical images have data management needs which are oriented perpendicular to clinical PACS. The image BOSS system is designed to permit researchers to organize and select images based on research topic, image metadata, and a thumbnail of the image. Image information is captured from existing images in a Unix based filesystem, stored in an object oriented database, and presented to the user in a familiar laboratory notebook metaphor. In addition, the ImageBOSS is designed to provide an extensible infrastructure for future content-based queries directly on the images.

  15. Multi-channel medical imaging system

    Frangioni, John V


    A medical imaging system provides simultaneous rendering of visible light and fluorescent images. The system may employ dyes in a small-molecule form that remain in the subject's blood stream for several minutes, allowing real-time imaging of the subject's circulatory system superimposed upon a conventional, visible light image of the subject. The system may provide an excitation light source to excite the fluorescent substance and a visible light source for general illumination within the same optical guide used to capture images. The system may be configured for use in open surgical procedures by providing an operating area that is closed to ambient light. The systems described herein provide two or more diagnostic imaging channels for capture of multiple, concurrent diagnostic images and may be used where a visible light image may be usefully supplemented by two or more images that are independently marked for functional interest.

  16. High dynamic range coding imaging system

    Wu, Renfan; Huang, Yifan; Hou, Guangqi


    We present a high dynamic range (HDR) imaging system design scheme based on coded aperture technique. This scheme can help us obtain HDR images which have extended depth of field. We adopt Sparse coding algorithm to design coded patterns. Then we utilize the sensor unit to acquire coded images under different exposure settings. With the guide of the multiple exposure parameters, a series of low dynamic range (LDR) coded images are reconstructed. We use some existing algorithms to fuse and display a HDR image by those LDR images. We build an optical simulation model and get some simulation images to verify the novel system.

  17. Improved Interactive Medical-Imaging System

    Ross, Muriel D.; Twombly, Ian A.; Senger, Steven


    An improved computational-simulation system for interactive medical imaging has been invented. The system displays high-resolution, three-dimensional-appearing images of anatomical objects based on data acquired by such techniques as computed tomography (CT) and magnetic-resonance imaging (MRI). The system enables users to manipulate the data to obtain a variety of views for example, to display cross sections in specified planes or to rotate images about specified axes. Relative to prior such systems, this system offers enhanced capabilities for synthesizing images of surgical cuts and for collaboration by users at multiple, remote computing sites.

  18. Imaging systems in nuclear medicine and image evaluation

    Beck, R.; Charleston, D.; Metz, C.; Tsui, B.


    A general computer code to simulate the imaging properties of existing and hypothetical imaging systems viewing realistic source distributions within non-uniform media. Such a code allows comparative evaluations of existing and hypothetical systems, and optimization of critical parameters of system design by maximizing the signal-to-noise ratio. To be most useful, such a code allows simulation of conventional scintillation scanners and cameras as well as single-photon and position tomographic systems

  19. Highly integrated image sensors enable low-cost imaging systems

    Gallagher, Paul K.; Lake, Don; Chalmers, David; Hurwitz, J. E. D.


    The highest barriers to wide scale implementation of vision systems have been cost. This is closely followed by the level of difficulty of putting a complete imaging system together. As anyone who has every been in the position of creating a vision system knows, the various bits and pieces supplied by the many vendors are not under any type of standardization control. In short, unless you are an expert in imaging, electrical interfacing, computers, digital signal processing, and high speed storage techniques, you will likely spend more money trying to do it yourself rather than to buy the exceedingly expensive systems available. Another alternative is making headway into the imaging market however. The growing investment in highly integrated CMOS based imagers is addressing both the cost and the system integration difficulties. This paper discusses the benefits gained from CMOS based imaging, and how these benefits are already being applied.

  20. Handheld microwave bomb-detecting imaging system

    Gorwara, Ashok; Molchanov, Pavlo


    Proposed novel imaging technique will provide all weather high-resolution imaging and recognition capability for RF/Microwave signals with good penetration through highly scattered media: fog, snow, dust, smoke, even foliage, camouflage, walls and ground. Image resolution in proposed imaging system is not limited by diffraction and will be determined by processor and sampling frequency. Proposed imaging system can simultaneously cover wide field of view, detect multiple targets and can be multi-frequency, multi-function. Directional antennas in imaging system can be close positioned and installed in cell phone size handheld device, on small aircraft or distributed around protected border or object. Non-scanning monopulse system allows dramatically decrease in transmitting power and at the same time provides increased imaging range by integrating 2-3 orders more signals than regular scanning imaging systems.

  1. Digital image display system for emergency room

    Murry, R.C.; Lane, T.J.; Miax, L.S.


    This paper reports on a digital image display system for the emergency room (ER) in a major trauma hospital. Its objective is to reduce radiographic image delivery time to a busy ER while simultaneously providing a multimodality capability. Image storage, retrieval, and display will also be facilitated with this system. The system's backbone is a token-ring network of RISC and personal computers. The display terminals are higher- function RISC computers with 1,024 2 color or gray-scale monitors. The PCs serve as administrative terminals. Nuclear medicine, CT, MR, and digitized film images are transferred to the image display system

  2. A fractal-based image encryption system

    Abd-El-Hafiz, S. K.; Radwan, Ahmed Gomaa; Abdel Haleem, Sherif H.; Barakat, Mohamed L.


    single-fractal image and statistical analysis is performed. A general encryption system utilising multiple fractal images is, then, introduced to improve the performance and increase the encryption key up to hundreds of bits. This improvement is achieved

  3. Objective analysis of image quality of video image capture systems

    Rowberg, Alan H.


    As Picture Archiving and Communication System (PACS) technology has matured, video image capture has become a common way of capturing digital images from many modalities. While digital interfaces, such as those which use the ACR/NEMA standard, will become more common in the future, and are preferred because of the accuracy of image transfer, video image capture will be the dominant method in the short term, and may continue to be used for some time because of the low cost and high speed often associated with such devices. Currently, virtually all installed systems use methods of digitizing the video signal that is produced for display on the scanner viewing console itself. A series of digital test images have been developed for display on either a GE CT9800 or a GE Signa MRI scanner. These images have been captured with each of five commercially available image capture systems, and the resultant images digitally transferred on floppy disk to a PC1286 computer containing Optimast' image analysis software. Here the images can be displayed in a comparative manner for visual evaluation, in addition to being analyzed statistically. Each of the images have been designed to support certain tests, including noise, accuracy, linearity, gray scale range, stability, slew rate, and pixel alignment. These image capture systems vary widely in these characteristics, in addition to the presence or absence of other artifacts, such as shading and moire pattern. Other accessories such as video distribution amplifiers and noise filters can also add or modify artifacts seen in the captured images, often giving unusual results. Each image is described, together with the tests which were performed using them. One image contains alternating black and white lines, each one pixel wide, after equilibration strips ten pixels wide. While some systems have a slew rate fast enough to track this correctly, others blur it to an average shade of gray, and do not resolve the lines, or give

  4. Characterization of lens based photoacoustic imaging system

    Kalloor Joseph Francis


    Full Text Available Some of the challenges in translating photoacoustic (PA imaging to clinical applications includes limited view of the target tissue, low signal to noise ratio and the high cost of developing real-time systems. Acoustic lens based PA imaging systems, also known as PA cameras are a potential alternative to conventional imaging systems in these scenarios. The 3D focusing action of lens enables real-time C-scan imaging with a 2D transducer array. In this paper, we model the underlying physics in a PA camera in the mathematical framework of an imaging system and derive a closed form expression for the point spread function (PSF. Experimental verification follows including the details on how to design and fabricate the lens inexpensively. The system PSF is evaluated over a 3D volume that can be imaged by this PA camera. Its utility is demonstrated by imaging phantom and an ex vivo human prostate tissue sample.

  5. Characterization of lens based photoacoustic imaging system.

    Francis, Kalloor Joseph; Chinni, Bhargava; Channappayya, Sumohana S; Pachamuthu, Rajalakshmi; Dogra, Vikram S; Rao, Navalgund


    Some of the challenges in translating photoacoustic (PA) imaging to clinical applications includes limited view of the target tissue, low signal to noise ratio and the high cost of developing real-time systems. Acoustic lens based PA imaging systems, also known as PA cameras are a potential alternative to conventional imaging systems in these scenarios. The 3D focusing action of lens enables real-time C-scan imaging with a 2D transducer array. In this paper, we model the underlying physics in a PA camera in the mathematical framework of an imaging system and derive a closed form expression for the point spread function (PSF). Experimental verification follows including the details on how to design and fabricate the lens inexpensively. The system PSF is evaluated over a 3D volume that can be imaged by this PA camera. Its utility is demonstrated by imaging phantom and an ex vivo human prostate tissue sample.

  6. Analysis of image plane's Illumination in Image-forming System

    Duan Lihua; Zeng Yan'an; Zhang Nanyangsheng; Wang Zhiguo; Yin Shiliang


    In the detection of optical radiation, the detecting accuracy is affected by optic power distribution of the detector's surface to a large extent. In addition, in the image-forming system, the quality of the image is greatly determined by the uniformity of the image's illumination distribution. However, in the practical optical system, affected by the factors such as field of view, false light and off axis and so on, the distribution of the image's illumination tends to be non uniform, so it is necessary to discuss the image plane's illumination in image-forming systems. In order to analyze the characteristics of the image-forming system at a full range, on the basis of photometry, the formulas to calculate the illumination of the imaging plane have been summarized by the numbers. Moreover, the relationship between the horizontal offset of the light source and the illumination of the image has been discussed in detail. After that, the influence of some key factors such as aperture angle, off-axis distance and horizontal offset on illumination of the image has been brought forward. Through numerical simulation, various theoretical curves of those key factors have been given. The results of the numerical simulation show that it is recommended to aggrandize the diameter of the exit pupil to increase the illumination of the image. The angle of view plays a negative role in the illumination distribution of the image, that is, the uniformity of the illumination distribution can be enhanced by compressing the angle of view. Lastly, it is proved that telecentric optical design is an effective way to advance the uniformity of the illumination distribution.

  7. Fluoroscopic Imaging Systems. Chapter 8

    Jones, A. K. [University of Texas MD Anderson Cancer Center, Houston (United States)


    Fluoroscopy refers to the use of an X ray beam and a suitable image receptor for viewing images of processes or instruments in the body in real time. Fluoroscopic imaging trades the high signal to noise ratio (SNR) of radiography for high temporal resolution, as factors that maintain patient dose at an acceptable level must be used.

  8. Developing stereo image based robot control system

    Suprijadi,; Pambudi, I. R.; Woran, M.; Naa, C. F; Srigutomo, W. [Department of Physics, FMIPA, InstitutTeknologi Bandung Jl. Ganesha No. 10. Bandung 40132, Indonesia (Indonesia)


    Application of image processing is developed in various field and purposes. In the last decade, image based system increase rapidly with the increasing of hardware and microprocessor performance. Many fields of science and technology were used this methods especially in medicine and instrumentation. New technique on stereovision to give a 3-dimension image or movie is very interesting, but not many applications in control system. Stereo image has pixel disparity information that is not existed in single image. In this research, we proposed a new method in wheel robot control system using stereovision. The result shows robot automatically moves based on stereovision captures.

  9. Image portion identification methods, image parsing methods, image parsing systems, and articles of manufacture

    Lassahn, Gordon D.; Lancaster, Gregory D.; Apel, William A.; Thompson, Vicki S.


    Image portion identification methods, image parsing methods, image parsing systems, and articles of manufacture are described. According to one embodiment, an image portion identification method includes accessing data regarding an image depicting a plurality of biological substrates corresponding to at least one biological sample and indicating presence of at least one biological indicator within the biological sample and, using processing circuitry, automatically identifying a portion of the image depicting one of the biological substrates but not others of the biological substrates.

  10. Transfer function analysis of radiographic imaging systems

    Metz, C.E.; Doi, K.


    The theoretical and experimental aspects of the techniques of transfer function analysis used in radiographic imaging systems are reviewed. The mathematical principles of transfer function analysis are developed for linear, shift-invariant imaging systems, for the relation between object and image and for the image due to a sinusoidal plane wave object. The other basic mathematical principle discussed is 'Fourier analysis' and its application to an input function. Other aspects of transfer function analysis included are alternative expressions for the 'optical transfer function' of imaging systems and expressions are derived for both serial and parallel transfer image sub-systems. The applications of transfer function analysis to radiographic imaging systems are discussed in relation to the linearisation of the radiographic imaging system, the object, the geometrical unsharpness, the screen-film system unsharpness, other unsharpness effects and finally noise analysis. It is concluded that extensive theoretical, computer simulation and experimental studies have demonstrated that the techniques of transfer function analysis provide an accurate and reliable means for predicting and understanding the effects of various radiographic imaging system components in most practical diagnostic medical imaging situations. (U.K.)

  11. Multispectral system for medical fluorescence imaging

    Andersson, P.S.; Montan, S.; Svanberg, S.


    The principles of a powerful multicolor imaging system for tissue fluorescence diagnostics are discussed. Four individually spectrally filtered images are formed on a matrix detector by means of a split-mirror arrangement. The four images are processed in a computer, pixel by pixel, by means of mathematical operations, leading to an optimized contrast image, which enhances a selected feature. The system is being developed primarily for medical fluorescence imaging, but has wide applications in fluorescence, reflectance, and transmission monitoring related to a wide range of industrial and environmental problems. The system operation is described for the case of linear imaging on a diode array detector. Laser-induced fluorescence is used for cancer tumor and arteriosclerotic plaque demarcation using the contrast enhancement capabilities of this imaging system. Further examples of applications include fluorescing minerals and flames

  12. 3D images and expert system

    Hasegawa, Jun-ichi


    This paper presents an expert system called 3D-IMPRESS for supporting applications of three dimensional (3D) image processing. This system can automatically construct a 3D image processing procedure based on a pictorial example of the goal given by a user. In the paper, to evaluate the performance of the system, it was applied to construction of procedures for extracting specific component figures from practical chest X-ray CT images. (author)

  13. Flow imaging of the cardiovascular system using magnetic resonance imaging

    Imai, Hitoshi; Sakakibara, Makoto; Sunami, Yuko


    Blood flow images by magnetic resonance imaging (MRI) using a 0.25 T unit were evaluated for nine normal volunteers and 108 subjects with a variety of cardiovascular abnormalities. Using the non-gated short-spin echo (SE) technique, blood flow in the cardiovascular systems was not imaged in the normal volunteers. Using end-systolic and end-diastolic SE techniques for the normal subjects, blood flow in the cardiac chambers was not clearly imaged. Blood flow in the ascending aorta and aortic arch often did not appear in the gated SE images of the normal subjects. However, blood flow in the descending aorta was often observed in the gated SE images. Blood flow imaging was demonstrated by both non-gated and gated SE techniques in regions where blood flow was relatively slow; for example, in the left atrium of mitral stenosis, in an aortic aneurysm, in a false lumen of an aortic dissection, and in the left ventricle having old myocardial infarction. Using the non-gated inversion recovery (IR) technique, no blood flow was imaged in the cardiovascular system except in the left atrium of one case with mitral stenosis. Using the non-gated short SE technique, there was good correlation between the thrombus formation and the presence of blood flow images in the left atria of 17 patients with mitral stenosis, and in the aneurysmal portions of the aorta or in the false lumens of aortic dissection of 18 patients. It was suggested that mural thrombi in such diseases were related to the relatively slow blood flow. Blood flow imaging easily distinguished stagnant blood flow from mural thrombi using non-gated short SE, end-systolic SE, and IR techniques. Thus, blood flow imaging using MRI should become an important means of evaluating the cardiovascular system. (author)

  14. Dynamic MR imaging of the musculoskeletal system

    Shah, A.S.; Hylton, H.; Hentz, V.R.; Schattner, P.


    This paper reports on dynamic MR imaging which is an MR technique that allows imaging of the musculoskeletal system in motion. Current methods for observing the articulation of muscles and joints are limited to acquisition of stationary images at different spatial orientations. These images are then replayed from computer memory to simulate motion. Unlike stationary acquisition, dynamic MR imaging allows the volume of interest to be subjected to motion and dynamic stress, which is important for detecting stress-induced pathology. To demonstrate the utility of dynamic MR imaging, a system for imaging a moving wrist has been developed. The system consists of apparatus capable of providing simultaneous radialulnar deviation and flexion-extension, and hardware for system control and acquisition gating. The apparatus is mounted on the patient bed and is transferable to a variety of standard clinical MR imaging systems. Images were obtained during motion, and the ability of dynamic MR imaging to accurately image the moving wrist with very little motion artifact was demonstrated

  15. Image processing of integrated video image obtained with a charged-particle imaging video monitor system

    Iida, Takao; Nakajima, Takehiro


    A new type of charged-particle imaging video monitor system was constructed for video imaging of the distributions of alpha-emitting and low-energy beta-emitting nuclides. The system can display not only the scintillation image due to radiation on the video monitor but also the integrated video image becoming gradually clearer on another video monitor. The distortion of the image is about 5% and the spatial resolution is about 2 line pairs (lp)mm -1 . The integrated image is transferred to a personal computer and image processing is performed qualitatively and quantitatively. (author)

  16. Digital image information systems in radiology

    Greinacher, C.F.C.; Luetke, B.; Seufert, G.


    About 25% of all patient examinations are performed digitally in a today's radiological department. A computerized system is described that supports generation, transport, interpretation and archiving of digital radiological images (Picture Archiving and Communication System PACS). The technical features concerning image communication via local area networks, image storage on magnetic and optical media and digital workstations for image display and manipulation are described. A structured system architecture is introduced. It allows flexible adaption to individual organizations and minimizes the requirements of the communication network. (orig.) [de

  17. Imaging of the peripheral vascular system

    Gould, S.A.; Pond, G.D.; Pinsky, S.; Moss, G.S.; Srikantaswamy, S.; Ryo, U.Y.


    This book is limited neither to the peripheral vascular system nor to diagnostic imaging techniques. Its 18 chapters cover nonimaging blood-flow techniques (Doppler ultrasound, plethysmography) as well as noninvasive and invasive imaging techniques (ultrasound, computed tomography, radionuclide digital-subtraction angiography, and contrast angiography). These are applied not only to the peripheral vascular system but also to the aorta and vena cava

  18. Image digitizer system for bubble chamber laser

    Haggerty, H.


    An IBM PC-based image digitizer system has been assembled to monitor the laser flash used for holography at the 15 foot bubble chamber. The hardware and the operating software are outlined. For an operational test of the system, an array of LEDs was flashed with a 10 microsecond pulse and the image was grabbed by one of the operating programs and processed

  19. IDAPS (Image Data Automated Processing System) System Description


    This document describes the physical configuration and components used in the image processing system referred to as IDAPS (Image Data Automated ... Processing System). This system was developed by the Environmental Research Institute of Michigan (ERIM) for Eglin Air Force Base. The system is designed

  20. Advanced millimeter wave imaging systems

    Schuchardt, J. M.; Gagliano, J. A.; Stratigos, J. A.; Webb, L. L.; Newton, J. M.


    Unique techniques are being utilized to develop self-contained imaging radiometers operating at single and multiple frequencies near 35, 95 and 183 GHz. These techniques include medium to large antennas for high spatial resolution, lowloss open structures for RF confinemnt and calibration, wide bandwidths for good sensitivity plus total automation of the unit operation and data collection. Applications include: detection of severe storms, imaging of motor vehicles, and the remote sensing of changes in material properties.

  1. Automated imaging system for single molecules

    Schwartz, David Charles; Runnheim, Rodney; Forrest, Daniel


    There is provided a high throughput automated single molecule image collection and processing system that requires minimal initial user input. The unique features embodied in the present disclosure allow automated collection and initial processing of optical images of single molecules and their assemblies. Correct focus may be automatically maintained while images are collected. Uneven illumination in fluorescence microscopy is accounted for, and an overall robust imaging operation is provided yielding individual images prepared for further processing in external systems. Embodiments described herein are useful in studies of any macromolecules such as DNA, RNA, peptides and proteins. The automated image collection and processing system and method of same may be implemented and deployed over a computer network, and may be ergonomically optimized to facilitate user interaction.

  2. Development of a THz spectroscopic imaging system

    Usami, M; Iwamoto, T; Fukasawa, R; Tani, M; Watanabe, M; Sakai, K


    We have developed a real-time THz imaging system based on the two-dimensional (2D) electro-optic (EO) sampling technique. Employing the 2D EO-sampling technique, we can obtain THz images using a CCD camera at a video rate of up to 30 frames per second. A spatial resolution of 1.4 mm was achieved. This resolution was reasonably close to the theoretical limit determined by diffraction. We observed not only static objects but also moving ones. To acquire spectroscopic information, time-domain images were collected. By processing these images on a computer, we can obtain spectroscopic images. Spectroscopy for silicon wafers was demonstrated

  3. Clinical software for MR imaging system, 4

    Shimizu, Koji; Kasai, Akira; Okamura, Shoichi


    Magnetic resonance imaging continues to elicit new application software through the recent technological advances of MR equipment. This paper describes several applications of our newly developed clinical software. The fast SE sequence (RISE) has proved to reduce routine examination time and to improve image quality, and ultra-fast FE sequence (SMASH) was found to extend the diagnostic capabilities in the field of cardiac study. Diffusion/perfusion imaging achieved in our MR system showed significant promise for providing novel information regarding tissue characterization. Furthermore, Image quality and practicalities of MR angiography have been improved by advanced imaging sequences and sophisticated post-processing software. (author)

  4. Image quality of digital mammography images produced using wet and dry laser imaging systems

    Al Khalifah, K.; Brindhaban, A.; AlArfaj, R.; Jassim, O.


    Introduction: A study was carried out to compare the quality of digital mammographic images printed or processed by a wet laser imaging system and a dedicated mammographic dry laser imaging system. Material and methods: Digital images of a tissue equivalent breast phantom were obtained using a GE Senographe 2000D digital mammography system and different target/filter combinations of the X-ray tube. These images were printed on films using the Fuji FL-IM D wet laser imaging system and the Kodak DryView 8600 dry laser imaging system. The quality of images was assessed in terms of detectability of microcalcifications and simulated tumour masses by five radiologists. In addition, the contrast index and speed index of the two systems were measured using the step wedge in the phantom. The unpaired, unequal variance t-test was used to test any statistically significant differences. Results: There were no significant (p < 0.05) differences between the images printed using the two systems in terms of microcalcification and tumour mass detectability. The wet system resulted in slightly higher contrast index while the dry system showed significantly higher speed index. Conclusion: Both wet and dry laser imaging systems can produce mammography images of good quality on which 0.2 mm microcalcifications and 2 mm tumour masses can be detected. Dry systems are preferable due to the absence of wet chemical processing and solid or liquid chemical waste. The wet laser imaging systems, however, still represent a useful alternative to dry laser imaging systems for mammography studies

  5. High sensitivity optical molecular imaging system

    An, Yu; Yuan, Gao; Huang, Chao; Jiang, Shixin; Zhang, Peng; Wang, Kun; Tian, Jie


    Optical Molecular Imaging (OMI) has the advantages of high sensitivity, low cost and ease of use. By labeling the regions of interest with fluorescent or bioluminescence probes, OMI can noninvasively obtain the distribution of the probes in vivo, which play the key role in cancer research, pharmacokinetics and other biological studies. In preclinical and clinical application, the image depth, resolution and sensitivity are the key factors for researchers to use OMI. In this paper, we report a high sensitivity optical molecular imaging system developed by our group, which can improve the imaging depth in phantom to nearly 5cm, high resolution at 2cm depth, and high image sensitivity. To validate the performance of the system, special designed phantom experiments and weak light detection experiment were implemented. The results shows that cooperated with high performance electron-multiplying charge coupled device (EMCCD) camera, precision design of light path system and high efficient image techniques, our OMI system can simultaneously collect the light-emitted signals generated by fluorescence molecular imaging, bioluminescence imaging, Cherenkov luminance and other optical imaging modality, and observe the internal distribution of light-emitting agents fast and accurately.

  6. Lossy image compression for digital medical imaging systems

    Wilhelm, Paul S.; Haynor, David R.; Kim, Yongmin; Nelson, Alan C.; Riskin, Eve A.


    Image compression at rates of 10:1 or greater could make PACS much more responsive and economically attractive. This paper describes a protocol for subjective and objective evaluation of the fidelity of compressed/decompressed images to the originals and presents the results ofits application to four representative and promising compression methods. The methods examined are predictive pruned tree-structured vector quantization, fractal compression, the discrete cosine transform with equal weighting of block bit allocation, and the discrete cosine transform with human visual system weighting of block bit allocation. Vector quantization is theoretically capable of producing the best compressed images, but has proven to be difficult to effectively implement. It has the advantage that it can reconstruct images quickly through a simple lookup table. Disadvantages are that codebook training is required, the method is computationally intensive, and achieving the optimum performance would require prohibitively long vector dimensions. Fractal compression is a relatively new compression technique, but has produced satisfactory results while being computationally simple. It is fast at both image compression and image reconstruction. Discrete cosine iransform techniques reproduce images well, but have traditionally been hampered by the need for intensive computing to compress and decompress images. A protocol was developed for side-by-side observer comparison of reconstructed images with originals. Three 1024 X 1024 CR (Computed Radiography) images and two 512 X 512 X-ray CT images were viewed at six bit rates (0.2, 0.4, 0.6, 0.9, 1.2, and 1.5 bpp for CR, and 1.0, 1.3, 1.6, 1.9, 2.2, 2.5 bpp for X-ray CT) by nine radiologists at the University of Washington Medical Center. The CR images were viewed on a Pixar II Megascan (2560 X 2048) monitor and the CT images on a Sony (1280 X 1024) monitor. The radiologists' subjective evaluations of image fidelity were compared to

  7. A gamma cammera image processing system

    Chen Weihua; Mei Jufang; Jiang Wenchuan; Guo Zhenxiang


    A microcomputer based gamma camera image processing system has been introduced. Comparing with other systems, the feature of this system is that an inexpensive microcomputer has been combined with specially developed hardware, such as, data acquisition controller, data processor and dynamic display controller, ect. Thus the process of picture processing has been speeded up and the function expense ratio of the system raised

  8. Advanced image display systems in radiology

    Wendler, T.


    Advanced image display systems for the fully digital diagnostic imaging departments of the future will be far more than simple replacements of the traditional film-viewing equipment. The new capabilities of very high resolution and highly dynamic displays offer a userfriendly and problem-oriented way of image interpretation. Advanced harware-, software- and human-machine interaction-concepts have been outlined. A scenario for a future way of handling and displaying images, reflecting a new image viewing paradigm in radiology is sketched which has been realized in an experimental image workstation model in the laboratory which, despite its technical complexity, offers a consistent strategy for fast and convenient interaction with image objects. The perspective of knowledge based techniques for workstation control software with object-oriented programming environments and user- and task-adaptive behavior leads to more advanced display properties and a new quality of userfriendliness. 2 refs.; 5 figs

  9. MONSOON Image Acquisition System | CTIO

    Staff CTIO History CTIO Directors Historic Highlights Site Description Contact Us Astronomers Observing Contact Acknowledgments TS4 History ISPI ISPI Exposure Time Calculator OSIRIS Spartan Optical Imagers single detector to very large focal planes made from arrays of detectors. The basic hierarchy of a

  10. Devices for Evaluating Imaging Systems. Chapter 15

    Demirkaya, O.; Al-Mazrou, R. [Department of Biomedical Physics, King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia)


    A quality management system (QMS) has three main components: (a) Quality assurance (QA); (b) Quality improvement; (c) Quality control (QC). The aim of a QMS is to ensure that the deliverables meet the requirements set forth by the users. The deliverables can be, in general, all the services provided in a nuclear medicine department, and the diagnostic imaging services in particular. In this section, the primary focus is the diagnostic imaging equipment and images produced by them.

  11. Imaging of dopaminergic system in movement disorders

    Kim, Yu Kyeong; Kim, Sang Eun


    Parkinson's disease is a common neurodegenerative disorder that is mainly caused by dopaminergic neuron loss in the substantia nigra. Several radiopharmaceutics have been developed to evaluated the integrity of dopaminergic neuronal system. In vivo PET and SPECT imaging of presynaptic dopamine imaging are already applied to Parkinson's disease and other parkinsonism, and can demonstrate the dopaminergic dysfunction. This review summarized the use of the presynaptic dopaminergic imaging in PD as biomarkers in evaluation of disease progression as well as in diagnosis of PD

  12. Scanned Image Projection System Employing Intermediate Image Plane

    DeJong, Christian Dean (Inventor); Hudman, Joshua M. (Inventor)


    In imaging system, a spatial light modulator is configured to produce images by scanning a plurality light beams. A first optical element is configured to cause the plurality of light beams to converge along an optical path defined between the first optical element and the spatial light modulator. A second optical element is disposed between the spatial light modulator and a waveguide. The first optical element and the spatial light modulator are arranged such that an image plane is created between the spatial light modulator and the second optical element. The second optical element is configured to collect the diverging light from the image plane and collimate it. The second optical element then delivers the collimated light to a pupil at an input of the waveguide.

  13. Image processing system for flow pattern measurements

    Ushijima, Satoru; Miyanaga, Yoichi; Takeda, Hirofumi


    This paper describes the development and application of an image processing system for measurements of flow patterns occuring in natural circulation water flows. In this method, the motions of particles scattered in the flow are visualized by a laser light slit and they are recorded on normal video tapes. These image data are converted to digital data with an image processor and then transfered to a large computer. The center points and pathlines of the particle images are numerically analized, and velocity vectors are obtained with these results. In this image processing system, velocity vectors in a vertical plane are measured simultaneously, so that the two dimensional behaviors of various eddies, with low velocity and complicated flow patterns usually observed in natural circulation flows, can be determined almost quantitatively. The measured flow patterns, which were obtained from natural circulation flow experiments, agreed with photographs of the particle movements, and the validity of this measuring system was confirmed in this study. (author)

  14. Fibre laser based broadband THz imaging systems

    Eichhorn, Finn

    imaging techniques. This thesis exhibits that fiber technology can improve the robustness and the flexibility of terahertz imaging systems both by the use of fiber-optic light sources and the employment of optical fibers as light distribution medium. The main focus is placed on multi-element terahertz...

  15. Image based rendering of iterated function systems

    Wijk, van J.J.; Saupe, D.


    A fast method to generate fractal imagery is presented. Iterated function systems (IFS) are based on repeatedly copying transformed images. We show that this can be directly translated into standard graphics operations: Each image is generated by texture mapping and blending copies of the previous

  16. Sampling system for in vivo ultrasound images

    Jensen, Jorgen Arendt; Mathorne, Jan


    Newly developed algorithms for processing medical ultrasound images use the high frequency sampled transducer signal. This paper describes demands imposed on a sampling system suitable for acquiring such data and gives details about a prototype constructed. It acquires full clinical images...... at a sampling frequency of 20 MHz with a resolution of 12 bits. The prototype can be used for real time image processing. An example of a clinical in vivo image is shown and various aspects of the data acquisition process are discussed....

  17. Four-Mirror Freeform Reflective Imaging Systems

    National Aeronautics and Space Administration — Central Objectives: The research involves a revelation of the solution space for revolutionary families of four-mirror freeform reflective imaging systems. A...

  18. Fusion of Images from Dissimilar Sensor Systems

    Chow, Khin


    Different sensors exploit different regions of the electromagnetic spectrum; therefore a multi-sensor image fusion system can take full advantage of the complementary capabilities of individual sensors in the suit...

  19. Shimadzu magnetic resonance imaging system, SMT-50

    Oikawa, Shiro; Nishida, Takayuki; Fujio, Yasuo


    The magnetic resonance imaging (MRI) system, as a new modality of medical imaging, has already been put to practical applications on many clinical sites, through which a lot of clinical data has been accumulated. It can offer a powerful new probe of internal anatomy of the human body and its functions. Now that the MRI has established its effectiveness in diagnosis, a really practical MRI system which features high efficiency and economical design with high patient throughput is strongly called for. Introduced in this article is a superconductive magnet MRI system, SMT-50, operating at 5000 Gauss. It has realized an excellent diagnostic capability with such functions as multi-slice multi-echo imaging, high sensitive, surface coil technique and so on. High resolution image display (1024 x 1024 pixcel) unit and separate console system (viewing console and scanning console) will assist high patient throughput. The outline of the SMT-50 and its clinical data are reported here. (author)

  20. System for imaging plutonium through heavy shielding

    Kuckertz, T.H.; Cannon, T.M.; Fenimore, E.E.; Moss, C.E.; Nixon, K.V.


    A single pinhole can be used to image strong self-luminescent gamma-ray sources such as plutonium on gamma scintillation (Anger) cameras. However, if the source is weak or heavily shielded, a poor signal to noise ratio can prevent acquisition of the image. An imaging system designed and built at Los Alamos National Laboratory uses a coded aperture to image heavily shielded sources. The paper summarizes the mathematical techniques, based on the Fast Delta Hadamard transform, used to decode raw images. Practical design considerations such as the phase of the uniformly redundant aperture and the encoded image sampling are discussed. The imaging system consists of a custom designed m-sequence coded aperture, a Picker International Corporation gamma scintillation camera, a LeCroy 3500 data acquisition system, and custom imaging software. The paper considers two sources - 1.5 mCi 57 Co unshielded at a distance of 27 m and 220 g of bulk plutonium (11.8% 240 Pu) with 0.3 cm lead, 2.5 cm steel, and 10 cm of dense plastic material at a distance of 77.5 cm. Results show that the location and geometry of a source hidden in a large sealed package can be determined without having to open the package. 6 references, 4 figures

  1. Document Examination: Applications of Image Processing Systems.

    Kopainsky, B


    Dealing with images is a familiar business for an expert in questioned documents: microscopic, photographic, infrared, and other optical techniques generate images containing the information he or she is looking for. A recent method for extracting most of this information is digital image processing, ranging from the simple contrast and contour enhancement to the advanced restoration of blurred texts. When combined with a sophisticated physical imaging system, an image pricessing system has proven to be a powerful and fast tool for routine non-destructive scanning of suspect documents. This article reviews frequent applications, comprising techniques to increase legibility, two-dimensional spectroscopy (ink discrimination, alterations, erased entries, etc.), comparison techniques (stamps, typescript letters, photo substitution), and densitometry. Computerized comparison of handwriting is not included. Copyright © 1989 Central Police University.

  2. A fractal-based image encryption system

    Abd-El-Hafiz, S. K.


    This study introduces a novel image encryption system based on diffusion and confusion processes in which the image information is hidden inside the complex details of fractal images. A simplified encryption technique is, first, presented using a single-fractal image and statistical analysis is performed. A general encryption system utilising multiple fractal images is, then, introduced to improve the performance and increase the encryption key up to hundreds of bits. This improvement is achieved through several parameters: feedback delay, multiplexing and independent horizontal or vertical shifts. The effect of each parameter is studied separately and, then, they are combined to illustrate their influence on the encryption quality. The encryption quality is evaluated using different analysis techniques such as correlation coefficients, differential attack measures, histogram distributions, key sensitivity analysis and the National Institute of Standards and Technology (NIST) statistical test suite. The obtained results show great potential compared to other techniques.

  3. Reliability demonstration of imaging surveillance systems

    Sheridan, T.F.; Henderson, J.T.; MacDiarmid, P.R.


    Security surveillance systems which employ closed circuit television are being deployed with increasing frequency for the protection of property and other valuable assets. A need exists to demonstrate the reliability of such systems before their installation to assure that the deployed systems will operate when needed with only the scheduled amount of maintenance and support costs. An approach to the reliability demonstration of imaging surveillance systems which employ closed circuit television is described. Failure definitions based on industry television standards and imaging alarm assessment criteria for surveillance systems are discussed. Test methods which allow 24 hour a day operation without the need for numerous test scenarios, test personnel and elaborate test facilities are presented. Existing reliability demonstration standards are shown to apply which obviate the need for elaborate statistical tests. The demonstration methods employed are shown to have applications in other types of imaging surveillance systems besides closed circuit television

  4. Breast imaging and reporting data system (BIRADS): Magnetic resonance imaging

    Tardivon, Anne A.; Athanasiou, Alexandra; Thibault, Fabienne; El Khoury, Carl


    This article reviews the technical aspects and interpretation criteria in breast MR imaging based on the first edition of breast imaging and reporting data system (BIRADS) published by the American College of Radiology (ACR) in 2003. In a second article, practical cases will be proposed for training the readers. The major aims of using this lexicon are: first to use a logical and standardized description of MR lesions, secondly to obtain a structured MR report with a clear final impression (BIRADS assessment categories), and thirdly to help comparison between different clinical studies based on similar breast MRI terminology

  5. Image quality in digital radiographic systems

    Almeida Solange Maria de


    Full Text Available The aim of the present study was to evaluate the image quality of four direct digital radiographic systems. Radiographs were made of the maxillary central incisor and mandibular left molar regions of a dry skull, and an aluminum step-wedge. The X-ray generator operated at 10 mA, 60 and 70 kVp, and images were acquired with 3, 5, 8, 12, 24 and 48 exposure pulses. Six well-trained observers classified the images by means of scores from 1 to 3. Collected data were submitted to nonparametric statistical analysis using Fisher's exact test. Statistical analysis showed significant differences (p<0.01 in image quality with the four systems. Based on the results, it was possible to conclude that: 1 all of the digital systems presented good performance in producing acceptable images for diagnosis, if the exposures of the step-wedge and the maxillary central incisor region were made at 5 pulses, as well as at 8 pulses for the mandibular left molar region, selecting 60 or 70kVp; 2 higher percentages of acceptable images were obtained with the administration of lower radiation doses in CCD-sensors (charge-coupled device; 3 the Storage Phosphor systems produced acceptable images at a large range of exposure settings, that included low, intermediate and high radiation doses.

  6. Image acquisition system for traffic monitoring applications

    Auty, Glen; Corke, Peter I.; Dunn, Paul; Jensen, Murray; Macintyre, Ian B.; Mills, Dennis C.; Nguyen, Hao; Simons, Ben


    An imaging system for monitoring traffic on multilane highways is discussed. The system, named Safe-T-Cam, is capable of operating 24 hours per day in all but extreme weather conditions and can capture still images of vehicles traveling up to 160 km/hr. Systems operating at different remote locations are networked to allow transmission of images and data to a control center. A remote site facility comprises a vehicle detection and classification module (VCDM), an image acquisition module (IAM) and a license plate recognition module (LPRM). The remote site is connected to the central site by an ISDN communications network. The remote site system is discussed in this paper. The VCDM consists of a video camera, a specialized exposure control unit to maintain consistent image characteristics, and a 'real-time' image processing system that processes 50 images per second. The VCDM can detect and classify vehicles (e.g. cars from trucks). The vehicle class is used to determine what data should be recorded. The VCDM uses a vehicle tracking technique to allow optimum triggering of the high resolution camera of the IAM. The IAM camera combines the features necessary to operate consistently in the harsh environment encountered when imaging a vehicle 'head-on' in both day and night conditions. The image clarity obtained is ideally suited for automatic location and recognition of the vehicle license plate. This paper discusses the camera geometry, sensor characteristics and the image processing methods which permit consistent vehicle segmentation from a cluttered background allowing object oriented pattern recognition to be used for vehicle classification. The image capture of high resolution images and the image characteristics required for the LPRMs automatic reading of vehicle license plates, is also discussed. The results of field tests presented demonstrate that the vision based Safe-T-Cam system, currently installed on open highways, is capable of producing automatic

  7. Hologlyphics: volumetric image synthesis performance system

    Funk, Walter


    This paper describes a novel volumetric image synthesis system and artistic technique, which generate moving volumetric images in real-time, integrated with music. The system, called the Hologlyphic Funkalizer, is performance based, wherein the images and sound are controlled by a live performer, for the purposes of entertaining a live audience and creating a performance art form unique to volumetric and autostereoscopic images. While currently configured for a specific parallax barrier display, the Hologlyphic Funkalizer's architecture is completely adaptable to various volumetric and autostereoscopic display technologies. Sound is distributed through a multi-channel audio system; currently a quadraphonic speaker setup is implemented. The system controls volumetric image synthesis, production of music and spatial sound via acoustic analysis and human gestural control, using a dedicated control panel, motion sensors, and multiple musical keyboards. Music can be produced by external acoustic instruments, pre-recorded sounds or custom audio synthesis integrated with the volumetric image synthesis. Aspects of the sound can control the evolution of images and visa versa. Sounds can be associated and interact with images, for example voice synthesis can be combined with an animated volumetric mouth, where nuances of generated speech modulate the mouth's expressiveness. Different images can be sent to up to 4 separate displays. The system applies many novel volumetric special effects, and extends several film and video special effects into the volumetric realm. Extensive and various content has been developed and shown to live audiences by a live performer. Real world applications will be explored, with feedback on the human factors.

  8. Visual computing scientific visualization and imaging systems


    This volume aims to stimulate discussions on research involving the use of data and digital images as an understanding approach for analysis and visualization of phenomena and experiments. The emphasis is put not only on graphically representing data as a way of increasing its visual analysis, but also on the imaging systems which contribute greatly to the comprehension of real cases. Scientific Visualization and Imaging Systems encompass multidisciplinary areas, with applications in many knowledge fields such as Engineering, Medicine, Material Science, Physics, Geology, Geographic Information Systems, among others. This book is a selection of 13 revised and extended research papers presented in the International Conference on Advanced Computational Engineering and Experimenting -ACE-X conferences 2010 (Paris), 2011 (Algarve), 2012 (Istanbul) and 2013 (Madrid). The examples were particularly chosen from materials research, medical applications, general concepts applied in simulations and image analysis and ot...

  9. Under sodium ultrasonic imaging system for PFBR

    Patankar, V.H.; Lalwani, S.K.; Agashe, A.A.


    Under Sodium UltraSonic Scanner (USUSS) has been developed to detect the growth and protrusion of fuel sub-assemblies of PFBR, submerged in liquid sodium by using the ultrasonic imaging technique during reactor shut-down when liquid sodium is at 180 ℃. The imaging is carried out prior to every Fuel handling operation. Electronics Division, BARC has designed and developed an 8-Channel Ultrasonic Imaging System (UIS) which consists of 4 downward viewing and 4 side viewing ultrasonic transducers alongwith pulser-receiver, signal processing electronics hardware and software. An automated mechanical scanner developed by IGCAR houses sodium immersible transducers to image the fuel sub assemblies. The system has been successfully tested with dummy protruding and grown FSAs, submerged under liquid sodium. Such ultrasonic imaging systems are not available to India from international market. The USUSS developed indigenously has all the features available in similar systems developed by other countries. After every imaging campaign, the mechanical scanner containing ultrasonic transducers is stored in the Argon filled storage-pit. Before every campaign of USUSS, it is necessary to check the healthiness of the sodium immersible and contaminated ultrasonic transducers, as the under-sodium scanner is decontaminated once in five years. For this purpose, a novel Non Contact Ultrasonic Inspection System (NCUIS) has been designed and developed by Electronics Division, BARC to check the functionality of the high-temperature and contaminated transducers of USUSS, using air-coupled ultrasonic technique. (author)

  10. Evaluation of transmitted images by teleradiology system

    Hoshikawa, Yoshikazu


    Teleradiology system is a combination of digital data networks and computer systems, which is the electric transmission of radiographs and/or radiologic images from local to center radiological system. The author evaluated reproducibility of transmitted images using Photophone (Image Data Corporation) as teleradiology system. Proven cases of abdominal free air (38 plain films, 15 CT), pneumothorax (24 plain films, 20 CT) and small bowel obstruction (30 plain films, 8 CT) were transmitted. Findings could be identified on non-magnified plain films in 75.6%, 83.3% and 96.7% respectively and on magnified CT in 100%, 100% and 100%. Transmitted images of 57 cases of abdominal trauma were read for positive findings and diagnosis by three radiologists. Average positive ratio was 47.3% on plain films and 70.9% on CT. Diagnosis was correct in 66.7% on CT. Specificity and sensitivity were 81.9% and 61.6% respectively on plain film and 88.6% and 93.9% on CT. The accuracy of transmitted images appears to be unsatisfactory on this study. It is suggested that the system is useful for consultation of already identified findings on the original images. (author)

  11. Evaluation of transmitted images by teleradiology system

    Hoshikawa, Yoshikazu (St. Marianna Univ., Kawasaki (Japan). School of Medicine)


    Teleradiology system is a combination of digital data networks and computer systems, which is the electric transmission of radiographs and/or radiologic images from local to center radiological system. The author evaluated reproducibility of transmitted images using Photophone (Image Data Corporation) as teleradiology system. Proven cases of abdominal free air (38 plain films, 15 CT), pneumothorax (24 plain films, 20 CT) and small bowel obstruction (30 plain films, 8 CT) were transmitted. Findings could be identified on non-magnified plain films in 75.6%, 83.3% and 96.7% respectively and on magnified CT in 100%, 100% and 100%. Transmitted images of 57 cases of abdominal trauma were read for positive findings and diagnosis by three radiologists. Average positive ratio was 47.3% on plain films and 70.9% on CT. Diagnosis was correct in 66.7% on CT. Specificity and sensitivity were 81.9% and 61.6% respectively on plain film and 88.6% and 93.9% on CT. The accuracy of transmitted images appears to be unsatisfactory on this study. It is suggested that the system is useful for consultation of already identified findings on the original images. (author).

  12. Imaging system design and image interpolation based on CMOS image sensor

    Li, Yu-feng; Liang, Fei; Guo, Rui


    An image acquisition system is introduced, which consists of a color CMOS image sensor (OV9620), SRAM (CY62148), CPLD (EPM7128AE) and DSP (TMS320VC5509A). The CPLD implements the logic and timing control to the system. SRAM stores the image data, and DSP controls the image acquisition system through the SCCB (Omni Vision Serial Camera Control Bus). The timing sequence of the CMOS image sensor OV9620 is analyzed. The imaging part and the high speed image data memory unit are designed. The hardware and software design of the image acquisition and processing system is given. CMOS digital cameras use color filter arrays to sample different spectral components, such as red, green, and blue. At the location of each pixel only one color sample is taken, and the other colors must be interpolated from neighboring samples. We use the edge-oriented adaptive interpolation algorithm for the edge pixels and bilinear interpolation algorithm for the non-edge pixels to improve the visual quality of the interpolated images. This method can get high processing speed, decrease the computational complexity, and effectively preserve the image edges.

  13. The National Ignition Facility Neutron Imaging System

    Wilke, Mark D.; Batha, Steven H.; Bradley, Paul A.; Day, Robert D.; Clark, David D.; Fatherley, Valerie E.; Finch, Joshua P.; Gallegos, Robert A.; Garcia, Felix P.; Grim, Gary P.; Jaramillo, Steven A.; Montoya, Andrew J.; Morgan, George L.; Oertel, John A.; Ortiz, Thomas A.; Payton, Jeremy R.; Pazuchanics, Peter; Schmidt, Derek W.; Valdez, Adelaida C.; Wilde, Carl H.


    The National Ignition Facility (NIF) is scheduled to begin deuterium-tritium (DT) shots possibly in the next several years. One of the important diagnostics in understanding capsule behavior and to guide changes in Hohlraum illumination, capsule design, and geometry will be neutron imaging of both the primary 14 MeV neutrons and the lower-energy downscattered neutrons in the 6-13 MeV range. The neutron imaging system (NIS) described here, which we are currently building for use on NIF, uses a precisely aligned set of apertures near the target to form the neutron images on a segmented scintillator. The images are recorded on a gated, intensified charge coupled device. Although the aperture set may be as close as 20 cm to the target, the imaging camera system will be located at a distance of 28 m from the target. At 28 m the camera system is outside the NIF building. Because of the distance and shielding, the imager will be able to obtain images with little background noise. The imager will be capable of imaging downscattered neutrons from failed capsules with yields Y n >10 14 neutrons. The shielding will also permit the NIS to function at neutron yields >10 18 , which is in contrast to most other diagnostics that may not work at high neutron yields. The following describes the current NIF NIS design and compares the predicted performance with the NIF specifications that must be satisfied to generate images that can be interpreted to understand results of a particular shot. The current design, including the aperture, scintillator, camera system, and reconstruction methods, is briefly described. System modeling of the existing Omega NIS and comparison with the Omega data that guided the NIF design based on our Omega results is described. We will show NIS model calculations of the expected NIF images based on component evaluations at Omega. We will also compare the calculated NIF input images with those unfolded from the NIS images generated from our NIS numerical

  14. Design of optically stable image reflector system.

    Tsai, Chung-Yu


    The design of a partially optically stable (POS) reflector system, in which the exit ray direction and image pose are unchanged as the reflector system rotates about a specific directional vector, was presented in an earlier study by the current group [Appl. Phys. B100, 883-890 (2010)]. The present study further proposes an optically stable image (OSI) reflector system, in which not only is the optical stability property of the POS system retained, but the image position and total ray path length are also fixed. An analytical method is proposed for the design of OSI reflector systems comprising multiple reflectors. The validity of the proposed approach is demonstrated by means of two illustrative examples.

  15. Imaging of primary central nervous system lymphoma

    Tang, Y.Z., E-mail: [Royal Free Hospital, London (United Kingdom); Booth, T.C.; Bhogal, P.; Malhotra, A.; Wilhelm, T. [Royal Free Hospital, London (United Kingdom)


    Primary central nervous system lymphoma (PCNSL) comprises 5% of all primary brain tumours. PCNSL demonstrates a variety of well-documented imaging findings, which can vary depending on immune status and histological type. Imaging features of PCNSL may overlap with other tumours and infection making definitive diagnosis challenging. In addition, several rare variants of PCNSL have been described, each with their own imaging characteristics. Advanced imaging techniques including 2-[{sup 18}F]-fluoro-2-deoxy-D-glucose ({sup 18}FDG) and {sup 11}C positron-emission tomography (PET), {sup 201}Tl single-photon emission computed tomography (SPECT), {sup 1}H-magnetic resonance spectroscopy (MRS), and MR perfusion, have been used to aid differentiation of PCNSL from other tumours. Ultimately, no imaging method can definitively diagnose PCNSL, and histology is required.

  16. Expert System for ASIC Imaging

    Gupta, Shri N.; Arshak, Khalil I.; McDonnell, Pearse; Boyce, Conor; Duggan, Andrew


    With the developments in the techniques of artificial intelligence over the last few years, development of advisory, scheduling and similar class of problems has become very convenient using tools such as PROLOG. In this paper an expert system has been described which helps lithographers and process engineers in several ways. The methodology used is to model each work station according to its input, output and control parameters, combine these work stations in a logical sequence based on past experience and work out process schedule for a job. In addition, all the requirements vis-a-vis a particular job parameters are converted into decision rules. One example is the exposure time, develop time for a wafer with different feature sizes would be different. This expert system has been written in Turbo Prolog. By building up a large number of rules, one can tune the program to any facility and use it for as diverse applications as advisory help, trouble shooting etc. Leitner (1) has described an advisory expert system that is being used at National Semiconductor. This system is quite different from the one being reported in the present paper. The approach is quite different for one. There is stress on job flow and process for another.

  17. Architecture Of High Speed Image Processing System

    Konishi, Toshio; Hayashi, Hiroshi; Ohki, Tohru


    One of architectures for a high speed image processing system which corresponds to a new algorithm for a shape understanding is proposed. And the hardware system which is based on the archtecture was developed. Consideration points of the architecture are mainly that using processors should match with the processing sequence of the target image and that the developed system should be used practically in an industry. As the result, it was possible to perform each processing at a speed of 80 nano-seconds a pixel.

  18. Highly Protable Airborne Multispectral Imaging System

    Lehnemann, Robert; Mcnamee, Todd


    A portable instrumentation system is described that includes and airborne and a ground-based subsytem. It can acquire multispectral image data over swaths of terrain ranging in width from about 1.5 to 1 km. The system was developed especially for use in coastal environments and is well suited for performing remote sensing and general environmental monitoring. It includes a small,munpilotaed, remotely controlled airplance that carries a forward-looking camera for navigation, three downward-looking monochrome video cameras for imaging terrain in three spectral bands, a video transmitter, and a Global Positioning System (GPS) reciever.

  19. MIDAS - ESO's new image processing system

    Banse, K.; Crane, P.; Grosbol, P.; Middleburg, F.; Ounnas, C.; Ponz, D.; Waldthausen, H.


    The Munich Image Data Analysis System (MIDAS) is an image processing system whose heart is a pair of VAX 11/780 computers linked together via DECnet. One of these computers, VAX-A, is equipped with 3.5 Mbytes of memory, 1.2 Gbytes of disk storage, and two tape drives with 800/1600 bpi density. The other computer, VAX-B, has 4.0 Mbytes of memory, 688 Mbytes of disk storage, and one tape drive with 1600/6250 bpi density. MIDAS is a command-driven system geared toward the interactive user. The type and number of parameters in a command depends on the unique parameter invoked. MIDAS is a highly modular system that provides building blocks for the undertaking of more sophisticated applications. Presently, 175 commands are available. These include the modification of the color-lookup table interactively, to enhance various image features, and the interactive extraction of subimages.

  20. High speed imaging system for nuclear diagnostics

    Eyer, H.H.


    A high speed imaging system based on state-of-the-art photosensor arrays has been designed for use in nuclear diagnostics. The system is comprised of a front-end rapid-scan solid-state camera, a high speed digitizer, and a PCM line driver in a downhole package and a memory buffer system in a uphole trailer. The downhole camera takes a ''snapshot'' of a nuclear device created flux stream, digitizes the image and transmits it to the uphole memory system before being destroyed. The memory system performs two functions: it retains the data for local display and processing by a microprocessor, and it buffers the data for retransmission at slower rates to the LLL computational facility (NADS). The impetus for such a system as well as its operation are discussed. Also discussed are new systems under development which incorporate higher data rates and more resolution

  1. High speed imaging system for nuclear diagnostics

    Eyer, H.H.


    A high speed imaging system based on state-of-the-art photosensor arrays has been designed for use in nuclear diagnostics. The system is comprised of a front-end rapid-scan solid-state camera, a high speed digitizer, and a PCM line driver in a downhole package and a memory buffer system in an uphole trailer. The downhole camera takes a ''snapshot'' of a nuclear device created flux stream, digitizes the image and transmits it to the uphole memory system before being destroyed. The memory system performs two functions: it retains the data for local display and processing by a microprocessor, and it buffers the data for retransmission at slower rates to the LLL computational facility (NADS). The impetus for such a system as well as its operation is discussed. Also discussed are new systems under development which incorporate higher data rates and more resolution

  2. NMR imaging of the cardiovascular system

    Canby, R.C.; Evanochko, W.T.; Pohost, G.M.


    Proton nuclear magnetic resonance (NMR) imaging permits high-resolution tomographic and three-dimensional images of the human body to be obtained without exposure to ionizing radiation. Such imaging not only yields anatomic resolution comparable to X-ray examinations but also provides a potential means to discriminate between healthy tissue and diseased tissue. This potential is based on certain NMR properties known as relaxation times, which determine, in part, the signal intensity in an image. These properties are related to such factors as the sizes and concentrations of proteins and mobile lipids and the compartmentalization of the protons of water. Although NMR imaging (also called magnetic resonance imaging, MRI) is becoming widely available for clinical use, application to the cardiovascular system, though promising, remains primarily a research tool. Gated proton NMR imaging can generate cardiac images with excellent morphologic detail and contrast; however, its ultimate importance as a cardiovascular diagnostic modality will depend on the development of several unique applications. These applications are discussed in this paper

  3. Image change detection systems, methods, and articles of manufacture

    Jones, James L.; Lassahn, Gordon D.; Lancaster, Gregory D.


    Aspects of the invention relate to image change detection systems, methods, and articles of manufacture. According to one aspect, a method of identifying differences between a plurality of images is described. The method includes loading a source image and a target image into memory of a computer, constructing source and target edge images from the source and target images to enable processing of multiband images, displaying the source and target images on a display device of the computer, aligning the source and target edge images, switching displaying of the source image and the target image on the display device, to enable identification of differences between the source image and the target image.

  4. Active gated imaging in driver assistance system

    Grauer, Yoav


    In this paper, we shall present the active gated imaging system (AGIS) in relation to the automotive field. AGIS is based on a fast-gated camera and pulsed illuminator, synchronized in the time domain to record images of a certain range of interest. A dedicated gated CMOS imager sensor and near infra-red (NIR) pulsed laser illuminator, is presented in this paper to provide active gated technology. In recent years, we have developed these key components and learned the system parameters, which are most beneficial to nighttime (in all weather conditions) driving in terms of field of view, illumination profile, resolution, and processing power. We shall present our approach of a camera-based advanced driver assistance systems (ADAS) named BrightEye™, which makes use of the AGIS technology in the automotive field.

  5. Consultation system for image diagnosis: Report formation support system

    Ikeda, M.; Sakuma, S.; Ishigaki, T.; Suzuki, K.; Oikawa, K.


    The authors developed a consultation system for image diagnosis, involving artificial intelligence ideas. In this system, the authors proposed a new report formation support system and implemented it in lymphangiography. This support system starts with the input of image interpretation. The input process is made mainly by selecting items. This system encodes the input findings into the semantic network, which is represented as a directed graph, and it reserves them into the knowledge database in the above structure. Finally, the output (report) is made in the near natural language, which corresponds to the input findings

  6. Fiber optic neutron imaging system: calibration

    Malone, R.M.; Gow, C.E.; Thayer, D.R.


    Two neutron imaging experiments using fiber optics have been performed at the Nevada Test Site. In each experiment, an array of scintillator fluor tubes is exposed to neutrons. Light is coupled out through radiation resistant PCS fibers (8-m long) into high-bandwidth, graded index fibers. For image reconstruction to be accurate, common timing differences and transmission variations between fiber optic channels are needed. The calibration system featured a scanning pulsed dye laser, a specially designed fiber optic star coupler, a tektronix 7912AD transient digitizer, and a DEC PDP 11/34 computing system

  7. X-ray image subtracting system

    Wesbey, W.H.; Keyes, G.S.; Georges, J.-P.J.


    An X-ray image subtracting system for making low contrast structures in the images more conspicuous is described. An X-ray source projects successive high and low energy X-ray beam pulses through a body and the resultant X-ray images are converted to optical images. Two image pick-up devices such as TV cameras that have synchronously operated shutters receive the alternate images and convert them to corresponding analog video signals. In some embodiments, the analog signals are converted to a matrix of digital pixel signals that are variously processed and subtracted and converted to signals for driving a TV monitor display and analog storage devices. In other embodiments the signals are processed and subtracted in analog form for display. The high and low energy pulses can follow each other immediately so good registration between subtracted images is obtainable even though the anatomy is in motion. The energy levels of the X-ray pulses are chosen to maximize the difference in attenuation between the anatomical structure which is to be subtracted out and that which remains. (author)

  8. Advances in Small Animal Imaging Systems

    Loudos, George K.


    The rapid growth in genetics and molecular biology combined with the development of techniques for genetically engineering small animals has led to an increased interest in in vivo laboratory animal imaging during the past few years. For this purpose, new instrumentation, data acquisition strategies, and image processing and reconstruction techniques are being developed, researched and evaluated. The aim of this article is to give a short overview of the state of the art technologies for high resolution and high sensitivity molecular imaging techniques, primarily positron emission tomography (PET) and single photon emission computed tomography (SPECT). The basic needs of small animal imaging will be described. The evolution in instrumentation in the past two decades, as well as the commercially available systems will be overviewed. Finally, the new trends in detector technology and preliminary results from challenging applications will be presented. For more details a number of references are provided

  9. Parallel asynchronous systems and image processing algorithms

    Coon, D. D.; Perera, A. G. U.


    A new hardware approach to implementation of image processing algorithms is described. The approach is based on silicon devices which would permit an independent analog processing channel to be dedicated to evey pixel. A laminar architecture consisting of a stack of planar arrays of the device would form a two-dimensional array processor with a 2-D array of inputs located directly behind a focal plane detector array. A 2-D image data stream would propagate in neuronlike asynchronous pulse coded form through the laminar processor. Such systems would integrate image acquisition and image processing. Acquisition and processing would be performed concurrently as in natural vision systems. The research is aimed at implementation of algorithms, such as the intensity dependent summation algorithm and pyramid processing structures, which are motivated by the operation of natural vision systems. Implementation of natural vision algorithms would benefit from the use of neuronlike information coding and the laminar, 2-D parallel, vision system type architecture. Besides providing a neural network framework for implementation of natural vision algorithms, a 2-D parallel approach could eliminate the serial bottleneck of conventional processing systems. Conversion to serial format would occur only after raw intensity data has been substantially processed. An interesting challenge arises from the fact that the mathematical formulation of natural vision algorithms does not specify the means of implementation, so that hardware implementation poses intriguing questions involving vision science.

  10. Semiautomatic digital imaging system for cytogenetic analysis

    Chaubey, R.C.; Chauhan, P.C.; Bannur, S.V.; Kulgod, S.V.; Chadda, V.K.; Nigam, R.K.


    The paper describes a digital image processing system, developed indigenously at BARC for size measurement of microscopic biological objects such as cell, nucleus and micronucleus in mouse bone marrow; cytochalasin-B blocked human lymphocytes in-vitro; numerical counting and karyotyping of metaphase chromosomes of human lymphocytes. Errors in karyotyping of chromosomes by the imaging system may creep in due to lack of well-defined position of centromere or extensive bending of chromosomes, which may result due to poor quality of preparation. Good metaphase preparations are mandatory for precise and accurate analysis by the system. Additional new morphological parameters about each chromosome have to be incorporated to improve the accuracy of karyotyping. Though the experienced cytogenetisist is the final judge; however, the system assists him/her to carryout analysis much faster as compared to manual scoring. Further, experimental studies are in progress to validate different software packages developed for various cytogenetic applications. (author)

  11. Imaging of the fetal central nervous system

    Pistorius, L.R.


    Introduction : Ultrasound and MR imaging of the fetal central nervous system (CNS) develop at an ever-increasing rate. Theoretically, the two modalities should be synergistic, but a literature review revealed the difficulties of determining the merit of either technique and revealed gaps in our

  12. A recommender system for medical imaging diagnostic.

    Monteiro, Eriksson; Valente, Frederico; Costa, Carlos; Oliveira, José Luís


    The large volume of data captured daily in healthcare institutions is opening new and great perspectives about the best ways to use it towards improving clinical practice. In this paper we present a context-based recommender system to support medical imaging diagnostic. The system relies on data mining and context-based retrieval techniques to automatically lookup for relevant information that may help physicians in the diagnostic decision.

  13. PET imaging of the autonomic nervous system

    THACKERAY, James T.; BENGEL, Frank M.


    The autonomic nervous system is the primary extrinsic control of heart rate and contractility, and is subject to adaptive and maladaptive changes in cardiovascular disease. Consequently, noninvasive assessment of neuronal activity and function is an attractive target for molecular imaging. A myriad of targeted radiotracers have been developed over the last 25 years for imaging various components of the sympathetic and parasympathetic signal cascades. While routine clinical use remains somewhat limited, a number of larger scale studies in recent years have supplied momentum to molecular imaging of autonomic signaling. Specifically, the findings of the ADMIRE HF trial directly led to United States Food and Drug Administration approval of 123I-metaiodobenzylguanidine (MIBG) for Single Photon Emission Computed Tomography (SPECT) assessment of sympathetic neuronal innervation, and comparable results have been reported using the analogous PET agent 11C-meta-hydroxyephedrine (HED). Due to the inherent capacity for dynamic quantification and higher spatial resolution, regional analysis may be better served by PET. In addition, preliminary clinical and extensive preclinical experience has provided a broad foundation of cardiovascular applications for PET imaging of the autonomic nervous system. Recent years have witnessed the growth of novel quantification techniques, expansion of multiple tracer studies, and improved understanding of the uptake of different radiotracers, such that the transitional biology of dysfunctional subcellular catecholamine handling can be distinguished from complete denervation. As a result, sympathetic neuronal molecular imaging is poised to play a role in individualized patient care, by stratifying cardiovascular risk, visualizing underlying biology, and guiding and monitoring therapy.

  14. Radiographic imaging system for high energy radiation


    A radiographic imaging system for high energy radiation is described utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation and interspersed among regions relatively opaque to such radiation. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  15. Penn State astronomical image processing system

    Truax, R.J.; Nousek, J.A.; Feigelson, E.D.; Lonsdale, C.J.


    The needs of modern astronomy for image processing set demanding standards in simultaneously requiring fast computation speed, high-quality graphic display, large data storage, and interactive response. An innovative image processing system was designed, integrated, and used; it is based on a supermicro architecture which is tailored specifically for astronomy, which provides a highly cost-effective alternative to the traditional minicomputer installation. The paper describes the design rationale, equipment selection, and software developed to allow other astronomers with similar needs to benefit from the present experience. 9 references

  16. Radiographic imaging system for high energy radiation

    Barrett, H.H.


    A radiographic imaging system for high energy radiation utilizing a detector of such radiation and a mask having regions relatively transparent to such radiation interspersed among regions relatively opaque to such radiation is described. A relative motion is imparted between the mask and the detector, the detector providing a time varying signal in response to the incident radiation and in response to the relative motion. The time varying signal provides, with the aid of a decoder, an image of a source of such radiation

  17. Brain MR imaging of systemic lupus erythematodes

    Kobayashi, Satoshi; Suzuki, Masayuki; Ueda, Fumiaki; Arai, Kazunori; Kobayashi, Takeshi; Kadoya, Masumi; Matsui, Osamu; Takashima, Tsutomu


    Brain MR imaging of 13 patients with systemic lupus erythematodus (SLE) were reviewed. Two major findings was obtained. One was deep white matter hyperintensity (DWMH) and periventricular hyperintensity (PVH), the other was cerebral infarction. In comparison with the same age group, relatively severe brain atrophy was also observed. It was thought that these findings were induced from the vasculitis caused by SLE. However, the influence of the steroid therapy could not be excluded. No definite correlation between MR findings and clinical symptoms were seen. In conclusion, when we interpret brain MR imaging of the patients with SLE, special attention should be paid to their age. (author)

  18. A Gimbal-Stabilized Compact Hyperspectral Imaging System, Phase II

    National Aeronautics and Space Administration — The Gimbal-stabilized Compact Hyperspectral Imaging System (GCHIS) fully integrates multi-sensor spectral imaging, stereovision, GPS and inertial measurement,...

  19. Web Based Distributed Coastal Image Analysis System, Phase I

    National Aeronautics and Space Administration — This project develops Web based distributed image analysis system processing the Moderate Resolution Imaging Spectroradiometer (MODIS) data to provide decision...

  20. Scattered radiation in fan beam imaging systems

    Johns, P.C.; Yaffe, M.


    Scatter-to-primary energy fluence ratios (S/P) have been studied for fan x-ray beams as used in CT scanners and slit projection radiography systems. The dependence of S/P on phantom diameter, distance from phantom to image receptor, and kilovoltage is presented. An empirical equation is given that predicts S/P over a wide range of fan beam imaging configurations. For CT body scans on a 4th-generation machine, S/P is approximately 5%. Scattered radiation can produce a significant cupping artefact in CT images which is similar to that due to beam hardening. When multiple slices are used in scanned slit radiography, they can be arranged such that the increase in S/P is negligible. Calculations of scatter-to-primary ratios for first order scattering showed that for fan beams the contribution of coherent scatter is comparable to or greater than that of incoherent first scatter

  1. System Matrix Analysis for Computed Tomography Imaging

    Flores, Liubov; Vidal, Vicent; Verdú, Gumersindo


    In practical applications of computed tomography imaging (CT), it is often the case that the set of projection data is incomplete owing to the physical conditions of the data acquisition process. On the other hand, the high radiation dose imposed on patients is also undesired. These issues demand that high quality CT images can be reconstructed from limited projection data. For this reason, iterative methods of image reconstruction have become a topic of increased research interest. Several algorithms have been proposed for few-view CT. We consider that the accurate solution of the reconstruction problem also depends on the system matrix that simulates the scanning process. In this work, we analyze the application of the Siddon method to generate elements of the matrix and we present results based on real projection data. PMID:26575482

  2. A PET imaging system dedicated to mammography

    Varela, J


    The imaging system Clear-PEM for positron emission mammography, under development within the framework of the Crystal Clear Collaboration at CERN, is presented. The detector is based on pixelized LYSO crystals optically coupled to avalanche photodiodes (APD) and readout by a fast low-noise electronic system. A dedicated digital trigger and data acquisition system is used for on-line selection of coincidence events with high efficiency, large bandwidth and negligible dead-time. The detector module performance was characterized in detail.

  3. An investigation of cerebrograph imaging system

    Chen Lianxiang; Zhang Qingling; Wang Xinhui; Luo Qikun


    A cerebrograph imaging system was investigated for the diagnosis of cerebrovascular diseases. This system can quantitatively analyse and map the regional cerebral blood flow (rCBF) and also the electroencephalography (EEG). The mapping of cerebellum-brain stem area was also realized. This system is the first one to combine the technology of nuclear medicine with electrophysiology, and thereby provide a combined information about the rCBF and the function of brain with coloured rCBF mapping, topographical EEG mapping and quantitative data at the same time. It has important value for the early diagnosis of brain diseases, especially for the cerebral vascular accident

  4. Intelligence, mapping, and geospatial exploitation system (IMAGES)

    Moellman, Dennis E.; Cain, Joel M.


    This paper provides further detail to one facet of the battlespace visualization concept described in last year's paper Battlespace Situation Awareness for Force XXI. It focuses on the National Imagery and Mapping Agency (NIMA) goal to 'provide customers seamless access to tailorable imagery, imagery intelligence, and geospatial information.' This paper describes Intelligence, Mapping, and Geospatial Exploitation System (IMAGES), an exploitation element capable of CONUS baseplant operations or field deployment to provide NIMA geospatial information collaboratively into a reconnaissance, surveillance, and target acquisition (RSTA) environment through the United States Imagery and Geospatial Information System (USIGS). In a baseplant CONUS setting IMAGES could be used to produce foundation data to support mission planning. In the field it could be directly associated with a tactical sensor receiver or ground station (e.g. UAV or UGV) to provide near real-time and mission specific RSTA to support mission execution. This paper provides IMAGES functional level design; describes the technologies, their interactions and interdependencies; and presents a notional operational scenario to illustrate the system flexibility. Using as a system backbone an intelligent software agent technology, called Open Agent ArchitectureTM (OAATM), IMAGES combines multimodal data entry, natural language understanding, and perceptual and evidential reasoning for system management. Configured to be DII COE compliant, it would utilize, to the extent possible, COTS applications software for data management, processing, fusion, exploitation, and reporting. It would also be modular, scaleable, and reconfigurable. This paper describes how the OAATM achieves data synchronization and enables the necessary level of information to be rapidly available to various command echelons for making informed decisions. The reasoning component will provide for the best information to be developed in the timeline

  5. Brain dopaminergic systems : imaging with positron tomography

    Baron, J C [University of Caen/INSERM U, Caen (France). CYCERON; Comar, D [E.E.C. Concerted Action on P.E.T. Investigations of Cellular Regeneration and Degeneration, Orsay (France) CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot; Farde, L [Karolinska Sjukhuset, Stockholm (Sweden); Martinot, J L; Mazoyer, B [CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot Paris-


    Imaging of the dopaminergic system in the human brain with the in vivo use of Positron Emission Tomography emerged in the late 1980s as a tool of major importance in clinical neurosciences and pharmacology. The last few years have witnessed rapid development of new radiotracers specific to receptors, reuptake sites and enzymes of the dopamine system; the application of these radiotracers has led to major break-troughs in the pathophysiology and therapy of movement disorders and schizophrenic-like psychoses. This book is the first to collect, in a single volume, state-of-the-art contributions to the various aspects of this research. Its contents address methodological issues related to the design, labelling, quantitative imaging and compartmental modeli-sation of radioligands of the post-synaptic, pre-synaptic and enzyme sites of the dopamine system and to their use in clinical research in the fields of Parkinson's disease as well as other movement disorders, psychoses and neuroleptic receptor occupancy. The chapters were written by leading European scientists in the field of PET, gathered together in Caen (France, November 1990) under the aegis of the EEC Concerted Action on PET Investigations of Cellular Regeneration and Degeneration. This book provides a current and comprehensive overview on PET studies of the brain dopamine system which should aid and interest neurologists , psychiatrists, pharmacologists and medical imaging scientists. (author). refs.; figs.; tabs.

  6. Imaging of systemic vasculitis in childhood

    Soliman, Magdy [The Hospital for Sick Children, Department of Medical Imaging, Toronto, ON (Canada); Cairo University, Department of Medical Imaging, Cairo (Egypt); Laxer, Ronald; Yeung, Rae [The Hospital for Sick Children, Department of Rheumatology, Toronto, ON (Canada); Manson, David; Doria, Andrea S. [The Hospital for Sick Children, Department of Medical Imaging, Toronto, ON (Canada)


    The term ''systemic vasculitis'' encompasses a diverse set of diseases linked by the presence of blood-vessel inflammation that are often associated with critical complications. These diseases are uncommon in childhood and are frequently subjected to a delayed diagnosis. Although the diagnosis and treatment may be similar for adult and childhood systemic vasculitides, the prevalence and classification vary according to the age group under investigation. For example, Kawasaki disease affects children while it is rarely encountered in adults. In 2006, the European League Against Rheumatism (EULAR) and the Pediatric Rheumatology European Society (PReS) proposed a classification system for childhood vasculitis adopting the system devised in the Chapel Hill Consensus Conference in 1993, which categorizes vasculitides according to the predominant size of the involved blood vessels into small, medium and large vessel diseases. Currently, medical imaging has a pivotal role in the diagnosis of vasculitis given recent developments in the imaging of blood vessels. For example, early diagnosis of coronary artery aneurysms, a serious complication of Kawasaki disease, is now possible by magnetic resonance imaging (MRI) of the heart and multidetector computed tomography (MDCT); positron emission tomography/CT (PET/CT) helps to assess active vascular inflammation in Takayasu arteritis. Our review offers a unique approach using the integration of the proposed classification criteria for common systemic childhood vasculitides with their most frequent imaging findings, along with differential diagnoses and an algorithm for diagnosis based on common findings. It should help radiologists and clinicians reach an early diagnosis, therefore facilitating the ultimate goal of proper management of affected children. (orig.)

  7. Imaging of systemic vasculitis in childhood

    Soliman, Magdy; Laxer, Ronald; Yeung, Rae; Manson, David; Doria, Andrea S.


    The term ''systemic vasculitis'' encompasses a diverse set of diseases linked by the presence of blood-vessel inflammation that are often associated with critical complications. These diseases are uncommon in childhood and are frequently subjected to a delayed diagnosis. Although the diagnosis and treatment may be similar for adult and childhood systemic vasculitides, the prevalence and classification vary according to the age group under investigation. For example, Kawasaki disease affects children while it is rarely encountered in adults. In 2006, the European League Against Rheumatism (EULAR) and the Pediatric Rheumatology European Society (PReS) proposed a classification system for childhood vasculitis adopting the system devised in the Chapel Hill Consensus Conference in 1993, which categorizes vasculitides according to the predominant size of the involved blood vessels into small, medium and large vessel diseases. Currently, medical imaging has a pivotal role in the diagnosis of vasculitis given recent developments in the imaging of blood vessels. For example, early diagnosis of coronary artery aneurysms, a serious complication of Kawasaki disease, is now possible by magnetic resonance imaging (MRI) of the heart and multidetector computed tomography (MDCT); positron emission tomography/CT (PET/CT) helps to assess active vascular inflammation in Takayasu arteritis. Our review offers a unique approach using the integration of the proposed classification criteria for common systemic childhood vasculitides with their most frequent imaging findings, along with differential diagnoses and an algorithm for diagnosis based on common findings. It should help radiologists and clinicians reach an early diagnosis, therefore facilitating the ultimate goal of proper management of affected children. (orig.)

  8. Expandable image compression system: A modular approach

    Ho, B.K.T.; Chan, K.K.; Ishimitsu, Y.; Lo, S.C.; Huang, H.K.


    The full-frame bit allocation algorithm for radiological image compression developed in the authors' laboratory can achieve compression ratios as high as 30:1. The software development and clinical evaluation of this algorithm has been completed. It involves two stages of operations: a two-dimensional discrete cosine transform and pixel quantization in the transform space with pixel depth kept accountable by a bit allocation table. Their design took an expandable modular approach based on the VME bus system which has a maximum data transfer rate of 48 Mbytes per second and a Motorola 68020 microprocessor as the master controller. The transform modules are based on advanced digital signal processor (DSP) chips microprogrammed to perform fast cosine transforms. Four DSP's built into a single-board transform module can process an 1K x 1K image in 1.7 seconds. Additional transform modules working in parallel can be added if even greater speeds are desired. The flexibility inherent in the microcode extends the capabilities of the system to incorporate images of variable sizes. Their design allows for a maximum image size of 2K x 2K

  9. Multilayer X-ray imaging systems

    Shealy, D. L.; Hoover, R. B.; Gabardi, D. R.


    An assessment of the imaging properties of multilayer X-ray imaging systems with spherical surfaces has been made. A ray trace analysis was performed to investigate the effects of using spherical substrates (rather than the conventional paraboloidal/hyperboloidal contours) for doubly reflecting Cassegrain telescopes. These investigations were carried out for mirrors designed to operate at selected soft X-ray/XUV wavelengths that are of significance for studies of the solar corona/transition region from the Stanford/MSFC Rocket X-Ray Telescope. The effects of changes in separation of the primary and secondary elements were also investigated. These theoretical results are presented as well as the results of ray trace studies to establish the resolution and vignetting effects as a function of field angle and system parameters.

  10. In-situ Planetary Subsurface Imaging System

    Song, W.; Weber, R. C.; Dimech, J. L.; Kedar, S.; Neal, C. R.; Siegler, M.


    Geophysical and seismic instruments are considered the most effective tools for studying the detailed global structures of planetary interiors. A planet's interior bears the geochemical markers of its evolutionary history, as well as its present state of activity, which has direct implications to habitability. On Earth, subsurface imaging often involves massive data collection from hundreds to thousands of geophysical sensors (seismic, acoustic, etc) followed by transfer by hard links or wirelessly to a central location for post processing and computing, which will not be possible in planetary environments due to imposed mission constraints on mass, power, and bandwidth. Emerging opportunities for geophysical exploration of the solar system from Venus to the icy Ocean Worlds of Jupiter and Saturn dictate that subsurface imaging of the deep interior will require substantial data reduction and processing in-situ. The Real-time In-situ Subsurface Imaging (RISI) technology is a mesh network that senses and processes geophysical signals. Instead of data collection then post processing, the mesh network performs the distributed data processing and computing in-situ, and generates an evolving 3D subsurface image in real-time that can be transmitted under bandwidth and resource constraints. Seismic imaging algorithms (including traveltime tomography, ambient noise imaging, and microseismic imaging) have been successfully developed and validated using both synthetic and real-world terrestrial seismic data sets. The prototype hardware system has been implemented and can be extended as a general field instrumentation platform tailored specifically for a wide variety of planetary uses, including crustal mapping, ice and ocean structure, and geothermal systems. The team is applying the RISI technology to real off-world seismic datasets. For example, the Lunar Seismic Profiling Experiment (LSPE) deployed during the Apollo 17 Moon mission consisted of four geophone instruments

  11. Development of terahertz systems for imaging applications

    Maestrojuán Biurrun, Itziar


    El principal objetivo de esta tesis fue el estudio y desarrollo de tecnología, concretamente mezcladores armónicos, trabajando a frecuencias de milimétricas y sub-milimétricas con el fin de implementar sistemas para aplicaciones de imagen. The main goal of this thesis was the study and development of technology, specifically harmonic mixers, working at millimetre and submillimetre frequencies in other to implement systems for imaging applications. A couple of sub-harmonic...

  12. Laboratory testing & measurement on optical imaging systems

    Theron, B


    Full Text Available on Optical Imaging Systems Bertus Theron 27 April 2013 presented at SIECPC 2013, Riyadh, Saudi Arabia Overview of Workshop Part 1. Introduction & Context  Some history of Arabic Optics  Context: Global vs Local optical testing... of Arabic Optics 1 See [4]  Arabic records of study of geometrical optics  Traced to Hellenistic (Greek) optics  Translated to Arabic  9th century  Arabic contribution to geometric optics  Not just translation to Arabic  Innovative research...

  13. GammaCam trademark radiation imaging system


    GammaCam trademark, a gamma-ray imaging system manufactured by AIL System, Inc., would benefit a site that needs to locate radiation sources. It is capable of producing a two-dimensional image of a radiation field superimposed on a black and white visual image. Because the system can be positioned outside the radiologically controlled area, the radiation exposure to personnel is significantly reduced and extensive shielding is not required. This report covers the following topics: technology description; performance; technology applicability and alternatives; cost; regulatory and policy issues; and lessons learned. The demonstration of GammaCam trademark in December 1996 was part of the Large-Scale Demonstration Project (LSDP) whose objective is to select and demonstrate potentially beneficial technologies at the Argonne National Laboratory-East (ANL) Chicago Pile-5 Research Reactor (CP-5). The purpose of the LSDP is to demonstrate that by using innovative and improved decontamination and decommissioning (D and D) technologies from various sources, significant benefits can be achieved when compared to baseline D and D technologies

  14. Brain MR imaging in systemic lupus erythematous

    Park, Hyun Ae; Chang, Kee Hyun; Han, Moon Hee; Lee, Kyung Hwon; Kim, Sung Kwon; Lee, Jung Sang [Seoul National University College of Medicine, Seoul (Korea, Republic of); Cha, Sang Hoon [Chungbuk National University College of Medicine, Chungju (Korea, Republic of)


    To present MR imaging findings of intracranial lesions in systemic lupus erythematosus(SLE), a retrospective study was performed on MR images of 33 SLE patients with neurologic symptoms and signs. MR imaging was performed on either a 0.5 T (21 patients) or 2.0 T unit (12 patients), using T1-weighted, proton-density-weighted, and T2-weighted spin echo sequences in all patients. In seven patients, post-contrast T1-weighted images were also obtained after administration of gadopentetate dimeglumine. The main MR findings consisted of focal lesions suggesting ischemia/infarct (15 patients), diffuse brain atrophy (8), and findings associated with infection (4). The MR findings were normal in 11 patients (33%). The focal lesions suggesting ischemia/infarcts presumably secondary to vasculitis were distributed in the cortex or subcortical white matter (7 patients), deep periventricular white matter (3), or in both areas (5). Most of the focal lesions were multiple and small in size. The findings associated with infection were variable and included communicating hydrocephalus, meningeal enhancement, granuloma, etc. MR findings of SLE were non-specific and therefore clinical correlation is needed when evaluating SLE in MR.

  15. Expandable image compression system: A modular approach

    Ho, B.K.T.; Lo, S.C.; Huang, H.K.


    The full-frame bit-allocation algorithm for radiological image compression can achieve an acceptable compression ratio as high as 30:1. It involves two stages of operation: a two-dimensional discrete cosine transform and pixel quantization in the transformed space with pixel depth kept accountable by a bit-allocation table. The cosine transform hardware design took an expandable modular approach based on the VME bus system with a maximum data transfer rate of 48 Mbytes/sec and a microprocessor (Motorola 68000 family). The modules are cascadable and microprogrammable to perform 1,024-point butterfly operations. A total of 18 stages would be required for transforming a 1,000 x 1,000 image. Multiplicative constants and addressing sequences are to be software loaded into the parameter buffers of each stage prior to streaming data through the processor stages. The compression rate for 1K x 1K images is expected to be faster than one image per sec

  16. Cine MR imaging of the cardiovascular system

    Nishimura, Fumiaki; Yoshino, Yasushi; Mihara, Junji; Ichikawa, Seiichi; Kimura, Masahiko; Yano, Masao; Umeda, Masahiro; Oouchi, Toshihiro


    In recent years cine magnetic resonance imaging (MRI) has developed as a high-speed imaging technique that provides a high intensity signal even at a short repetition time (20-30 msec) by using an excited pulse with a small flip angle according to the gradient echo method, enabling about 20 to 30 continuous images of the same section per one cardiac cycle to be taken. On cine display of these continuous images, information concerning blood flow shown by a high intensity signal in comparison with that of the myocardium and vascular wall is obtained with high temporal resolution along with anatomical information. The present study reports the clinical usefulness of cine MRI in today's situation, inculding the following: calculation of the left ventricular ejection fraction and pulmonary-to-systemic flow ratio in congenital shunt disease by integration of the area of multisections through application of Simpson's method; diagnosis of the severity of valvular regurgitation, evaluation of stenosal diseases, and diagnosis of inflow from the fissured entry of dissecting aortic aneurysm by evaluating of an area of low intensity signal, probably based on the high velocity or turbulent blood flow: and evaluation of patency of the internal mammary artery bypass graft of the basis of the possible visualization of even thin blood vessels because of the high intensity signal of blood flow. In particular, the characteristics of this procedures are described by comparing it with other technologies in the field of diseases of valvular regurgitation. (author)

  17. Systems for increasing the sensitivity of gamma-ray imagers

    Mihailescu, Lucian; Vetter, Kai M.; Chivers, Daniel H.


    Systems that increase the position resolution and granularity of double sided segmented semiconductor detectors are provided. These systems increase the imaging resolution capability of such detectors, either used as Compton cameras, or as position sensitive radiation detectors in imagers such as SPECT, PET, coded apertures, multi-pinhole imagers, or other spatial or temporal modulated imagers.

  18. Molecular Imaging with Activatable Reporter Systems

    Gang Niu, Xiaoyuan Chen


    Full Text Available Molecular imaging is a newly emerged multiple disciplinary field that aims to visualize, characterize and quantitatively measure biological processes at cellular and molecular levels in humans and other living systems. A reporter gene is a piece of DNA encoding reporter protein, which presents as a readily measurable phenotype that can be distinguished easily from the background of endogenous protein. After being transferred into cells of organ systems (transgenes, the reporter gene can be utilized to visualize transcriptional and posttranscriptional regulation of gene expression, protein-protein interactions, or trafficking of proteins or cells in living subjects. Herein, we review previous classification of reporter genes and regroup the reporter gene based imaging as basic, inducible and activatable, based on the regulation of reporter gene transcription and post-translational modification of reporter proteins. We then focus on activatable reporters, in which the signal can be activated at the posttranslational level for visualizing protein-protein interactions, protein phosphorylation or tertiary structure changes. The applications of several types of activatable reporters will also be summarized. We conclude that activatable reporter imaging can benefit both basic biomedical research and drug development.

  19. Special feature on imaging systems and techniques

    Yang, Wuqiang; Giakos, George


    The IEEE International Conference on Imaging Systems and Techniques (IST'2012) was held in Manchester, UK, on 16-17 July 2012. The participants came from 26 countries or regions: Austria, Brazil, Canada, China, Denmark, France, Germany, Greece, India, Iran, Iraq, Italy, Japan, Korea, Latvia, Malaysia, Norway, Poland, Portugal, Sweden, Switzerland, Taiwan, Tunisia, UAE, UK and USA. The technical program of the conference consisted of a series of scientific and technical sessions, exploring physical principles, engineering and applications of new imaging systems and techniques, as reflected by the diversity of the submitted papers. Following a rigorous review process, a total of 123 papers were accepted, and they were organized into 30 oral presentation sessions and a poster session. In addition, six invited keynotes were arranged. The conference not only provided the participants with a unique opportunity to exchange ideas and disseminate research outcomes but also paved a way to establish global collaboration. Following the IST'2012, a total of 55 papers, which were technically extended substantially from their versions in the conference proceeding, were submitted as regular papers to this special feature of Measurement Science and Technology . Following a rigorous reviewing process, 25 papers have been finally accepted for publication in this special feature and they are organized into three categories: (1) industrial tomography, (2) imaging systems and techniques and (3) image processing. These papers not only present the latest developments in the field of imaging systems and techniques but also offer potential solutions to existing problems. We hope that this special feature provides a good reference for researchers who are active in the field and will serve as a catalyst to trigger further research. It has been our great pleasure to be the guest editors of this special feature. We would like to thank the authors for their contributions, without which it would

  20. Space-Ready Advanced Imaging System, Phase II

    National Aeronautics and Space Administration — In this Phase II effort Toyon will increase the state-of-the-art for video/image systems. This will include digital image compression algorithms as well as system...

  1. An integral design strategy combining optical system and image processing to obtain high resolution images

    Wang, Jiaoyang; Wang, Lin; Yang, Ying; Gong, Rui; Shao, Xiaopeng; Liang, Chao; Xu, Jun


    In this paper, an integral design that combines optical system with image processing is introduced to obtain high resolution images, and the performance is evaluated and demonstrated. Traditional imaging methods often separate the two technical procedures of optical system design and imaging processing, resulting in the failures in efficient cooperation between the optical and digital elements. Therefore, an innovative approach is presented to combine the merit function during optical design together with the constraint conditions of image processing algorithms. Specifically, an optical imaging system with low resolution is designed to collect the image signals which are indispensable for imaging processing, while the ultimate goal is to obtain high resolution images from the final system. In order to optimize the global performance, the optimization function of ZEMAX software is utilized and the number of optimization cycles is controlled. Then Wiener filter algorithm is adopted to process the image simulation and mean squared error (MSE) is taken as evaluation criterion. The results show that, although the optical figures of merit for the optical imaging systems is not the best, it can provide image signals that are more suitable for image processing. In conclusion. The integral design of optical system and image processing can search out the overall optimal solution which is missed by the traditional design methods. Especially, when designing some complex optical system, this integral design strategy has obvious advantages to simplify structure and reduce cost, as well as to gain high resolution images simultaneously, which has a promising perspective of industrial application.

  2. New imaging systems in nuclear medicine


    PCR-I, an analog coded single ring positron tomograph, demonstrates the concepts of analog coding and the utility of high resolution systems. PCR-I, with a resolution of 4.5mm, has been employed in a series of biological studies using small animals that have been highly successful and will lead to clinical application. The emphasis now is turning to even higher sensitivity instruments in order to provide adequate number of events to populate a volume image. For this purpose, we have designed and are constructing PCR-II, a cylindrical analog coded positron tomograph incorporating 12,800 small detectors coded to 1760 phototubes. The increased sensitivity is achieved by recording all events within a cylindrical source that produce annihilation radiation striking any point on the cylindrical detector. PCR-II is projected to have a sensitivity of 1.6 million counts per second for a 20 centimeter diameter sphere uniformly filled with activity at 1 μCi/cm 3 . This system, with a resolution of 3mm, will approach the limits of sensitivity and resolution for positron tomographs. It is our opinion that this system will revolutionize the concept of positron imaging

  3. The image acquisition system design of floor grinder

    Wang, Yang-jiang; Liu, Wei; Liu, Hui-qin


    Based on linear CCD, high resolution image real-time acquisition system serves as designing a set of image acquisition system for floor grinder through the calculation of optical imaging system. The entire image acquisition system can collect images of ground before and after the work of the floor grinder, and the data is transmitted through the Bluetooth system to the computer and compared to realize real-time monitoring of its working condition. The system provides technical support for the design of unmanned ground grinders.

  4. Magnetic resonance imaging of the cardiovascular system

    Masuda, Yoshiaki; Imai, Hiroshi; Watanabe, Sigeru; Inagaki, Yoshiaki; Tateno, Yukio; Ikehira, Hiroo.


    Magnetic resonance imaging (MRI) is a new noninvasive technique for visualization of the cardiovascular system, and is used to evaluate tissue characteristics, cardiac function and blood flow abnormalities, as well as to obtain morphological information. In this paper we presented results of clinical and laboratory research obtained using conventional spin echo MRI with regard to cardiovascular anatomy, tissue characterization and physiology. Furthermore, experience with two new techniques, cine-MRI and volume-selected MR spectroscopy, and their potential clinical usefulness in detecting cardiovascular diseases are documented. (author)

  5. GRANITE- A steroscopic imaging Chernkov telescope system

    Shubnell, M.; Akerlof, C.W.; Cawley, M.F.; Chantell, M.; Fegan, D.J.; Fennell, S.; O'Flaherty, K.S.; Freeman, S.; Frishman, D.; Gaidos, J.A.; Hagan, J.; Harris, K.; Hillas, A.M.; Kerrick, A.D.; Lamb, R.C.; Lappin, T.; Lawrence, M.A.; Levy, H.; Lewis, D.A.; Meyer, D.I.; Mohanty, G.; Punch, M.; Reynolds, P.T.; Rovero, A.C.; Sembroski, G.; Weaverdyck, C.; Weekes, T.C.; Whitaker, T.; Wilson, C.


    A second 10 meter class imaging telescope was constructed on Mt. Hopkins, Arizona, the site of the original 10 meter Whipple Cherenkov telescope. The twin telescope system with a 140 meter base line will allow both a reduction in the energy threshold and an improvement in the rejection of the hardonic background. The new telescope started operation in December 1991. With the final completion of the first installation stage (GRANITE I) during spring 92, it is now operating simultaneously with the orginal reflector. We describe in this paper design and construction of the new instrument and demonstrate the capability of the experiment to record coincident events

  6. An Ibm PC/AT-Based Image Acquisition And Processing System For Quantitative Image Analysis

    Kim, Yongmin; Alexander, Thomas


    In recent years, a large number of applications have been developed for image processing systems in the area of biological imaging. We have already finished the development of a dedicated microcomputer-based image processing and analysis system for quantitative microscopy. The system's primary function has been to facilitate and ultimately automate quantitative image analysis tasks such as the measurement of cellular DNA contents. We have recognized from this development experience, and interaction with system users, biologists and technicians, that the increasingly widespread use of image processing systems, and the development and application of new techniques for utilizing the capabilities of such systems, would generate a need for some kind of inexpensive general purpose image acquisition and processing system specially tailored for the needs of the medical community. We are currently engaged in the development and testing of hardware and software for a fairly high-performance image processing computer system based on a popular personal computer. In this paper, we describe the design and development of this system. Biological image processing computer systems have now reached a level of hardware and software refinement where they could become convenient image analysis tools for biologists. The development of a general purpose image processing system for quantitative image analysis that is inexpensive, flexible, and easy-to-use represents a significant step towards making the microscopic digital image processing techniques more widely applicable not only in a research environment as a biologist's workstation, but also in clinical environments as a diagnostic tool.

  7. Image processing system for videotape review

    Bettendroffer, E.


    In a nuclear plant, the areas in which fissile materials are stored or handled, have to be monitored continuously. One method of surveillance is to record pictures of TV cameras with determined time intervals on special video recorders. The 'time lapse' recorded tape is played back at normal speed and an inspector checks visually the pictures. This method requires much manpower and an automated method would be useful. The present report describes an automatic reviewing method based on an image processing system; the system detects scene changes in the picture sequence and stores the reduced data set on a separate video tape. The resulting reduction of reviewing time by inspector is important for surveillance data with few movements

  8. SORIS-A standoff radiation imaging system

    Zelakiewicz, Scott; Hoctor, Ralph; Ivan, Adrian; Ross, William; Nieters, Edward; Smith, William; McDevitt, Daniel; Wittbrodt, Michael; Milbrath, Brian


    The detection of radiological and special nuclear material within the country's borders is a crucial component of the national security network. Being able to detect small amounts of radiological material at large distances is especially important for search applications. To provide this capability General Electric's Research Center has developed, as a part of DNDO's standoff radiation detection system advanced technology demonstration (SORDS-ATD) program, a standoff radiation imaging system (SORIS). This vehicle-based system is capable of detecting weak sources at large distances in relatively short times. To accomplish this, GE has developed a novel coded aperture detector based on commercial components from GE Healthcare. An array of commercial gamma cameras modified to increase the system efficiency and energy range are used as position sensitive detectors. Unlike typical coded aperture systems, however, SORIS employs a non-planar mask and thus does not suffer the typical limitations of partially encoded regions giving it a wide field of view. Source identification is done using both low-statistics anomaly indicators and conventional high-statistics algorithms being developed by Pacific Northwest National Laboratory. The results of scanned areas and threats identified are displayed to the user and overlaid on satellite imagery.

  9. SORIS—A standoff radiation imaging system

    Zelakiewicz, Scott; Hoctor, Ralph; Ivan, Adrian; Ross, William; Nieters, Edward; Smith, William; McDevitt, Daniel; Wittbrodt, Michael; Milbrath, Brian


    The detection of radiological and special nuclear material within the country's borders is a crucial component of the national security network. Being able to detect small amounts of radiological material at large distances is especially important for search applications. To provide this capability General Electric's Research Center has developed, as a part of DNDO's standoff radiation detection system advanced technology demonstration (SORDS-ATD) program, a standoff radiation imaging system (SORIS). This vehicle-based system is capable of detecting weak sources at large distances in relatively short times. To accomplish this, GE has developed a novel coded aperture detector based on commercial components from GE Healthcare. An array of commercial gamma cameras modified to increase the system efficiency and energy range are used as position sensitive detectors. Unlike typical coded aperture systems, however, SORIS employs a non-planar mask and thus does not suffer the typical limitations of partially encoded regions giving it a wide field of view. Source identification is done using both low-statistics anomaly indicators and conventional high-statistics algorithms being developed by Pacific Northwest National Laboratory. The results of scanned areas and threats identified are displayed to the user and overlaid on satellite imagery.

  10. A Data Acquisition System for Medical Imaging

    Abellan, Carlos; Cachemiche, Jean-Pierre; Rethore, Frederic; Morel, Christian


    A data acquisition system for medical imaging applications is presented. Developed at CPPM, it provides high performance generic data acquisition and processing capabilities. The DAQ system is based on the PICMG xTCA standard and is composed of 1 up to 10 cards in a single rack, each one with 2 Altera Stratix IV FPGAs and a Fast Mezzanine Connector (FMC). Several mezzanines have been produced, each one with different functionalities. Some examples are: a mezzanine capable of receiving 36 optical fibres with up to 180 Gbps sustained data rates or a mezzanine with 12 x 5 Gbps input links, 12 x 5 Gbps output links and an SFP+ connector for control purposes. Several rack sizes are also available, thus making the system scalable from a one card desktop system useful for development purpose up to a full featured rack mounted DAQ for high end applications. Depending on the application, boards may exchange data at speeds of up to 25.6 Gbps bidirectional sustained rates in a double star topology through back-plane connections. Also, front panel optical fibres can be used when higher rates are required by the application. The system may be controlled by a standard Ethernet connection, thus providing easy integration with control computers and avoiding the need for drivers. Two control systems are foreseen. A Socket connection provides easy interaction with automation software regardless of the operating system used for the control PC. Moreover a web server may run on the Envision cards and provide an easy intuitive user interface. The system and its different components will be introduced. Some preliminary measurements with high speed signal links will be presented as well as the signal conditioning used to allow these rates. (authors)

  11. Triangular SPECT system for 3-D total organ volume imaging: Design concept and preliminary imaging results

    Lim, C.B.; Anderson, J.; Covic, J.


    SPECT systems based on 2-D detectors for projection data collection and filtered back-projection image reconstruction have the potential for true 3-D imaging, providing contiguous slice images in any orientation. Anger camera-based SPECT systems have the natural advantage supporting planar imaging clinical procedures. However, current systems suffer from two drawbacks; poor utilization of emitted photons, and inadequate system design for SPECT. A SPECT system consisting of three rectangular cameras with radial translation would offer the variable cylindrical FOV of 25 cm to 40 cm diameter allowing close detector access to the object. This system would provide optimized imaging for both brain and body organs in terms of sensitivity and resolution. For brain imaging a tight detector triangle with fan beam collimation, matching detector UFOV to the head, allows full 2 π utilization of emitted photons, resulting in >4 times sensitivity increase over the single detector system. Minification of intrinsic detector resolution in fan beam collimation further improves system resolution. For body organ imaging the three detectors with parallel hole collimators, rotating in non-circular orbit, provide both improved resolution and three-fold sensitivity increase. Practical challenges lie in ensuring perfect image overlap from three detectors without resolution degradation and artifact generation in order to benefit from the above improvements. An experimental system has been developed to test the above imaging concept and we have successfully demonstrated the superior image quality of the overlapped images. Design concept will be presented with preliminary imaging results

  12. Quantification of image persistence in a digital angiography system

    Okkalides, D.P.; Raptou, P.D.


    Image persistence, as a characteristic of video imaging systems affecting the quality of fast moving fluoroscopic images, is shown to vary considerably. A simple quantitative method for measuring image persistence in a digital angiography system is presented, together with a series of image intensifier exposure-response curves. For the Saticon tube, used with the Siemens 3VA Digitron, it was found that persistence increased for low exposure rates and may increase to 31% at a 120 ms interval. In addition, a sharp increase in image persistence, from 8.3% to 33%, was observed within 18 months from installation of the system. (author)

  13. Millimeter-wave Imaging Systems with Aperture Synthesis Techniques

    Löffler, Torsten; Krozer, Viktor; Zhurbenko, Vitaliy


    The paper describes development of a millimetre-wave imaging system using multi-element aperture filling techniques [1]. Such imaging systems are increasingly demonstrated for security applications and in particular standoff imaging of persons and bonding flaw and defect detection [2]. The major ...

  14. Prototype of Microwave Imaging System for Breast-Cancer Screening

    Rubæk, Tonny; Zhurbenko, Vitaliy


    Microwave imaging for breast-cancer detection has received the attention of a large number of research groups in the last decade. In this paper, the imaging system currently being developed at the Technical university of Denmark is presented. This includes a description of the antenna system......, the microwave hardware, and the imaging algorithm....

  15. Recent developments of MR imaging system and future trends

    Fujieda, Kunimi


    Because MR imaging technique has no limitation of slice direction, uses none of mechanically moving components and can employ electronic scanning method for data acquisition, the most advanced electronics and CPU techniques have been applied to develop MR imaging systems. Along with pursuance of better equipment performance as clinical diagnostic equipment, cost reduction, improvement of operability and safety, easy siting, comfortable examination and economical operation cost by remarkable reduction of running cost have become important factors in development of MR imaging system. From this viewpoint, MR imaging systems incorporating an open gantry with a relatively low field strength and of vertical field system have been developed recently and they are being accepted as clinically useful equipment. The vertical field, open gantry system has an optimum structure capable of performing interventional imaging, thus clinical application of the system have been actively attempted. Thanks to recent development of various MRI techniques, image quality quite acceptable for routine clinical diagnosis can now be obtained by using the systems with permanent magnet and resistive magnet. Thus, it is considered that evaluation of not only equipment performance but also the total performances of the MR imaging system as described above will become important. The MR imaging technique has a possibility to substitute itself for other conventional imaging modalities because the technique can visualize physiological and metabolic functions in addition to morphological imaging. It is expected that application of MR imaging modality will be further expanded by continuous investigation of applicable clinical fields and development of imaging technologies. (J.P.N.)

  16. Real-time beam profile imaging system for actinotherapy accelerator

    Lin Yong; Wang Jingjin; Song Zheng; Zheng Putang; Wang Jianguo


    This paper describes a real-time beam profile imaging system for actinotheraphy accelerator. With the flash X-ray imager and the technique of digital image processing, a real-time 3-dimension dosage image is created from the intensity profile of the accelerator beam in real time. This system helps to obtain all the physical characters of the beam in any section plane, such as FWHM, penumbra, peak value, symmetry and homogeneity. This system has been used to acquire a 3-dimension dosage distribution of dynamic wedge modulator and the transient process of beam dosage. The system configure and the tested beam profile images are also presented

  17. IMIS: An intelligence microscope imaging system

    Caputo, Michael; Hunter, Norwood; Taylor, Gerald


    Until recently microscope users in space relied on traditional microscopy techniques that required manual operation of the microscope and recording of observations in the form of written notes, drawings, or photographs. This method was time consuming and required the return of film and drawings from space for analysis. No real-time data analysis was possible. Advances in digital and video technologies along with recent developments in article intelligence will allow future space microscopists to have a choice of three additional modes of microscopy: remote coaching, remote control, and automation. Remote coaching requires manual operations of the microscope with instructions given by two-way audio/video transmission during critical phases of the experiment. When using the remote mode of microscopy, the Principal Investigator controls the microscope from the ground. The automated mode employs artificial intelligence to control microscope functions and is the only mode that can be operated in the other three modes as well. The purpose of this presentation is to discuss the advantages and disadvantages of the four modes of of microscopy and how the IMIS, a proposed intelligent microscope imaging system, can be used as a model for developing and testing concepts, operating procedures, and equipment design of specifications required to provide a comprehensive microscopy/imaging capability onboard Space Station Freedom.

  18. Data acquisition system for radiographic imaging

    Lanza, R.C.; Votano, J.R.; Russ, T.


    This patent describes a continuous data acquisition system for radiographic imaging without interrupting acquisition activity the acquisition system. It comprises at least two memory means for storing radiographic data from a radiation detector wherein each of the memory means having a plurality of addressable memory locations and each of the memory means are such that the locations of the memory means correspond to spatial locations in the radiation detector; logic control means for sensing radiographic data transmitted by the radiation detector, for selecting one of the memory means for storage of the data, for transferring data to the selected memory means, and for switching form one memory means to another memory means according to a predefined schedule and according to memory capacity level, the logic control means further comprising a logic device which receives data and increments the contents of locations in a memory means in response to such data; and interface control means for reading data from one or the other memory means when such memory means is not actively acquiring data such that data can be acquired continuously by the system

  19. Automatic system for detecting pornographic images

    Ho, Kevin I. C.; Chen, Tung-Shou; Ho, Jun-Der


    Due to the dramatic growth of network and multimedia technology, people can more easily get variant information by using Internet. Unfortunately, it also makes the diffusion of illegal and harmful content much easier. So, it becomes an important topic for the Internet society to protect and safeguard Internet users from these content that may be encountered while surfing on the Net, especially children. Among these content, porno graphs cause more serious harm. Therefore, in this study, we propose an automatic system to detect still colour porno graphs. Starting from this result, we plan to develop an automatic system to search porno graphs or to filter porno graphs. Almost all the porno graphs possess one common characteristic that is the ratio of the size of skin region and non-skin region is high. Based on this characteristic, our system first converts the colour space from RGB colour space to HSV colour space so as to segment all the possible skin-colour regions from scene background. We also apply the texture analysis on the selected skin-colour regions to separate the skin regions from non-skin regions. Then, we try to group the adjacent pixels located in skin regions. If the ratio is over a given threshold, we can tell if the given image is a possible porno graph. Based on our experiment, less than 10% of non-porno graphs are classified as pornography, and over 80% of the most harmful porno graphs are classified correctly.

  20. PC imaging system for reactor NDE



    PC-based systems have been given recent attention by EPRI to organize and manage inspection data (RP-2405-15, TestPro system); integrate with larger, mainframe computers to maintain dialogue for on-site and remote applications; and, in this project, to aid the operator in providing guidance to render decisions on the data. The PC system configuration for this project consisted of a central processing unit (CPU), a hard disk and a floppy disk, 640K bytes of system memory, a high-resolution graphics card and compatible color monitor, and a mouse for operator interaction with software. The software package was written in FORTRAN under the PC Disk Operating System (PC-DOS) and utilized a graphics package for image display. Application of this package to crack-counterbore discrimination in piping welds was investigated. Present automatic techniques utilize signal features from single, A-scan data to render a decision on whether the reflector is benign (i.e., counterbore, weld root) or a crack. However, experienced manual operators in the field make reliable decisions based on the integrated response from the reflector as the transducer is scanned past the suspicious region. Since this software package could display and manipulate ensemble A-scans, spatial features - similar to those used by experts - were developed as discriminants. Ultrasonic responses from intergranular stress corrosion cracks (IGSCCs) were discovered to vary both in time-of-flight and in their amplitude, whereas counterbore responses were more consistent. The software package contains methods for viewing and quantifying these spatial features

  1. An integrated compact airborne multispectral imaging system using embedded computer

    Zhang, Yuedong; Wang, Li; Zhang, Xuguo


    An integrated compact airborne multispectral imaging system using embedded computer based control system was developed for small aircraft multispectral imaging application. The multispectral imaging system integrates CMOS camera, filter wheel with eight filters, two-axis stabilized platform, miniature POS (position and orientation system) and embedded computer. The embedded computer has excellent universality and expansibility, and has advantages in volume and weight for airborne platform, so it can meet the requirements of control system of the integrated airborne multispectral imaging system. The embedded computer controls the camera parameters setting, filter wheel and stabilized platform working, image and POS data acquisition, and stores the image and data. The airborne multispectral imaging system can connect peripheral device use the ports of the embedded computer, so the system operation and the stored image data management are easy. This airborne multispectral imaging system has advantages of small volume, multi-function, and good expansibility. The imaging experiment results show that this system has potential for multispectral remote sensing in applications such as resource investigation and environmental monitoring.

  2. Multi region based image retrieval system

    data mining, information theory, statistics and psychology. ∗ .... ground complication and independent of image size and orientation (Zhang 2007). ..... Figure 2. Significant regions: (a) the input image, (b) the primary significant region, (c) the ...

  3. Content Based Retrieval System for Magnetic Resonance Images

    Trojachanets, Katarina


    The amount of medical images is continuously increasing as a consequence of the constant growth and development of techniques for digital image acquisition. Manual annotation and description of each image is impractical, expensive and time consuming approach. Moreover, it is an imprecise and insufficient way for describing all information stored in medical images. This induces the necessity for developing efficient image storage, annotation and retrieval systems. Content based image retrieval (CBIR) emerges as an efficient approach for digital image retrieval from large databases. It includes two phases. In the first phase, the visual content of the image is analyzed and the feature extraction process is performed. An appropriate descriptor, namely, feature vector is then associated with each image. These descriptors are used in the second phase, i.e. the retrieval process. With the aim to improve the efficiency and precision of the content based image retrieval systems, feature extraction and automatic image annotation techniques are subject of continuous researches and development. Including the classification techniques in the retrieval process enables automatic image annotation in an existing CBIR system. It contributes to more efficient and easier image organization in the system.Applying content based retrieval in the field of magnetic resonance is a big challenge. Magnetic resonance imaging is an image based diagnostic technique which is widely used in medical environment. According to this, the number of magnetic resonance images is enormously growing. Magnetic resonance images provide plentiful medical information, high resolution and specific nature. Thus, the capability of CBIR systems for image retrieval from large database is of great importance for efficient analysis of this kind of images. The aim of this thesis is to propose content based retrieval system architecture for magnetic resonance images. To provide the system efficiency, feature

  4. Subwavelength image manipulation through oblique and herringbone layered acoustic systems

    Li, Chunhui; Jia, Han; Ke, Manzhu; Li, Yixiang; Liu, Zhengyou


    In this paper, an oblique and a herringbone layered acoustic structure are experimentally and theoretically demonstrated to manipulate acoustic subwavelength images. An imaging resolution of less than one tenth of a wavelength is achieved with both optimized systems, and lateral image shift has been realized by an oblique layered system. The thicknesses of both the oblique and the herringbone layered acoustic systems are largely reduced through utilizing the oblique or herringbone wave propagation path instead of the vertical wave propagation path in the rectangular layered planar acoustic system. With smaller size and subwavelength image manipulation, the acoustic systems are more favourable for practical application. (paper)

  5. Radionuclide Imaging Technologies for Biological Systems

    Howell, Calvin R. [Duke Univ., Durham, NC (United States); Reid, Chantal D. [Duke Univ., Durham, NC (United States); Weisenberger, Andrew G. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)


    The main objective of this project is to develop technologies and experimental techniques for studying the dynamics of physiological responses of plants to changes in their interface with the local environment and to educate a new generation of scientists in an interdisciplinary environment of biology, physics and engineering. Also an important goal is to perform measurements to demonstrate the new data that can be produced and made available to the plant-biology community using the imaging technologies and experimental techniques developed in this project. The study of the plant-environment interface includes a wide range of topics in plant physiology, e.g., the root-soil interface, resource availability, impact of herbivores, influence of microbes on root surface, and responses to toxins in the air and soil. The initial scientific motivation for our work is to improve understanding of the mechanisms for physiological responses to abrupt changes in the local environment, in particular, the responses that result in short-term adjustments in resource (e.g., sugars, nutrients and water) allocations. Data of time-dependent responses of plants to environmental changes are essential in developing mechanistic models for substance intake and resource allocation. Our approach is to use radioisotope tracing techniques to study whole-plant and plant organ (e.g., leaves, stems, roots) dynamical responses to abrupt changes in environmental conditions such as concentration of CO2 in the atmosphere, nutrient availability and lighting. To this aim we are collaborating with the Radiation Detector and Imaging Group at the Thomas Jefferson National Laboratory Facility (JLab) to develop gamma-ray and beta particle imaging systems optimized for plant studies. The radioisotope tracing measurements are conducted at the Phytotron facility at Duke University. The Phytotron is a controlled environment plant research facility with a variety of plant growth chambers. One chamber

  6. Dynamic MR imaging in the musculoskeletal system

    Hedlund, L.; Vogler, J.; Utz, J.A.; Herfkens, R.J.; Martinez, S.; Urbaniak, J.; Evans, A.


    Many joint disorders are related to movement, and lack of dynamic imaging has thus far been a limitation of MR imaging. A recently developed dynamic MR imaging technique utilizing a gradient refocused echo (TE = 12 msec, TR = 21 msec) coupled to a physiologic trigger allows dynamic images of the moving joint to be obtained. Controlled joint articulation is produced using an air-driven nonmagnetic device. Imaging of the wrist by this technique demonstrated the dynamic motion of the carpal rows. The method displays cartilage with more sensitivity than does conventional MR imaging; thus, ligamentous and triangular cartilage alignment could be evaluated during motion. In the wrist, potential applications include imaging of carpal instability syndromes, ligamentous interruption, and tears of the triangular cartilage

  7. Systems of imaging digital systems in case of glaucoma

    Fernandez Argones, Liamet; Piloto Diaz, Ibrain; Coba Penna, Maria Josefa; Perez Tamayo, Bertila; Dominguez Randulfe, Marerneda; Trujillo Fonseca, Katia


    Now a day we can't consider the strict follow up in Glaucoma without the use of the digital analysis of image system of the optic nerve head and the retinal nerve fiber layer. This is a review about some contributions of Scanning Laser Polarimetry (GDx VCC, Carl Zeiss Meditec, Dublin, CA), Confocal Scanning Laser (Heidelberg Retina Tomograph HRT, Heidelberg Engineering Inc.) and Optical Coherence Tomography (Stratus OCT, Carl Zeiss Meditec, Alemania) in the diagnosis and follow up of Glaucoma. It's considered that objective measurement giving by them must be incorporate in the rigorous analysis of each glaucomatous patient

  8. Investigation of physical imaging properties in various digital radiography systems

    Jeong, Hoi Woun [Dept. of Radiological Science, Baekseok Culture University, Cheonan (Korea, Republic of); Min, Jung Hwan [Dept. of Radiological technology, Shingu University, Seongnam (Korea, Republic of); Yoon, Yong Su [Dept. of Health Sciences, Graduate School of Medical Sciences, Kyushu University, Kyushu (Japan); Kim, Jung Min [Dept. of Health and Environmental Science, College of Health Science, Korea University, Seoul (Korea, Republic of)


    We aimed to evaluate the physical imaging properties in various digital radiography systems with charged coupled device (CCD), computed radiography (CR), and indirect flat panel detector (FPD). The imaging properties measured in this study were modulation transfer function (MTF) wiener spectrum (WS), and detective quantum efficiency (DQE) to compare the performance of each digital radiography system. The system response of CCD were in a linear relationship with exposure and that of CR and FPD were proportional to the logarithm of exposure. The MTF of both CR and FPD indicated a similar tendency but in case of CCD, it showed lower MTF than that of CR and FPD. FPD showed the lowest WS and also indicated the highest DQE among three systems. According to the results, digital radiography system with different type of image receptor had its own image characteristics. Therefore, it is important to know the physical imaging characteristics of the digital radiography system accurately to obtain proper image quality.

  9. Optimization of a Biometric System Based on Acoustic Images

    Alberto Izquierdo Fuente


    Full Text Available On the basis of an acoustic biometric system that captures 16 acoustic images of a person for 4 frequencies and 4 positions, a study was carried out to improve the performance of the system. On a first stage, an analysis to determine which images provide more information to the system was carried out showing that a set of 12 images allows the system to obtain results that are equivalent to using all of the 16 images. Finally, optimization techniques were used to obtain the set of weights associated with each acoustic image that maximizes the performance of the biometric system. These results improve significantly the performance of the preliminary system, while reducing the time of acquisition and computational burden, since the number of acoustic images was reduced.

  10. Optimization of a Biometric System Based on Acoustic Images

    Izquierdo Fuente, Alberto; Del Val Puente, Lara; Villacorta Calvo, Juan J.; Raboso Mateos, Mariano


    On the basis of an acoustic biometric system that captures 16 acoustic images of a person for 4 frequencies and 4 positions, a study was carried out to improve the performance of the system. On a first stage, an analysis to determine which images provide more information to the system was carried out showing that a set of 12 images allows the system to obtain results that are equivalent to using all of the 16 images. Finally, optimization techniques were used to obtain the set of weights associated with each acoustic image that maximizes the performance of the biometric system. These results improve significantly the performance of the preliminary system, while reducing the time of acquisition and computational burden, since the number of acoustic images was reduced. PMID:24616643

  11. Development of a PET/Cerenkov-light hybrid imaging system

    Yamamoto, Seiichi; Hamamura, Fuka; Kato, Katsuhiko; Ogata, Yoshimune; Watabe, Tadashi; Ikeda, Hayato; Kanai, Yasukazu; Hatazawa, Jun; Watabe, Hiroshi


    Purpose: Cerenkov-light imaging is a new molecular imaging technology that detects visible photons from high-speed electrons using a high sensitivity optical camera. However, the merit of Cerenkov-light imaging remains unclear. If a PET/Cerenkov-light hybrid imaging system were developed, the merit of Cerenkov-light imaging would be clarified by directly comparing these two imaging modalities. Methods: The authors developed and tested a PET/Cerenkov-light hybrid imaging system that consists of a dual-head PET system, a reflection mirror located above the subject, and a high sensitivity charge coupled device (CCD) camera. The authors installed these systems inside a black box for imaging the Cerenkov-light. The dual-head PET system employed a 1.2 × 1.2 × 10 mm 3 GSO arranged in a 33 × 33 matrix that was optically coupled to a position sensitive photomultiplier tube to form a GSO block detector. The authors arranged two GSO block detectors 10 cm apart and positioned the subject between them. The Cerenkov-light above the subject is reflected by the mirror and changes its direction to the side of the PET system and is imaged by the high sensitivity CCD camera. Results: The dual-head PET system had a spatial resolution of ∼1.2 mm FWHM and sensitivity of ∼0.31% at the center of the FOV. The Cerenkov-light imaging system's spatial resolution was ∼275μm for a 22 Na point source. Using the combined PET/Cerenkov-light hybrid imaging system, the authors successfully obtained fused images from simultaneously acquired images. The image distributions are sometimes different due to the light transmission and absorption in the body of the subject in the Cerenkov-light images. In simultaneous imaging of rat, the authors found that 18 F-FDG accumulation was observed mainly in the Harderian gland on the PET image, while the distribution of Cerenkov-light was observed in the eyes. Conclusions: The authors conclude that their developed PET/Cerenkov-light hybrid imaging

  12. A new remote-imaging diagnosis system at Komazawa University

    Shimada, Morio; Kohda, Eiichi; Yoshikawa, Kohki


    We developed a remote-imaging diagnosis system that links the highly experienced radiologists at Komazawa University with Fuji Electric Hospital, where no such radiologists are present. MRI or CT images from Fuji Electric hospital are transmitted to Komazawa University via private line (INS64). The radiologists at Komazawa University then read the MRI or CT images, and relay the results to Fuji Electric Hospital. We describe the advantages and disadvantages of this system. MRI or CT imaging data from 80 cases were used. The data were stored in the imaging system server at Fuji Electric Hospital and were evaluated by experienced radiologists at Komazawa University. The images were sent one by one to the diagnostic support system server at Komazawa University through the private INS64 line. We examined transmission time per case and the security of transmission. Transmission of MRI or CT images from the 80 cases required a mean duration of 63 minutes 30 seconds per image. The quality of all images was highly satisfactory. In addition, there was no evidence of weaknesses in security. A physician at Fuji Electric Hospital was able to readily explain to the patient the results of the images by referring to the findings written by a radiologist at Komazawa University. We were able to transmit MRI or CT images by using this system safely and readily. The primary disadvantage of this system was the slow transmission speed. This will be improved by upgrading to an optical fibers. (author)

  13. 21 CFR 892.1550 - Ultrasonic pulsed doppler imaging system.


    ... system. (a) Identification. An ultrasonic pulsed doppler imaging system is a device that combines the... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ultrasonic pulsed doppler imaging system. 892.1550... include signal analysis and display equipment, patient and equipment supports, component parts, and...

  14. 21 CFR 892.1560 - Ultrasonic pulsed echo imaging system.


    ... system. (a) Identification. An ultrasonic pulsed echo imaging system is a device intended to project a... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ultrasonic pulsed echo imaging system. 892.1560... receiver. This generic type of device may include signal analysis and display equipment, patient and...

  15. A simple polarized-based diffused reflectance colour imaging system

    A simple polarized-based diffuse reflectance imaging system has been developed. The system is designed for both in vivo and in vitro imaging of agricultural specimen in the visible region. The system uses a commercial web camera and a halogen lamp that makes it relatively simple and less expensive for diagnostic ...

  16. Digital image processing software system using an array processor

    Sherwood, R.J.; Portnoff, M.R.; Journeay, C.H.; Twogood, R.E.


    A versatile array processor-based system for general-purpose image processing was developed. At the heart of this system is an extensive, flexible software package that incorporates the array processor for effective interactive image processing. The software system is described in detail, and its application to a diverse set of applications at LLNL is briefly discussed. 4 figures, 1 table

  17. System and method for three-dimensional image reconstruction using an absolute orientation sensor

    Giancola, Silvio; Ghanem, Bernard; Schneider, Jens; Wonka, Peter


    A three-dimensional image reconstruction system includes an image capture device, an inertial measurement unit (IMU), and an image processor. The image capture device captures image data. The inertial measurement unit (IMU) is affixed to the image

  18. The operation technology of realtime image processing system (Datacube)

    Cho, Jai Wan; Lee, Yong Bum; Lee, Nam Ho; Choi, Young Soo; Park, Soon Yong; Park, Jin Seok


    In this project, a Sparc VME-based MaxSparc system, running the solaris operating environment, is selected as the dedicated image processing hardware for robot vision applications. In this report, the operation of Datacube maxSparc system, which is high performance realtime image processing hardware, is systematized. And image flow example programs for running MaxSparc system are studied and analyzed. The state-of-the-arts of Datacube system utilizations are studied and analyzed. For the next phase, advanced realtime image processing platform for robot vision application is going to be developed. (author). 19 refs., 71 figs., 11 tabs.

  19. Design and simulation of a totally digital image system for medical image applications

    Archwamety, C.


    The Totally Digital Imaging System (TDIS) is based on system requirements information from the Radiology Department, University of Arizona Health Science Center. This dissertation presents the design of this complex system, the TDIS specification, the system performance requirements, and the evaluation of the system using the computer-simulation programs. Discrete-event simulation models were developed for the TDIS subsystems, including an image network, imaging equipment, storage migration algorithm, data base archive system, and a control and management network. The simulation system uses empirical data generation and retrieval rates measured at the University Medical Center hospital. The entire TDIS system was simulated in Simscript II.5 using a VAX 8600 computer system. Simulation results show the fiber-optical-image network to be suitable; however, the optical-disk-storage system represents a performance bottleneck

  20. (New imaging systems in nuclear medicine)


    Further progress has been made on improving the uniformity and stability of PCR-I, the single ring analog coded tomograph. This camera has been employed in a wide range of animal studies described below. Data from PCR-I have been used in various image processing procedures. These include motion pictures of dog heart, comparison of PET and MRI image in dog heart and rat brain and quantitation of tumor metabolism in the nude mouse using blood data from heart images. A SUN workstation with TAAC board has been used to produce gated three-dimensional images of the dog heart. The ANALYZE program from the Mayo Clinic has also been mounted on a SUN workstation for comparison of images and image processing. 15 refs., 6 figs.

  1. [New imaging systems in nuclear medicine


    Further progress has been made on improving the uniformity and stability of PCR-I, the single ring analog coded tomograph. This camera has been employed in a wide range of animal studies described below. Data from PCR-I have been used in various image processing procedures. These include motion pictures of dog heart, comparison of PET and MRI image in dog heart and rat brain and quantitation of tumor metabolism in the nude mouse using blood data from heart images. A SUN workstation with TAAC board has been used to produce gated three-dimensional images of the dog heart. The ANALYZE program from the Mayo Clinic has also been mounted on a SUN workstation for comparison of images and image processing. 15 refs., 6 figs

  2. Designing a stable feedback control system for blind image deconvolution.

    Cheng, Shichao; Liu, Risheng; Fan, Xin; Luo, Zhongxuan


    Blind image deconvolution is one of the main low-level vision problems with wide applications. Many previous works manually design regularization to simultaneously estimate the latent sharp image and the blur kernel under maximum a posterior framework. However, it has been demonstrated that such joint estimation strategies may lead to the undesired trivial solution. In this paper, we present a novel perspective, using a stable feedback control system, to simulate the latent sharp image propagation. The controller of our system consists of regularization and guidance, which decide the sparsity and sharp features of latent image, respectively. Furthermore, the formational model of blind image is introduced into the feedback process to avoid the image restoration deviating from the stable point. The stability analysis of the system indicates the latent image propagation in blind deconvolution task can be efficiently estimated and controlled by cues and priors. Thus the kernel estimation used for image restoration becomes more precision. Experimental results show that our system is effective on image propagation, and can perform favorably against the state-of-the-art blind image deconvolution methods on different benchmark image sets and special blurred images. Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. Geometrical optics in correlated imaging systems

    Cao Dezhong; Xiong Jun; Wang Kaige


    We discuss the geometrical optics of correlated imaging for two kinds of spatial correlations corresponding, respectively, to a classical thermal light source and a quantum two-photon entangled source. Due to the different features in the second-order spatial correlation, the two sources obey different imaging equations. The quantum entangled source behaves as a mirror, whereas the classical thermal source looks like a phase-conjugate mirror in the correlated imaging

  4. Infrared Images of an Infant Solar System


    ESO Telescopes Detect a Strange-Looking Object Summary Using the ESO 3.5-m New Technology Telescope and the Very Large Telescope (VLT) , a team of astronomers [1] have discovered a dusty and opaque disk surrounding a young solar-type star in the outskirts of a dark cloud in the Milky Way. It was found by chance during an unrelated research programme and provides a striking portrait of what our Solar System must have looked like when it was in its early infancy. Because of its striking appearance, the astronomers have nicknamed it the "Flying Saucer" . The new object appears to be a perfect example of a very young star with a disk in which planets are forming or will soon form, and located far away from the usual perils of an active star-forming environment . Most other young stars, especially those that are born in dense regions, run a serious risk of having their natal dusty disks destroyed by the blazing radiation of their more massive and hotter siblings in these clusters. The star at the centre of the "Flying Saucer", seems destined to live a long and quiet life at the centre of a planetary system , very much like our own Sun. This contributes to making it a most interesting object for further studies with the VLT and other telescopes. The mass of the observed disk of gas and dust is at least twice that of the planet Jupiter and its radius measures about 45 billion km, or 5 times the size of the orbit of Neptune. PR Photo 12a/02 : The "Flying Saucer" object photographed with NTT/SOFI. PR Photo 12b/02 : VLT/ISAAC image of this object. PR Photo 12c/02 : Enlargement of VLT/ISAAC image . Circumstellar Disks and Planets Planets form in dust disks around young stars. This is a complex process of which not all stages are yet fully understood but it begins when small dust particles collide and stick to each other. For this reason, observations of such dust disks, in particular those that appear as extended structures (are "resolved"), are very important for our

  5. PARAGON-IPS: A Portable Imaging Software System For Multiple Generations Of Image Processing Hardware

    Montelione, John


    Paragon-IPS is a comprehensive software system which is available on virtually all generations of image processing hardware. It is designed for an image processing department or a scientist and engineer who is doing image processing full-time. It is being used by leading R&D labs in government agencies and Fortune 500 companies. Applications include reconnaissance, non-destructive testing, remote sensing, medical imaging, etc.

  6. Ultrasound Vector Flow Imaging: Part II: Parallel Systems

    Jensen, Jørgen Arendt; Nikolov, Svetoslav Ivanov; Yu, Alfred C. H.


    The paper gives a review of the current state-of-theart in ultrasound parallel acquisition systems for flow imaging using spherical and plane waves emissions. The imaging methods are explained along with the advantages of using these very fast and sensitive velocity estimators. These experimental...... ultrasound imaging for studying brain function in animals. The paper explains the underlying acquisition and estimation methods for fast 2-D and 3-D velocity imaging and gives a number of examples. Future challenges and the potentials of parallel acquisition systems for flow imaging are also discussed....

  7. A Wide Spectral Range Reflectance and Luminescence Imaging System

    Tapani Hirvonen


    Full Text Available In this study, we introduce a wide spectral range (200–2500 nm imaging system with a 250 μm minimum spatial resolution, which can be freely modified for a wide range of resolutions and measurement geometries. The system has been tested for reflectance and luminescence measurements, but can also be customized for transmittance measurements. This study includes the performance results of the developed system, as well as examples of spectral images. Discussion of the system relates it to existing systems and methods. The wide range spectral imaging system that has been developed is however highly customizable and has great potential in many practical applications.

  8. The neutron imaging system fielded at the National Ignition Facility

    Fittinghoff D.N.


    Full Text Available We have fielded a neutron imaging system at the National Ignition Facility to collect images of fusion neutrons produced in the implosion of inertial confinement fusion experiments and scattered neutrons from (n, n′ reactions of the source neutrons in the surrounding dense material. A description of the neutron imaging system is presented, including the pinhole array aperture, the line-of-sight collimation, the scintillator-based detection system and the alignment systems and methods. Discussion of the alignment and resolution of the system is presented. We also discuss future improvements to the system hardware.

  9. [Research on Spectral Polarization Imaging System Based on Static Modulation].

    Zhao, Hai-bo; Li, Huan; Lin, Xu-ling; Wang, Zheng


    The main disadvantages of traditional spectral polarization imaging system are: complex structure, with moving parts, low throughput. A novel method of spectral polarization imaging system is discussed, which is based on static polarization intensity modulation combined with Savart polariscope interference imaging. The imaging system can obtain real-time information of spectral and four Stokes polarization messages. Compared with the conventional methods, the advantages of the imaging system are compactness, low mass and no moving parts, no electrical control, no slit and big throughput. The system structure and the basic theory are introduced. The experimental system is established in the laboratory. The experimental system consists of reimaging optics, polarization intensity module, interference imaging module, and CCD data collecting and processing module. The spectral range is visible and near-infrared (480-950 nm). The white board and the plane toy are imaged by using the experimental system. The ability of obtaining spectral polarization imaging information is verified. The calibration system of static polarization modulation is set up. The statistical error of polarization degree detection is less than 5%. The validity and feasibility of the basic principle is proved by the experimental result. The spectral polarization data captured by the system can be applied to object identification, object classification and remote sensing detection.

  10. The use of the general image quality equation in the design and evaluation of imaging systems

    Cota, Steve A.; Florio, Christopher J.; Duvall, David J.; Leon, Michael A.


    The design of any modern imaging system is the end result of many trade studies, each seeking to optimize image quality within real world constraints such as cost, schedule and overall risk. The National Imagery Interpretability Rating Scale (NIIRS) is a useful measure of image quality, because, by characterizing the overall interpretability of an image, it combines into one metric those contributors to image quality to which a human interpreter is most sensitive. The main drawback to using a NIIRS rating as a measure of image quality in engineering trade studies is the fact that it is tied to the human observer and cannot be predicted from physical principles and engineering parameters alone. The General Image Quality Equation (GIQE) of Leachtenauer et al. 1997 [Appl. Opt. 36, 8322-8328 (1997)] is a regression of actual image analyst NIIRS ratings vs. readily calculable engineering metrics, and provides a mechanism for using the expected NIIRS rating of an imaging system in the design and evaluation process. In this paper, we will discuss how we use the GIQE in conjunction with The Aerospace Corporation's Parameterized Image Chain Analysis & Simulation SOftware (PICASSO) to evaluate imager designs, taking a hypothetical high resolution commercial imaging system as an example.

  11. NMR imaging of the musculoskeletal system

    Naegele, M.; Lienemann, A.; Hahn, D.


    NMR imaging now allows in vivo imaging of soft tissue hitherto undetectable by non-invasive means. This opens up excellent perspectives with regard to the diagnosis and therapy of various diseases in the field of traumatology and oncology, of which examples are discussed in this paper. (orig.) [de

  12. Kingfisher: a system for remote sensing image database management

    Bruzzo, Michele; Giordano, Ferdinando; Dellepiane, Silvana G.


    At present retrieval methods in remote sensing image database are mainly based on spatial-temporal information. The increasing amount of images to be collected by the ground station of earth observing systems emphasizes the need for database management with intelligent data retrieval capabilities. The purpose of the proposed method is to realize a new content based retrieval system for remote sensing images database with an innovative search tool based on image similarity. This methodology is quite innovative for this application, at present many systems exist for photographic images, as for example QBIC and IKONA, but they are not able to extract and describe properly remote image content. The target database is set by an archive of images originated from an X-SAR sensor (spaceborne mission, 1994). The best content descriptors, mainly texture parameters, guarantees high retrieval performances and can be extracted without losses independently of image resolution. The latter property allows DBMS (Database Management System) to process low amount of information, as in the case of quick-look images, improving time performance and memory access without reducing retrieval accuracy. The matching technique has been designed to enable image management (database population and retrieval) independently of dimensions (width and height). Local and global content descriptors are compared, during retrieval phase, with the query image and results seem to be very encouraging.

  13. A review of imaging techniques for systems biology

    Po Ming J


    Full Text Available Abstract This paper presents a review of imaging techniques and of their utility in system biology. During the last decade systems biology has matured into a distinct field and imaging has been increasingly used to enable the interplay of experimental and theoretical biology. In this review, we describe and compare the roles of microscopy, ultrasound, CT (Computed Tomography, MRI (Magnetic Resonance Imaging, PET (Positron Emission Tomography, and molecular probes such as quantum dots and nanoshells in systems biology. As a unified application area among these different imaging techniques, examples in cancer targeting are highlighted.

  14. Effects of scanning resolution and digital image magnification on photostimulable phosphor imaging system

    Sakurai, Takashi; Inagaki, Masafumi; Asai, Hideomi; Koyama, Atsushi; Kashima, Isamu


    The purpose of this study is to examine the effects of changes in scanning resolution and digital magnification on the image quality and diagnostic ability of the photostimulable phosphor imaging system. Using a photostimulable phosphor imaging system, images of a human adult dried mandible phantom embedded in a 25 mm-thick epoxy resin block were made. The latent images on the photostimulable phosphor imaging plate were scanned using four different pixel sizes as follows: 25 μm x 25 μm, 50 μm x 50 μm, 100 μm x 100 μm and 200 μm x 200 μm. A primary image was produced for each pixel size. These images were also digitally magnified at powers of 2, 4 and 8 times. The gradient range, brightness and contrast of each image were adjusted to optimum levels on a cathode ray tube display, and hard copies were produced with a writing pixel size of 60 μm x 60 μm. The granularity, sharpness and anatomical diagnostic ability of the images were assessed subjectively by eight dentists. Increasing the scanning resolution tended to generally improve image quality and diagnostic ability. Visual image quality was maintained up to a pixel size of 50 μm, and diagnostic ability was maintained up to a pixel size of 100 μm. Digital image magnification degraded image quality, and more than 2-times magnification degraded diagnostic ability. Under the present experimental conditions, increasing the scanning resolution did not always lead to an improvement in image quality or diagnostic ability, and digital image magnification degraded image quality and diagnostic ability. (author)

  15. A secure online image trading system for untrusted cloud environments.

    Munadi, Khairul; Arnia, Fitri; Syaryadhi, Mohd; Fujiyoshi, Masaaki; Kiya, Hitoshi


    In conventional image trading systems, images are usually stored unprotected on a server, rendering them vulnerable to untrusted server providers and malicious intruders. This paper proposes a conceptual image trading framework that enables secure storage and retrieval over Internet services. The process involves three parties: an image publisher, a server provider, and an image buyer. The aim is to facilitate secure storage and retrieval of original images for commercial transactions, while preventing untrusted server providers and unauthorized users from gaining access to true contents. The framework exploits the Discrete Cosine Transform (DCT) coefficients and the moment invariants of images. Original images are visually protected in the DCT domain, and stored on a repository server. Small representation of the original images, called thumbnails, are generated and made publicly accessible for browsing. When a buyer is interested in a thumbnail, he/she sends a query to retrieve the visually protected image. The thumbnails and protected images are matched using the DC component of the DCT coefficients and the moment invariant feature. After the matching process, the server returns the corresponding protected image to the buyer. However, the image remains visually protected unless a key is granted. Our target application is the online market, where publishers sell their stock images over the Internet using public cloud servers.

  16. A novel secret image sharing scheme based on chaotic system

    Li, Li; Abd El-Latif, Ahmed A.; Wang, Chuanjun; Li, Qiong; Niu, Xiamu


    In this paper, we propose a new secret image sharing scheme based on chaotic system and Shamir's method. The new scheme protects the shadow images with confidentiality and loss-tolerance simultaneously. In the new scheme, we generate the key sequence based on chaotic system and then encrypt the original image during the sharing phase. Experimental results and analysis of the proposed scheme demonstrate a better performance than other schemes and confirm a high probability to resist brute force attack.

  17. Performance assessment of imaging plates for the JHR transfer Neutron Imaging System

    Simon, E.; Guimbal, P. AB(; )


    The underwater Neutron Imaging System to be installed in the Jules Horowitz Reactor (JHR-NIS) is based on a transfer method using a neutron activated beta-emitter like Dysprosium. The information stored in the converter is to be offline transferred on a specific imaging system, still to be defined. Solutions are currently under investigation for the JHR-NIS in order to anticipate the disappearance of radiographic films commonly used in these applications. We report here the performance assessment of Computed Radiography imagers (Imaging Plates) performed at LLB/Orphée (CEA Saclay). Several imaging plate types are studied, in one hand in the configuration involving an intimate contact with an activated dysprosium foil converter: Fuji BAS-TR, Fuji UR-1 and Carestream Flex XL Blue imaging plates, and in the other hand by using a prototypal imaging plate doped with dysprosium and thus not needing any contact with a separate converter foil. The results for these imaging plates are compared with those obtained with gadolinium doped imaging plate used in direct neutron imaging (Fuji BAS-ND). The detection performances of the different imagers are compared regarding resolution and noise. The many advantages of using imaging plates over radiographic films (high sensitivity, linear response, high dynamic range) could palliate its lower intrinsic resolution.

  18. Digital radiology and digitally formatted image management systems

    Cox, G.G.; Dwyer, S.J. III; Templeton, A.W.


    The number of diagnostic examinations performed with digitally formatted imaging equipment is increasing. Digital general-purpose and fluoroscopic radiology systems are being clinically evaluated. Digitizing conventional x-ray films, such as mammograms, frequently improves the diagnostic quality of the images. The digitizing process with laser has also afforded the opportunity to document required spatial resolution for digital imaging and network systems. The use of digitally formatted image instrumentation imposes new requirements on the acquisition, display and manipulation, transmission, hard copy image recording, and archiving of diagnostic data. Networking of digitally formatted image data offers many advantages for managing digital information. This paper identifies and describes digital radiographic systems. Parameters required for designing and implementing a digital image management system are outlined. Spatial and contrast resolution requirements are identified. The key parameters include the amount of image data generated each working day, the retrieval rate of the generated data, the display hardware and software needed for interactive diagnosis display stations, the requirements for analog hard copy generation, and on-line and long-term archiving requirements. These image management systems are often called PACS (Picture Archiving and Communication Systems)

  19. Magnetic resonance imaging of central nervous system haemorrhage

    Silberstein, M.; Hennessy, O.


    The variable magnetic resonance imaging appearances of central nervous system haemorrhage, both intra- and extra-axial, are described. These will vary with the type of image contrast (T1 or T2 weighting), the nature of the imaging sequence (spin-echo or gradient-echo) and the time from onset of haemorrhage. Magnetic resonance imaging is a useful technique for imaging haemorrhage in the central nervous system as it yields temporal information about haematoma development, and it is the only non-invasive means of imaging intraspinal haemorrhage. However, in the imaging of haematomas within 24 h of onset and in subarachnoid haemorrhage computed tomography is the investigation of choice. 13 refs., 6 figs

  20. Imaging system for creating 3D block-face cryo-images of whole mice

    Roy, Debashish; Breen, Michael; Salvado, Olivier; Heinzel, Meredith; McKinley, Eliot; Wilson, David


    We developed a cryomicrotome/imaging system that provides high resolution, high sensitivity block-face images of whole mice or excised organs, and applied it to a variety of biological applications. With this cryo-imaging system, we sectioned cryo-preserved tissues at 2-40 μm thickness and acquired high resolution brightfield and fluorescence images with microscopic in-plane resolution (as good as 1.2 μm). Brightfield images of normal and pathological anatomy show exquisite detail, especially in the abdominal cavity. Multi-planar reformatting and 3D renderings allow one to interrogate 3D structures. In this report, we present brightfield images of mouse anatomy, as well as 3D renderings of organs. For BPK mice model of polycystic kidney disease, we compared brightfield cryo-images and kidney volumes to MRI. The color images provided greater contrast and resolution of cysts as compared to in vivo MRI. We note that color cryo-images are closer to what a researcher sees in dissection, making it easier for them to interpret image data. The combination of field of view, depth of field, ultra high resolution and color/fluorescence contrast enables cryo-image volumes to provide details that cannot be found through in vivo imaging or other ex vivo optical imaging approaches. We believe that this novel imaging system will have applications that include identification of mouse phenotypes, characterization of diseases like blood vessel disease, kidney disease, and cancer, assessment of drug and gene therapy delivery and efficacy and validation of other imaging modalities.

  1. A combination chaotic system and application in color image encryption

    Parvaz, R.; Zarebnia, M.


    In this paper, by using Logistic, Sine and Tent systems we define a combination chaotic system. Some properties of the chaotic system are studied by using figures and numerical results. A color image encryption algorithm is introduced based on new chaotic system. Also this encryption algorithm can be used for gray scale or binary images. The experimental results of the encryption algorithm show that the encryption algorithm is secure and practical.

  2. Implementation of a program of quality assurance of image in an imaging system of flat panel portal

    Gomez Barrado, A.; Sanchez Jimenez, E.; Benitez, J. A.; Sanchez-Reyes, A.


    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  3. Design of CMOS imaging system based on FPGA

    Hu, Bo; Chen, Xiaolai


    In order to meet the needs of engineering applications for high dynamic range CMOS camera under the rolling shutter mode, a complete imaging system is designed based on the CMOS imaging sensor NSC1105. The paper decides CMOS+ADC+FPGA+Camera Link as processing architecture and introduces the design and implementation of the hardware system. As for camera software system, which consists of CMOS timing drive module, image acquisition module and transmission control module, the paper designs in Verilog language and drives it to work properly based on Xilinx FPGA. The ISE 14.6 emulator ISim is used in the simulation of signals. The imaging experimental results show that the system exhibits a 1280*1024 pixel resolution, has a frame frequency of 25 fps and a dynamic range more than 120dB. The imaging quality of the system satisfies the requirement of the index.

  4. Enhancement system of nighttime infrared video image and visible video image

    Wang, Yue; Piao, Yan


    Visibility of Nighttime video image has a great significance for military and medicine areas, but nighttime video image has so poor quality that we can't recognize the target and background. Thus we enhance the nighttime video image by fuse infrared video image and visible video image. According to the characteristics of infrared and visible images, we proposed improved sift algorithm andαβ weighted algorithm to fuse heterologous nighttime images. We would deduced a transfer matrix from improved sift algorithm. The transfer matrix would rapid register heterologous nighttime images. And theαβ weighted algorithm can be applied in any scene. In the video image fusion system, we used the transfer matrix to register every frame and then used αβ weighted method to fuse every frame, which reached the time requirement soft video. The fused video image not only retains the clear target information of infrared video image, but also retains the detail and color information of visible video image and the fused video image can fluency play.

  5. Exploratory survey of image quality on CR digital mammography imaging systems in Mexico

    Gaona, E.; Rivera, T.; Arreola, M.; Franco, J.; Molina, N.; Alvarez, B.; Azorín, C.G.; Casian, G.


    The purpose of this study was to assess the current status of image quality and dose in computed radiographic digital mammography (CRDM) systems. Studies included CRDM systems of various models and manufacturers which dose and image quality comparisons were performed. Due to the recent rise in the use of digital radiographic systems in Mexico, CRDM systems are rapidly replacing conventional film-screen systems without any regard to quality control or image quality standards. Study was conducted in 65 mammography facilities which use CRDM systems in the Mexico City and surrounding States. The systems were tested as used clinically. This means that the dose and beam qualities were selected using the automatic beam selection and photo-timed features. All systems surveyed generate laser film hardcopies for the radiologist to read on a scope or mammographic high luminance light box. It was found that 51 of CRDM systems presented a variety of image artefacts and non-uniformities arising from inadequate acquisition and processing, as well as from the laser printer itself. Undisciplined alteration of image processing settings by the technologist was found to be a serious prevalent problem in 42 facilities. Only four of them showed an image QC program which is periodically monitored by a medical physicist. The Average Glandular Dose (AGD) in the surveyed systems was estimated to have a mean value of 2.4 mGy. To improve image quality in mammography and make more efficient screening mammographic in early detection of breast cancer is required new legislation. - Highlights: • Radiation dose in CR digital mammography (CRDM) systems was determined. • Image quality related with dose in CR digital mammography (CRDM) systems was analysed. • Image processing artefacts were observed and correlated with dose. • Measured entrance dose by TL phosphors could be good parameter for radiation protection optimization in patient

  6. Stepped scanner radiographic imaging system using edge blending

    Lapidus, S.N.


    An imaging system is described which includes a radiographic camera, a bed for supporting a subject in view of the camera, and a display system. The camera provides X and Y coordinate signals for each radiographic event. The position of the bed relative to the camera is altered stepwise and a sequence of images is provided by the camera each image being positioned on a display system in correspondence with the location of the bed relative to the camera. The camera is electronically decoupled from the display by a gate during movement of the bed relative to the camera from one location to the next location to prevent any smearing effect within the composite image presented on the display. The edges of contiguous images making up the composite image are blended by electronically adjusting their boundary regions so as to provide overlapping or interlocking. (author)

  7. Television imaging system for fast neutron radiography using baby cyclotron

    Yoshii, Koji; Miya, Kenzo; Katoh, Norihiko.


    A television imaging system for fast neutron radiography (FNR-TV) developed using the fast neutron source reactor YAYOI was applied to the baby-cyclotron based fast neutron source to get images of thick objects quickly. In the system the same technique as a current television imaging system of thermal neutron radiography was applied, while the luminescent converter was used to detect fast neutrons. Using the CR39 track etch method it took about 7 h to get an image, while the FNR-TV only 20 s enough for taking the same object. However the FNR-TV imaging result of the simulation model of a large explosive device for the space launch vehicle of H-2 type was not so good as the image taken with the CR39 track etch method. The reason was that the luminescence intensity of the FNR-TV converter was a quarter of that in the YAYOI. (author)

  8. Advanced imaging of skeletal manifestations of systemic mastocytosis

    Fritz, J.; Fishman, E.K.; Carrino, J.A.; Horger, M.S.


    Systemic mastocytosis comprises a group of clonal disorders of the mast cell that most commonly involves the skeletal system. Imaging can be helpful in the detection and characterization of the osseous manifestations of this disease. While radiography and bone scans are frequently used for this assessment, low-dose multidetector computed tomography and magnetic resonance imaging can be more sensitive for the detection of marrow involvement and for the demonstration of the various disease patterns. In this article, we review the pathophysiological and clinical features of systemic mastocytosis, discuss the role of imaging for staging and management, and illustrate the various cross-sectional imaging appearances. Awareness and knowledge of the imaging features of this disorder will increase the accuracy of image interpretation and can contribute important information for management decisions. (orig.)

  9. Advanced imaging of skeletal manifestations of systemic mastocytosis

    Fritz, J. [Johns Hopkins University School of Medicine, Russell H. Morgan Department of Radiology and Radiological Science, Baltimore, MD (United States); Fishman, E.K.; Carrino, J.A. [Johns Hopkins University School of Medicine, Russell H. Morgan Department of Radiology and Radiological Science, Baltimore, MD (United States); Horger, M.S. [Eberhard-Karls-University, Department of Diagnostic and Interventional Radiology, Tuebingen (Germany)


    Systemic mastocytosis comprises a group of clonal disorders of the mast cell that most commonly involves the skeletal system. Imaging can be helpful in the detection and characterization of the osseous manifestations of this disease. While radiography and bone scans are frequently used for this assessment, low-dose multidetector computed tomography and magnetic resonance imaging can be more sensitive for the detection of marrow involvement and for the demonstration of the various disease patterns. In this article, we review the pathophysiological and clinical features of systemic mastocytosis, discuss the role of imaging for staging and management, and illustrate the various cross-sectional imaging appearances. Awareness and knowledge of the imaging features of this disorder will increase the accuracy of image interpretation and can contribute important information for management decisions. (orig.)

  10. Imaging systems and methods for obtaining and using biometric information

    McMakin, Douglas L [Richland, WA; Kennedy, Mike O [Richland, WA


    Disclosed herein are exemplary embodiments of imaging systems and methods of using such systems. In one exemplary embodiment, one or more direct images of the body of a clothed subject are received, and a motion signature is determined from the one or more images. In this embodiment, the one or more images show movement of the body of the subject over time, and the motion signature is associated with the movement of the subject's body. In certain implementations, the subject can be identified based at least in part on the motion signature. Imaging systems for performing any of the disclosed methods are also disclosed herein. Furthermore, the disclosed imaging, rendering, and analysis methods can be implemented, at least in part, as one or more computer-readable media comprising computer-executable instructions for causing a computer to perform the respective methods.

  11. Development of an integrated filing system for endoscopic images.

    Fujino, M A; Ikeda, M; Yamamoto, Y; Kinose, T; Tachikawa, H; Morozumi, A; Sano, S; Kojima, Y; Nakamura, T; Kawai, T


    A new integrated filing system for endoscopic images has been developed, comprising a main image filing system and subsystems located at different stations. A hybrid filing system made up of both digital and analog filing devices was introduced to construct this system that combines the merits of the two filing methods. Each subsystem provided with a video processor, is equipped with a digital filing device, and routine images were recorded in the analog image filing device of the main system. The use of a multi-input adapter enabled simultaneous input of analog images from up to 8 video processors. Recorded magneto-optical disks make it possible to recall the digital images at any station in the hospital; the disks are copied without image degradation and also utilised for image processing. This system promises reliable storage and integrated, efficient management of endoscopic information. It also costs less to install than the so-called PACS (picture archiving and communication system), which connects all the stations of the hospital using optical fiber cables.

  12. Stokes image reconstruction for two-color microgrid polarization imaging systems.

    Lemaster, Daniel A


    The Air Force Research Laboratory has developed a new microgrid polarization imaging system capable of simultaneously reconstructing linear Stokes parameter images in two colors on a single focal plane array. In this paper, an effective method for extracting Stokes images is presented for this type of camera system. It is also shown that correlations between the color bands can be exploited to significantly increase overall spatial resolution. Test data is used to show the advantages of this approach over bilinear interpolation. The bounds (in terms of available reconstruction bandwidth) on image resolution are also provided.

  13. Development of computed tomography system and image reconstruction algorithm

    Khairiah Yazid; Mohd Ashhar Khalid; Azaman Ahmad; Khairul Anuar Mohd Salleh; Ab Razak Hamzah


    Computed tomography is one of the most advanced and powerful nondestructive inspection techniques, which is currently used in many different industries. In several CT systems, detection has been by combination of an X-ray image intensifier and charge -coupled device (CCD) camera or by using line array detector. The recent development of X-ray flat panel detector has made fast CT imaging feasible and practical. Therefore this paper explained the arrangement of a new detection system which is using the existing high resolution (127 μm pixel size) flat panel detector in MINT and the image reconstruction technique developed. The aim of the project is to develop a prototype flat panel detector based CT imaging system for NDE. The prototype consisted of an X-ray tube, a flat panel detector system, a rotation table and a computer system to control the sample motion and image acquisition. Hence this project is divided to two major tasks, firstly to develop image reconstruction algorithm and secondly to integrate X-ray imaging components into one CT system. The image reconstruction algorithm using filtered back-projection method is developed and compared to other techniques. The MATLAB program is the tools used for the simulations and computations for this project. (Author)

  14. RANZAR Body Systems Framework of diagnostic imaging examination descriptors

    Pitman, Alexander D.; Penlington, Lisa; Doromal, Darren; Vukolova, Natalia; Slater, Gregory


    A unified and logical system of descriptors for diagnostic imaging examinations and procedures is a desirable resource for radiology in Australia and New Zealand and is needed to support core activities of RANZCR. Existing descriptor systems available in Australia and New Zealand (including the Medicare DIST and the ACC Schedule) have significant limitations and are inappropriate for broader clinical application. An anatomically based grid was constructed, with anatomical structures arranged in rows and diagnostic imaging modalities arranged in columns (including nuclear medicine and positron emission tomography). The grid was segregated into five body systems. The cells at the intersection of an anatomical structure row and an imaging modality column were populated with short, formulaic descriptors of the applicable diagnostic imaging examinations. Clinically illogical or physically impossible combinations were ‘greyed out’. Where the same examination applied to different anatomical structures, the descriptor was kept identical for the purposes of streamlining. The resulting Body Systems Framework of diagnostic imaging examination descriptors lists all the reasonably common diagnostic imaging examinations currently performed in Australia and New Zealand using a unified grid structure allowing navigation by both referrers and radiologists. The Framework has been placed on the RANZCR website and is available for access free of charge by registered users. The Body Systems Framework of diagnostic imaging examination descriptors is a system of descriptors based on relationships between anatomical structures and imaging modalities. The Framework is now available as a resource and reference point for the radiology profession and to support core College activities.

  15. Magnetic resonance imaging in multiple system atrophy

    Aotsuka, Akiyo; Shinotoh, Hitoshi; Hirayama, Keizo [Chiba Univ. (Japan). School of Medicine; Ikehira, Hiroo; Hashimoto, Takahiro


    We studied 18 patients with multiple system atrophy (MSA) by high field strength MRI: 6 striatonigral degeneration (SND), 4 Shy-Drager syndrome (SDS), and 8 olivo-ponto-cerebellar atrophy (OPCA). We also studied 30 Parkinson's disease (PD) and 10 age-matched controls. The diagnosis of SND, SDS, and OPCA were based on criteria after Hirayama et al (1985). Bradykinesia, rigidity, and tremor were assessed with the summed scores of the signs used as the extrapyramidal scores. The mean extrapyramidal scores were not significantly different in patients with SND, SDS, OPCA, and PD. MRI studies were performed on 1.5 tesla MRI unit, using a T[sub 2]-weighted spin echo pulse sequence (TR2500 ms/TE40 ms). The width of the pars compacta signal in all subjects was measured by the method of Duguid et al (1986). Intensity profiles were made on a straight line perpendicular to the pars compacta through the center of the red nucleus on an image of the midbrain. We measured the width of the valley at half-height between the peaks of an index of the width of the pars compacta signal. The mean widths of the pars compacta signal were: 2.8[+-]0.4 mm (SND), 2.8[+-]0.7 mm (SDS), 3.6[+-]0.6 mm (OPCA), 2.7[+-]0.3 mm (PD), and 4.3[+-]0.6 mm (control). The mean widths of the pars compacta signal in PD, SND, and SDS were significantly narrower than that in the control group (p<0.05), while the OPCA group was not significantly narrower. The results may indicate that the time course of nigral involvement is milder in OPCA than in SND and SDS. The extrapyramidal signs in OPCA may be attributed mainly to the degeneration of the putamen rather than to that of the substantia nigra. Abnormal hypointensity in the posterolateral putamen was found in only one SND patient and in two OPCA patients, even though this finding has been frequently observed in MSA. Since no PD patients exhibited this finding, it may of some value in differentiating MSA from PD. (author).

  16. [The Role of Imaging in Central Nervous System Infections].

    Yokota, Hajime; Tazoe, Jun; Yamada, Kei


    Many infections invade the central nervous system. Magnetic resonance imaging (MRI) is the main tool that is used to evaluate infectious lesions of the central nervous system. The useful sequences on MRI are dependent on the locations, such as intra-axial, extra-axial, and spinal cord. For intra-axial lesions, besides the fundamental sequences, including T1-weighted images, T2-weighted images, and fluid-attenuated inversion recovery (FLAIR) images, advanced sequences, such as diffusion-weighted imaging, diffusion tensor imaging, susceptibility-weighted imaging, and MR spectroscopy, can be applied. They are occasionally used as determinants for quick and correct diagnosis. For extra-axial lesions, understanding the differences among 2D-conventional T1-weighted images, 2D-fat-saturated T1-weighted images, 3D-Spin echo sequences, and 3D-Gradient echo sequence after the administration of gadolinium is required to avoid wrong interpretations. FLAIR plus gadolinium is a useful tool for revealing abnormal enhancement on the brain surface. For the spinal cord, the sequences are limited. Evaluating the distribution and time course of the spinal cord are essential for correct diagnoses. We summarize the role of imaging in central nervous system infections and show the pitfalls, key points, and latest information in them on clinical practices.

  17. A photoacoustic tomography system for imaging of biological tissues

    Su Yixiong; Zhang Fan; Xu Kexin; Yao Jianquan; Wang, Ruikang K


    Non-invasive laser-induced photoacoustic tomography (PAT) is a promising imaging modality in the biomedical optical imaging field. This technology, based on the intrinsic optical properties of tissue and ultrasonic detection, overcomes the resolution disadvantage of pure-optical imaging caused by strong light scattering and the contrast and speckle disadvantages of pure ultrasonic imaging. Here, we report a PAT experimental system constructed in our laboratory. In our system, a Q-switched Nd : YAG pulse laser operated at 532 nm with a 8 ns pulse width is used to generate a photoacoustic signal. By using this system, the two-dimensional distribution of optical absorption in the tissue-mimicking phantom is reconstructed and has an excellent agreement with the original ones. The spatial resolution of the imaging system approaches 100 μm through about 4 cm of highly scattering medium

  18. ORIS: the Oak Ridge Imaging System program listings

    Bell, P.R.; Dougherty, J.M.


    The Oak Ridge Imaging System (ORIS) is a general purpose access, storage, processing and display system for nuclear medicine imaging with rectilinear scanner and gamma camera. This volume contains listings of the PDP-8/E version of ORIS Version 2. The system is designed to run under the Digital Equipment Corporation's OS/8 monitor in 16K or more words of core. System and image file mass storage is on RK8E disk; longer-time image file storage is provided on DECtape. Another version of this program exists for use with the RF08 disk, and a more limited version is for DECtape only. This latter version is intended for non-medical imaging

  19. Improvement of a Vocal Fold Imaging System

    Krauter, K. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)


    Medical professionals can better serve their patients through continual update of their imaging tools. A wide range of pathologies and disease may afflict human vocal cords or, as they’re also known, vocal folds. These diseases can affect human speech hampering the ability of the patient to communicate. Vocal folds must be opened for breathing and the closed to produce speech. Currently methodologies to image markers of potential pathologies are difficult to use and often fail to detect early signs of disease. These current methodologies rely on a strobe light and slower frame rate camera in an attempt to obtain images as the vocal folds travel over the full extent of their motion.

  20. Hyperspectral imaging system for disease scanning on banana plants

    Ochoa, Daniel; Cevallos, Juan; Vargas, German; Criollo, Ronald; Romero, Dennis; Castro, Rodrigo; Bayona, Oswaldo


    Black Sigatoka (BS) is a banana plant disease caused by the fungus Mycosphaerella fijiensis. BS symptoms can be observed at late infection stages. By that time, BS has probably spread to other plants. In this paper, we present our current work on building an hyper-spectral (HS) imaging system aimed at in-vivo detection of BS pre-symptomatic responses in banana leaves. The proposed imaging system comprises a motorized stage, a high-sensitivity VIS-NIR camera and an optical spectrograph. To capture images of the banana leaf, the stage's speed and camera's frame rate must be computed to reduce motion blur and to obtain the same resolution along both spatial dimensions of the resulting HS cube. Our continuous leaf scanning approach allows imaging leaves of arbitrary length with minimum frame loss. Once the images are captured, a denoising step is performed to improve HS image quality and spectral profile extraction.

  1. Diagnostic information management system for the evaluation of medical images

    Higa, Toshiaki; Torizuka, Kanji; Minato, Kotaro; Komori, Masaru; Hirakawa, Akina


    A practical, small and low-cost diagnostic information management system has been developed for a comparative study of various medical imaging procedures, including ordinary radiography, X-ray computed tomography, emission computed tomography, and so forth. The purpose of the system is to effectively manage the original image data files and diagnostic descriptions during the various imaging procedures. A diagnostic description of each imaging procedure for each patient is made on a hand-sort punched-card with line-drawings and ordinary medical terminology and then coded and computerized using Index for Roentgen Diagnoses (American College of Radiology). A database management software (DB Master) on a personal computer (Apple II) is used for searching for patients' records on hand-sort punched-cards and finally original medical images. Discussed are realistic use of medical images and an effective form of diagnostic descriptions.

  2. Diagnostic information management system for the evaluation of medical images

    Higa, Toshiaki; Torizuka, Kanji; Minato, Kotaro; Komori, Masaru; Hirakawa, Akina.


    A practical, small and low-cost diagnostic information management system has been developed for a comparative study of various medical imaging procedures, including ordinary radiography, X-ray computed tomography, emission computed tomography, and so forth. The purpose of the system is to effectively manage the original image data files and diagnostic descriptions during the various imaging procedures. A diagnostic description of each imaging procedure for each patient is made on a hand-sort punched-card with line-drawings and ordinary medical terminology and then coded and computerized using Index for Roentgen Diagnoses (American College of Radiology). A database management software (DB Master) on a personal computer (Apple II) is used for searching for patients' records on hand-sort punched-cards and finally original medical images. Discussed are realistic use of medical images and an effective form of diagnostic descriptions. (author)

  3. Advanced digital image archival system using MPEG technologies

    Chang, Wo


    Digital information and records are vital to the human race regardless of the nationalities and eras in which they were produced. Digital image contents are produced at a rapid pace from cultural heritages via digitalization, scientific and experimental data via high speed imaging sensors, national defense satellite images from governments, medical and healthcare imaging records from hospitals, personal collection of photos from digital cameras. With these mass amounts of precious and irreplaceable data and knowledge, what standards technologies can be applied to preserve and yet provide an interoperable framework for accessing the data across varieties of systems and devices? This paper presents an advanced digital image archival system by applying the international standard of MPEG technologies to preserve digital image content.

  4. An FPGA-based heterogeneous image fusion system design method

    Song, Le; Lin, Yu-chi; Chen, Yan-hua; Zhao, Mei-rong


    Taking the advantages of FPGA's low cost and compact structure, an FPGA-based heterogeneous image fusion platform is established in this study. Altera's Cyclone IV series FPGA is adopted as the core processor of the platform, and the visible light CCD camera and infrared thermal imager are used as the image-capturing device in order to obtain dualchannel heterogeneous video images. Tailor-made image fusion algorithms such as gray-scale weighted averaging, maximum selection and minimum selection methods are analyzed and compared. VHDL language and the synchronous design method are utilized to perform a reliable RTL-level description. Altera's Quartus II 9.0 software is applied to simulate and implement the algorithm modules. The contrast experiments of various fusion algorithms show that, preferably image quality of the heterogeneous image fusion can be obtained on top of the proposed system. The applied range of the different fusion algorithms is also discussed.

  5. Development of CCD Imaging System Using Thermoelectric Cooling Method

    Youngsik Park


    Full Text Available We developed low light CCD imaging system using thermoelectric cooling method collaboration with a company to design a commercial model. It consists of Kodak KAF-0401E (768x512 pixels CCD chip,thermoelectric module manufactured by Thermotek. This TEC system can reach an operative temperature of -25deg. We employed an Uniblitz VS25S shutter and it has capability a minimum exposure time 80ms. The system components are an interface card using a Korea Astronomy Observatory (hereafter KAO ISA bus controller, image acquisition with AD9816 chip, that is 12bit video processor. The performance test with this imaging system showed good operation within the initial specification of our design. It shows a dark current less than 0.4e-/pixel/sec at a temperature of -10deg, a linearity 99.9+/-0.1%, gain 4.24e-adu, and system noise is 25.3e- (rms. For low temperature CCD operation, we designed a TEC, which uses a one-stage peltier module and forced air heat exchanger. This TEC imaging system enables accurate photometry (+/-0.01mag even though the CCD is not at 'conventional' cryogenic temperatures (140K. The system can be a useful instrument for any other imaging applications. Finally, with this system, we obtained several images of astronomical objects for system performance tests.

  6. Design and implementation of typical target image database system

    Qin Kai; Zhao Yingjun


    It is necessary to provide essential background data and thematic data timely in image processing and application. In fact, application is an integrating and analyzing procedure with different kinds of data. In this paper, the authors describe an image database system which classifies, stores, manages and analyzes database of different types, such as image database, vector database, spatial database, spatial target characteristics database, its design and structure. (authors)

  7. An image analysis system for near-infrared (NIR) fluorescence lymph imaging

    Zhang, Jingdan; Zhou, Shaohua Kevin; Xiang, Xiaoyan; Rasmussen, John C.; Sevick-Muraca, Eva M.


    Quantitative analysis of lymphatic function is crucial for understanding the lymphatic system and diagnosing the associated diseases. Recently, a near-infrared (NIR) fluorescence imaging system is developed for real-time imaging lymphatic propulsion by intradermal injection of microdose of a NIR fluorophore distal to the lymphatics of interest. However, the previous analysis software3, 4 is underdeveloped, requiring extensive time and effort to analyze a NIR image sequence. In this paper, we develop a number of image processing techniques to automate the data analysis workflow, including an object tracking algorithm to stabilize the subject and remove the motion artifacts, an image representation named flow map to characterize lymphatic flow more reliably, and an automatic algorithm to compute lymph velocity and frequency of propulsion. By integrating all these techniques to a system, the analysis workflow significantly reduces the amount of required user interaction and improves the reliability of the measurement.

  8. Image registration for a UV-Visible dual-band imaging system

    Chen, Tao; Yuan, Shuang; Li, Jianping; Xing, Sheng; Zhang, Honglong; Dong, Yuming; Chen, Liangpei; Liu, Peng; Jiao, Guohua


    The detection of corona discharge is an effective way for early fault diagnosis of power equipment. UV-Visible dual-band imaging can detect and locate corona discharge spot at all-weather condition. In this study, we introduce an image registration protocol for this dual-band imaging system. The protocol consists of UV image denoising and affine transformation model establishment. We report the algorithm details of UV image preprocessing, affine transformation model establishment and relevant experiments for verification of their feasibility. The denoising algorithm was based on a correlation operation between raw UV images, a continuous mask and the transformation model was established by using corner feature and a statistical method. Finally, an image fusion test was carried out to verify the accuracy of affine transformation model. It has proved the average position displacement error between corona discharge and equipment fault at different distances in a 2.5m-20 m range are 1.34 mm and 1.92 mm in the horizontal and vertical directions, respectively, which are precise enough for most industrial applications. The resultant protocol is not only expected to improve the efficiency and accuracy of such imaging system for locating corona discharge spot, but also supposed to provide a more generalized reference for the calibration of various dual-band imaging systems in practice.

  9. Practical evaluation of clinical image quality (4). Determination of image quality in digital radiography system

    Katayama, Reiji


    Recently, for medical imaging, digital radiography systems are widely used in clinical practices. However, a study in the past reported that a patient radiation exposure level by digital radiography is in fact not lower than that by analog radiography system. High level of attention needs to be paid for over-exposure when using the conventional analog radiography with a screen and a film, as it results in high density of the film. However, for digital radiography systems, since the automatic adjusting function of image density is equipped with them, no attention for radiation dose need to be paid. Thus technologists tend to be careless and results in higher chance for over-exposure. Current digital radiography systems are high-performance in the image properties and capable of patient dose reduction. Especially, the image quality of the flat panel detector system is recognized, higher than that of the computed radiography system by imaging plates, in both objective and subjective evaluations. Therefore, we technologists are responsible for optimizing the balance between the image quality of the digital radiogram and the radiation dose required for each case. Moreover, it is also required for us as medical technologists to make effective use of such evaluation result of medical images for patients. (author)

  10. A luminescence imaging system based on a CCD camera

    Duller, G.A.T.; Bøtter-Jensen, L.; Markey, B.G.


    Stimulated luminescence arising from naturally occurring minerals is likely to be spatially heterogeneous. Standard luminescence detection systems are unable to resolve this variability. Several research groups have attempted to use imaging photon detectors, or image intensifiers linked...... to photographic systems, in order to obtain spatially resolved data. However, the former option is extremely expensive and it is difficult to obtain quantitative data from the latter. This paper describes the use of a CCD camera for imaging both thermoluminescence and optically stimulated luminescence. The system...


    Y. C. Chen


    Full Text Available This paper proposes an object-space multi-image matching procedure of terrestrial MMS (Mobile Mapping System image sequences to determine the coordinates of an object point automatically and reliably. This image matching procedure can be applied to find conjugate points of MMS image sequences efficiently. Conventional area-based image matching methods are not reliable to deliver accurate matching results for this application due to image scale variations, viewing angle variations, and object occlusions. In order to deal with these three matching problems, an object space multi-image matching is proposed. A modified NCC (Normalized Cross Correlation coefficient is proposed to measure the similarity of image patches. A modified multi-window matching procedure will also be introduced to solve the problem of object occlusion. A coarse-to-fine procedure with a combination of object-space multi-image matching and multi-window matching is adopted. The proposed procedure has been implemented for the purpose of matching terrestrial MMS image sequences. The ratio of correct matches of this experiment was about 80 %. By providing an approximate conjugate point in an overlapping image manually, most of the incorrect matches could be fixed properly and the ratio of correct matches was improved up to 98 %.

  12. A novel track imaging system as a range counter

    Chen, Z. [National Institute of Radiological Sciences (Japan); Matsufuji, N. [National Institute of Radiological Sciences (Japan); Tokyo Institute of Technology (Japan); Kanayama, S. [Chiba University (Japan); Ishida, A. [National Institute of Radiological Sciences (Japan); Tokyo Institute of Technology (Japan); Kohno, T. [Tokyo Institute of Technology (Japan); Koba, Y.; Sekiguchi, M.; Kitagawa, A.; Murakami, T. [National Institute of Radiological Sciences (Japan)


    An image-intensified, camera-based track imaging system has been developed to measure the tracks of ions in a scintillator block. To study the performance of the detector unit in the system, two types of scintillators, a dosimetrically tissue-equivalent plastic scintillator EJ-240 and a CsI(Tl) scintillator, were separately irradiated with carbon ion ({sup 12}C) beams of therapeutic energy from HIMAC at NIRS. The images of individual ion tracks in the scintillators were acquired by the newly developed track imaging system. The ranges reconstructed from the images are reported here. The range resolution of the measurements is 1.8 mm for 290 MeV/u carbon ions, which is considered a significant improvement on the energy resolution of the conventional ΔE/E method. The detector is compact and easy to handle, and it can fit inside treatment rooms for in-situ studies, as well as satisfy clinical quality assurance purposes.

  13. System for objective assessment of image differences in digital cinema

    Fliegel, Karel; Krasula, Lukáš; Páta, Petr; Myslík, Jiří; Pecák, Josef; Jícha, Marek


    There is high demand for quick digitization and subsequent image restoration of archived film records. Digitization is very urgent in many cases because various invaluable pieces of cultural heritage are stored on aging media. Only selected records can be reconstructed perfectly using painstaking manual or semi-automatic procedures. This paper aims to answer the question what are the quality requirements on the restoration process in order to obtain acceptably close visual perception of the digitally restored film in comparison to the original analog film copy. This knowledge is very important to preserve the original artistic intention of the movie producers. Subjective experiment with artificially distorted images has been conducted in order to answer the question what is the visual impact of common image distortions in digital cinema. Typical color and contrast distortions were introduced and test images were presented to viewers using digital projector. Based on the outcome of this subjective evaluation a system for objective assessment of image distortions has been developed and its performance tested. The system utilizes calibrated digital single-lens reflex camera and subsequent analysis of suitable features of images captured from the projection screen. The evaluation of captured image data has been optimized in order to obtain predicted differences between the reference and distorted images while achieving high correlation with the results of subjective assessment. The system can be used to objectively determine the difference between analog film and digital cinema images on the projection screen.

  14. Computer simulation of radiographic images sharpness in several system of image record

    Silva, Marcia Aparecida; Schiable, Homero; Frere, Annie France; Marques, Paulo M.A.; Oliveira, Henrique J.Q. de; Alves, Fatima F.R.; Medeiros, Regina B.


    A method to predict the influence of the record system on radiographic images sharpness by computer simulation is studied. The method intend to previously show the image to be obtained for each type of film or screen-film combination used during the exposure

  15. Pattern recognition and expert image analysis systems in biomedical image processing (Invited Paper)

    Oosterlinck, A.; Suetens, P.; Wu, Q.; Baird, M.; F. M., C.


    This paper gives an overview of pattern recoanition techniques (P.R.) used in biomedical image processing and problems related to the different P.R. solutions. Also the use of knowledge based systems to overcome P.R. difficulties, is described. This is illustrated by a common example ofabiomedical image processing application.

  16. Breast imaging with the SoftVue imaging system: first results

    Duric, Neb; Littrup, Peter; Schmidt, Steven; Li, Cuiping; Roy, Olivier; Bey-Knight, Lisa; Janer, Roman; Kunz, Dave; Chen, Xiaoyang; Goll, Jeffrey; Wallen, Andrea; Zafar, Fouzaan; Allada, Veerendra; West, Erik; Jovanovic, Ivana; Li, Kuo; Greenway, William


    For women with dense breast tissue, who are at much higher risk for developing breast cancer, the performance of mammography is at its worst. Consequently, many early cancers go undetected when they are the most treatable. Improved cancer detection for women with dense breasts would decrease the proportion of breast cancers diagnosed at later stages, which would significantly lower the mortality rate. The emergence of whole breast ultrasound provides good performance for women with dense breast tissue, and may eliminate the current trade-off between the cost effectiveness of mammography and the imaging performance of more expensive systems such as magnetic resonance imaging. We report on the performance of SoftVue, a whole breast ultrasound imaging system, based on the principles of ultrasound tomography. SoftVue was developed by Delphinus Medical Technologies and builds on an early prototype developed at the Karmanos Cancer Institute. We present results from preliminary testing of the SoftVue system, performed both in the lab and in the clinic. These tests aimed to validate the expected improvements in image performance. Initial qualitative analyses showed major improvements in image quality, thereby validating the new imaging system design. Specifically, SoftVue's imaging performance was consistent across all breast density categories and had much better resolution and contrast. The implications of these results for clinical breast imaging are discussed and future work is described.

  17. Developments of optical fast-gated imaging systems

    Koehler, H.A.; Kotecki, D.


    Several fast-gated imaging systems to measure ultra-fast single-transient data have been developed for time-resolved imaging of pulsed radiation sources. These systems were designed to achieve image recording times of 1 to 3 ms and dynamic ranges of >200:1 to produce large two-dimensional images (greater than or equal to 10 4 spatial points) of 1 to 2 ns exposure and small two-dimensional images (less than or equal to 200 spatial points) of less than or equal to 0.5 ns exposure. Both MCP intensified solid-state two-dimensional framing cameras and streak camera/solid-state camera systems were used; the framing camera system provides snap shots with high spatial resolution whereas the streak camera system provides for limited spatial points each with high temporal resolution. Applications of these systems include electron-beam, x-ray, gamma-ray, and neutron diagnostics. This report reviews the characteristics of the major components of fast-gated imaging systems developed at Lawrence Livermore National Laboratory. System performances are described in view of major experiments, and the diagnostic requirements of new experiments in atomic physics (x-ray lasers) and nuclear physics (fusion) are indicated

  18. Evaluating Picture Quality of Image Plates in Digital CR Systems

    Kwak, Byung Joon [Dept. of Radiological Tecnology, Choonhae College of Health Science, Ulsan (Korea, Republic of); Ji Tae Jeong [Dept. of Radiological Science, Kaya University, Kimhae (Korea, Republic of)


    Lab effectively supplemented the effects of outside radiation on image plates in the process of image acquisition of CR (computed radiography) systems and conducted for effective utilization in the case of clinical application. For this, Lab classified the storage places and time periods of image plates and compared and analyzed the differences between small dark spots. Lab also assessed the concentration distribution within the boundaries of images. Lab compared and measured the number of dark spots in a light room and a dark room depending on the storage places of image plates and found that dark spots slightly increased in an image plate when stored in a light room on the first and second days. Dark spots increased in proportion to the length of time stored. In the case of the image plate stored in a dark room, the number of dark spots remarkably decreased. With regard to picture quality as related to the location of image plates, the damage to picture quality could be reduced by locating regions of interest in the center. With regard to differences in sharpness following changes in the thickness of subjects, fewer scatter rays occurred and sharpness improved by reducing the thickness of subjects as much as possible. To get medical images of excellent quality, image plates should be managed effectively and it is desirable to keep images plates in dark iron plate boxes and not to expose them to outside radiation for a long time.

  19. Evaluating Picture Quality of Image Plates in Digital CR Systems

    Kwak, Byung Joon; Ji Tae Jeong


    Lab effectively supplemented the effects of outside radiation on image plates in the process of image acquisition of CR (computed radiography) systems and conducted for effective utilization in the case of clinical application. For this, Lab classified the storage places and time periods of image plates and compared and analyzed the differences between small dark spots. Lab also assessed the concentration distribution within the boundaries of images. Lab compared and measured the number of dark spots in a light room and a dark room depending on the storage places of image plates and found that dark spots slightly increased in an image plate when stored in a light room on the first and second days. Dark spots increased in proportion to the length of time stored. In the case of the image plate stored in a dark room, the number of dark spots remarkably decreased. With regard to picture quality as related to the location of image plates, the damage to picture quality could be reduced by locating regions of interest in the center. With regard to differences in sharpness following changes in the thickness of subjects, fewer scatter rays occurred and sharpness improved by reducing the thickness of subjects as much as possible. To get medical images of excellent quality, image plates should be managed effectively and it is desirable to keep images plates in dark iron plate boxes and not to expose them to outside radiation for a long time.

  20. Parameter Optimization of Multi-Element Synthetic Aperture Imaging Systems

    Vera Behar


    Full Text Available In conventional ultrasound imaging systems with phased arrays, the further improvement of lateral resolution requires enlarging of the number of array elements that in turn increases both, the complexity and the cost, of imaging systems. Multi-element synthetic aperture focusing (MSAF systems are a very good alternative to conventional systems with phased arrays. The benefit of the synthetic aperture is in reduction of the system complexity, cost and acquisition time. In a MSAF system considered in the paper, a group of elements transmit and receive signals simultaneously, and the transmit beam is defocused to emulate a single element response. The echo received at each element of a receive sub-aperture is recorded in the computer memory. The process of transmission/reception is repeated for all positions of a transmit sub-aperture. All the data recordings associated with each corresponding pair "transmit-receive sub-aperture" are then focused synthetically producing a low-resolution image. The final high-resolution image is formed by summing of the all low-resolution images associated with transmit/receive sub-apertures. A problem of parameter optimization of a MSAF system is considered in this paper. The quality of imaging (lateral resolution and contrast is expressed in terms of the beam characteristics - beam width and side lobe level. The comparison between the MSAF system described in the paper and an equivalent conventional phased array system shows that the MSAF system acquires images of equivalent quality much faster using only a small part of the power per image.

  1. Image processing. A system for the automatic sorting of chromosomes

    Najai, Amor


    The present paper deals with two aspects of the system: - an automata (specialized hardware) dedicated to image processing. Images are digitized, divided into sub-units and computations are carried out on their main parameters. - A software for the automatic recognition and sorting of chromosomes is implemented on a Multi-20 minicomputer, connected to the automata. (author) [fr

  2. Design and applications of Computed Industrial Tomographic Imaging System (CITIS)

    Ramakrishna, G S; Kumar, Umesh; Datta, S S [Bhabha Atomic Research Centre, Bombay (India). Isotope Div.


    This paper highlights the design and development of a prototype Computed Tomographic (CT) imaging system and its software for image reconstruction, simulation and display. It also describes results obtained with several test specimens including Dhruva reactor uranium fuel assembly and possibility of using neutrons as well as high energy x-rays in computed tomography. 5 refs., 4 figs.

  3. Integrating two spectral imaging systems in an automated mineralogy application

    Harris, D


    Full Text Available is treated in batches, with trays of mono-layered material presented to various imaging systems. The identification of target grains is achieved by means of spectral imaging in two wavelength bands (Visible, and Long Wave Infrared). Target grains...

  4. Robust algebraic image enhancement for intelligent control systems

    Lerner, Bao-Ting; Morrelli, Michael


    Robust vision capability for intelligent control systems has been an elusive goal in image processing. The computationally intensive techniques a necessary for conventional image processing make real-time applications, such as object tracking and collision avoidance difficult. In order to endow an intelligent control system with the needed vision robustness, an adequate image enhancement subsystem capable of compensating for the wide variety of real-world degradations, must exist between the image capturing and the object recognition subsystems. This enhancement stage must be adaptive and must operate with consistency in the presence of both statistical and shape-based noise. To deal with this problem, we have developed an innovative algebraic approach which provides a sound mathematical framework for image representation and manipulation. Our image model provides a natural platform from which to pursue dynamic scene analysis, and its incorporation into a vision system would serve as the front-end to an intelligent control system. We have developed a unique polynomial representation of gray level imagery and applied this representation to develop polynomial operators on complex gray level scenes. This approach is highly advantageous since polynomials can be manipulated very easily, and are readily understood, thus providing a very convenient environment for image processing. Our model presents a highly structured and compact algebraic representation of grey-level images which can be viewed as fuzzy sets.

  5. Nuclear magnetic resonance imaging of the central nervous system

    Knaap, M.S. van der; Valk, J.


    In this article a review is given of the use of magnetic resonance imaging for the central nervous system. An example of the screening of the population for multiple scelerosis is given. A good preliminary examination and the supply of relevant information to the person which performs the imaging is necessary. (R.B.). 9 figs.; 4 tabs

  6. Laboratory Characterization of an Imaging Reflectometer System

    Munsat, T.; Mazzucato, E.; Park, H.; Domier, C.W.; Luhmann, N.C. Jr.; Donne, A.J.H.; Pol, M. van de


    While microwave reflectometry has proven to be a sensitive tool for measuring electron density fluctuations in many circumstances, it has also been shown to have limited viability for core measurements and/or conditions of strong turbulence. To this end, a new instrument based on 2-D imaging reflectometry has been developed to measure density fluctuations over an extended plasma region in the TEXTOR tokamak. Laboratory characterization of this instrument has been performed using corrugated reflecting targets as an approximation to plasma reflections including 2-D turbulent fluctuations of various magnitude and poloidal wavenumber. Within this approximation, the imaging reflectometer can recover the spectral and spatial characteristics of the reflection layer lost to or otherwise inaccessible to conventional techniques

  7. An imaging system for a gamma camera

    Miller, D.W.; Gerber, M.S.


    A detailed description is given of a novel gamma camera which is designed to produce superior images than conventional cameras used in nuclear medicine. The detector consists of a solid state detector (e.g. germanium) which is formed to have a plurality of discrete components to enable 2-dimensional position identification. Details of the electronic processing circuits are given and the problems and limitations introduced by noise are discussed in full. (U.K.)

  8. Spectrally Adaptable Compressive Sensing Imaging System


    capture the hyperspectral scene. Several simulations and experimental measurements demonstrate the benefits of the new discretization model. 11...apertures are used sequentially to capture the hyperspectral scene. Several simulations and experimental measurements demonstrate the benefits of the new...with our DMD-SSI setup. Figure 5.22(a) shows the imaging target used in this experiment, which is a red chili pepper with a green stem. Figure 5.22(b

  9. Nuclear imaging of the skeletal system

    Yong Whee Bahk


    Bone scintigraphy is one of the most valuable nuclear imaging procedure, especially remarkable for its high sensitivity in disclosing bone metastasis of cancer long before radiographic demonstration. Bone scintigraphy is also useful in the diagnosis of covert fracture, occult trauma, bone contusion, early acute osteomyelitis, acute pyogenic arthritis and avascular bone necrosis. Measurements of bone clearance of radiopharmaceuticals, absorptiometry and quantitative bone scintigraphy are applied to the study of metabolic bone disorders such as osteoporosis and osteomalacia

  10. Nuclear imaging of the skeletal system

    Bahk, Yong Whee


    Bone scintigraphy is one of the most valuable nuclear imaging procedure, especially remarkable for its high sensitivity in disclosing bone metastasis of cancer long before radiographic demonstration. Bone scintigraphy is also useful in the diagnosis of covert fracture, occult trauma, bone contusion, early acute osteomyelitis, acute pyogenic arthritis and avascular bone necrosis. Measurements of bone clearance of radiopharmaceuticals, absorptiometry and quantitative bone scintigraphy are applied to the study of metabolic bone disorders such as osteoporosis and osteomalacia

  11. Fast imaging system on Tore Supra

    Geraud, A.; Salasca, S.; Verger, J. M.; Alarcon, T.; Agarici, G.; Bremond, S.; Chenevois, J. P.; Geynet, M.; Migozzi, J. B.; Reux, C.


    A new endoscope aiming at transferring the image of a poloidal section of the Tore Supra plasma to a fast camera able to record frames at a speed up to 4800 frames per second at full resolution, or much faster for a limited number of pixel, has been installed on Tore Supra. First movies showing the light emission associated to fast phenomena such as plasma start up, disruptions or gas and pellet injections have been produced.

  12. Establishing Information Security Systems via Optical Imaging


    SLM, spatial light modulator; BSC, non - polarizing beam splitter cube; CCD, charge-coupled device. In computational ghost imaging, a series of...Laser Object Computer Fig. 5. A schematic setup for the proposed method using holography: BSC, Beam splitter cube; CCD, Charge-coupled device. The...interference between reference and object beams . (a) (e) (d) (c) (b) Distribution Code A: Approved for public release, distribution is unlimited

  13. An adaptive optics imaging system designed for clinical use

    Zhang, Jie; Yang, Qiang; Saito, Kenichi; Nozato, Koji; Williams, David R.; Rossi, Ethan A.


    Here we demonstrate a new imaging system that addresses several major problems limiting the clinical utility of conventional adaptive optics scanning light ophthalmoscopy (AOSLO), including its small field of view (FOV), reliance on patient fixation for targeting imaging, and substantial post-processing time. We previously showed an efficient image based eye tracking method for real-time optical stabilization and image registration in AOSLO. However, in patients with poor fixation, eye motion causes the FOV to drift substantially, causing this approach to fail. We solve that problem here by tracking eye motion at multiple spatial scales simultaneously by optically and electronically integrating a wide FOV SLO (WFSLO) with an AOSLO. This multi-scale approach, implemented with fast tip/tilt mirrors, has a large stabilization range of ± 5.6°. Our method consists of three stages implemented in parallel: 1) coarse optical stabilization driven by a WFSLO image, 2) fine optical stabilization driven by an AOSLO image, and 3) sub-pixel digital registration of the AOSLO image. We evaluated system performance in normal eyes and diseased eyes with poor fixation. Residual image motion with incremental compensation after each stage was: 1) ~2–3 arc minutes, (arcmin) 2) ~0.5–0.8 arcmin and, 3) ~0.05–0.07 arcmin, for normal eyes. Performance in eyes with poor fixation was: 1) ~3–5 arcmin, 2) ~0.7–1.1 arcmin and 3) ~0.07–0.14 arcmin. We demonstrate that this system is capable of reducing image motion by a factor of ~400, on average. This new optical design provides additional benefits for clinical imaging, including a steering subsystem for AOSLO that can be guided by the WFSLO to target specific regions of interest such as retinal pathology and real-time averaging of registered images to eliminate image post-processing. PMID:26114033

  14. System for digitalization of medical images based on DICOM standard

    Čabarkapa Slobodan


    Full Text Available According to DICOM standard, which defines both medical image information and user information, a new system for digitalizing medical images is involved as a part of the main system for archiving and retrieving medical databases. The basic characteristics of this system are described in this paper. Furthermore, the analysis of some important DICOM header's tags which are used in this system, are presented, too. Having chosen the appropriate tags in order to preserve important information, the efficient system has been created. .

  15. ATR/OTR-SY Tank Camera Purge System and in Tank Color Video Imaging System

    Werry, S.M.


    This procedure will document the satisfactory operation of the 101-SY tank Camera Purge System (CPS) and 101-SY in tank Color Camera Video Imaging System (CCVIS). Included in the CPRS is the nitrogen purging system safety interlock which shuts down all the color video imaging system electronics within the 101-SY tank vapor space during loss of nitrogen purge pressure


    I. M. Gulis


    Full Text Available Instruments for spectral filtration of images are an important element of the systems used in remote sensing, medical diagnostics, in-process measurements. The aim of this study is analysis of the functional features and characteristics of the proposed two image monochromator versions which are based on dispersive spectral filtering. The first is based on the use of a dispersive monochromator, where collimating and camera lenses form a telescopic system, the dispersive element of which is within the intermediate image plane. The second version is based on an imaging double monochromator with dispersion subtraction by back propagation. For the telescopic system version, the spectral and spatial resolutions are estimated, the latter being limited by aberrations and diffraction from the entrance slit. The device has been numerically simulated and prototyped. It is shown that for the spectral bandwidth 10 nm (visible spectral range, the aberration-limited spot size is from 10–20 μm at the image center to about 30 μm at the image periphery for the image size 23–27 mm. The monochromator with dispersion subtraction enables one to vary the spectral resolution (up to 1 nm and higher by changing the intermediate slit width. But the distinctive feature is a significant change in the selected central wavelength over the image field. The considered designs of dispersive image monochromators look very promising due to the particular advantages over the systems based on tunable filters as regards the spectral resolution, fast tuning, and the spectral contrast. The monochromator based on a telescopic system has a simple design and a rather large image field but it also has a limited light throughput due to small aperture size. The monochromator with dispersion subtraction has higher light throughput, can provide high spectral resolution when recording a full data cube in a series of measuring acts for different dispersive element positions. 

  17. Agency Secure Image And Storage Tracking System (ASIST)

    US Agency for International Development — Agency Secure Image and Storage Tracking System (Missions): is a Documentum-based user interface developed and maintained by the USAID OCIO (formerly IRM) to improve...

  18. A Total Information Management System For All Medical Images

    Ouimette, Donald; Nudelman, Sol; Ramsby, Gale; Spackman, Thomas


    A PACS has been designed for the University of Connecticut Health Center to serve all departments acquiring images for diagnosis, surgery and therapy. It incorporates a multiple community communications architecture to provide complete information management for medical images, medical data and departmental administrative matter. The system is modular and expandable. It permits an initial installation for radiology and subsequent expansion to include other departments at the Health Center, beginning with internal medicine, surgery, ophthalmology and dentistry. The design permits sufficient expansion to offer the potential for accepting the additional burden of a hospital information system. Primary parameters that led to this system design were based on the anticipation that departments in time could achieve generating 60 to 90% of their images suited to insertion in a PACS, that a high network throughput for large block image transfers would be essen-tial and that total system reliability was fundamental to success.

  19. Data simulation for the Associated Particle Imaging system

    Tunnell, L.N.


    A data simulation procedure for the Associated Particle Imaging (API) system has been developed by postprocessing output from the Monte Carlo Neutron Photon (MCNP) code. This paper compares the simulated results to our experimental data

  20. Miniaturized Airborne Imaging Central Server System, Phase I

    National Aeronautics and Space Administration — The innovation is a miniaturized airborne imaging central server system (MAICSS). MAICSS is designed as a high-performance-computer-based electronic backend that...

  1. Miniaturized Airborne Imaging Central Server System, Phase II

    National Aeronautics and Space Administration — The innovation is a miniaturized airborne imaging central server system (MAICSS). MAICSS is designed as a high-performance computer-based electronic backend that...

  2. Robustness of an artificially tailored fisheye imaging system with a curvilinear image surface

    Lee, Gil Ju; Nam, Won Il; Song, Young Min


    Curved image sensors inspired by animal and insect eyes have provided a new development direction in next-generation digital cameras. It is known that natural fish eyes afford an extremely wide field of view (FOV) imaging due to the geometrical properties of the spherical lens and hemispherical retina. However, its inherent drawbacks, such as the low off-axis illumination and the fabrication difficulty of a 'dome-like' hemispherical imager, limit the development of bio-inspired wide FOV cameras. Here, a new type of fisheye imaging system is introduced that has simple lens configurations with a curvilinear image surface, while maintaining high off-axis illumination and a wide FOV. Moreover, through comparisons with commercial conventional fisheye designs, it is determined that the volume and required number of optical elements of the proposed design is practical while capturing the fundamental optical performances. Detailed design guidelines for tailoring the proposed optic system are also discussed.

  3. Suppression of fixed pattern noise for infrared image system

    Park, Changhan; Han, Jungsoo; Bae, Kyung-Hoon


    In this paper, we propose suppression of fixed pattern noise (FPN) and compensation of soft defect for improvement of object tracking in cooled staring infrared focal plane array (IRFPA) imaging system. FPN appears an observable image which applies to non-uniformity compensation (NUC) by temperature. Soft defect appears glittering black and white point by characteristics of non-uniformity for IR detector by time. This problem is very important because it happen serious problem for object tracking as well as degradation for image quality. Signal processing architecture in cooled staring IRFPA imaging system consists of three tables: low, normal, high temperature for reference gain and offset values. Proposed method operates two offset tables for each table. This is method which operates six term of temperature on the whole. Proposed method of soft defect compensation consists of three stages: (1) separates sub-image for an image, (2) decides a motion distribution of object between each sub-image, (3) analyzes for statistical characteristic from each stationary fixed pixel. Based on experimental results, the proposed method shows an improved image which suppresses FPN by change of temperature distribution from an observational image in real-time.

  4. The Use of QBIC Content-Based Image Retrieval System

    Ching-Yi Wu


    Full Text Available The fast increase in digital images has caught increasing attention on the development of image retrieval technologies. Content-based image retrieval (CBIR has become an important approach in retrieving image data from a large collection. This article reports our results on the use and users study of a CBIR system. Thirty-eight students majored in art and design were invited to use the IBM’s OBIC (Query by Image Content system through the Internet. Data from their information needs, behaviors, and retrieval strategies were collected through an in-depth interview, observation, and self-described think-aloud process. Important conclusions are:(1)There are four types of information needs for image data: implicit, inspirational, ever-changing, and purposive. The types of needs may change during the retrieval process. (2)CBIR is suitable for the example-type query, text retrieval is suitable for the scenario-type query, and image browsing is suitable for the symbolic query. (3)Different from text retrieval, detailed description of the query condition may lead to retrieval failure more easily. (4)CBIR is suitable for the domain-specific image collection, not for the images on the Word-Wide Web.[Article content in Chinese

  5. A real time S-parameter imaging system

    Naik, P.S.; Cheung, C.K.; Beling, C.D.; Fung, S.


    Obtaining a lateral S-parameter image scan from positrons implanted into semiconductor devices can be a helpful research tool both for localizing device structures and in diagnosing defect patterns that could help interpret function. S-parameter images can be obtained by electromagnetically rastering a variable energy positron beam of small spot size across the sample. Here we describe a general hardware and software architecture of relatively low cost that has recently been developed in our laboratory which allows the whole sub-surface S-parameter image of a sample or device to be obtained in real time. This system has the advantage over more conventional sequential scanning techniques of allowing the operator to terminate data collection once the quality of the image is deemed sufficient. As an example of the usefulness of this type of imaging architecture, S-parameter images of a representative sample are presented at two different position implantation energies. (author)

  6. Systematic Calibration for a Backpacked Spherical Photogrammetry Imaging System

    Rau, J. Y.; Su, B. W.; Hsiao, K. W.; Jhan, J. P.


    A spherical camera can observe the environment for almost 720 degrees' field of view in one shoot, which is useful for augmented reality, environment documentation, or mobile mapping applications. This paper aims to develop a spherical photogrammetry imaging system for the purpose of 3D measurement through a backpacked mobile mapping system (MMS). The used equipment contains a Ladybug-5 spherical camera, a tactical grade positioning and orientation system (POS), i.e. SPAN-CPT, and an odometer, etc. This research aims to directly apply photogrammetric space intersection technique for 3D mapping from a spherical image stereo-pair. For this purpose, several systematic calibration procedures are required, including lens distortion calibration, relative orientation calibration, boresight calibration for direct georeferencing, and spherical image calibration. The lens distortion is serious on the ladybug-5 camera's original 6 images. Meanwhile, for spherical image mosaicking from these original 6 images, we propose the use of their relative orientation and correct their lens distortion at the same time. However, the constructed spherical image still contains systematic error, which will reduce the 3D measurement accuracy. Later for direct georeferencing purpose, we need to establish a ground control field for boresight/lever-arm calibration. Then, we can apply the calibrated parameters to obtain the exterior orientation parameters (EOPs) of all spherical images. In the end, the 3D positioning accuracy after space intersection will be evaluated, including EOPs obtained by structure from motion method.

  7. The Omega Ring Imaging Cerenkov Detector readout system user's guide

    Hallewell, G.


    The manual describes the electronic readout system of the Ring Imaging Cerenkov Detector at the CERN Omega Spectrometer. The system is described in its configuration of September 1984 after the Rich readout system had been used in two Omega experiments. (U.K.)

  8. A single-image method of aberration retrieval for imaging systems under partially coherent illumination

    Xu, Shuang; Liu, Shiyuan; Zhang, Chuanwei; Wei, Haiqing


    We propose a method for retrieving small lens aberrations in optical imaging systems under partially coherent illumination, which only requires to measure one single defocused image of intensity. By deriving a linear theory of imaging systems, we obtain a generalized formulation of aberration sensitivity in a matrix form, which provides a set of analytic kernels that relate the measured intensity distribution directly to the unknown Zernike coefficients. Sensitivity analysis is performed and test patterns are optimized to ensure well-posedness of the inverse problem. Optical lithography simulations have validated the theoretical derivation and confirmed its simplicity and superior performance in retrieving small lens aberrations. (fast track communication)

  9. Iodine filter imaging system for subtraction angiography using synchrotron radiation

    Umetani, K.; Ueda, K.; Takeda, T.; Itai, Y.; Akisada, M.; Nakajima, T.


    A new type of real-time imaging system was developed for transvenous coronary angiography. A combination of an iodine filter and a single energy broad-bandwidth X-ray produces two-energy images for the iodine K-edge subtraction technique. X-ray images are sequentially converted to visible images by an X-ray image intensifier. By synchronizing the timing of the movement of the iodine filter into and out of the X-ray beam, two output images of the image intensifier are focused side by side on the photoconductive layer of a camera tube by an oscillating mirror. Both images are read out by electron beam scanning of a 1050-scanning-line video camera within a camera frame time of 66.7 ms. One hundred ninety two pairs of iodine-filtered and non-iodine-filtered images are stored in the frame memory at a rate of 15 pairs/s. In vivo subtracted images of coronary arteries in dogs were obtained in the form of motion pictures.

  10. Real-Time Implementation of Medical Ultrasound Strain Imaging System

    Jeong, Mok Kun; Kwon, Sung Jae; Bae, Moo Ho


    Strain imaging in a medical ultrasound imaging system can differentiate the cancer or tumor in a lesion that is stiffer than the surrounding tissue. In this paper, a strain imaging technique using quasistatic compression is implemented that estimates the displacement between pre- and postcompression ultrasound echoes and obtains strain by differentiating it in the spatial direction. Displacements are computed from the phase difference of complex baseband signals obtained using their autocorrelation, and errors associated with converting the phase difference into time or distance are compensated for by taking into the center frequency variation. Also, to reduce the effect of operator's hand motion, the displacements of all scanlines are normalized with the result that satisfactory strain image quality has been obtained. These techniques have been incorporated into implementing a medical ultrasound strain imaging system that operates in real time.

  11. DIANE stationary neutron radiography system image quality and industrial applications

    Cluzeau, S.; Huet, J.; Tourneur, P. le


    The SODERN neutron radiography laboratory has operated since February 1993 using a sealed tube generator (GENIE 46). An experimental programme of characterization (dosimetry, spectroscopy) has confirmed the expected performances concerning: neutron flux intensity, neutron energy range, residual gamma flux. Results are given in a specific report [2]. This paper is devoted to the image performance reporting. ASTM and specific indicators have been used to test the image quality with various converters and films. The corresponding modulation transfer functions are to be determined from image processing. Some industrial applications have demonstrated the capabilities of the system: corrosion detection in aircraft parts, ammunitions filling testing, detection of polymer lacks in sandwich steel sheets, detection of moisture in a probe for geophysics, residual ceramic cores imaging in turbine blades. Various computerized electronic imaging systems will be tested to improve the industrial capabilities. (orig.)

  12. pyBSM: A Python package for modeling imaging systems

    LeMaster, Daniel A.; Eismann, Michael T.


    There are components that are common to all electro-optical and infrared imaging system performance models. The purpose of the Python Based Sensor Model (pyBSM) is to provide open source access to these functions for other researchers to build upon. Specifically, pyBSM implements much of the capability found in the ERIM Image Based Sensor Model (IBSM) V2.0 along with some improvements. The paper also includes two use-case examples. First, performance of an airborne imaging system is modeled using the General Image Quality Equation (GIQE). The results are then decomposed into factors affecting noise and resolution. Second, pyBSM is paired with openCV to evaluate performance of an algorithm used to detect objects in an image.

  13. Physical image quality of computed radiography in mammography system

    Norriza Mohd Isa; Muhammad Jamal Isa; Wan Muhamad Saridan Wan Hassan; Fatimah Othman


    Full-text: Mammography is a screening procedure that mostly used for early detection of breast cancer. In digital imaging system, Computed Radiography is a cost-effective technology that applied indirect conversion detector. The paper presents physical image quality parameter measurements namely modulation transfer function (MTF), normalized noise power spectrum (NNPS) and detective quantum efficiency (DQE) of Computed Radiography in mammography system. MTF was calculated from two different orientations of slanted images of an edge test device and NNPS was estimated using flat-field image. Both images were acquired using a standard mammography beam quality. DQE was determined by applying the MTF and NNPS values into our developed software program. Both orientations have similar DQE characteristics. (author)

  14. Image acquisition system using on sensor compressed sampling technique

    Gupta, Pravir Singh; Choi, Gwan Seong


    Advances in CMOS technology have made high-resolution image sensors possible. These image sensors pose significant challenges in terms of the amount of raw data generated, energy efficiency, and frame rate. This paper presents a design methodology for an imaging system and a simplified image sensor pixel design to be used in the system so that the compressed sensing (CS) technique can be implemented easily at the sensor level. This results in significant energy savings as it not only cuts the raw data rate but also reduces transistor count per pixel; decreases pixel size; increases fill factor; simplifies analog-to-digital converter, JPEG encoder, and JPEG decoder design; decreases wiring; and reduces the decoder size by half. Thus, CS has the potential to increase the resolution of image sensors for a given technology and die size while significantly decreasing the power consumption and design complexity. We show that it has potential to reduce power consumption by about 23% to 65%.

  15. Variable code gamma ray imaging system

    Macovski, A.; Rosenfeld, D.


    A gamma-ray source distribution in the body is imaged onto a detector using an array of apertures. The transmission of each aperture is modulated using a code such that the individual views of the source through each aperture can be decoded and separated. The codes are chosen to maximize the signal to noise ratio for each source distribution. These codes determine the photon collection efficiency of the aperture array. Planar arrays are used for volumetric reconstructions and circular arrays for cross-sectional reconstructions. 14 claims

  16. X-ray spectral decomposition imaging system


    Projection measurements are made of the transmitted X-ray beam in low and high energy regions. These are combined in a non-linear processor to produce atomic-number-dependent and density-dependent projection information. This information is used to provide cross-sectional images which are free of spectral-shift artifacts and completely define the specific material properties. The invention described herein was made in the course of work under a grant from the Department of Health, Education, and Welfare.

  17. [A computer-aided image diagnosis and study system].

    Li, Zhangyong; Xie, Zhengxiang


    The revolution in information processing, particularly the digitizing of medicine, has changed the medical study, work and management. This paper reports a method to design a system for computer-aided image diagnosis and study. Combined with some good idea of graph-text system and picture archives communicate system (PACS), the system was realized and used for "prescription through computer", "managing images" and "reading images under computer and helping the diagnosis". Also typical examples were constructed in a database and used to teach the beginners. The system was developed by the visual developing tools based on object oriented programming (OOP) and was carried into operation on the Windows 9X platform. The system possesses friendly man-machine interface.

  18. New real-time image processing system for IRFPA

    WANG Bing-jian; LIU Shang-qian; CHENG Yu-bao


    Influenced by detectors' material,manufacturing technology etc,every detector in infrared focal plane array (IRFPA) will output different voltages even if their input radiation flux is the same.And this is called non-uniformity of IRFPA.At the same time,the high background temperature,low temperature difference between targets and background and the low responsivity of IRFPA result in low contrast of infrared images.So non-uniformity correction and image enhancement are important techniques for IRFPA imaging system.This paper proposes a new real-time infrared image processing system based on Field Programmable Gate Array(FPGA).The system implements non-uniformity correction,image enhancement and video synthesization etc.By using parallel architecture and pipeline technique,the system processing speed is as high as 50Mx12bits per second.It is appropriate greatly to a large IRFPA and a high frame frequency IRFPA imaging system.The system is miniatured in one FPGA.

  19. Microwave Breast Imaging System Prototype with Integrated Numerical Characterization

    Mark Haynes


    Full Text Available The increasing number of experimental microwave breast imaging systems and the need to properly model them have motivated our development of an integrated numerical characterization technique. We use Ansoft HFSS and a formalism we developed previously to numerically characterize an S-parameter- based breast imaging system and link it to an inverse scattering algorithm. We show successful reconstructions of simple test objects using synthetic and experimental data. We demonstrate the sensitivity of image reconstructions to knowledge of the background dielectric properties and show the limits of the current model.

  20. Medical image information system 2001. Development of the medical image information system to risk management- Medical exposure management

    Kuranishi, Makoto; Kumagai, Michitomo; Shintani, Mitsuo


    This paper discusses the methods and systems for optimizing the following supplements 10 and 17 for national health and medical care. The supplements 10 and 17 of DICOM (digital imaging and communications in medicine) system, which is now under progress for the purpose to keep compatibility within medical image information system as an international standard, are important for making the cooperation between HIS (hospital information system)/RIS (radiation information system) and modality (imaging instruments). Supplement 10 concerns the system to send the information of patients and their orders through HIS/RIS to modality and 17, the information of modality performed procedure step (MPPS) to HIS/RIS. The latter defines to document patients' exposure, a part of which has not been recognized in Japan. Thus the medical information system can be useful for risk-management of medical exposure in future. (K.H.)

  1. Medical image information system 2001. Development of the medical image information system to risk management- Medical exposure management

    Kuranishi, Makoto; Kumagai, Michitomo; Shintani, Mitsuo [Toyama Medical and Pharmaceutical Univ. (Japan). Hospital


    This paper discusses the methods and systems for optimizing the following supplements 10 and 17 for national health and medical care. The supplements 10 and 17 of DICOM (digital imaging and communications in medicine) system, which is now under progress for the purpose to keep compatibility within medical image information system as an international standard, are important for making the cooperation between HIS (hospital information system)/RIS (radiation information system) and modality (imaging instruments). Supplement 10 concerns the system to send the information of patients and their orders through HIS/RIS to modality and 17, the information of modality performed procedure step (MPPS) to HIS/RIS. The latter defines to document patients' exposure, a part of which has not been recognized in Japan. Thus the medical information system can be useful for risk-management of medical exposure in future. (K.H.)

  2. Image-guided stereotactic surgery using ultrasonography and reconstructive three-dimensional CT-imaging system

    Kawamura, Hirotsune; Iseki, Hiroshi; Umezawa, Yoshihiro


    A new simulation and navigation system utilizing three-dimensional CT images has been developed for image-guided stereotactic surgery. Preoperative CT images are not always useful in predicting the intraoperative location of lesions, for cerebral lesions are easily displaced or distorted by gravity, brain retraction, and/or CSF aspiration during operative procedure. This new system, however, has the advantage that the intraoperative locations of intracranial lesions or the anatomical structures of the brain can be precisely confirmed during stereotactic surgery. Serial CT images were obtained from a patient whose head had been fixed to the ISEKI CT-guided stereotactic frame. The data of serial CT images were saved on a floppy disc and then transferred to the work station (IRIS) using the off line. In order to find the best approach angle for ultrasound-guided stereotactic surgery, three-dimenstional CT images were reconstructed using the work station. The site of the craniotomy or the angle of the trajectory of the ultrasound probe was measured preoperatively based on the three-dimensional CT images. Then, in the operating room, the patient's head was fixed to the ISEKI frame with the subframe at the same position as before according to the measurement of the CT images. In a case of cystic glioma, the predicable ultrasonograms from three-dimensional reconstructive CT images were ascertained to correspond well to the actual ultrasound images during ultrasound-guided stereotactic surgery. Therefore, the new simulation and navigation system can be judged to be a powerful operative supporting modality for correcting the locations of cerebral lesions; it allows one to perform stereotactic surgery more accurately and less invasively. (author)

  3. Integrating a FISH imaging system into the cytology laboratory

    Denice Smith G


    Full Text Available We have implemented an interactive imaging system for the interpretation of UroVysion fluorescence in situ hybridization (FISH to improve throughput, productivity, quality control and diagnostic accuracy. We describe the Duet imaging system, our experiences with implementation, and outline the financial investment, space requirements, information technology needs, validation, and training of cytotechnologists needed to integrate such a system into a cytology laboratory. Before purchasing the imaging system, we evaluated and validated the instrument at our facility. Implementation required slide preparation changes, IT modifications, development of training programs, and revision of job descriptions for cytotechnologists. A darkened room was built to house the automated scanning station and microscope, as well as two imaging stations. IT changes included generation of storage for archival images on the LAN, addition of external hard drives for back-up, and changes to cable connections for communication between remote locations. Training programs for cytotechnologists, and pathologists/fellows/residents were developed, and cytotechnologists were integrated into multiple steps of the process. The imaging system has resulted in increased productivity for pathologists, concomitant with an expanded role of cytotechnologists in multiple critical steps, including FISH, scan setup, reclassification, and initial interpretation.

  4. A Time of Flight Fast Neutron Imaging System Design Study

    Canion, Bonnie; Glenn, Andrew; Sheets, Steven; Wurtz, Ron; Nakae, Les; Hausladen, Paul; McConchie, Seth; Blackston, Matthew; Fabris, Lorenzo; Newby, Jason


    LLNL and ORNL are designing an active/passive fast neutron imaging system that is flexible to non-ideal detector positioning. It is often not possible to move an inspection object in fieldable imager applications such as safeguards, arms control treaty verification, and emergency response. Particularly, we are interested in scenarios which inspectors do not have access to all sides of an inspection object, due to interfering objects or walls. This paper will present the results of a simulation-based design parameter study, that will determine the optimum system design parameters for a fieldable system to perform time-of-flight based imaging analysis. The imaging analysis is based on the use of an associated particle imaging deuterium-tritium (API DT) neutron generator to get the time-of-flight of radiation induced within an inspection object. This design study will investigate the optimum design parameters for such a system (e.g. detector size, ideal placement, etc.), as well as the upper and lower feasible design parameters that the system can expect to provide results within a reasonable amount of time (e.g. minimum/maximum detector efficiency, detector standoff, etc.). Ideally the final prototype from this project will be capable of using full-access techniques, such as transmission imaging, when the measurement circumstances allow, but with the additional capability of producing results at reduced accessibility.

  5. Intelligent MRTD testing for thermal imaging system using ANN

    Sun, Junyue; Ma, Dongmei


    The Minimum Resolvable Temperature Difference (MRTD) is the most widely accepted figure for describing the performance of a thermal imaging system. Many models have been proposed to predict it. The MRTD testing is a psychophysical task, for which biases are unavoidable. It requires laboratory conditions such as normal air condition and a constant temperature. It also needs expensive measuring equipments and takes a considerable period of time. Especially when measuring imagers of the same type, the test is time consuming. So an automated and intelligent measurement method should be discussed. This paper adopts the concept of automated MRTD testing using boundary contour system and fuzzy ARTMAP, but uses different methods. It describes an Automated MRTD Testing procedure basing on Back-Propagation Network. Firstly, we use frame grabber to capture the 4-bar target image data. Then according to image gray scale, we segment the image to get 4-bar place and extract feature vector representing the image characteristic and human detection ability. These feature sets, along with known target visibility, are used to train the ANN (Artificial Neural Networks). Actually it is a nonlinear classification (of input dimensions) of the image series using ANN. Our task is to justify if image is resolvable or uncertainty. Then the trained ANN will emulate observer performance in determining MRTD. This method can reduce the uncertainties between observers and long time dependent factors by standardization. This paper will introduce the feature extraction algorithm, demonstrate the feasibility of the whole process and give the accuracy of MRTD measurement.

  6. Symmetries of the 2D magnetic particle imaging system matrix

    Weber, A; Knopp, T


    In magnetic particle imaging (MPI), the relation between the particle distribution and the measurement signal can be described by a linear system of equations. For 1D imaging, it can be shown that the system matrix can be expressed as a product of a convolution matrix and a Chebyshev transformation matrix. For multidimensional imaging, the structure of the MPI system matrix is not yet fully explored as the sampling trajectory complicates the physical model. It has been experimentally found that the MPI system matrix rows have symmetries and look similar to the tensor products of Chebyshev polynomials. In this work we will mathematically prove that the 2D MPI system matrix has symmetries that can be used for matrix compression. (paper)

  7. RANZCR Body Systems Framework of diagnostic imaging examination descriptors.

    Pitman, Alexander G; Penlington, Lisa; Doromal, Darren; Slater, Gregory; Vukolova, Natalia


    A unified and logical system of descriptors for diagnostic imaging examinations and procedures is a desirable resource for radiology in Australia and New Zealand and is needed to support core activities of RANZCR. Existing descriptor systems available in Australia and New Zealand (including the Medicare DIST and the ACC Schedule) have significant limitations and are inappropriate for broader clinical application. An anatomically based grid was constructed, with anatomical structures arranged in rows and diagnostic imaging modalities arranged in columns (including nuclear medicine and positron emission tomography). The grid was segregated into five body systems. The cells at the intersection of an anatomical structure row and an imaging modality column were populated with short, formulaic descriptors of the applicable diagnostic imaging examinations. Clinically illogical or physically impossible combinations were 'greyed out'. Where the same examination applied to different anatomical structures, the descriptor was kept identical for the purposes of streamlining. The resulting Body Systems Framework of diagnostic imaging examination descriptors lists all the reasonably common diagnostic imaging examinations currently performed in Australia and New Zealand using a unified grid structure allowing navigation by both referrers and radiologists. The Framework has been placed on the RANZCR website and is available for access free of charge by registered users. The Body Systems Framework of diagnostic imaging examination descriptors is a system of descriptors based on relationships between anatomical structures and imaging modalities. The Framework is now available as a resource and reference point for the radiology profession and to support core College activities. © 2014 The Royal Australian and New Zealand College of Radiologists.

  8. A new optical encryption system for image transformation

    Yao, Shuyu; Chen, Linfei; Chang, Guojun; He, Bingyu


    This paper introduces a new optical image encryption system based on Fresnel diffraction and phase iterative algorithm, which can realize the conversion between different images. The method is based on the optical system of free space transmission, and uses the iterative phase retrieval algorithm to encode an image into two phase masks and a ciphertext. Unlike the existed methods, the ciphertext is a visible image, which can be used to achieve the conversion of one image to another image. In order to enhance the security, two phase masks are combined into a wide-scale phase mask by the double image cross pixel scrambling approach. In the decryption process, the wide-scale phase mask is re-decrypted into two random phase masks using a random shift matrix. The ciphertext and the first phase mask are placed on the input plane and the second random phase mask is placed on the transformation plane. The Fresnel diffraction principle can be used to obtain the plaintext information on the output plane. Theoretical analysis and simulation results show that the encryption system is feasible and quite safe.

  9. A Wildlife Monitoring System Based on Wireless Image Sensor Networks

    Junguo Zhang


    Full Text Available Survival and development of wildlife sustains the balance and stability of the entire ecosystem. Wildlife monitoring can provide lots of information such as wildlife species, quantity, habits, quality of life and habitat conditions, to help researchers grasp the status and dynamics of wildlife resources, and to provide basis for the effective protection, sustainable use, and scientific management of wildlife resources. Wildlife monitoring is the foundation of wildlife protection and management. Wireless Sensor Networks (WSN technology has become the most popular technology in the field of information. With advance of the CMOS image sensor technology, wireless sensor networks combined with image sensors, namely Wireless Image Sensor Networks (WISN technology, has emerged as an alternative in monitoring applications. Monitoring wildlife is one of its most promising applications. In this paper, system architecture of the wildlife monitoring system based on the wireless image sensor networks was presented to overcome the shortcomings of the traditional monitoring methods. Specifically, some key issues including design of wireless image sensor nodes and software process design have been studied and presented. A self-powered rotatable wireless infrared image sensor node based on ARM and an aggregation node designed for large amounts of data were developed. In addition, their corresponding software was designed. The proposed system is able to monitor wildlife accurately, automatically, and remotely in all-weather condition, which lays foundations for applications of wireless image sensor networks in wildlife monitoring.

  10. Using a web-based image quality assurance reporting system to improve image quality.

    Czuczman, Gregory J; Pomerantz, Stuart R; Alkasab, Tarik K; Huang, Ambrose J


    The purpose of this study is to show the impact of a web-based image quality assurance reporting system on the rates of three common image quality errors at our institution. A web-based image quality assurance reporting system was developed and used beginning in April 2009. Image quality endpoints were assessed immediately before deployment (period 1), approximately 18 months after deployment of a prototype reporting system (period 2), and approximately 12 months after deployment of a subsequent upgraded department-wide reporting system (period 3). A total of 3067 axillary shoulder radiographs were reviewed for correct orientation, 355 shoulder CT scans were reviewed for correct reformatting of coronal and sagittal images, and 346 sacral MRI scans were reviewed for correct acquisition plane of axial images. Error rates for each review period were calculated and compared using the Fisher exact test. Error rates of axillary shoulder radiograph orientation were 35.9%, 7.2%, and 10.0%, respectively, for the three review periods. The decrease in error rate between periods 1 and 2 was statistically significant (p < 0.0001). Error rates of shoulder CT reformats were 9.8%, 2.7%, and 5.8%, respectively, for the three review periods. The decrease in error rate between periods 1 and 2 was statistically significant (p = 0.03). Error rates for sacral MRI axial sequences were 96.5%, 32.5%, and 3.4%, respectively, for the three review periods. The decrease in error rates between periods 1 and 2 and between periods 2 and 3 was statistically significant (p < 0.0001). A web-based system for reporting image quality errors may be effective for improving image quality.

  11. An integrated multimodality image-guided robot system for small-animal imaging research

    Hsu, Wen-Lin; Hsin Wu, Tung; Hsu, Shih-Ming; Chen, Chia-Lin; Lee, Jason J.S.; Huang, Yung-Hui


    We design and construct an image-guided robot system for use in small-animal imaging research. This device allows the use of co-registered small-animal PET-MRI images to guide the movements of robotic controllers, which will accurately place a needle probe at any predetermined location inside, for example, a mouse tumor, for biological readouts without sacrificing the animal. This system is composed of three major components: an automated robot device, a CCD monitoring mechanism, and a multimodality registration implementation. Specifically, the CCD monitoring mechanism was used for correction and validation of the robot device. To demonstrate the value of the proposed system, we performed a tumor hypoxia study that involved FMISO small-animal PET imaging and the delivering of a pO 2 probe into the mouse tumor using the image-guided robot system. During our evaluation, the needle positioning error was found to be within 0.153±0.042 mm of desired placement; the phantom simulation errors were within 0.693±0.128 mm. In small-animal studies, the pO 2 probe measurements in the corresponding hypoxia areas showed good correlation with significant, low tissue oxygen tensions (less than 6 mmHg). We have confirmed the feasibility of the system and successfully applied it to small-animal investigations. The system could be easily adapted to extend to other biomedical investigations in the future.

  12. Nondestructive Imaging of an Object Using the Compact Continuous-Wave Sub-Terahertz Imaging System

    Jang, Jin Seok; Kwon, Il Bub; Yoon, Dong Jin; Seo, Dae Cheol [Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of)


    This paper presented compact CW sub-THz imaging system using the terahertz transmitter(Tx) that generating 0.34 THz electromagnetic wave on based electronic device. Using 0.34 THz electromagnetic wave generated by Tx, we transmitted to sample by point by point scan method and measured transmitting terahertz wave magnitude and phase information respectively with terahertz receiver(Rx) based on sub harmonic mixer. This paper measured and compared images of several samples to obtain better imaging results by changing time delay and step distance of scanning stage which affect image resolution. Also, through the imaging measurement of various samples, we were able to assure possibility of application of terahertz wave

  13. Nondestructive Imaging of an Object Using the Compact Continuous-Wave Sub-Terahertz Imaging System

    Jang, Jin Seok; Kwon, Il Bub; Yoon, Dong Jin; Seo, Dae Cheol


    This paper presented compact CW sub-THz imaging system using the terahertz transmitter(Tx) that generating 0.34 THz electromagnetic wave on based electronic device. Using 0.34 THz electromagnetic wave generated by Tx, we transmitted to sample by point by point scan method and measured transmitting terahertz wave magnitude and phase information respectively with terahertz receiver(Rx) based on sub harmonic mixer. This paper measured and compared images of several samples to obtain better imaging results by changing time delay and step distance of scanning stage which affect image resolution. Also, through the imaging measurement of various samples, we were able to assure possibility of application of terahertz wave

  14. Thermoluminescence dosimetry in quality imaging in CR mammography systems

    Gaona, E.; Franco E, J.G. [UAM-Xochimilco, 04960 Mexico D.F. (Mexico); Azorin N, J. [UAM-Iztapalapa, 09340 Mexico D.F. (Mexico); Diaz G, J.A.I. [CICATA, Unidad Legaria, Av. Legaria 694, 11599 mexico D.F. (Mexico); Arreola, M. [Department of Radiology, Shands Hospital at UF, PO Box 100374, Gainesville, FL 32610-0374 (United States)


    The aim of this work is to estimate the average glandular dose with Thermoluminescence Dosimetry (TLD) and comparison with quality imaging in CR mammography. For measuring dose, FDA and ACR use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, Full Field Digital Mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one CR mammography system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium fluoro halide. We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated x-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose that overcomes 3.0 mGy and it doesn't improve the image quality and dose to the breast will be excessive. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement. (Author)

  15. Real-Time Imaging System for the OpenPET

    Tashima, Hideaki; Yoshida, Eiji; Kinouchi, Shoko; Nishikido, Fumihiko; Inadama, Naoko; Murayama, Hideo; Suga, Mikio; Haneishi, Hideaki; Yamaya, Taiga


    The OpenPET and its real-time imaging capability have great potential for real-time tumor tracking in medical procedures such as biopsy and radiation therapy. For the real-time imaging system, we intend to use the one-pass list-mode dynamic row-action maximum likelihood algorithm (DRAMA) and implement it using general-purpose computing on graphics processing units (GPGPU) techniques. However, it is difficult to make consistent reconstructions in real-time because the amount of list-mode data acquired in PET scans may be large depending on the level of radioactivity, and the reconstruction speed depends on the amount of the list-mode data. In this study, we developed a system to control the data used in the reconstruction step while retaining quantitative performance. In the proposed system, the data transfer control system limits the event counts to be used in the reconstruction step according to the reconstruction speed, and the reconstructed images are properly intensified by using the ratio of the used counts to the total counts. We implemented the system on a small OpenPET prototype system and evaluated the performance in terms of the real-time tracking ability by displaying reconstructed images in which the intensity was compensated. The intensity of the displayed images correlated properly with the original count rate and a frame rate of 2 frames per second was achieved with average delay time of 2.1 s.

  16. Thermoluminescence dosimetry in quality imaging in CR mammography systems

    Gaona, E.; Franco E, J.G.; Azorin N, J.; Diaz G, J.A.I.; Arreola, M.


    The aim of this work is to estimate the average glandular dose with Thermoluminescence Dosimetry (TLD) and comparison with quality imaging in CR mammography. For measuring dose, FDA and ACR use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, Full Field Digital Mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one CR mammography system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium fluoro halide. We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated x-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose that overcomes 3.0 mGy and it doesn't improve the image quality and dose to the breast will be excessive. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement. (Author)

  17. A proposed intracortical visual prosthesis image processing system.

    Srivastava, N R; Troyk, P


    It has been a goal of neuroprosthesis researchers to develop a system, which could provide artifical vision to a large population of individuals with blindness. It has been demonstrated by earlier researches that stimulating the visual cortex area electrically can evoke spatial visual percepts, i.e. phosphenes. The goal of visual cortex prosthesis is to stimulate the visual cortex area and generate a visual perception in real time to restore vision. Even though the normal working of the visual system is not been completely understood, the existing knowledge has inspired research groups to develop strategies to develop visual cortex prosthesis which can help blind patients in their daily activities. A major limitation in this work is the development of an image proceessing system for converting an electronic image, as captured by a camera, into a real-time data stream for stimulation of the implanted electrodes. This paper proposes a system, which will capture the image using a camera and use a dedicated hardware real time image processor to deliver electrical pulses to intracortical electrodes. This system has to be flexible enough to adapt to individual patients and to various strategies of image reconstruction. Here we consider a preliminary architecture for this system.

  18. Modeling the National Ignition Facility neutron imaging system.

    Wilson, D C; Grim, G P; Tregillis, I L; Wilke, M D; Patel, M V; Sepke, S M; Morgan, G L; Hatarik, R; Loomis, E N; Wilde, C H; Oertel, J A; Fatherley, V E; Clark, D D; Fittinghoff, D N; Bower, D E; Schmitt, M J; Marinak, M M; Munro, D H; Merrill, F E; Moran, M J; Wang, T-S F; Danly, C R; Hilko, R A; Batha, S H; Frank, M; Buckles, R


    Numerical modeling of the neutron imaging system for the National Ignition Facility (NIF), forward from calculated target neutron emission to a camera image, will guide both the reduction of data and the future development of the system. Located 28 m from target chamber center, the system can produce two images at different neutron energies by gating on neutron arrival time. The brighter image, using neutrons near 14 MeV, reflects the size and symmetry of the implosion "hot spot." A second image in scattered neutrons, 10-12 MeV, reflects the size and symmetry of colder, denser fuel, but with only ∼1%-7% of the neutrons. A misalignment of the pinhole assembly up to ±175 μm is covered by a set of 37 subapertures with different pointings. The model includes the variability of the pinhole point spread function across the field of view. Omega experiments provided absolute calibration, scintillator spatial broadening, and the level of residual light in the down-scattered image from the primary neutrons. Application of the model to light decay measurements of EJ399, BC422, BCF99-55, Xylene, DPAC-30, and Liquid A suggests that DPAC-30 and Liquid A would be preferred over the BCF99-55 scintillator chosen for the first NIF system, if they could be fabricated into detectors with sufficient resolution.

  19. Dynamic Raman imaging system with high spatial and temporal resolution

    Wang, Lei; Dai, Yinzhen; He, Hao; Lv, Ruiqi; Zong, Cheng; Ren, Bin


    There is an increasing need to study dynamic changing systems with significantly high spatial and temporal resolutions. In this work, we integrated point-scanning, line-scanning, and wide-field Raman imaging techniques into a single system. By using an Electron Multiplying CCD (EMCCD) with a high gain and high frame rate, we significantly reduced the time required for wide-field imaging, making it possible to monitor the electrochemical reactions in situ. The highest frame rate of EMCDD was ˜50 fps, and the Raman images for a specific Raman peak can be obtained by passing the signal from the sample through the Liquid Crystal Tunable Filter. The spatial resolutions of scanning imaging and wide-field imaging with a 100× objective (NA = 0.9) are 0.5 × 0.5 μm2 and 0.36 × 0.36 μm2, respectively. The system was used to study the surface plasmon resonance of Au nanorods, the surface-enhanced Raman scattering signal distribution for Au Nanoparticle aggregates, and dynamic Raman imaging of an electrochemical reacting system.

  20. Coded aperture imaging system for nuclear fuel motion detection

    Stalker, K.T.; Kelly, J.G.


    A Coded Aperature Imaging System (CAIS) has been developed at Sandia National Laboratories to image the motion of nuclear fuel rods undergoing tests simulating accident conditions within a liquid metal fast breeder reactor. The tests require that the motion of the test fuel be monitored while it is immersed in a liquid sodium coolant precluding the use of normal optical means of imaging. However, using the fission gamma rays emitted by the fuel itself and coded aperture techniques, images with 1.5 mm radial and 5 mm axial resolution have been attained. Using an electro-optical detection system coupled to a high speed motion picture camera a time resolution of one millisecond can be achieved. This paper will discuss the application of coded aperture imaging to the problem, including the design of the one-dimensional Fresnel zone plate apertures used and the special problems arising from the reactor environment and use of high energy gamma ray photons to form the coded image. Also to be discussed will be the reconstruction techniques employed and the effect of various noise sources on system performance. Finally, some experimental results obtained using the system will be presented

  1. Magnetic resonance imaging in central nervous system tuberculosis

    Trivedi, Richa; Saksena, Sona; Gupta, Rakesh K


    Tuberculosis (TB) in any form is a devastating disease, which in its most severe form involves the central nervous system (CNS), with a high mortality and morbidity. Early diagnosis of CNS TB is necessary for appropriate treatment to reduce this morbidity and mortality. Routine diagnostic techniques involve culture and immunological tests of the tissue and biofluids, which are time-consuming and may delay definitive management. Noninvasive imaging modalities such as computed tomography (CT) scan and magnetic resonance imaging (MRI) are routinely used in the diagnosis of neurotuberculosis, with MRI offering greater inherent sensitivity and specificity than CT scan. In addition to conventional MRI imaging, magnetization transfer imaging, diffusion imaging, and proton magnetic resonance spectroscopy techniques are also being evaluated for better tissue characterization in CNS TB. The current article reviews the role of various MRI techniques in the diagnosis and management of CNS TB

  2. Dosimetry and image quality assessment in a direct radiography system

    Oliveira, Bruno Beraldo; Paixao, Lucas; Nogueira, Maria do Socorro, E-mail: [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Oliveira, Marcio Alves de [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Fac. de Medicina. Dept. de Anatomia e Imagem; Teixeira, Maria Helena Araujo [Clinica Dra. Maria Helena Araujo Teixeira, Belo Horizonte, MG (Brazil)


    Objective: to evaluate the mean glandular dose with a solid state detector and the image quality in a direct radiography system, utilizing phantoms. Materials and methods: Irradiations were performed with automatic exposure control and polymethyl methacrylate slabs with different thicknesses to calculate glandular dose values. The image quality was evaluated by means of the structures visualized on the images of the phantoms. Results: considering the uncertainty of the measurements, the mean glandular dose results are in agreement with the values provided by the equipment and with internationally adopted reference levels. Results obtained from images of the phantoms were in agreement with the reference values. Conclusion: the present study contributes to verify the equipment conformity as regards dose values and image quality. (author)

  3. Visible Korean human images on MIOS system

    Har, Donghwan; Son, Young-Ho; Lee, Sung-Won; Lee, Jung Beom


    Basically, photography has the attributes of reason, which encompasses the scientific knowledge of optics, physics and chemistry, and delicate sensibility of individuals. Ultimately, the photograph pursues "effective communication." Communication is "mental and psychosocial exchange mediated by material symbols, such as language, gesture and picture," and it has four compositions: "sender, receiver, message and channel." Recently, a change in the communication method is on the rise in the field of art and culture, including photography. Until now, communication was mainly achieved by the form of messages unilaterally transferred from senders to receivers. But, nowadays, an interactive method, in which the boundary of sender and receiver is obscure, is on the increase. Such new communication method may be said to have arrived from the desire of art and culture societies, pursuing something new and creative in the background of utilization of a variety of information media. The multi-view screen we developed is also a communication tool capable of effective interaction using photos or motion pictures. The viewer can see different images at different locations. It utilizes the basic lenticular characteristics, which have been used in printing. Each motion picture is displayed on the screen without crosstalk. The multi-view screen is different in many aspects from other display media, and is expected to be utilized in many fields, including advertisement, display and education.

  4. Spot analysis system by digitalization and imaging

    Gedin, F.


    Laser isotope separation experiments use series of laser producing several beams with characteristics adapted to physical conditions of photoionization. This paper describes briefly the laser chain and systems for measure and test with more details on analysis of spatial distribution of fluence and superposition of the three beams and alignment on the experiment axis [fr

  5. Apparent exchange rate imaging in anisotropic systems

    Sønderby, Casper Kaae; Lundell, Henrik M; Søgaard, Lise V


    Double-wave diffusion experiments offer the possibility of probing correlation between molecular diffusion at multiple time points. It has recently been shown that this technique is capable of measuring the exchange of water across cellular membranes. The aim of this study was to investigate...... the effect of macroscopic tissue anisotropy on the measurement of the apparent exchange rate (AXR) in multicompartment systems....

  6. Fabrication of a Terahertz Imaging System

    Kolodzey, James; Goossen, Keith


    .... This FTIR system operates over a frequency range from 0.6 THz to 300 THz (20 to 10,000 cm-1). Spectral transmission measurements for lens materials such as ZnSe, and for architectural materials such as dry-wall...

  7. Imaging quality evaluation method of pixel coupled electro-optical imaging system

    He, Xu; Yuan, Li; Jin, Chunqi; Zhang, Xiaohui


    With advancements in high-resolution imaging optical fiber bundle fabrication technology, traditional photoelectric imaging system have become ;flexible; with greatly reduced volume and weight. However, traditional image quality evaluation models are limited by the coupling discrete sampling effect of fiber-optic image bundles and charge-coupled device (CCD) pixels. This limitation substantially complicates the design, optimization, assembly, and evaluation image quality of the coupled discrete sampling imaging system. Based on the transfer process of grayscale cosine distribution optical signal in the fiber-optic image bundle and CCD, a mathematical model of coupled modulation transfer function (coupled-MTF) is established. This model can be used as a basis for following studies on the convergence and periodically oscillating characteristics of the function. We also propose the concept of the average coupled-MTF, which is consistent with the definition of traditional MTF. Based on this concept, the relationships among core distance, core layer radius, and average coupled-MTF are investigated.

  8. Flexibility analysis in adolescent idiopathic scoliosis on side-bending images using the EOS imaging system.

    Hirsch, C; Ilharreborde, B; Mazda, K


    Analysis of preoperative flexibility in adolescent idiopathic scoliosis (AIS) is essential to classify the curves, determine their structurality, and select the fusion levels during preoperative planning. Side-bending x-rays are the gold standard for the analysis of preoperative flexibility. The objective of this study was to examine the feasibility and performance of side-bending images taken in the standing position using the EOS imaging system. All patients who underwent preoperative assessment between April 2012 and January 2013 for AIS were prospectively included in the study. The work-up included standing AP and lateral EOS x-rays of the spine, standard side-bending x-rays in the supine position, and standing bending x-rays in the EOS booth. The irradiation dose was measured for each of the tests. Two-dimensional reducibility of the Cobb angle was measured on both types of bending x-rays. The results were based on the 50 patients in the study. No significant difference was demonstrated for reducibility of the Cobb angle between the standing side-bending images with the EOS imaging system and those in the supine position for all types of Lenke deformation. The irradiation dose was five times lower during the EOS bending imaging. The standing side-bending images in the EOS device contributed the same results as the supine images, with five times less irradiation. They should therefore be used in clinical routine. 2. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  9. Indirect gonioscopy system for imaging iridocorneal angle of eye

    Perinchery, Sandeep M.; Fu, Chan Yiu; Baskaran, Mani; Aung, Tin; Murukeshan, V. M.


    Current clinical optical imaging systems do not provide sufficient structural information of trabecular meshwork (TM) in the iridocorneal angle (ICA) of the eye due to their low resolution. Increase in the intraocular pressure (IOP) can occur due to the abnormalities in TM, which could subsequently lead to glaucoma. Here, we present an indirect gonioscopy based imaging probe with significantly improved visualization of structures in the ICA including TM region, compared to the currently available tools. Imaging quality of the developed system was tested in porcine samples. Improved direct high quality visualization of the TM region through this system can be used for Laser trabeculoplasty, which is a primary treatment of glaucoma. This system is expected to be used complementary to angle photography and gonioscopy.

  10. Design and applications of Computed Industrial Tomographic Imaging System (CITIS)

    Ramakrishna, G.S.; Umesh Kumar; Datta, S.S.; Rao, S.M.


    Computed tomographic imaging is an advanced technique for nondestructive testing (NDT) and examination. For the first time in India a computed aided tomography system has been indigenously developed in BARC for testing industrial components and was successfully demonstrated. The system in addition to Computed Tomography (CT) can also perform Digital Radiography (DR) to serve as a powerful tool for NDT applications. It has wider applications in the fields of nuclear, space and allied fields. The authors have developed a computed industrial tomographic imaging system with Cesium 137 gamma radiation source for nondestructive examination of engineering and industrial specimens. This presentation highlights the design and development of a prototype system and its software for image reconstruction, simulation and display. The paper also describes results obtained with several tests specimens, current development and possibility of using neutrons as well as high energy x-rays in computed tomography. (author)

  11. Portable Fluorescence Imaging System for Hypersonic Flow Facilities

    Wilkes, J. A.; Alderfer, D. W.; Jones, S. B.; Danehy, P. M.


    A portable fluorescence imaging system has been developed for use in NASA Langley s hypersonic wind tunnels. The system has been applied to a small-scale free jet flow. Two-dimensional images were taken of the flow out of a nozzle into a low-pressure test section using the portable planar laser-induced fluorescence system. Images were taken from the center of the jet at various test section pressures, showing the formation of a barrel shock at low pressures, transitioning to a turbulent jet at high pressures. A spanwise scan through the jet at constant pressure reveals the three-dimensional structure of the flow. Future capabilities of the system for making measurements in large-scale hypersonic wind tunnel facilities are discussed.

  12. Artificial neural net system for interactive tissue classification with MR imaging and image segmentation

    Clarke, L.P.; Silbiger, M.; Naylor, C.; Brown, K.


    This paper reports on the development of interactive methods for MR tissue classification that permit mathematically rigorous methods for three-dimensional image segmentation and automatic organ/tumor contouring, as required for surgical and RTP planning. The authors investigate a number of image-intensity based tissue- classification methods that make no implicit assumptions on the MR parameters and hence are not limited by image data set. Similarly, we have trained artificial neural net (ANN) systems for both supervised and unsupervised tissue classification

  13. Imaging Freeform Optical Systems Designed with NURBS Surfaces


    reflective, anastigmat 1 Introduction The imaging freeform optical systems described here are designed using non-uniform rational basis-spline (NURBS...code, but to succeed in designing NURBS freeform optical systems an optimization code is required. The motivation for developing the optical design

  14. Positron imaging system with improved count rate and tomographic capability


    A system with improved count rate capability for detecting the radioactive distribution of positron events within an organ of interest in a living subject is described. Objects of the invention include improving the scintillation crystal and pulse processing electronics, avoiding the limitations of collimators and provide an Arger camera positron imaging system that avoids the use of collimators. (U.K.)

  15. Software for MR imaging system VISTA-E50

    Nakatao, Shirou; Iino, Mitsutoshi; Fukuda, Kazuhiko


    VISTA-E50 has the advantages of high-quality imaging, fast scanning, high patient throughput and easy operation featured by AI (artificial intelligence) technologies, as well as merits of compact, light-weight, space- and energy-saving system. This paper presents system software and clinical application software of VISTA-E50, especially for each function and advantage. (author)

  16. Self-imaging in first-order optical systems

    Alieva, T.; Bastiaans, M.J.; Nijhawan, O.P.; Guota, A.K.; Musla, A.K.; Singh, Kehar


    The structure and main properties of coherent and partially coherent optical fields that are self-reproducible under propagation through a first-order optical system are investigated. A phase space description of self-imaging in first-order optical systems is presented. The Wigner distribution

  17. Image processing system performance prediction and product quality evaluation

    Stein, E. K.; Hammill, H. B. (Principal Investigator)


    The author has identified the following significant results. A new technique for image processing system performance prediction and product quality evaluation was developed. It was entirely objective, quantitative, and general, and should prove useful in system design and quality control. The technique and its application to determination of quality control procedures for the Earth Resources Technology Satellite NASA Data Processing Facility are described.

  18. A new method of the light irradiation image by the computed radiography (imaging plate) system

    Aiba, Susumu; Nishi, Katsuki.


    There are two method for the purpose of diagnosing medically by using gamma-ray light irradiation image. One is to use of the scintillation camera for gamma-ray, the other is to use of the photostimulable luminescence point by the secondary excitation of the image plate (IP) system for X-ray. The standpoint of the spatial resolution at the total medical image, using gamma-ray, the first can get the image on a short time, but the first is a poor image quality, and the second is good image quality, but the second can get the image on a long time, because of insensitive to gamma-ray. We report on the improvement for IP's week point by our proposal method, and by our clinical and quantitative analysis data, to use the highly efficient IP (ST-III). We make the improvement on the imaging time (from 30 minutes to 20 minutes), and the inprocessing time (from 33-50 minutes to 27 minutes) for a former method on an organism. We strongly believe that our convenience improvement method, and our clinical quantitative analysis data can contribute to the wide application as well as the quality up for the clinical diagnosis to use gamma-ray. (author)

  19. Efficient Lossy Compression for Compressive Sensing Acquisition of Images in Compressive Sensing Imaging Systems

    Xiangwei Li


    Full Text Available Compressive Sensing Imaging (CSI is a new framework for image acquisition, which enables the simultaneous acquisition and compression of a scene. Since the characteristics of Compressive Sensing (CS acquisition are very different from traditional image acquisition, the general image compression solution may not work well. In this paper, we propose an efficient lossy compression solution for CS acquisition of images by considering the distinctive features of the CSI. First, we design an adaptive compressive sensing acquisition method for images according to the sampling rate, which could achieve better CS reconstruction quality for the acquired image. Second, we develop a universal quantization for the obtained CS measurements from CS acquisition without knowing any a priori information about the captured image. Finally, we apply these two methods in the CSI system for efficient lossy compression of CS acquisition. Simulation results demonstrate that the proposed solution improves the rate-distortion performance by 0.4~2 dB comparing with current state-of-the-art, while maintaining a low computational complexity.

  20. Adaptive Image Transmission Scheme over Wavelet-Based OFDM System

    GAOXinying; YUANDongfeng; ZHANGHaixia


    In this paper an adaptive image transmission scheme is proposed over Wavelet-based OFDM (WOFDM) system with Unequal error protection (UEP) by the design of non-uniform signal constellation in MLC. Two different data division schemes: byte-based and bitbased, are analyzed and compared. Different bits are protected unequally according to their different contribution to the image quality in bit-based data division scheme, which causes UEP combined with this scheme more powerful than that with byte-based scheme. Simulation results demonstrate that image transmission by UEP with bit-based data division scheme presents much higher PSNR values and surprisingly better image quality. Furthermore, by considering the tradeoff of complexity and BER performance, Haar wavelet with the shortest compactly supported filter length is the most suitable one among orthogonal Daubechies wavelet series in our proposed system.

  1. Experimental ultrasound system for real-time synthetic imaging

    Jensen, Jørgen Arendt; Holm, Ole; Jensen, Lars Joost


    Digital signal processing is being employed more and more in modern ultrasound scanners. This has made it possible to do dynamic receive focusing for each sample and implement other advanced imaging methods. The processing, however, has to be very fast and cost-effective at the same time. Dedicated...... for synthetic aperture imaging, 2D and 3D B-mode and velocity imaging. The system can be used with 128 element transducers and can excite 128 channels and receive and sample data from 64 channels simultaneously at 40 MHz with 12 bits precision. Data can be processed in real time using the system's 80 signal...... chips are used in order to do real time processing. This often makes it difficult to implement radically different imaging strategies on one platform and makes the scanners less accessible for research purposes. Here flexibility is the prime concern, and the storage of data from all transducer elements...

  2. Online Voting System Based on Image Steganography and Visual Cryptography

    Biju Issac


    Full Text Available This paper discusses the implementation of an online voting system based on image steganography and visual cryptography. The system was implemented in Java EE on a web-based interface, with MySQL database server and Glassfish application server as the backend. After considering the requirements of an online voting system, current technologies on electronic voting schemes in published literature were examined. Next, the cryptographic and steganography techniques best suited for the requirements of the voting system were chosen, and the software was implemented. We have incorporated in our system techniques like the password hashed based scheme, visual cryptography, F5 image steganography and threshold decryption cryptosystem. The analysis, design and implementation phase of the software development of the voting system is discussed in detail. We have also used a questionnaire survey and did the user acceptance testing of the system.

  3. Quality Control of Mega Voltage Portal Imaging System

    Diklic, A.; Dundara Debeljuh, D.; Jurkovic, S.; Smilovic Radojcic, D.; Svabic Kolacio; Kasabasic, M.; Faj, D.


    The Electronic Portal Imaging Device (EPID) is a system used to verify either the correct positioning of the patient during radiotherapy treatment or the linear accelerator beam parameters. The correct position of the patient corresponds to the position at which the patient was scanned at the CT simulator and according to which the therapy plan was made and optimized. Regarding this, besides the advanced treatment planning system and optimized treatment planning techniques, the day-to-day reproduction of simulated conditions is of great importance for the treatment outcome. Therefore, to verify the patient set-up portal imaging should be applied prior to the first treatment session and repeated according to treatment prescriptions during the treatment. In order to achieve full functionality and precision of the EPID, it must be included in radiotherapy Quality Control (QC) programme. The QC of the Mega Voltage portal imaging system was separated in two parts. In the first, the QC of the detector parameters should be performed. For this purpose, the FC2 and QC3 phantoms should be used, along with the Portal Image Processing System program (PIPSpro) package for data analysis. The second part of the QC of the linear accelerator's portal imaging system should include the QC of the CBCT. In this part a set of predefined manufacturer's tests using two different phantoms, one for the geometry calibration and the other for the image quality evaluation, should be performed. Also, the treatment conditions should be simulated using anthropomorphic phantoms and dose distributions for particular EPID protocols should be measured. Procedures for quality control of the portal imaging system developed and implemented at University Hospital Rijeka are presented in this paper.(author)

  4. Radiation dose reduction and new image modalities development for interventional C-arm imaging system

    Niu, Kai

    Cardiovascular disease and stroke are the leading health problems and causes of death in the US. Due to the minimally invasive nature of the evolution of image guided techniques, interventional radiological procedures are becoming more common and are preferred in treating many cardiovascular diseases and strokes. In addition, with the recent advances in hardware and device technology, the speed and efficacy of interventional treatment has significantly improved. This implies that more image modalities can be developed based on the current C-arm system and patients treated in interventional suites can potentially experience better health outcomes. However, during the treatment patients are irradiated with substantial amounts of ionizing radiation with a high dose rate (digital subtraction angiography (DSA) with 3muGy/frame and 3D cone beam CT image with 0.36muGy/frame for a Siemens Artis Zee biplane system) and/or a long irradiation time (a roadmapping image sequence can be as long as one hour during aneurysm embolization). As a result, the patient entrance dose is extremely high. Despite the fact that the radiation dose is already substantial, image quality is not always satisfactory. By default a temporal average is used in roadmapping images to overcome poor image quality, but this technique can result in motion blurred images. Therefore, reducing radiation dose while maintaining or even improving the image quality is an important area for continued research. This thesis is focused on improving the clinical applications of C-arm cone beam CT systems in two ways: (1) Improve the performance of current image modalities on the C-arm system. (2) Develop new image modalities based on the current system. To be more specific, the objectives are to reduce radiation dose for current modalities (e.g., DSA, fluoroscopy, roadmapping, and cone beam CT) and enable cone beam CT perfusion and time resolved cone beam CT angiography that can be used to diagnose and triage acute

  5. Development of a new electronic neutron imaging system

    Brenizer, J S; Gibbs, K M; Mengers, P; Stebbings, C T; Polansky, D; Rogerson, D J


    An electronic neutron imaging camera system was developed for use with thermal, epithermal, and fast neutrons in applications that include nondestructive inspection of explosives, corrosion, turbine blades, electronics, low Z components, etc. The neutron images are expected to provide information to supplement that available from X-ray tests. The primary camera image area was a 30x30 cm field-of-view with a spatial resolution approaching 1.6 line pairs/mm (lp/mm). The camera had a remotely changeable second lens to limit the field-of-view to 7.6x7.6 cm for high spatial resolution (at least 4 lp/mm) thermal neutron imaging, but neutron and light scatter will limit resolution for fast neutrons to about 0.5 lp/mm. Remote focus capability enhanced camera set-up for optimum operation. The 75 dB dynamic range camera system included sup 6 Li-based screens for imaging of thermal and epithermal neutrons and ZnS(Ag)-based screens for fast neutron imaging. The fast optics was input to a Super S-25 Gen II image intensifi...

  6. Neutron imaging system based on a video camera

    Dinca, M.


    The non-destructive testing with cold, thermal, epithermal or fast neutrons is nowadays more and more useful because the world-wide level of industrial development requires considerably higher standards of quality of manufactured products and reliability of technological processes especially where any deviation from standards could result in large-scale catastrophic consequences or human loses. Thanks to their properties, easily obtained and very good discrimination of the materials that penetrate, the thermal neutrons are the most used probe. The methods involved for this technique have advanced from neutron radiography based on converter screens and radiological films to neutron radioscopy based on video cameras, that is, from static images to dynamic images. Many neutron radioscopy systems have been used in the past with various levels of success. The quality of an image depends on the quality of the neutron beam and the type of the neutron imaging system. For real time investigations there are involved tube type cameras, CCD cameras and recently CID cameras that capture the image from an appropriate scintillator through the agency of a mirror. The analog signal of the camera is then converted into digital signal by the signal processing technology included into the camera. The image acquisition card or frame grabber from a PC converts the digital signal into an image. The image is formatted and processed by image analysis software. The scanning position of the object is controlled by the computer that commands the electrical motors that move horizontally, vertically and rotate the table of the object. Based on this system, a lot of static image acquisitions, real time non-destructive investigations of dynamic processes and finally, tomographic investigations of the small objects are done in a short time. A system based on a CID camera is presented. Fundamental differences between CCD and CID cameras lie in their pixel readout structure and technique. CIDs

  7. Reflective optical imaging system for extreme ultraviolet wavelengths

    Viswanathan, V.K.; Newnam, B.E.


    A projection reflection optical system has two mirrors in a coaxial, four reflection configuration to reproduce the image of an object. The mirrors have spherical reflection surfaces to provide a very high resolution of object feature wavelengths less than 200 [mu]m, and preferably less than 100 [mu]m. An image resolution of features less than 0.05-0.1 [mu]m, is obtained over a large area field; i.e., 25.4 mm [times] 25.4 mm, with a distortion less than 0.1 of the resolution over the image field.

  8. Surface Nuclear Magnetic Resonance Imaging of Large Systems

    Weichman, P.B.; Lavely, E.M.; Ritzwoller, M.H.


    The general theory of surface NMR imaging of large electromagnetically active systems is considered, motivated by geophysical applications. A general imaging equation is derived for the NMR voltage response, valid for arbitrary transmitter and receiver loop geometry and arbitrary conductivity structure of the sample. When the conductivity grows to the point where the electromagnetic skin depth becomes comparable to the sample size, significant diffusive retardation effects occur that strongly affect the signal. Accounting for these now allows more accurate imaging than previously possible. It is shown that the time constant T 1 may in principle be inferred directly from the diffusive tail of the signal. copyright 1999 The American Physical Society

  9. Imaging cytometry in a plastic ultra-mobile system

    Martínez Vázquez, R.; Trotta, G.; Paturzo, M.; Volpe, A.; Bernava, G.; Basile, V.; Ancona, A.; Ferraro, P.; Fassi, I.; Osellame, R.


    We present a cost-effective and highly-portable plastic prototype that can be interfaced with a cell phone to implement an optofluidic imaging cytometry platform. It is based on a PMMA microfluidic chip that fits inside an opto-mechanical platform fabricated by a 3D printer. The fluorescence excitation and imaging is performed using the LED and the CMOS from the cell phone increasing the compactness of the system. A custom developed application is used to analyze the images and provide a value of particle concentration.

  10. System and method for image registration of multiple video streams

    Dillavou, Marcus W.; Shum, Phillip Corey; Guthrie, Baron L.; Shenai, Mahesh B.; Deaton, Drew Steven; May, Matthew Benton


    Provided herein are methods and systems for image registration from multiple sources. A method for image registration includes rendering a common field of interest that reflects a presence of a plurality of elements, wherein at least one of the elements is a remote element located remotely from another of the elements and updating the common field of interest such that the presence of the at least one of the elements is registered relative to another of the elements.

  11. Enabling vendor independent photoacoustic imaging systems with asynchronous laser source

    Wu, Yixuan; Zhang, Haichong K.; Boctor, Emad M.


    Channel data acquisition, and synchronization between laser excitation and PA signal acquisition, are two fundamental hardware requirements for photoacoustic (PA) imaging. Unfortunately, however, neither is equipped by most clinical ultrasound scanners. Therefore, less economical specialized research platforms are used in general, which hinders a smooth clinical transition of PA imaging. In previous studies, we have proposed an algorithm to achieve PA imaging using ultrasound post-beamformed (USPB) RF data instead of channel data. This work focuses on enabling clinical ultrasound scanners to implement PA imaging, without requiring synchronization between the laser excitation and PA signal acquisition. Laser synchronization is inherently consisted of two aspects: frequency and phase information. We synchronize without communicating the laser and the ultrasound scanner by investigating USPB images of a point-target phantom in two steps. First, frequency information is estimated by solving a nonlinear optimization problem, under the assumption that the segmented wave-front can only be beamformed into a single spot when synchronization is achieved. Second, after making frequencies of two systems identical, phase delay is estimated by optimizing the image quality while varying phase value. The proposed method is validated through simulation, by manually adding both frequency and phase errors, then applying the proposed algorithm to correct errors and reconstruct PA images. Compared with the ground truth, simulation results indicate that the remaining errors in frequency correction and phase correction are 0.28% and 2.34%, respectively, which affirm the potential of overcoming hardware barriers on PA imaging through software solution.

  12. Adaptive Optical System for Retina Imaging Approaches Clinic Applications

    Ling, N.; Zhang, Y.; Rao, X.; Wang, C.; Hu, Y.; Jiang, W.; Jiang, C.

    We presented "A small adaptive optical system on table for human retinal imaging" at the 3rd Workshop on Adaptive Optics for Industry and Medicine. In this system, a 19 element small deformable mirror was used as wavefront correction element. High resolution images of photo receptors and capillaries of human retina were obtained. In recent two years, at the base of this system a new adaptive optical system for human retina imaging has been developed. The wavefront correction element is a newly developed 37 element deformable mirror. Some modifications have been adopted for easy operation. Experiments for different imaging wavelengths and axial positions were conducted. Mosaic pictures of photoreceptors and capillaries were obtained. 100 normal and abnormal eyes of different ages have been inspected.The first report in the world concerning the most detailed capillary distribution images cover ±3° by ± 3° field around the fovea has been demonstrated. Some preliminary very early diagnosis experiment has been tried in laboratory. This system is being planned to move to the hospital for clinic experiments.

  13. Image-based fingerprint verification system using LabVIEW

    Sunil K. Singla


    Full Text Available Biometric-based identification/verification systems provide a solution to the security concerns in the modern world where machine is replacing human in every aspect of life. Fingerprints, because of their uniqueness, are the most widely used and highly accepted biometrics. Fingerprint biometric systems are either minutiae-based or pattern learning (image based. The minutiae-based algorithm depends upon the local discontinuities in the ridge flow pattern and are used when template size is important while image-based matching algorithm uses both the micro and macro feature of a fingerprint and is used if fast response is required. In the present paper an image-based fingerprint verification system is discussed. The proposed method uses a learning phase, which is not present in conventional image-based systems. The learning phase uses pseudo random sub-sampling, which reduces the number of comparisons needed in the matching stage. This system has been developed using LabVIEW (Laboratory Virtual Instrument Engineering Workbench toolbox version 6i. The availability of datalog files in LabVIEW makes it one of the most promising candidates for its usage as a database. Datalog files can access and manipulate data and complex data structures quickly and easily. It makes writing and reading much faster. After extensive experimentation involving a large number of samples and different learning sizes, high accuracy with learning image size of 100 100 and a threshold value of 700 (1000 being the perfect match has been achieved.

  14. Assessing the impact of a medical image access system

    McNeill, Kevin M.; Maloney, Kris; Parra, Miguel V.; Ovitt, Theron W.; Dallas, William J.


    We have developed and installed a Medical Image Access System in an intensive care unit. Images are acquired and transmitted automatically to this system, thus expanding on the previous results of Shile et. al. It is our goal to determine what effect regular, sustained availability of image data in the clinic has on the Intensive Care Unit and the Department of Radiology. Our system is installed and has been in regular use in the hospital since late August of 1993. Since the time of installation we have been collecting usage information from both the manual and automated systems. From this data we are performing the standard measures established by DeSimone et. al. Our initial results support the original findings that image availability in the clinic leads to earlier patient care decision based on the image data. However, our findings do not seem to indicate that there is a breakdown of communication between the clinician and the radiologist as a result of the use of the clinical display system. In addition to the established measure we are investigating other criteria to measure time saved by both the clinician and radiologist. The results are reported in this paper.

  15. CT image reconstruction system based on hardware implementation

    Silva, Hamilton P. da; Evseev, Ivan; Schelin, Hugo R.; Paschuk, Sergei A.; Milhoretto, Edney; Setti, Joao A.P.; Zibetti, Marcelo; Hormaza, Joel M.; Lopes, Ricardo T.


    Full text: The timing factor is very important for medical imaging systems, which can nowadays be synchronized by vital human signals, like heartbeats or breath. The use of hardware implemented devices in such a system has advantages considering the high speed of information treatment combined with arbitrary low cost on the market. This article refers to a hardware system which is based on electronic programmable logic called FPGA, model Cyclone II from ALTERA Corporation. The hardware was implemented on the UP3 ALTERA Kit. A partially connected neural network with unitary weights was programmed. The system was tested with 60 topographic projections, 100 points in each, of the Shepp and Logan phantom created by MATLAB. The main restriction was found to be the memory size available on the device: the dynamic range of reconstructed image was limited to 0 65535. Also, the normalization factor must be observed in order to do not saturate the image during the reconstruction and filtering process. The test shows a principal possibility to build CT image reconstruction systems for any reasonable amount of input data by arranging the parallel work of the hardware units like we have tested. However, further studies are necessary for better understanding of the error propagation from topographic projections to reconstructed image within the implemented method. (author)

  16. A study of television imaging system for fast neutron radiography

    Yoshii, Koji


    The neutron radiography with fast neutron beam is a very useful imaging technique for thicker objects, especially those composed of hydrogen-rich materials which are sometimes difficult to image by thermal neutron radiography. The fast neutron radiography has not been studied so much as the thermal neutron radiography. The fast neutron radiography has been studied at the fast neutron source reactor 'Yayoi' of the University of Tokyo built in Tokai-mura. The average neutron energy of the Yayoi is about 1 MeV, and the peak neutron flux at the core center is 0.8 x 10 12 at the maximum operating power of 2 kW. In the experiment on fast neutron radiography, a CR39 nuclear track detector has been used successfully. But in the Yayoi radiography procedure, about 24 hours were required for obtaining an imaging result. To get a prompt imaging result and a real-time imaging result, it is necessary to develop a fast neutron television system, and in this paper, a new fast neutron TV system is proposed. The main difference is the converter material sensitive to fast neutrons. The study on the fast neutron TV system was carried out by using the Baby Cyclotron of Japan Steel Works, and the good images were realized. (K.I.)

  17. Detection rates in pediatric diagnostic imaging: a picture archive and communication system compared with a web-based imaging system

    McDonald, L.; Cramer, B.; Barrett, B.


    This prospective study assesses whether there are differences in accuracy of interpretation of diagnostic images among users of a picture archive and communication system (PACS) diagnostic workstation, compared with a less costly Web-based imaging system on a personal computer (PC) with a high resolution monitor. One hundred consecutive pediatric chest or abdomen and skeletal X-rays were selected from hospital inpatient and outpatient studies over a 5-month interval. They were classified as normal (n = 32), obviously abnormal (n = 33), or having subtle abnormal findings (n = 35) by 2 senior radiologists who reached a consensus for each individual case. Subsequently, 5 raters with varying degrees of experience independently viewed and interpreted the cases as normal or abnormal. Raters viewed each image 1 month apart on a PACS and on the Web-based PC imaging system. There was no relation between accuracy of detection and the system used to evaluate X-ray images (P = 0.92). The total percentage of incorrect interpretations on the Web-based PC imaging system was 23.2%, compared with 23.6% on the PACS (P = 0.92). For all raters combined, the overall difference in proportion assessed incorrectly on the PACS, compared with the PC system, was not significant at 0.4% (95%CI, -3.5% to 4.3%). The high-resolution Web-based imaging system via PC is an adequate alternative to a PACS clinical workstation. Accordingly, the provision of a more extensive network of workstations throughout the hospital setting could have potentially significant cost savings. (author)


    R. V. Anitropov; P. Benitez; I. L. Livshits S. K. Stafeev; S. K. Stafeev; V. N. Vasilev; M. V. Letunovskaya; A. S. Zaitceva


    Subject of Research. The research results, structural composition analysis and the parametric synthesis of the projected imaging and non-imaging optical systems were presented. We made an attempt to use the gained experience about imaging systems while designing non-imaging systems, by adapting the composition theory for the calculations of non-imaging systems. Several patterns were revealed, which provide a deeper understanding of the design process of non-imaging optical systems; measures ...

  19. Developing standard transmission system for radiology reporting including key images

    Kim, Seon Chil


    Development of hospital information system and Picture Archiving Communication System is not new in the medical field, and the development of internet and information technology are also universal. In the course of such development, however, it is hard to share medical information without a refined standard format. Especially in the department of radiology, the role of PACS has become very important in interchanging information with other disparate hospital information systems. A specific system needs to be developed that radiological reports are archived into a database efficiently. This includes sharing of medical images. A model is suggested in this study in which an internal system is developed where radiologists store necessary images and transmit them is the standard international clinical format, Clinical Document Architecture, and share the information with hospitals. CDA document generator was made to generate a new file format and separate the existing storage system from the new system. This was to ensure the access to required data in XML documents. The model presented in this study added a process where crucial images in reading are inserted in the CDA radiological report generator. Therefore, this study suggests a storage and transmission model for CDA documents, which is different from the existing DICOM SR. Radiological reports could be better shared, when the application function for inserting images and the analysis of standard clinical terms are completed

  20. Gamma camera image processing and graphical analysis mutual software system

    Wang Zhiqian; Chen Yongming; Ding Ailian; Ling Zhiye; Jin Yongjie


    GCCS gamma camera image processing and graphical analysis system is a special mutual software system. It is mainly used to analyse various patient data acquired from gamma camera. This system is used on IBM PC, PC/XT or PC/AT. It consists of several parts: system management, data management, device management, program package and user programs. The system provides two kinds of user interfaces: command menu and command characters. It is easy to change and enlarge this system because it is best modularized. The user programs include almost all the clinical protocols used now

  1. Information system for administrating and distributing color images through internet


    Full Text Available The information system for administrating and distributing color images through the Internet ensures the consistent replication of color images, their storage - in an on-line data base - and predictable distribution, by means of a digitally distributed flow, based on Windows platform and POD (Print On Demand technology. The consistent replication of color images inde-pendently from the parameters of the processing equipment and from the features of the programs composing the technological flow, is ensured by the standard color management sys-tem defined by ICC (International Color Consortium, which is integrated by the Windows operation system and by the POD technology. The latter minimize the noticeable differences between the colors captured, displayed or printed by various replication equipments and/or edited by various graphical applications. The system integrated web application ensures the uploading of the color images in an on-line database and their administration and distribution among the users via the Internet. For the preservation of the data expressed by the color im-ages during their transfer along a digitally distributed flow, the software application includes an original tool ensuring the accurate replication of colors on computer displays or when printing them by means of various color printers or presses. For development and use, this application employs a hardware platform based on PC support and a competitive software platform, based on: the Windows operation system, the .NET. Development medium and the C# programming language. This information system is beneficial for creators and users of color images, the success of the printed or on-line (Internet publications depending on the sizeable, predictable and accurate replication of colors employed for the visual expression of information in every activity fields of the modern society. The herein introduced information system enables all interested persons to access the

  2. Smart image processing system for retinal prosthesis.

    Weiland, James D; Parikh, Neha; Pradeep, Vivek; Medioni, Gerard


    Retinal prostheses for the blind have demonstrated the ability to provide the sensation of light in otherwise blind individuals. However, visual task performance in these patients remains poor relative to someone with normal vision. Computer vision algorithms for navigation and object detection were evaluated for their ability to improve task performance. Blind subjects navigating a mobility course had fewer collisions when using a wearable camera system that guided them on a safe path. Subjects using a retinal prosthesis simulator could locate objects more quickly when an object detection algorithm assisted them. Computer vision algorithms can assist retinal prosthesis patients and low-vision patients in general.

  3. MDCT imaging of calcinosis in systemic sclerosis

    Freire, V.; Becce, F.; Feydy, A.; Guérini, H.; Campagna, R.; Allanore, Y.; Drapé, J.-L.


    Calcinosis is a typical feature of systemic sclerosis (SSc) and can be found in many different tissues including the superficial soft tissues, periarticular structures, muscles, and tendons. It can also provoke erosive changes on bones. Investigation is conducted most often with plain radiographs. However, when a more detailed assessment is necessary, multidetector computed tomography (MDCT) is helpful owing to its multiplanar reformat (MPR) ability. The purpose of this review is to provide an overview of the various appearances of calcinosis in SSc patients as visualized at MDCT

  4. Planetary Data Systems (PDS) Imaging Node Atlas II

    Stanboli, Alice; McAuley, James M.


    The Planetary Image Atlas (PIA) is a Rich Internet Application (RIA) that serves planetary imaging data to the science community and the general public. PIA also utilizes the USGS Unified Planetary Coordinate system (UPC) and the on-Mars map server. The Atlas was designed to provide the ability to search and filter through greater than 8 million planetary image files. This software is a three-tier Web application that contains a search engine backend (MySQL, JAVA), Web service interface (SOAP) between server and client, and a GWT Google Maps API client front end. This application allows for the search, retrieval, and download of planetary images and associated meta-data from the following missions: 2001 Mars Odyssey, Cassini, Galileo, LCROSS, Lunar Reconnaissance Orbiter, Mars Exploration Rover, Mars Express, Magellan, Mars Global Surveyor, Mars Pathfinder, Mars Reconnaissance Orbiter, MESSENGER, Phoe nix, Viking Lander, Viking Orbiter, and Voyager. The Atlas utilizes the UPC to translate mission-specific coordinate systems into a unified coordinate system, allowing the end user to query across missions of similar targets. If desired, the end user can also use a mission-specific view of the Atlas. The mission-specific views rely on the same code base. This application is a major improvement over the initial version of the Planetary Image Atlas. It is a multi-mission search engine. This tool includes both basic and advanced search capabilities, providing a product search tool to interrogate the collection of planetary images. This tool lets the end user query information about each image, and ignores the data that the user has no interest in. Users can reduce the number of images to look at by defining an area of interest with latitude and longitude ranges.

  5. Shimadzu magnetic resonance imaging system, SMT-50X

    Kohno, Kazuhiro; Yamauchi, Mikio; Shimizu, Koji; Fujio, Yasuo


    We have already had the passage of five years, since 0.5 T MRI system named SMT-50A had been announced. On the other hand, many severe efforts in the fields of both technic and diagnosis have been done to get higher image quality having more informations and they caused recent abrupt progress in MRI. To reply these demands, we have developed new 0.5T super-conductive MRI system 'SMT-50X', having the following features in the points of image quality, operability and economy. (1) RF antenna, called multipolarization has been developed. (2) Compact gantry having a large bore size has been designed for patient to get enough view in it. (3) Easier operation could be done by means of multitask software system. This paper introduces the outline, features and clinical images acquired by SMT-50X. (author)

  6. Intelligent System for Data Tracking in Image Editing Company

    Kimlong Ngin


    Full Text Available The success of data transaction in a company largely depends on the intelligence system used in its database and application system. The complex and heterogeneous data in the log file make it more difficult for users to manage data effectively. Therefore, this paper creates an application system that can manage data from the log file. A sample was collected from an image editing company in Cambodia by interviewing five customers and seven operators, who worked on the data files for 300 images. This paper found two results: first, the agent script was used for retrieving data from the log file, classifying data, and inserting data into a database; and second, the web interface was used for the viewing of results by the users. The intelligence capabilities of our application, together with a friendly web-based and window-based experience, allow the users to easily acquire, manage, and access the data in an image editing company.

  7. An automated digital imaging system for environmental monitoring applications

    Bogle, Rian; Velasco, Miguel; Vogel, John


    Recent improvements in the affordability and availability of high-resolution digital cameras, data loggers, embedded computers, and radio/cellular modems have advanced the development of sophisticated automated systems for remote imaging. Researchers have successfully placed and operated automated digital cameras in remote locations and in extremes of temperature and humidity, ranging from the islands of the South Pacific to the Mojave Desert and the Grand Canyon. With the integration of environmental sensors, these automated systems are able to respond to local conditions and modify their imaging regimes as needed. In this report we describe in detail the design of one type of automated imaging system developed by our group. It is easily replicated, low-cost, highly robust, and is a stand-alone automated camera designed to be placed in remote locations, without wireless connectivity.

  8. Experimental consideration for realizing image based visual servo control system

    Ishikawa, N.; Suzuki, K.; Fujii, Y.; Usui, H.


    In this study, we consider the experimental aspect of image based visual servo control system. The items considered are the following; 1) Inertial parameter estimation, 2) Focal point estimation, 3) Controller performance for the system with delay. From the experimental result of visual control, it is found that the system is very sensitive to the controller gain because of the computational delay of vision. In order to establish a satisfactory delay compensation, more investigations on controller design are required. (author)

  9. Automatic system for quantification and visualization of lung aeration on chest computed tomography images: the Lung Image System Analysis - LISA

    Felix, John Hebert da Silva; Cortez, Paulo Cesar, E-mail: [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Dept. de Engenharia de Teleinformatica; Holanda, Marcelo Alcantara [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Hospital Universitario Walter Cantidio. Dept. de Medicina Clinica


    High Resolution Computed Tomography (HRCT) is the exam of choice for the diagnostic evaluation of lung parenchyma diseases. There is an increasing interest for computational systems able to automatically analyze the radiological densities of the lungs in CT images. The main objective of this study is to present a system for the automatic quantification and visualization of the lung aeration in HRCT images of different degrees of aeration, called Lung Image System Analysis (LISA). The secondary objective is to compare LISA to the Osiris system and also to specific algorithm lung segmentation (ALS), on the accuracy of the lungs segmentation. The LISA system automatically extracts the following image attributes: lungs perimeter, cross sectional area, volume, the radiological densities histograms, the mean lung density (MLD) in Hounsfield units (HU), the relative area of the lungs with voxels with density values lower than -950 HU (RA950) and the 15th percentile of the least density voxels (PERC15). Furthermore, LISA has a colored mask algorithm that applies pseudo-colors to the lung parenchyma according to the pre-defined radiological density chosen by the system user. The lungs segmentations of 102 images of 8 healthy volunteers and 141 images of 11 patients with Chronic Obstructive Pulmonary Disease (COPD) were compared on the accuracy and concordance among the three methods. The LISA was more effective on lungs segmentation than the other two methods. LISA's color mask tool improves the spatial visualization of the degrees of lung aeration and the various attributes of the image that can be extracted may help physicians and researchers to better assess lung aeration both quantitatively and qualitatively. LISA may have important clinical and research applications on the assessment of global and regional lung aeration and therefore deserves further developments and validation studies. (author)

  10. Automatic system for quantification and visualization of lung aeration on chest computed tomography images: the Lung Image System Analysis - LISA

    Felix, John Hebert da Silva; Cortez, Paulo Cesar; Holanda, Marcelo Alcantara


    High Resolution Computed Tomography (HRCT) is the exam of choice for the diagnostic evaluation of lung parenchyma diseases. There is an increasing interest for computational systems able to automatically analyze the radiological densities of the lungs in CT images. The main objective of this study is to present a system for the automatic quantification and visualization of the lung aeration in HRCT images of different degrees of aeration, called Lung Image System Analysis (LISA). The secondary objective is to compare LISA to the Osiris system and also to specific algorithm lung segmentation (ALS), on the accuracy of the lungs segmentation. The LISA system automatically extracts the following image attributes: lungs perimeter, cross sectional area, volume, the radiological densities histograms, the mean lung density (MLD) in Hounsfield units (HU), the relative area of the lungs with voxels with density values lower than -950 HU (RA950) and the 15th percentile of the least density voxels (PERC15). Furthermore, LISA has a colored mask algorithm that applies pseudo-colors to the lung parenchyma according to the pre-defined radiological density chosen by the system user. The lungs segmentations of 102 images of 8 healthy volunteers and 141 images of 11 patients with Chronic Obstructive Pulmonary Disease (COPD) were compared on the accuracy and concordance among the three methods. The LISA was more effective on lungs segmentation than the other two methods. LISA's color mask tool improves the spatial visualization of the degrees of lung aeration and the various attributes of the image that can be extracted may help physicians and researchers to better assess lung aeration both quantitatively and qualitatively. LISA may have important clinical and research applications on the assessment of global and regional lung aeration and therefore deserves further developments and validation studies. (author)

  11. A computerized tomography system for transcranial ultrasound imaging.

    Tang, Sai Chun; Clement, Gregory T

    Hardware for tomographic imaging presents both challenge and opportunity for simplification when compared with traditional pulse-echo imaging systems. Specifically, point diffraction tomography does not require simultaneous powering of elements, in theory allowing just a single transmit channel and a single receive channel to be coupled with a switching or multiplexing network. In our ongoing work on transcranial imaging, we have developed a 512-channel system designed to transmit and/or receive a high voltage signal from/to arbitrary elements of an imaging array. The overall design follows a hierarchy of modules including a software interface, microcontroller, pulse generator, pulse amplifier, high-voltage power converter, switching mother board, switching daughter board, receiver amplifier, analog-to-digital converter, peak detector, memory, and USB communication. Two pulse amplifiers are included, each capable of producing up to 400Vpp via power MOSFETS. Switching is based around mechanical relays that allow passage of 200V, while still achieving switching times of under 2ms, with an operating frequency ranging from below 100kHz to 10MHz. The system is demonstrated through ex vivo human skulls using 1MHz transducers. The overall system design is applicable to planned human studies in transcranial image acquisition, and may have additional tomographic applications for other materials necessitating a high signal output.

  12. A Novel Reporting System to Improve Accuracy in Appendicitis Imaging

    Godwin, Benjamin D.; Drake, Frederick T.; Simianu, Vlad V.; Shriki, Jabi E.; Hippe, Daniel S.; Dighe, Manjiri; Bastawrous, Sarah; Cuevas, Carlos; Flum, David; Bhargava, Puneet


    OBJECTIVE The purpose of this study was to ascertain if standardized radiologic reporting for appendicitis imaging increases diagnostic accuracy. MATERIALS AND METHODS We developed a standardized appendicitis reporting system that includes objective imaging findings common in appendicitis and a certainty score ranging from 1 (definitely not appendicitis) through 5 (definitely appendicitis). Four radiologists retrospectively reviewed the preoperative CT scans of 96 appendectomy patients using our reporting system. The presence of appendicitis-specific imaging findings and certainty scores were compared with final pathology. These comparisons were summarized using odds ratios (ORs) and the AUC. RESULTS The appendix was visualized on CT in 89 patients, of whom 71 (80%) had pathologically proven appendicitis. Imaging findings associated with appendicitis included appendiceal diameter (odds ratio [OR] = 14 [> 10 vs appendicitis. In this initially indeterminate group, using the standardized reporting system, radiologists assigned higher certainty scores (4 or 5) in 21 of the 28 patients with appendicitis (75%) and lower scores (1 or 2) in five of the seven patients without appendicitis (71%) (AUC = 0.90; p = 0.001). CONCLUSION Standardized reporting and grading of objective imaging findings correlated well with postoperative pathology and may decrease the number of CT findings reported as indeterminate for appendicitis. Prospective evaluation of this reporting system on a cohort of patients with clinically suspected appendicitis is currently under way. PMID:26001230

  13. The BIRN Project: Imaging the Nervous System

    Ellisman, Mark


    The grand goal in neuroscience research is to understand how the interplay of structural, chemical and electrical signals in nervous tissue gives rise to behavior. Experimental advances of the past decades have given the individual neuroscientist an increasingly powerful arsenal for obtaining data, from the level of molecules to nervous systems. Scientists have begun the arduous and challenging process of adapting and assembling neuroscience data at all scales of resolution and across disciplines into computerized databases and other easily accessed sources. These databases will complement the vast structural and sequence databases created to catalogue, organize and analyze gene sequences and protein products. The general premise of the neuroscience goal is simple; namely that with 'complete' knowledge of the genome and protein structures accruing rapidly we next need to assemble an infrastructure that will facilitate acquisition of an understanding for how functional complexes operate in their cell and tissue contexts.

  14. Development of an image intensifier-TV digital imaging system with a multiple-slit scanning x-ray beam

    Kume, Y.; Doi, K.


    The authors are developing a new digital x-ray imaging system employing a multiple-slit assembly (MSA) and an image intensifier (II)-TV digital system. The final image consisting of primary radiation is digitally reconstructed from multiple slit images obtained with the MSA. This system can significantly reduce the scattered radiation from an object and the veiling glare from II-TV system. The quality of the reconstructed image is related to many parameters, such as slit width, the number of image frames, and the image reconstruction algorithm. They present the effect of these various parameters on basic imaging properties and the practicability of the method in comparison with conventional wide beam imaging

  15. Implementation of webcam-based hyperspectral imaging system

    Balooch, Ali; Nazeri, Majid; Abbasi, Hamed


    In the present work, a hyperspectral imaging system (imaging spectrometer) using a commercial webcam has been designed and developed. This system was able to capture two-dimensional spectra (in emission, transmission and reflection modes) directly from the scene in the desired wavelengths. Imaging of the object is done directly by linear sweep (pushbroom method). To do so, the spectrometer is equipped with a suitable collecting lens and a linear travel stage. A 1920 x 1080 pixel CMOS webcam was used as a detector. The spectrometer has been calibrated by the reference spectral lines of standard lamps. The spectral resolution of this system was about 2nm and its spatial resolution was about 1 mm for a 10 cm long object. The hardware solution is based on data acquisition working on the USB platform and controlled by a LabVIEW program. In this system, the initial output was a three-dimensional matrix in which two dimensions of the matrix were related to the spatial information of the object and the third dimension was the spectrum of any point of the object. Finally, the images in different wavelengths were created by reforming the data of the matrix. The free spectral range (FSR) of the system was 400 to 1100 nm. The system was successfully tested for some applications, such as plasma diagnosis as well as applications in food and agriculture sciences.

  16. A portable fluorescence microscopic imaging system for cholecystectomy

    Ye, Jian; Yang, Chaoyu; Gan, Qi; Ma, Rong; Zhang, Zeshu; Chang, Shufang; Shao, Pengfei; Zhang, Shiwu; Liu, Chenhai; Xu, Ronald


    In this paper we proposed a portable fluorescence microscopic imaging system to prevent iatrogenic biliary injuries from occurring during cholecystectomy due to misidentification of the cystic structures. The system consisted of a light source module, a CMOS camera, a Raspberry Pi computer and a 5 inch HDMI LCD. Specifically, the light source module was composed of 690 nm and 850 nm LEDs, allowing the CMOS camera to simultaneously acquire both fluorescence and background images. The system was controlled by Raspberry Pi using Python programming with the OpenCV library under Linux. We chose Indocyanine green(ICG) as a fluorescent contrast agent and then tested fluorescence intensities of the ICG aqueous solution at different concentration levels by our fluorescence microscopic system compared with the commercial Xenogen IVIS system. The spatial resolution of the proposed fluorescence microscopic imaging system was measured by a 1951 USAF resolution target and the dynamic response was evaluated quantitatively with an automatic displacement platform. Finally, we verified the technical feasibility of the proposed system in mouse models of bile duct, performing both correct and incorrect gallbladder resection. Our experiments showed that the proposed system can provide clear visualization of the confluence between the cystic duct and common bile duct or common hepatic duct, suggesting that this is a potential method for guiding cholecystectomy. The proposed portable system only cost a total of $300, potentially promoting its use in resource-limited settings.

  17. Image quality assessment for video stream recognition systems

    Chernov, Timofey S.; Razumnuy, Nikita P.; Kozharinov, Alexander S.; Nikolaev, Dmitry P.; Arlazarov, Vladimir V.


    Recognition and machine vision systems have long been widely used in many disciplines to automate various processes of life and industry. Input images of optical recognition systems can be subjected to a large number of different distortions, especially in uncontrolled or natural shooting conditions, which leads to unpredictable results of recognition systems, making it impossible to assess their reliability. For this reason, it is necessary to perform quality control of the input data of recognition systems, which is facilitated by modern progress in the field of image quality evaluation. In this paper, we investigate the approach to designing optical recognition systems with built-in input image quality estimation modules and feedback, for which the necessary definitions are introduced and a model for describing such systems is constructed. The efficiency of this approach is illustrated by the example of solving the problem of selecting the best frames for recognition in a video stream for a system with limited resources. Experimental results are presented for the system for identity documents recognition, showing a significant increase in the accuracy and speed of the system under simulated conditions of automatic camera focusing, leading to blurring of frames.

  18. Diagnostic medical imaging systems. X-ray radiography and angiography, computerized tomography, nuclear medicine, NMR imaging, sonography, integrated image information systems. 3. rev. and enl. ed.

    Morneburg, H.


    This third edition is based on major review and updating work. Many recent developments have been included, as for instance novel systems for fluoroscopy and mammography, spiral CT and electron beam CT, nuclear medical tomography ( SPECT and PET), novel techniques for fast NMR imaging, spectral and colour coded duplex sonography, as well as a new chapter on integrated image information systems, including network installations. (orig.) [de

  19. Online hyperspectral imaging system for evaluating quality of agricultural products

    Mo, Changyeun; Kim, Giyoung; Lim, Jongguk


    The consumption of fresh-cut agricultural produce in Korea has been growing. The browning of fresh-cut vegetables that occurs during storage and foreign substances such as worms and slugs are some of the main causes of consumers' concerns with respect to safety and hygiene. The purpose of this study is to develop an on-line system for evaluating quality of agricultural products using hyperspectral imaging technology. The online evaluation system with single visible-near infrared hyperspectral camera in the range of 400 nm to 1000 nm that can assess quality of both surfaces of agricultural products such as fresh-cut lettuce was designed. Algorithms to detect browning surface were developed for this system. The optimal wavebands for discriminating between browning and sound lettuce as well as between browning lettuce and the conveyor belt were investigated using the correlation analysis and the one-way analysis of variance method. The imaging algorithms to discriminate the browning lettuces were developed using the optimal wavebands. The ratio image (RI) algorithm of the 533 nm and 697 nm images (RI533/697) for abaxial surface lettuce and the ratio image algorithm (RI533/697) and subtraction image (SI) algorithm (SI538-697) for adaxial surface lettuce had the highest classification accuracies. The classification accuracy of browning and sound lettuce was 100.0% and above 96.0%, respectively, for the both surfaces. The overall results show that the online hyperspectral imaging system could potentially be used to assess quality of agricultural products.

  20. Toward a unified view of radiological imaging systems. Part II: Noisy images

    Wagner, R.F.


    ''The imaging process is fundamentally a sampling process.'' This philosophy of Otto Schade, utilizing the concepts of sample number and sampling aperture, is applied to a systems analysis of radiographic imaging, including some aspects of vision. It leads to a simple modification of the Rose statistical model; this results in excellent fits to the Blackwell data on the detectability of disks as a function of contrast and size. It gives a straightforward prescription for calculating a signal-to-noise ratio, which is applicable to the detection of low-contrast detail in screen--film imaging, including the effects of magnification. The model lies between the optimistic extreme of the Rose model and the pessimistic extreme of the Morgan model. For high-contrast detail, the rules for the evaluation of noiseless images are recovered

  1. Microscopic image processing system for measuring nonuniform film thickness profiles: Image scanning ellipsometry

    Liu, A.H.; Plawsky, J.L.; Wayner, P.C. Jr.


    The long-term objective of this research program is to determine the stability and heat transfer characteristics of evaporating thin films. The current objective is to develop and use a microscopic image-processing system (IPS) which has two parts: an image analyzing interferometer (IAI) and an image scanning ellipsometer (ISE). The primary purpose of this paper is to present the basic concept of ISE, which is a novel technique to measure the two dimensional thickness profile of a non-uniform, thin film, from several nm up to several μm, in a steady state as well as in a transient state. It is a full-field imaging technique which can study every point on the surface simultaneously with high spatial resolution and thickness sensitivity, i.e., it can measure and map the 2-D film thickness profile. The ISE was tested by measuring the thickness profile and the refractive index of a nonuniform solid film

  2. Positron imaging system with improved count rate and tomographic capability

    Muehllehner, G.; Buchin, M.P.


    Improvements to a positron camera imaging system are described. A pair of Angear-type scintillation cameras serve as the detectors, each camera being positioned on opposite sides of the organ of interest. Pulse shaping circuits reduce the pulse duration below 900 nanoseconds and the integration time below 500 noneseconds, improving the count rate capability and the counting statistics of the system and thus the image quality and processing speed. The invention also provides means for rotating the opposed camera heads about an axis which passes through the organ of interest. The cameras do not use collimators, and are capable of accepting radiation travelling in planes not perpendicular to the scintillation crystals. (LL)

  3. Performance of a thermal neutron radiographic system using imaging plates

    Silvani, Maria Ines; Almeida, Gevaldo L. de; Furieri, Rosanne; Lopes, Ricardo T.


    A performance evaluation of a neutron radiographic system equipped with a thermal neutron sensitive imaging plate has been undertaken. It includes the assessment of spatial resolution, linearity, dynamic range and the response to exposure time, as well as a comparison of these parameters with the equivalent ones for neutron radiography employing conventional films and a gadolinium foil as converter. The evaluation and comparison between the radiographic systems have been performed at the Instituto de Engenharia Nuclear - CNEN, using the Argonauta Reactor as source of thermal neutrons and a commercially available imaging plate reader. (author)

  4. Building an Image-Based System to automatically Score psoriasis

    G{'o}mez, D. Delgado; Carstensen, Jens Michael; Ersbøll, Bjarne Kjær


    Nowadays the medical tracking of dermatological diseases is imprecise. The main reason is the lack of suitable objective methods to evaluate the lesion. The severity of the disease is scored by doctors just through their visual examination. In this work, a system to take accurate images of dermat......Nowadays the medical tracking of dermatological diseases is imprecise. The main reason is the lack of suitable objective methods to evaluate the lesion. The severity of the disease is scored by doctors just through their visual examination. In this work, a system to take accurate images...

  5. Third-generation imaging sensor system concepts

    Reago, Donald A.; Horn, Stuart B.; Campbell, James, Jr.; Vollmerhausen, Richard H.


    Second generation forward looking infrared sensors, based on either parallel scanning, long wave (8 - 12 um) time delay and integration HgCdTe detectors or mid wave (3 - 5 um), medium format staring (640 X 480 pixels) InSb detectors, are being fielded. The science and technology community is now turning its attention toward the definition of a future third generation of FLIR sensors, based on emerging research and development efforts. Modeled third generation sensor performance demonstrates a significant improvement in performance over second generation, resulting in enhanced lethality and survivability on the future battlefield. In this paper we present the current thinking on what third generation sensors systems will be and the resulting requirements for third generation focal plane array detectors. Three classes of sensors have been identified. The high performance sensor will contain a megapixel or larger array with at least two colors. Higher operating temperatures will also be the goal here so that power and weight can be reduced. A high performance uncooled sensor is also envisioned that will perform somewhere between first and second generation cooled detectors, but at significantly lower cost, weight, and power. The final third generation sensor is a very low cost micro sensor. This sensor can open up a whole new IR market because of its small size, weight, and cost. Future unattended throwaway sensors, micro UAVs, and helmet mounted IR cameras will be the result of this new class.

  6. Remote Cherenkov imaging-based quality assurance of a magnetic resonance image-guided radiotherapy system.

    Andreozzi, Jacqueline M; Mooney, Karen E; Brůža, Petr; Curcuru, Austen; Gladstone, David J; Pogue, Brian W; Green, Olga


    Tools to perform regular quality assurance of magnetic resonance image-guided radiotherapy (MRIgRT) systems should ideally be independent of interference from the magnetic fields. Remotely acquired optical Cherenkov imaging-based dosimetry measurements in water were investigated for this purpose, comparing measures of dose accuracy, temporal dynamics, and overall integrated IMRT delivery. A 40 × 30.5 × 37.5 cm 3 water tank doped with 1 g/L of quinine sulfate was imaged using an intensified charge-coupled device (ICCD) to capture the Cherenkov emission while being irradiated by a commercial MRIgRT system (ViewRay™). The ICCD was placed down-bore at the end of the couch, 4 m from treatment isocenter and behind the 5-Gauss line of the 0.35-T MRI. After establishing optimal camera acquisition settings, square beams of increasing size (4.2 × 4.2 cm 2 , 10.5 × 10.5 cm 2 , and 14.7 × 14.7 cm 2 ) were imaged at 0.93 frames per second, from an individual cobalt-60 treatment head, to develop projection measures related to percent depth dose (PDD) curves and cross beam profiles (CPB). These Cherenkov-derived measurements were compared to ionization chamber (IC) and radiographic film dosimetry data, as well as simulation data from the treatment planning system (TPS). An intensity-modulated radiotherapy (IMRT) commissioning plan from AAPM TG-119 (C4:C-Shape) was also imaged at 2.1 frames per second, and the single linear sum image from 509 s of plan delivery was compared to the dose volume prediction generated by the TPS using gamma index analysis. Analysis of standardized test target images (1024 × 1024 pixels) yielded a pixel resolution of 0.37 mm/pixel. The beam width measured from the Cherenkov image-generated projection CBPs was within 1 mm accuracy when compared to film measurements for all beams. The 502 point measurements (i.e., pixels) of the Cherenkov image-based projection percent depth dose curves (pPDDs) were compared to p

  7. Image reconstruction technique using projection data from neutron tomography system

    Waleed Abd el Bar


    Full Text Available Neutron tomography is a very powerful technique for nondestructive evaluation of heavy industrial components as well as for soft hydrogenous materials enclosed in heavy metals which are usually difficult to image using X-rays. Due to the properties of the image acquisition system, the projection images are distorted by several artifacts, and these reduce the quality of the reconstruction. In order to eliminate these harmful effects the projection images should be corrected before reconstruction. This paper gives a description of a filter back projection (FBP technique, which is used for reconstruction of projected data obtained from transmission measurements by neutron tomography system We demonstrated the use of spatial Discrete Fourier Transform (DFT and the 2D Inverse DFT in the formulation of the method, and outlined the theory of reconstruction of a 2D neutron image from a sequence of 1D projections taken at different angles between 0 and π in MATLAB environment. Projections are generated by applying the Radon transform to the original image at different angles.

  8. Fast MR imaging for evaluating the pancreaticobiliary system

    Takehara, Yasuo


    Due to physiological movement clinical MR applications for abdominal organs got off to a very slow start compared to MR imaging of other organs. However, with recent cutting-edge hardware technologies such as high performance gradient systems and phased-array capability, as well as software innovations including short TR fast spoiled gradient recalled acquisition in the steady state (GRASS), snapshot imaging such as single shot fast spin echo sequence (SSFSE) and echo planar imaging (EPI), scan times have been further reduced to make breath-hold imaging clinically viable and to enable semi-fluoroscopic, kinematic imaging recognition. The elimination of physiological motion has contributed to the significant improvement in image quality, or more specifically, the physiological motion that had long been problematic has been turned into a source of physiological information about pancreaticobiliary pathologies. In this article, the author reviewed the current status of fast MR technologies for examining pancreaticobiliary pathologies, stressing the functional and physiological aspects of the corresponding anatomy. The technologies included secretin MRCP, which became a powerful tool when combined with kinematic imaging

  9. Design of a practical model-observer-based image quality assessment method for CT imaging systems

    Tseng, Hsin-Wu; Fan, Jiahua; Cao, Guangzhi; Kupinski, Matthew A.; Sainath, Paavana


    The channelized Hotelling observer (CHO) is a powerful method for quantitative image quality evaluations of CT systems and their image reconstruction algorithms. It has recently been used to validate the dose reduction capability of iterative image-reconstruction algorithms implemented on CT imaging systems. The use of the CHO for routine and frequent system evaluations is desirable both for quality assurance evaluations as well as further system optimizations. The use of channels substantially reduces the amount of data required to achieve accurate estimates of observer performance. However, the number of scans required is still large even with the use of channels. This work explores different data reduction schemes and designs a new approach that requires only a few CT scans of a phantom. For this work, the leave-one-out likelihood (LOOL) method developed by Hoffbeck and Landgrebe is studied as an efficient method of estimating the covariance matrices needed to compute CHO performance. Three different kinds of approaches are included in the study: a conventional CHO estimation technique with a large sample size, a conventional technique with fewer samples, and the new LOOL-based approach with fewer samples. The mean value and standard deviation of area under ROC curve (AUC) is estimated by shuffle method. Both simulation and real data results indicate that an 80% data reduction can be achieved without loss of accuracy. This data reduction makes the proposed approach a practical tool for routine CT system assessment.

  10. A Recursive Fuzzy System for Efficient Digital Image Stabilization

    Nikolaos Kyriakoulis


    Full Text Available A novel digital image stabilization technique is proposed in this paper. It is based on a fuzzy Kalman compensation of the global motion vector (GMV, which is estimated in the log-polar plane. The GMV is extracted using four local motion vectors (LMVs computed on respective subimages in the logpolar plane. The fuzzy Kalman system consists of a fuzzy system with the Kalman filter's discrete time-invariant definition. Due to this inherited recursiveness, the output results into smoothed image sequences. The proposed stabilization system aims to compensate any oscillations of the frame absolute positions, based on the motion estimation in the log-polar domain, filtered by the fuzzy Kalman system, and thus the advantages of both the fuzzy Kalman system and the log-polar transformation are exploited. The described technique produces optimal results in terms of the output quality and the level of compensation.

  11. Results from the Coded Aperture Neutron Imaging System (CANIS)

    Brubaker, Erik; Steele, John T.; Brennan, James S.; Hilton, Nathan R.; Marleau, Peter


    Because of their penetrating power, energetic neutrons and gamma rays (∼1 MeV) offer the best possibility of detecting highly shielded or distant special nuclear material (SNM). Of these, fast neutrons offer the greatest advantage due to their very low and well understood natural background. We are investigating a new approach to fast-neutron imaging- a coded aperture neutron imaging system (CANIS). Coded aperture neutron imaging should offer a highly efficient solution for improved detection speed, range, and sensitivity. We have demonstrated fast neutron and gamma ray imaging with several different configurations of coded masks patterns and detectors including an 'active' mask that is composed of neutron detectors. Here we describe our prototype detector and present some initial results from laboratory tests and demonstrations.

  12. Results from the coded aperture neutron imaging system

    Brubaker, Erik; Steele, John T.; Brennan, James S.; Marleau, Peter


    Because of their penetrating power, energetic neutrons and gamma rays (∼1 MeV) offer the best possibility of detecting highly shielded or distant special nuclear material (SNM). Of these, fast neutrons offer the greatest advantage due to their very low and well understood natural background. We are investigating a new approach to fast-neutron imaging - a coded aperture neutron imaging system (CANIS). Coded aperture neutron imaging should offer a highly efficient solution for improved detection speed, range, and sensitivity. We have demonstrated fast neutron and gamma ray imaging with several different configurations of coded masks patterns and detectors including an 'active' mask that is composed of neutron detectors. Here we describe our prototype detector and present some initial results from laboratory tests and demonstrations.

  13. The Research of Optical Turbulence Model in Underwater Imaging System

    Liying Sun


    Full Text Available In order to research the effect of turbulence on underwater imaging system and image restoration, the underwater turbulence model is simulated by computer fluid dynamics. This model is obtained in different underwater turbulence intensity, which contains the pressure data that influences refractive index distribution. When the pressure value is conversed to refractive index, the refractive index distribution can be received with the refraction formula. In the condition of same turbulent intensity, the distribution of refractive index presents gradient in the whole region, with disorder and mutations in the local region. With the turbulence intensity increase, the holistic variation of the refractive index in the image is larger, and the refractive index change more tempestuously in the local region. All the above are illustrated by the simulation results with he ray tracing method and turbulent refractive index model. According to different turbulence intensity analysis, it is proved that turbulence causes image distortion and increases noise.

  14. Central nervous system lymphoma: magnetic resonance imaging features at presentation

    Ricardo Schwingel


    Full Text Available OBJECTIVE: This paper aimed at studying presentations of the central nervous system (CNS lymphoma using structural images obtained by magnetic resonance imaging (MRI. METHODS: The MRI features at presentation of 15 patients diagnosed with CNS lymphoma in a university hospital, between January 1999 and March 2011, were analyzed by frequency and cross tabulation. RESULTS: All patients had supratentorial lesions; and four had infra- and supratentorial lesions. The signal intensity on T1 and T2 weighted images was predominantly hypo- or isointense. In the T2 weighted images, single lesions were associated with a hypointense signal component. Six patients presented necrosis, all of them showed perilesional abnormal white matter, nine had meningeal involvement, and five had subependymal spread. Subependymal spread and meningeal involvement tended to occur in younger patients. CONCLUSION: Presentations of lymphoma are very pleomorphic, but some of them should point to this diagnostic possibility.

  15. Optimization of an Image-Based Talking Head System

    Kang Liu


    Full Text Available This paper presents an image-based talking head system, which includes two parts: analysis and synthesis. The audiovisual analysis part creates a face model of a recorded human subject, which is composed of a personalized 3D mask as well as a large database of mouth images and their related information. The synthesis part generates natural looking facial animations from phonetic transcripts of text. A critical issue of the synthesis is the unit selection which selects and concatenates these appropriate mouth images from the database such that they match the spoken words of the talking head. Selection is based on lip synchronization and the similarity of consecutive images. The unit selection is refined in this paper, and Pareto optimization is used to train the unit selection. Experimental results of subjective tests show that most people cannot distinguish our facial animations from real videos.

  16. Alignment effects on a neutron imaging system using coded apertures

    Thfoin, Isabelle; Landoas, Olivier; Caillaud, Tony; Vincent, Maxime; Bourgade, Jean-Luc; Rosse, Bertrand; Disdier, Laurent; Sangster, Thomas C.; Glebov, Vladimir Yu.; Pien, Greg; Armstrong, William


    A high resolution neutron imaging system is being developed and tested on the OMEGA laser facility for inertial confinement fusion experiments. This diagnostic uses a coded imaging technique with a penumbral or an annular aperture. The sensitiveness of these techniques to misalignment was pointed out with both experiments and simulations. Results obtained during OMEGA shots are in good agreement with calculations performed with the Monte Carlo code GEANT4. Both techniques are sensitive to the relative position of the source in the field of view. The penumbral imaging technique then demonstrates to be less sensitive to misalignment compared to the ring. These results show the necessity to develop a neutron imaging diagnostic for megajoule class lasers taking into account our alignment capabilities on such facilities.

  17. A new compact, high sensitivity neutron imaging system

    Caillaud, T.; Landoas, O.; Briat, M.; Rosse, B.; Thfoin, I.; Philippe, F.; Casner, A.; Bourgade, J. L.; Disdier, L. [CEA, DAM, DIF,F-91297 Arpajon (France); Glebov, V. Yu.; Marshall, F. J.; Sangster, T. C. [Laboratory for Laser Energetics, University of Rochester, 250 East River Road, Rochester, New York 14623-1299 (United States); Park, H. S.; Robey, H. F.; Amendt, P. [Lawrence Livermore National Laboratory, Livermore, California 94550 (United States)


    We have developed a new small neutron imaging system (SNIS) diagnostic for the OMEGA laser facility. The SNIS uses a penumbral coded aperture and has been designed to record images from low yield (10{sup 9}-10{sup 10} neutrons) implosions such as those using deuterium as the fuel. This camera was tested at OMEGA in 2009 on a rugby hohlraum energetics experiment where it recorded an image at a yield of 1.4 Multiplication-Sign 10{sup 10}. The resolution of this image was 54 {mu}m and the camera was located only 4 meters from target chamber centre. We recently improved the instrument by adding a cooled CCD camera. The sensitivity of the new camera has been fully characterized using a linear accelerator and a {sup 60}Co {gamma}-ray source. The calibration showed that the signal-to-noise ratio could be improved by using raw binning detection.

  18. A new compact, high sensitivity neutron imaging system

    Caillaud, T.; Landoas, O.; Briat, M.; Rossé, B.; Thfoin, I.; Philippe, F.; Casner, A.; Bourgade, J. L.; Disdier, L.; Glebov, V. Yu.; Marshall, F. J.; Sangster, T. C.; Park, H. S.; Robey, H. F.; Amendt, P.


    We have developed a new small neutron imaging system (SNIS) diagnostic for the OMEGA laser facility. The SNIS uses a penumbral coded aperture and has been designed to record images from low yield (10 9 –10 10 neutrons) implosions such as those using deuterium as the fuel. This camera was tested at OMEGA in 2009 on a rugby hohlraum energetics experiment where it recorded an image at a yield of 1.4 × 10 10 . The resolution of this image was 54 μm and the camera was located only 4 meters from target chamber centre. We recently improved the instrument by adding a cooled CCD camera. The sensitivity of the new camera has been fully characterized using a linear accelerator and a 60 Co γ-ray source. The calibration showed that the signal-to-noise ratio could be improved by using raw binning detection.

  19. Hyperthermia system working in combination with an MR imaging unit

    LeBihan, D.J.; Delannoy, J.; Levin, R.L.; Hoult, D.I.


    The authors propose a hyperthermia device to be used for temperature monitoring. It consists of a modified miniannular phased array (MAPA) radio-frequency applicator designed for limb tumor treatment that works in combination with a whole-body MR imaging unit operating at 21 MHz. Highly accurate (0.5 0 c/0.8 cm 2 ) temperature images are obtained noninvasively throughout the heated volume from MR images of molecular diffusion, the relation of which with temperature is well known. The MAPA, electrically modified to be compatible with MR imagers, can be centered inside the MR head coil. The combined system was tested on a phantom in which the temperature distribution was confirmed by miniature thermocouples

  20. HALO: a reconfigurable image enhancement and multisensor fusion system

    Wu, F.; Hickman, D. L.; Parker, Steve J.


    Contemporary high definition (HD) cameras and affordable infrared (IR) imagers are set to dramatically improve the effectiveness of security, surveillance and military vision systems. However, the quality of imagery is often compromised by camera shake, or poor scene visibility due to inadequate illumination or bad atmospheric conditions. A versatile vision processing system called HALO™ is presented that can address these issues, by providing flexible image processing functionality on a low size, weight and power (SWaP) platform. Example processing functions include video distortion correction, stabilisation, multi-sensor fusion and image contrast enhancement (ICE). The system is based around an all-programmable system-on-a-chip (SoC), which combines the computational power of a field-programmable gate array (FPGA) with the flexibility of a CPU. The FPGA accelerates computationally intensive real-time processes, whereas the CPU provides management and decision making functions that can automatically reconfigure the platform based on user input and scene content. These capabilities enable a HALO™ equipped reconnaissance or surveillance system to operate in poor visibility, providing potentially critical operational advantages in visually complex and challenging usage scenarios. The choice of an FPGA based SoC is discussed, and the HALO™ architecture and its implementation are described. The capabilities of image distortion correction, stabilisation, fusion and ICE are illustrated using laboratory and trials data.

  1. A prototype tap test imaging system: Initial field test results

    Peters, J. J.; Barnard, D. J.; Hudelson, N. A.; Simpson, T. S.; Hsu, D. K.


    This paper describes a simple, field-worthy tap test imaging system that gives quantitative information about the size, shape, and severity of defects and damages. The system consists of an accelerometer, electronic circuits for conditioning the signal and measuring the impact duration, a laptop PC and data acquisition and processing software. The images are generated manually by tapping on a grid printed on a plastic sheet laid over the part's surface. A mechanized scanner is currently under development. The prototype has produced images for a variety of aircraft composite and metal honeycomb structures containing flaws, damages, and repairs. Images of the local contact stiffness, deduced from the impact duration using a spring model, revealed quantitatively the stiffness reduction due to flaws and damages, as well as the stiffness enhancement due to substructures. The system has been field tested on commercial and military aircraft as well as rotor blades and engine decks on helicopters. Field test results will be shown and the operation of the system will be demonstrated.—This material is based upon work supported by the Federal Aviation Administration under Contract #DTFA03-98-D-00008, Delivery Order No. IA016 and performed at Iowa State University's Center for NDE as part of the Center for Aviation Systems Reliability program.

  2. Portable multispectral imaging system for oral cancer diagnosis

    Hsieh, Yao-Fang; Ou-Yang, Mang; Lee, Cheng-Chung


    This study presents the portable multispectral imaging system that can acquire the image of specific spectrum in vivo for oral cancer diagnosis. According to the research literature, the autofluorescence of cells and tissue have been widely applied to diagnose oral cancer. The spectral distribution is difference for lesions of epithelial cells and normal cells after excited fluorescence. We have been developed the hyperspectral and multispectral techniques for oral cancer diagnosis in three generations. This research is the third generation. The excited and emission spectrum for the diagnosis are acquired from the research of first generation. The portable system for detection of oral cancer is modified for existing handheld microscope. The UV LED is used to illuminate the surface of oral cavity and excite the cells to produce fluorescent. The image passes through the central channel and filters out unwanted spectrum by the selection of filter, and focused by the focus lens on the image sensor. Therefore, we can achieve the specific wavelength image via fluorescence reaction. The specificity and sensitivity of the system are 85% and 90%, respectively.

  3. Comparative evaluation of image quality in computed radiology systems using imaging plates with different usage time

    Lazzaro, M.V.; Luz, R.M. da; Capaverde, A.S.; Silva, A.M. Marques da


    Computed Radiology (CR) systems use imaging plates (IPs) for latent image acquisition. Taking into account the quality control (QC) of these systems, imaging plates usage time is undetermined. Different recommendations and publications on the subject suggest tests to evaluate these systems. The objective of this study is to compare the image quality of IPs of a CR system, in a mammography service, considering the usage time and consistency of assessments. 8 IPs were used divided into two groups: the first group included 4 IPs with 3 years of use (Group A); the second group consisted of 4 new IPs with no previous exposure (Group B). The tests used to assess the IP's quality were: Uniformity, Differential Signal to Noise Ratio (SDNR), Ghost Effect and Figure of Merit (FOM). Statistical results show that the proposed tests are shown efficient in assessing the conditions of image quality obtained in CR systems in mammography and can be used as determining factors for the replacement of IP's. Moreover, comparing the two sets of IP, results led to the replacement of all the set of IP’s with 3 years of use. This work demonstrates the importance of an efficient quality control, not only with regard to the quality of IP's used, but in the acquisition system as a whole. From this work, these tests will be conducted on an annual basis, already targeting as future work, monitoring the wear of IP's Group B and the creation of a baseline for analysis and future replacements. (author)

  4. Simulation of an image network in a medical image information system

    Massar, A.D.A.; De Valk, J.P.J.; Reijns, G.L.; Bakker, A.R.


    The desirability of an integrated (digital) communication system for medical images is widely accepted. In the USA and in Europe several experimental projects are in progress to realize (a part of) such a system. Among these is the IMAGIS project in the Netherlands. From the conclusions of the preliminary studies performed, some requirements can be formulated such a system should meet in order to be accepted by its users. For example, the storage resolution of the images should match the maximum resolution of the presently acquired digital images. This determines the amount of data and therefore the storage requirements. Further, the desired images should be there when needed. This time constraint determines the speed requirements to be imposed on the system. As compared to current standards, very large storage capacities and very fast communication media are needed to meet these requirements. By employing cacheing techniques and suitable data compression schemes for the storage and by carefully choosing the network protocols, bare capacity demands can be alleviated. A communication network is needed to make the imaging system available over a larger area. As the network is very likely to become a major bottleneck for system performance, effects of variation of various attributes have to be carefully studied and analysed. After interesting results had been obtained (although preliminary) using a simulation model for a layered storage structure, it was decided to apply simulation also to this problem. Effects of network topology, access protocols and buffering strategies will be tested. Changes in performance resulting from changes in various network parameters will be studied. Results of this study at its present state are presented

  5. Imaging Manifestations in Systemic Cat Scratch Disease: Case report

    Forero M, Julian F; Perez A, Maria C; Cerquera C, Fredy M


    Cat scratch disease is a zoonosis caused by Bartonella henselae, which is transmitted by scratches, bites or exposition to cats saliva (1). The disease typically manifests with local lymphadenitis after bacterial inoculation in the skin, however, there is an atypical systemic presentation in 5 to 10% of patients, which causes unspecific symptoms. There are several imaging findings that lead the radiologist to consider this diagnosis, in order to prevent an invasive procedure, especially if we consider that the majority of cases occur in the pediatric population (2,3). Although in the majority of cases the symptoms and imaging findings resolve spontaneously, there are specific indications like the systemic form of the disease,which requires antibiotic treatment. In the present article we are exposing a case report from Fundacion Cardioinfantil; we will review some epidemiologic aspects, clinical manifestations, diagnostic methods as well as imaging findings in Ultrasonography, Computed Tomography, Magnetic Resonance and Nuclear Medicine.

  6. Imaging Manifestations in Systemic Cat Scratch Disease: Case report

    Forero Melo, Julian Francisco; Perez Alvarado, Maria Carolina; Cerquera Cabrera, Fredy Martin


    Cat scratch disease is a zoonosis caused by Bartonella henselae, which is transmitted by scratches, bites or exposition to cats saliva (1). The disease typically manifests with local lymphadenitis after bacterial inoculation in the skin, however, there is an atypical systemic presentation in 5 to 10% of patients, which causes unspecific symptoms. There are several imaging findings that lead the radiologist to consider this diagnosis, in order to prevent an invasive procedure, especially if we consider that the majority of cases occur in the pediatric population (2,3). Although in the majority of cases the symptoms and imaging findings resolve spontaneously, there are specific indications like the systemic form of the disease, which requires antibiotic treatment. In the present article we are exposing a case report from Fundacion Cardio infantil; we will review some epidemiologic aspects, clinical manifestations, diagnostic methods as well as imaging findings in Ultrasonography, Computed Tomography, Magnetic Resonance and Nuclear Medicine.

  7. Biological elements carry out optical tasks in coherent imaging systems

    Ferraro, P.; Bianco, V.; Paturzo, M.; Miccio, L.; Memmolo, P.; Merola, F.; Marchesano, V.


    We show how biological elements, like live bacteria species and Red Blood Cells (RBCs) can accomplish optical functionalities in DH systems. Turbid media allow coherent microscopy despite the strong light scattering these provoke, acting on light just as moving diffusers. Furthermore, a turbid medium can have positive effects on a coherent imaging system, providing resolution enhancement and mimicking the action of noise decorrelation devices, thus yielding an image quality significantly higher than the quality achievable through a transparent medium in similar recording conditions. Besides, suspended RBCs are demonstrated to behave as controllable liquid micro-lenses, opening new possibilities in biophotonics for endoscopy imaging purposes, as well as telemedicine for point-of-care diagnostics in developing countries and low-resource settings.

  8. Active polarization imaging system based on optical heterodyne balanced receiver

    Xu, Qian; Sun, Jianfeng; Lu, Zhiyong; Zhou, Yu; Luan, Zhu; Hou, Peipei; Liu, liren


    Active polarization imaging technology has recently become the hot research field all over the world, which has great potential application value in the military and civil area. By introducing active light source, the Mueller matrix of the target can be calculated according to the incident light and the emitted or reflected light. Compared with conventional direct detection technology, optical heterodyne detection technology have higher receiving sensitivities, which can obtain the whole amplitude, frequency and phase information of the signal light. In this paper, an active polarization imaging system will be designed. Based on optical heterodyne balanced receiver, the system can acquire the horizontal and vertical polarization of reflected optical field simultaneously, which contain the polarization characteristic of the target. Besides, signal to noise ratio and imaging distance can be greatly improved.

  9. Imaging findings in systemic childhood diseases presenting with dermatologic manifestations.

    Fink, Adam Z; Gittler, Julia K; Nakrani, Radhika N; Alis, Jonathan; Blumfield, Einat; Levin, Terry L

    Many childhood diseases often present with skin abnormalities with which radiologists are largely unfamiliar. Knowledge of associated dermatologic manifestations may aid the radiologist in confirming the diagnosis and recommending targeted imaging of affected organs. We review the imaging findings in childhood diseases associated with dermatologic manifestations. Diseases include dermatologic findings which herald underlying malignancy (Neuroblastoma, leukemia/lymphoma, Langerhans cell histiocytosis),are associated with risk of malignancy (Epidermolysis Bullosa, basal cell nevus syndrome, Cowden's syndrome, Tuberous Sclerosis),or indicate a systemic inflammatory/immune disorder (Kawasaki's disease, Henoch Schonlein Purpura, systemic lupus erythematosus, scleroderma, sarcoidosis, dermatomyositis and immune thrombocytopenic purpura). Familiarity with pertinent findings in childhood diseases presenting with dermatologic manifestations in childhood diseases aids the radiologist in confirming the diagnosis and guiding imaging workup. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Automation of chromosomes analysis. Automatic system for image processing

    Le Go, R.; Cosnac, B. de; Spiwack, A.


    The A.S.T.I. is an automatic system relating to the fast conversational processing of all kinds of images (cells, chromosomes) converted to a numerical data set (120000 points, 16 grey levels stored in a MOS memory) through a fast D.O. analyzer. The system performs automatically the isolation of any individual image, the area and weighted area of which are computed. These results are directly displayed on the command panel and can be transferred to a mini-computer for further computations. A bright spot allows parts of an image to be picked out and the results to be displayed. This study is particularly directed towards automatic karyo-typing [fr

  11. Performance Evaluation of a Biometric System Based on Acoustic Images

    Izquierdo-Fuente, Alberto; del Val, Lara; Jiménez, María I.; Villacorta, Juan J.


    An acoustic electronic scanning array for acquiring images from a person using a biometric application is developed. Based on pulse-echo techniques, multifrequency acoustic images are obtained for a set of positions of a person (front, front with arms outstretched, back and side). Two Uniform Linear Arrays (ULA) with 15 λ/2-equispaced sensors have been employed, using different spatial apertures in order to reduce sidelobe levels. Working frequencies have been designed on the basis of the main lobe width, the grating lobe levels and the frequency responses of people and sensors. For a case-study with 10 people, the acoustic profiles, formed by all images acquired, are evaluated and compared in a mean square error sense. Finally, system performance, using False Match Rate (FMR)/False Non-Match Rate (FNMR) parameters and the Receiver Operating Characteristic (ROC) curve, is evaluated. On the basis of the obtained results, this system could be used for biometric applications. PMID:22163708

  12. Performance Evaluation of a Biometric System Based on Acoustic Images

    Juan J. Villacorta


    Full Text Available An acoustic electronic scanning array for acquiring images from a person using a biometric application is developed. Based on pulse-echo techniques, multifrequency acoustic images are obtained for a set of positions of a person (front, front with arms outstretched, back and side. Two Uniform Linear Arrays (ULA with 15 l/2-equispaced sensors have been employed, using different spatial apertures in order to reduce sidelobe levels. Working frequencies have been designed on the basis of the main lobe width, the grating lobe levels and the frequency responses of people and sensors. For a case-study with 10 people, the acoustic profiles, formed by all images acquired, are evaluated and compared in a mean square error sense. Finally, system performance, using False Match Rate (FMR/False Non-Match Rate (FNMR parameters and the Receiver Operating Characteristic (ROC curve, is evaluated. On the basis of the obtained results, this system could be used for biometric applications.

  13. Toward objective and quantitative evaluation of imaging systems using images of phantoms

    Gagne, Robert M.; Gallas, Brandon D.; Myers, Kyle J.


    The use of imaging phantoms is a common method of evaluating image quality in the clinical setting. These evaluations rely on a subjective decision by a human observer with respect to the faintest detectable signal(s) in the image. Because of the variable and subjective nature of the human-observer scores, the evaluations manifest a lack of precision and a potential for bias. The advent of digital imaging systems with their inherent digital data provides the opportunity to use techniques that do not rely on human-observer decisions and thresholds. Using the digital data, signal-detection theory (SDT) provides the basis for more objective and quantitative evaluations which are independent of a human-observer decision threshold. In a SDT framework, the evaluation of imaging phantoms represents a 'signal-known-exactly/background-known-exactly' ('SKE/BKE') detection task. In this study, we compute the performance of prewhitening and nonprewhitening model observers in terms of the observer signal-to-noise ratio (SNR) for these 'SKE/BKE' tasks. We apply the evaluation methods to a number of imaging systems. For example, we use data from a laboratory implementation of digital radiography and from a full-field digital mammography system in a clinical setting. In addition, we make a comparison of our methods to human-observer scoring of a set of digital images of the CDMAM phantom available from the internet (EUREF--European Reference Organization). In the latter case, we show a significant increase in the precision of the quantitative methods versus the variability in the scores from human observers on the same set of images. As regards bias, the performance of a model observer estimated from a finite data set is known to be biased. In this study, we minimize the bias and estimate the variance of the observer SNR using statistical resampling techniques, namely, 'bootstrapping' and 'shuffling' of the data sets. Our methods provide objective and quantitative evaluation of

  14. Remote radiation imaging system using a compact gamma-ray imager mounted on a multicopter drone

    Sato, Yuki; Terasaka, Yuta; Kaburagi, Masaaki; Tanifuji, Yuta; Kawabata, Kuniaki; Miyamura, Hiroko; Torii, Tatsuo; Ozawa, Shingo; Izumi, Ryo; Suzuki, Toshikazu


    A remote radiation imaging system comprising a lightweight Compton camera and a multicopter drone was developed to remotely and quickly measure radioactive contamination inside the buildings of the Fukushima Daiichi Nuclear Power Station (FDNPS). The drone system is used for measuring detailed radiation distributions in narrow areas, which have been difficult to gauge with conventional aircraft monitoring using helicopters. A measurement of radiation distributions in outdoor environments in the coastal areas of Fukushima, Japan, was performed. The drone system with the Compton camera succeeded in remote observations of dense hotspots from the sky over a contaminated area near the FDNPS. The time required for image reconstruction is approximately 550 s in the case of a 9-m flight altitude for the hotspots with a surface dose rate of several tens of μSv/h. This drone system will be used inside the buildings of the FDNPS for remote measurement of radioactive contamination. (author)

  15. Autonomous control systems: applications to remote sensing and image processing

    Jamshidi, Mohammad


    One of the main challenges of any control (or image processing) paradigm is being able to handle complex systems under unforeseen uncertainties. A system may be called complex here if its dimension (order) is too high and its model (if available) is nonlinear, interconnected, and information on the system is uncertain such that classical techniques cannot easily handle the problem. Examples of complex systems are power networks, space robotic colonies, national air traffic control system, and integrated manufacturing plant, the Hubble Telescope, the International Space Station, etc. Soft computing, a consortia of methodologies such as fuzzy logic, neuro-computing, genetic algorithms and genetic programming, has proven to be powerful tools for adding autonomy and semi-autonomy to many complex systems. For such systems the size of soft computing control architecture will be nearly infinite. In this paper new paradigms using soft computing approaches are utilized to design autonomous controllers and image enhancers for a number of application areas. These applications are satellite array formations for synthetic aperture radar interferometry (InSAR) and enhancement of analog and digital images.

  16. Whole-body imaging of the musculoskeletal system: the value of MR imaging

    Schmidt, Gerwin P.; Reiser, Maximilian F.; Baur-Melnyk, Andrea [University Hospitals Munich/Grosshadern, LMU, Institute of Clinical Radiology, Munich (Germany)


    In clinical practice various modalities are used for whole-body imaging of the musculoskeletal system, including radiography, bone scintigraphy, computed tomography, magnetic resonance imaging (MRI), and positron emission tomography-computed tomography (PET-CT). Multislice CT is far more sensitive than radiographs in the assessment of trabecular and cortical bone destruction and allows for evaluation of fracture risk. The introduction of combined PET-CT scanners has markedly increased diagnostic accuracy for the detection of skeletal metastases compared with PET alone. The unique soft-tissue contrast of MRI enables for precise assessment of bone marrow infiltration and adjacent soft tissue structures so that alterations within the bone marrow may be detected before osseous destruction becomes apparent in CT or metabolic changes occur on bone scintigraphy or PET scan. Improvements in hard- and software, including parallel image acquisition acceleration, have made high resolution whole-body MRI clinically feasible. Whole-body MRI has successfully been applied for bone marrow screening of metastasis and systemic primary bone malignancies, like multiple myeloma. Furthermore, it has recently been proposed for the assessment of systemic bone diseases predisposing for malignancy (e.g., multiple cartilaginous exostoses) and muscle disease (e.g., muscle dystrophy). The following article gives an overview on state-of-the-art whole-body imaging of the musculoskeletal system and highlights present and potential future applications, especially in the field of whole-body MRI. (orig.)

  17. Depth imaging system for seismic reflection data. Part 1. Outline of system; Hanshaho jishin tansa data no tame no shindo imaging system. 1. System no gaiyo

    Shimizu, N [Japex Jeoscience Institute, Tokyo (Japan); Matsuoka, T [Japan Petroleum Exploration Corp., Tokyo (Japan); Tsuru, T [Japan National Oil Corp., Tokyo (Japan)


    Structures of oil and gas fields to be recently explored have changed from simple structures represented by anticline into more complicated and more delicate structures in the deeper underground. In order to discover and develop prospective oil and gas fields among such geological structures, it is indispensable to construct a system which can treat seismic exploration date collectively before stacking and can easily perform imaging of underground structures accurately. Based on the advancement of hardware, Japan National Oil Corporation and Japan Petroleum Exploration Co., Ltd. have developed a depth imaging system as an interactive tool for constructing underground structures accurately through a cooperation of highly accurate imaging technology. Using this system, two-dimensional underground structure models can be easily given and modified by interactively referring to results of depth migration velocity analysis and stacking velocity analysis, well data, cross sections after depth transform, etc. 1 fig.

  18. TL dosimetry for quality control of CR mammography imaging systems

    Gaona, E.; Nieto, J. A.; Góngora, J. A. I. D.; Arreola, M.; Enríquez, J. G. F.

    The aim of this work is to estimate the average glandular dose with thermoluminescent (TL) dosimetry and comparison with quality imaging in computed radiography (CR) mammography. For a measuring dose, the Food and Drug Administration (FDA) and the American College of Radiology (ACR) use a phantom, so that dose and image quality are assessed with the same test object. The mammography is a radiological image to visualize early biological manifestations of breast cancer. Digital systems have two types of image-capturing devices, full field digital mammography (FFDM) and CR mammography. In Mexico, there are several CR mammography systems in clinical use, but only one system has been approved for use by the FDA. Mammography CR uses a photostimulable phosphor detector (PSP) system. Most CR plates are made of 85% BaFBr and 15% BaFI doped with europium (Eu) commonly called barium flourohalideE We carry out an exploratory survey of six CR mammography units from three different manufacturers and six dedicated X-ray mammography units with fully automatic exposure. The results show three CR mammography units (50%) have a dose greater than 3.0 mGy without demonstrating improved image quality. The differences between doses averages from TLD system and dosimeter with ionization chamber are less than 10%. TLD system is a good option for average glandular dose measurement for X-rays with a HVL (0.35-0.38 mmAl) and kVp (24-26) used in quality control procedures with ACR Mammography Accreditation Phantom.

  19. Development of a new electronic neutron imaging system

    Brenizer, J.S. [Department of Mechanical, Aerospace and Nuclear Engineering, Thornton Hall, University of Virginia, Charlottesville, VA 22903-2442 (United States); Berger, H. [Industrial Quality, Inc., Gaithersburg, MD (United States); Gibbs, K.M. [Industrial Quality, Inc., Gaithersburg, MD (United States); Mengers, P. [Paultek Systems, Inc., Nevada City, CA (United States); Stebbings, C.T. [Department of Mechanical, Aerospace and Nuclear Engineering, Thornton Hall, University of Virginia, Charlottesville, VA 22903-2442 (United States); Polansky, D. [Industrial Quality, Inc., Gaithersburg, MD (United States); Rogerson, D.J. [Naval Air Warfare Center, China Lake, CA (United States)


    An electronic neutron imaging camera system was developed for use with thermal, epithermal, and fast neutrons in applications that include nondestructive inspection of explosives, corrosion, turbine blades, electronics, low Z components, etc. The neutron images are expected to provide information to supplement that available from X-ray tests. The primary camera image area was a 30x30 cm field-of-view with a spatial resolution approaching 1.6 line pairs/mm (lp/mm). The camera had a remotely changeable second lens to limit the field-of-view to 7.6x7.6 cm for high spatial resolution (at least 4 lp/mm) thermal neutron imaging, but neutron and light scatter will limit resolution for fast neutrons to about 0.5 lp/mm. Remote focus capability enhanced camera set-up for optimum operation. The 75 dB dynamic range camera system included {sup 6}Li-based screens for imaging of thermal and epithermal neutrons and ZnS(Ag)-based screens for fast neutron imaging. The fast optics was input to a Super S-25 Gen II image intensifier, fiber optically coupled to a 1134 (h)x486 (v) frame transfer CCD camera. The camera system was designed to be compatible with a Navy-sponsored accelerator neutron source. The planned neutron source is an RF quadrupole accelerator that will provide a fast neutron flux of 10{sup 7} n/cm{sup 2}-s (at a source distance of 1 m) at an energy of about 2.2 MeV and a thermal neutron flux of 10{sup 6} n/cm{sup 2}-s at a source L/D ratio of 30. The electronic camera produced good quality real-time images at these neutron levels. On-chip integration could be used to improve image quality for low flux situations. The camera and accelerator combination provided a useful non-reactor neutron inspection system.

  20. An expert image analysis system for chromosome analysis application

    Wu, Q.; Suetens, P.; Oosterlinck, A.; Van den Berghe, H.


    This paper reports a recent study on applying a knowledge-based system approach as a new attempt to solve the problem of chromosome classification. A theoretical framework of an expert image analysis system is proposed, based on such a study. In this scheme, chromosome classification can be carried out under a hypothesize-and-verify paradigm, by integrating a rule-based component, in which the expertise of chromosome karyotyping is formulated with an existing image analysis system which uses conventional pattern recognition techniques. Results from the existing system can be used to bring in hypotheses, and with the rule-based verification and modification procedures, improvement of the classification performance can be excepted

  1. Fourier transform digital holographic adaptive optics imaging system

    Liu, Changgeng; Yu, Xiao; Kim, Myung K.


    A Fourier transform digital holographic adaptive optics imaging system and its basic principles are proposed. The CCD is put at the exact Fourier transform plane of the pupil of the eye lens. The spherical curvature introduced by the optics except the eye lens itself is eliminated. The CCD is also at image plane of the target. The point-spread function of the system is directly recorded, making it easier to determine the correct guide-star hologram. Also, the light signal will be stronger at the CCD, especially for phase-aberration sensing. Numerical propagation is avoided. The sensor aperture has nothing to do with the resolution and the possibility of using low coherence or incoherent illumination is opened. The system becomes more efficient and flexible. Although it is intended for ophthalmic use, it also shows potential application in microscopy. The robustness and feasibility of this compact system are demonstrated by simulations and experiments using scattering objects. PMID:23262541

  2. Optical Imaging Sensors and Systems for Homeland Security Applications

    Javidi, Bahram


    Optical and photonic systems and devices have significant potential for homeland security. Optical Imaging Sensors and Systems for Homeland Security Applications presents original and significant technical contributions from leaders of industry, government, and academia in the field of optical and photonic sensors, systems and devices for detection, identification, prevention, sensing, security, verification and anti-counterfeiting. The chapters have recent and technically significant results, ample illustrations, figures, and key references. This book is intended for engineers and scientists in the relevant fields, graduate students, industry managers, university professors, government managers, and policy makers. Advanced Sciences and Technologies for Security Applications focuses on research monographs in the areas of -Recognition and identification (including optical imaging, biometrics, authentication, verification, and smart surveillance systems) -Biological and chemical threat detection (including bios...

  3. A System for Drawing Synthetic Images of Forested Landscapes

    Timothy P. McDonald


    A software package for drawing images of forested landscapes was developed. Programs included in the system convert topographic and stand polygon information output from a GIS into a form that can be read by a general-purpose ray-tracing renderer. Other programs generate definitions for surface features, mainly trees but ground surface textural properties as well. The...

  4. A portable microscopy system for fluorescence, polarized, and brightfield imaging

    Gordon, Paul; Wattinger, Rolla; Lewis, Cody; Venancio, Vinicius Paula; Mertens-Talcott, Susanne U.; Coté, Gerard


    The use of mobile phones to conduct diagnostic microscopy at the point-of-care presents intriguing possibilities for the advancement of high-quality medical care in remote settings. However, it is challenging to create a single device that can adapt to the ever-varying camera technologies in phones or that can image with the customization that multiple modalities require for applications such as malaria diagnosis. A portable multi-modal microscope system is presented that utilizes a Raspberry Pi to collect and transmit data wirelessly to a myriad of electronic devices for image analysis. The microscopy system is capable of providing to the user correlated brightfield, polarized, and fluorescent images of samples fixed on traditional microscopy slides. The multimodal diagnostic capabilities of the microscope were assessed by measuring parasitemia of Plasmodium falciparum-infected thin blood smears. The device is capable of detecting fluorescently-labeled DNA using FITC excitation (490 nm) and emission (525 nm), the birefringent P. falciparum byproduct hemozoin, and detecting brightfield absorption with a resolution of 0.78 micrometers (element 9-3 of a 1951 Air Force Target). This microscopy system is a novel portable imaging tool that may be a viable candidate for field implementation if challenges of system durability, cost considerations, and full automation can be overcome.

  5. Generating color terrain images in an emergency response system

    Belles, R.D.


    The Atmospheric Release Advisory Capability (ARAC) provides real-time assessments of the consequences resulting from an atmospheric release of radioactive material. In support of this operation, a system has been created which integrates numerical models, data acquisition systems, data analysis techniques, and professional staff. Of particular importance is the rapid generation of graphical images of the terrain surface in the vicinity of the accident site. A terrain data base and an associated acquisition system have been developed that provide the required terrain data. This data is then used as input to a collection of graphics programs which create and display realistic color images of the terrain. The graphics system currently has the capability of generating color shaded relief images from both overhead and perspective viewpoints within minutes. These images serve to quickly familiarize ARAC assessors with the terrain near the release location, and thus permit them to make better informed decisions in modeling the behavior of the released material. 7 refs., 8 figs

  6. Imaging in the infectious diseases of the central nervous system

    Brunet, F.; Gandon, Y.; Heautot, J.F.; Montagne, C.; Michelet, C.; Carsin, M.


    The basic signs of the major bacterial, viral, parasitic or mycotic infections of the central nervous system with CT and MRI are described. The problems arising from the presence of the HIV virus are emphasized and the attitude required according to the findings of imaging, is defined [fr

  7. Evaluation of IsoCal geometric calibration system for Varian linacs equipped with on-board imager and electronic portal imaging device imaging systems.

    Gao, Song; Du, Weiliang; Balter, Peter; Munro, Peter; Jeung, Andrew


    The purpose of this study is to evaluate the accuracy and reproducibility of the IsoCal geometric calibration system for kilovoltage (kV) and megavoltage (MV) imagers on Varian C-series linear accelerators (linacs). IsoCal calibration starts by imaging a phantom and collimator plate using MV images with different collimator angles, as well as MV and kV images at different gantry angles. The software then identifies objects on the collimator plate and in the phantom to determine the location of the treatment isocenter and its relation to the MV and kV imager centers. It calculates offsets between the positions of the imaging panels and the treatment isocenter as a function of gantry angle and writes a correction file that can be applied to MV and kV systems to correct for those offsets in the position of the panels. We performed IsoCal calibration three times on each of five Varian C-series linacs, each time with an independent setup. We then compared the IsoCal calibrations with a simplified Winston-Lutz (WL)-based system and with a Varian cubic phantom (VC)-based system. The maximum IsoCal corrections ranged from 0.7 mm to 1.5 mm for MV and 0.9 mm to 1.8 mm for kV imagers across the five linacs. The variations in the three calibrations for each linac were less than 0.2 mm. Without IsoCal correction, the WL results showed discrepancies between the treatment isocenter and the imager center of 0.9 mm to 1.6 mm (for the MV imager) and 0.5 mm to 1.1 mm (for the kV imager); with IsoCal corrections applied, the differences were reduced to 0.2 mm to 0.6 mm (MV) and 0.3 mm to 0.6 mm (kV) across the five linacs. The VC system was not as precise as the WL system, but showed similar results, with discrepancies of less than 1.0 mm when the IsoCal corrections were applied. We conclude that IsoCal is an accurate and consistent method for calibration and periodic quality assurance of MV and kV imaging systems.

  8. The fluid systems for the SLD Cherenkov ring imaging detector

    Abe, K.; Hasegawa, K.; Hasegawa, Y.; Iwasaki, Y.; Suekane, F.; Yuta, H.; Baird, K.; Jacques, P.; Kalelkar, M.; Plano, R.; Stamer, P.; Word, G.; Bean, A.; Caldwell, D.O.; Duboscq, J.; Huber, J.; Lu, A.; Mathys, L.; McHugh, S.; Yellin, S.; Ben-David, R.; Manly, S.; Snyder, J.; Turk, J.; Cavalli-Sforza, M.; Coyle, P.; Coyne, D.; Gagnon, P.; Liu, X.; Schneider, M.; Williams, D.A.; Coller, J.; Shank, J.T.; Whitaker, J.S.; d'Oliveira, A.; Johnson, R.A.; Martinez, J.; Nussbaum, M.; Santha, A.K.S.; Sokoloff, M.D.; Stockdale, I.; Wilson, R.J.


    We describe the design and operation of the fluid delivery, monitor and control systems for the SLD barrel Cherenkov Ring Imaging Detector (CRID). The systems deliver drift gas (C 2 H 6 + TMAE), radiator gas (C 5 F 12 + N 2 ) and radiator liquid (C 6 F 14 ). Measured critical quantities such as electron lifetime in the drift gas and ultra-violet (UV) transparencies of the radiator fluids, together with the operational experience, are also reported

  9. An Ultra-High Speed Whole Slide Image Viewing System

    Yukako Yagi


    Full Text Available Background: One of the goals for a Whole Slide Imaging (WSI system is implementation in the clinical practice of pathology. One of the unresolved problems in accomplishing this goal is the speed of the entire process, i.e., from viewing the slides through making the final diagnosis. Most users are not satisfied with the correct viewing speeds of available systems. We have evaluated a new WSI viewing station and tool that focuses on speed.

  10. Advances in computed radiography systems and their physical imaging characteristics

    Cowen, A.R.; Davies, A.G.; Kengyelics, S.M.


    Radiological imaging is progressing towards an all-digital future, across the spectrum of medical imaging techniques. Computed radiography (CR) has provided a ready pathway from screen film to digital radiography and a convenient entry point to PACS. This review briefly revisits the principles of modern CR systems and their physical imaging characteristics. Wide dynamic range and digital image enhancement are well-established benefits of CR, which lend themselves to improved image presentation and reduced rates of repeat exposures. However, in its original form CR offered limited scope for reducing the radiation dose per radiographic exposure, compared with screen film. Recent innovations in CR, including the use of dual-sided image readout and channelled storage phosphor have eased these concerns. For example, introduction of these technologies has improved detective quantum efficiency (DQE) by approximately 50 and 100%, respectively, compared with standard CR. As a result CR currently affords greater scope for reducing patient dose, and provides a more substantive challenge to the new solid-state, flat-panel, digital radiography detectors

  11. Implementing An Image Understanding System Architecture Using Pipe

    Luck, Randall L.


    This paper will describe PIPE and how it can be used to implement an image understanding system. Image understanding is the process of developing a description of an image in order to make decisions about its contents. The tasks of image understanding are generally split into low level vision and high level vision. Low level vision is performed by PIPE -a high performance parallel processor with an architecture specifically designed for processing video images at up to 60 fields per second. High level vision is performed by one of several types of serial or parallel computers - depending on the application. An additional processor called ISMAP performs the conversion from iconic image space to symbolic feature space. ISMAP plugs into one of PIPE's slots and is memory mapped into the high level processor. Thus it forms the high speed link between the low and high level vision processors. The mechanisms for bottom-up, data driven processing and top-down, model driven processing are discussed.

  12. Linear-constraint wavefront control for exoplanet coronagraphic imaging systems

    Sun, He; Eldorado Riggs, A. J.; Kasdin, N. Jeremy; Vanderbei, Robert J.; Groff, Tyler Dean


    A coronagraph is a leading technology for achieving high-contrast imaging of exoplanets in a space telescope. It uses a system of several masks to modify the diffraction and achieve extremely high contrast in the image plane around target stars. However, coronagraphic imaging systems are very sensitive to optical aberrations, so wavefront correction using deformable mirrors (DMs) is necessary to avoid contrast degradation in the image plane. Electric field conjugation (EFC) and Stroke minimization (SM) are two primary high-contrast wavefront controllers explored in the past decade. EFC minimizes the average contrast in the search areas while regularizing the strength of the control inputs. Stroke minimization calculates the minimum DM commands under the constraint that a target average contrast is achieved. Recently in the High Contrast Imaging Lab at Princeton University (HCIL), a new linear-constraint wavefront controller based on stroke minimization was developed and demonstrated using numerical simulation. Instead of only constraining the average contrast over the entire search area, the new controller constrains the electric field of each single pixel using linear programming, which could led to significant increases in speed of the wavefront correction and also create more uniform dark holes. As a follow-up of this work, another linear-constraint controller modified from EFC is demonstrated theoretically and numerically and the lab verification of the linear-constraint controllers is reported. Based on the simulation and lab results, the pros and cons of linear-constraint controllers are carefully compared with EFC and stroke minimization.

  13. Image processing system for the measurement of timber truck loads

    Carvalho, Fernando D.; Correia, Bento A. B.; Davies, Roger; Rodrigues, Fernando C.; Freitas, Jose C. A.


    The paper industry uses wood as its raw material. To know the quantity of wood in the pile of sawn tree trunks, every truck load entering the plant is measured to determine its volume. The objective of this procedure is to know the solid volume of wood stocked in the plant. Weighing the tree trunks has its own problems, due to their high capacity for absorbing water. Image processing techniques were used to evaluate the volume of a truck load of logs of wood. The system is based on a PC equipped with an image processing board using data flow processors. Three cameras allow image acquisition of the sides and rear of the truck. The lateral images contain information about the sectional area of the logs, and the rear image contains information about the length of the logs. The machine vision system and the implemented algorithms are described. The results being obtained with the industrial prototype that is now installed in a paper mill are also presented.

  14. Photo acoustic imaging: technology, systems and market trends

    Faucheux, Marc; d'Humières, Benoît; Cochard, Jacques


    Although the Photo Acoustic effect was observed by Graham Bell in 1880, the first applications (gas analysis) occurred in 1970's using the required energetic light pulses from lasers. During mid 1990's medical imaging research begun to use Photo Acoustic effect and in vivo images were obtained in mid-2000. Since 2009, the number of patent related to Photo Acoustic Imaging (PAI) has dramatically increased. PAI machines for pre-clinical and small animal imaging have been being used in a routine way for several years. Based on its very interesting features (non-ionizing radiation, noninvasive, high depth resolution ratio, scalability, moderate price) and because it is able to deliver not only anatomical, but functional and molecular information, PAI is a very promising clinical imaging modality. It penetrates deeper into tissue than OCT (Optical Coherence Tomography) and provides a higher resolution than ultrasounds. The PAI is one of the most growing imaging modality and some innovative clinical systems are planned to be on market in 2017. Our study analyzes the different approaches such as photoacoustic computed tomography, 3D photoacoustic microscopy, multispectral photoacoustic tomography and endoscopy with the recent and tremendous technological progress over the past decade: advances in image reconstruction algorithms, laser technology, ultrasound detectors and miniaturization. We analyze which medical domains and applications are the most concerned and explain what should be the forthcoming medical system in the near future. We segment the market in four parts: Components and R&D, pre-clinical, analytics, clinical. We analyzed what should be, quantitatively and qualitatively, the PAI medical markets in each segment and its main trends. We point out the market accessibility (patents, regulations, clinical evaluations, clinical acceptance, funding). In conclusion, we explain the main market drivers and challenges to overcome and give a road map for medical

  15. Automated Image Acquisition System for the Verification of Copper-Brass Seal Images

    Stringa, E.; Bergonzi, C.; Littmann, F.; ); Marszalek, Y.; Tempesta, S.; )


    This paper describes a system for the verification of copper-brass seals realized by JRC according to DG ENER requirements. DG ENER processes about 20,000 metal seals per year. The verification of metal seals consists in visually checking the identity of a removed seal. The identity of a copper-brass seal is defined by a random stain pattern realized by the seal producer together with random scratches engraved when the seals are initialized ('seal production'). In order to verify that the seal returned from the field is the expected one its pattern is compared with an image taken during seal production. Formerly, seal initialization and verification were very heavy tasks as seal pictures were acquired with a camera one by one both in the initialization and verification stages. During the initialization the Nuclear Safeguards technicians had to place one by one new seals under a camera and acquire the related reference images. During the verification, the technician had to take used seals and place them one by one under a camera to take new pictures. The new images were presented to the technicians without any preprocessing and the technicians had to recognize the seal. The new station described in this paper has an automated image acquisition system allowing to easily process seals in batches of 100 seals. To simplify the verification, a software automatically centres and rotates the newly acquired seal image in order to perfectly overlap with the reference image acquired during the production phase. The new system significantly speeds up seal production and helps particularly with the demanding task of seal verification. As a large part of the seals is dealt with by a joint Euratom-IAEA team, the IAEA directly profits from this development. The new tool has been in routine use since mid 2013. (author)

  16. High-speed photoacoustic imaging using an LED-based photoacoustic imaging system

    Sato, Naoto; Kuniyil Ajith Singh, Mithun; Shigeta, Yusuke; Hanaoka, Takamitsu; Agano, Toshitaka


    Recently we developed a multispectral LED-based photoacoustic/ultrasound imaging system (AcousticX) and have been continuously working on its technical/functional improvements. AcousticX is a linear array ultrasound transducer (128 elements, 10 MHz)-based system in which LED arrays (selectable wavelengths, pulse repetition frequency: 4 kHz, pulse width: tunable from 40 - 100 ns) are fixed on both sides of the transducer to illuminate the tissue for photoacoustic imaging. The ultrasound/photoacoustic data from all 128 elements can be simultaneously acquired, processed and displayed. We already demonstrated our system's capability to perform photoacoustic/ultrasound imaging for dynamic imaging of the tissue at a frame rate of 10 Hz (for example to visualize the pulsation of arteries in vivo in human subjects). In this work, we present the development of a new high-speed imaging mode in AcousticX. In this mode, instead of toggling between ultrasound and photoacoustic measurements, it is possible to continuously acquire only photoacoustic data for 1.5 seconds with a time interval of 1 ms. With this improvement, we can record photoacoustic signals from the whole aperture (38 mm) at fast rate and can be reviewed later at different speeds for analyzing dynamic changes in the photoacoustic signals. We believe that AcousticX with this new high-speed mode opens up a feasible technical path for multiple dynamic studies, for example one which focus on imaging the response of voltage sensitive dyes. We envisage to improve the acquisition speed further in future for exploring ultra-high-speed applications.

  17. A Hybrid DWT-SVD Image-Coding System (HDWTSVD for Color Images

    Humberto Ochoa


    Full Text Available In this paper, we propose the HDWTSVD system to encode color images. Before encoding, the color components (RGB are transformed into YCbCr. Cb and Cr components are downsampled by a factor of two, both horizontally and vertically, before sending them through the encoder. A criterion based on the average standard deviation of 8x8 subblocks of the Y component is used to choose DWT or SVD for all the components. Standard test images are compressed based on the proposed algorithm.

  18. Modulation of the semantic system by word imageability.

    Sabsevitz, D S; Medler, D A; Seidenberg, M; Binder, J R


    A prevailing neurobiological theory of semantic memory proposes that part of our knowledge about concrete, highly imageable concepts is stored in the form of sensory-motor representations. While this theory predicts differential activation of the semantic system by concrete and abstract words, previous functional imaging studies employing this contrast have provided relatively little supporting evidence. We acquired event-related functional magnetic resonance imaging (fMRI) data while participants performed a semantic similarity judgment task on a large number of concrete and abstract noun triads. Task difficulty was manipulated by varying the degree to which the words in the triad were similar in meaning. Concrete nouns, relative to abstract nouns, produced greater activation in a bilateral network of multimodal and heteromodal association areas, including ventral and medial temporal, posterior-inferior parietal, dorsal prefrontal, and posterior cingulate cortex. In contrast, abstract nouns produced greater activation almost exclusively in the left hemisphere in superior temporal and inferior frontal cortex. Increasing task difficulty modulated activation mainly in attention, working memory, and response monitoring systems, with almost no effect on areas that were modulated by imageability. These data provide critical support for the hypothesis that concrete, imageable concepts activate perceptually based representations not available to abstract concepts. In contrast, processing abstract concepts makes greater demands on left perisylvian phonological and lexical retrieval systems. The findings are compatible with dual coding theory and less consistent with single-code models of conceptual representation. The lack of overlap between imageability and task difficulty effects suggests that once the neural representation of a concept is activated, further maintenance and manipulation of that information in working memory does not further increase neural activation in

  19. apART: system for the acquisition, processing, archiving, and retrieval of digital images in an open, distributed imaging environment

    Schneider, Uwe; Strack, Ruediger


    apART reflects the structure of an open, distributed environment. According to the general trend in the area of imaging, network-capable, general purpose workstations with capabilities of open system image communication and image input are used. Several heterogeneous components like CCD cameras, slide scanners, and image archives can be accessed. The system is driven by an object-oriented user interface where devices (image sources and destinations), operators (derived from a commercial image processing library), and images (of different data types) are managed and presented uniformly to the user. Browsing mechanisms are used to traverse devices, operators, and images. An audit trail mechanism is offered to record interactive operations on low-resolution image derivatives. These operations are processed off-line on the original image. Thus, the processing of extremely high-resolution raster images is possible, and the performance of resolution dependent operations is enhanced significantly during interaction. An object-oriented database system (APRIL), which can be browsed, is integrated into the system. Attribute retrieval is supported by the user interface. Other essential features of the system include: implementation on top of the X Window System (X11R4) and the OSF/Motif widget set; a SUN4 general purpose workstation, inclusive ethernet, magneto optical disc, etc., as the hardware platform for the user interface; complete graphical-interactive parametrization of all operators; support of different image interchange formats (GIF, TIFF, IIF, etc.); consideration of current IPI standard activities within ISO/IEC for further refinement and extensions.

  20. A Development of Hybrid Drug Information System Using Image Recognition

    HwaMin Lee


    Full Text Available In order to prevent drug abuse or misuse cases and avoid over-prescriptions, it is necessary for medicine taker to be provided with detailed information about the medicine. In this paper, we propose a drug information system and develop an application to provide information through drug image recognition using a smartphone. We designed a contents-based drug image search algorithm using the color, shape and imprint of drug. Our convenient application can provide users with detailed information about drugs and prevent drug misuse.

  1. Magneto-optical system for high speed real time imaging

    Baziljevich, M.; Barness, D.; Sinvani, M.; Perel, E.; Shaulov, A.; Yeshurun, Y.


    A new magneto-optical system has been developed to expand the range of high speed real time magneto-optical imaging. A special source for the external magnetic field has also been designed, using a pump solenoid to rapidly excite the field coil. Together with careful modifications of the cryostat, to reduce eddy currents, ramping rates reaching 3000 T/s have been achieved. Using a powerful laser as the light source, a custom designed optical assembly, and a high speed digital camera, real time imaging rates up to 30 000 frames per seconds have been demonstrated.

  2. Image processing. Volumetric analysis with a digital image processing system. [GAMMA]. Bildverarbeitung. Volumetrie mittels eines digitalen Bildverarbeitungssystems

    Kindler, M; Radtke, F; Demel, G


    The book is arranged in seven sections, describing various applications of volumetric analysis using image processing systems, and various methods of diagnostic evaluation of images obtained by gamma scintigraphy, cardic catheterisation, and echocardiography. A dynamic ventricular phantom is explained that has been developed for checking and calibration for safe examination of patient, the phantom allowing extensive simulation of volumetric and hemodynamic conditions of the human heart: One section discusses the program development for image processing, referring to a number of different computer systems. The equipment described includes a small non-expensive PC system, as well as a standardized nuclear medical diagnostic system, and a computer system especially suited to image processing.

  3. Augmented reality based real-time subcutaneous vein imaging system.

    Ai, Danni; Yang, Jian; Fan, Jingfan; Zhao, Yitian; Song, Xianzheng; Shen, Jianbing; Shao, Ling; Wang, Yongtian


    A novel 3D reconstruction and fast imaging system for subcutaneous veins by augmented reality is presented. The study was performed to reduce the failure rate and time required in intravenous injection by providing augmented vein structures that back-project superimposed veins on the skin surface of the hand. Images of the subcutaneous vein are captured by two industrial cameras with extra reflective near-infrared lights. The veins are then segmented by a multiple-feature clustering method. Vein structures captured by the two cameras are matched and reconstructed based on the epipolar constraint and homographic property. The skin surface is reconstructed by active structured light with spatial encoding values and fusion displayed with the reconstructed vein. The vein and skin surface are both reconstructed in the 3D space. Results show that the structures can be precisely back-projected to the back of the hand for further augmented display and visualization. The overall system performance is evaluated in terms of vein segmentation, accuracy of vein matching, feature points distance error, duration times, accuracy of skin reconstruction, and augmented display. All experiments are validated with sets of real vein data. The imaging and augmented system produces good imaging and augmented reality results with high speed.

  4. Ion beam induced fluorescence imaging in biological systems

    Bettiol, Andrew A.; Mi, Zhaohong; Vanga, Sudheer Kumar; Chen, Ce-belle; Tao, Ye; Watt, Frank


    Imaging fluorescence generated by MeV ions in biological systems such as cells and tissue sections requires a high resolution beam (<100 nm), a sensitive detection system and a fluorescent probe that has a high quantum efficiency and low bleaching rate. For cutting edge applications in bioimaging, the fluorescence imaging technique needs to break the optical diffraction limit allowing for sub-cellular structure to be visualized, leading to a better understanding of cellular function. In a nuclear microprobe this resolution requirement can be readily achieved utilizing low beam current techniques such as Scanning Transmission Ion Microscopy (STIM). In recent times, we have been able to extend this capability to fluorescence imaging through the development of a new high efficiency fluorescence detection system, and through the use of new novel fluorescent probes that are resistant to ion beam damage (bleaching). In this paper we demonstrate ion beam induced fluorescence imaging in several biological samples, highlighting the advantages and challenges associated with using this technique

  5. A radiographic image archive system on digital optical disks

    Mankovich, N.J.; Taira, R.K.; Cho, P.S.; Wong, W.K.; Stewart, B.K.; Huang, H.K.


    The recent introduction of projection computed radiography (CR) systems allows radiology departments to consider digital operation in over 90% of performed procedures. Ideally, current patient procedures from CT, CT, and MR along with laser-digitized historical films should be centrally stored at their full digital resolution. Magnetic disks, because of their limited storage capacity and expense, can only retain these data on a limited basis. The author devised an optical disk archive system which automatically stores images directly onto 2.6-gigabyte optical cartridges without recourse to film. This system is in full clinical operation in the UCLA Pediatric Radiology Section of the authors' department. From this experience they present (a) an analysis of the digital archiving requirements of the Pediatric Radiology Section based on CR, CT, MR, and laser digitized films; (b) the archive and retrieval methods along with performance statistics; and (c) the procedure for assuring digital image integrity

  6. Portable remote sensing image processing system; Kahangata remote sensing gazo shori system

    Fujikawa, S; Uchida, K; Tanaka, S; Jingo, H [Dowa Engineering Co. Ltd., Tokyo (Japan); Hato, M [Earth Remote Sensing Data Analysis Center, Tokyo (Japan)


    Recently, geological analysis using remote sensing data has been put into practice due to data with high spectral resolution and high spatial resolution. There has been a remarkable increase in both software and hardware of personal computer. Software is independent of hardware due to Windows. It has become easy to develop softwares. Under such situation, a portable remote sensing image processing system coping with Window 95 has been developed. Using this system, basic image processing can be conducted, and present location can be displayed on the image in real time by linking with GPS. Accordingly, it is not required to bring printed images for the field works of image processing. This system can be used instead of topographic maps for overseas surveys. Microsoft Visual C++ ver. 2.0 is used for the software. 1 fig.

  7. Towards eye-safe standoff Raman imaging systems

    Glimtoft, Martin; Bââth, Petra; Saari, Heikki; Mäkynen, Jussi; Näsilä, Antti; Östmark, Henric


    Standoff Raman imaging systems have shown the ability to detect single explosives particles. However, in many cases, the laser intensities needed restrict the applications where they can be safely used. A new generation imaging Raman system has been developed based on a 355 nm UV laser that, in addition to eye safety, allows discrete and invisible measurements. Non-dangerous exposure levels for the eye are several orders of magnitude higher in UVA than in the visible range that previously has been used. The UV Raman system has been built based on an UV Fabry-Perot Interferometer (UV-FPI) developed by VTT. The design allows for precise selection of Raman shifts in combination with high out-of-band blocking. The stable operation of the UV-FPI module under varying environmental conditions is arranged by controlling the temperature of the module and using a closed loop control of the FPI air gap based on capacitive measurement. The system presented consists of a 3rd harmonics Nd:YAG laser with 1.5 W average output at 1000 Hz, a 200 mm Schmidt-Cassegrain telescope, UV-FPI filter and an ICCD camera for signal gating and detection. The design principal leads to a Raman spectrum in each image pixel. The system is designed for field use and easy manoeuvring. Preliminary results show that in measurements of <60 s on 10 m distance, single AN particles of <300 μm diameter can be identified.

  8. Active multispectral imaging system for photodiagnosis and personalized phototherapies

    Ugarte, M. F., E-mail:, E-mail:; Chávarri, L.; Padrón, V. M. [Industrial Engineering Department, Universidad Europea de Madrid, C/ Tajo, s/n 28670 Villaviciosa de Odón, Madrid (Spain); Briz, S., E-mail:, E-mail: [Physics Department, Universidad Carlos III de Madrid, Avda. de la Universidad, 30,28911 Leganés, Madrid (Spain); García-Cuesta, E. [Computer Science and Telecommunications Department, Universidad Europea de Madrid, C/ Tajo, s/n 28670 Villaviciosa de Odón, Madrid (Spain)


    The proposed system has been designed to identify dermatopathologies or to apply personalized phototherapy treatments. The system emits electromagnetic waves in different spectral bands in the range of visible and near infrared to irradiate the target (skin or any other object) to be spectrally characterized. Then, an imaging sensor measures the target response to the stimulus at each spectral band and, after processing, the system displays in real time two images. In one of them the value of each pixel corresponds to the more reflected wavenumber whereas in the other image the pixel value represents the energy absorbed at each band. The diagnosis capability of this system lies in its multispectral design, and the phototherapy treatments are adapted to the patient and his lesion by measuring his absorption capability. This “in situ” absorption measurement allows us to determine the more appropriate duration of the treatment according to the wavelength and recommended dose. The main advantages of this system are its low cost, it does not have moving parts or complex mechanisms, it works in real time, and it is easy to handle. For these reasons its widespread use in dermatologist consultation would facilitate the work of the dermatologist and would improve the efficiency of diagnosis and treatment. In fact the prototype has already been successfully applied to pathologies such as carcinomas, melanomas, keratosis, and nevi.

  9. Active multispectral imaging system for photodiagnosis and personalized phototherapies

    Ugarte, M. F.; Chávarri, L.; Padrón, V. M.; Briz, S.; García-Cuesta, E.


    The proposed system has been designed to identify dermatopathologies or to apply personalized phototherapy treatments. The system emits electromagnetic waves in different spectral bands in the range of visible and near infrared to irradiate the target (skin or any other object) to be spectrally characterized. Then, an imaging sensor measures the target response to the stimulus at each spectral band and, after processing, the system displays in real time two images. In one of them the value of each pixel corresponds to the more reflected wavenumber whereas in the other image the pixel value represents the energy absorbed at each band. The diagnosis capability of this system lies in its multispectral design, and the phototherapy treatments are adapted to the patient and his lesion by measuring his absorption capability. This “in situ” absorption measurement allows us to determine the more appropriate duration of the treatment according to the wavelength and recommended dose. The main advantages of this system are its low cost, it does not have moving parts or complex mechanisms, it works in real time, and it is easy to handle. For these reasons its widespread use in dermatologist consultation would facilitate the work of the dermatologist and would improve the efficiency of diagnosis and treatment. In fact the prototype has already been successfully applied to pathologies such as carcinomas, melanomas, keratosis, and nevi

  10. Study on image quality and dosage comparison of F/S system and DR system

    Kim, Sun Chil; Jung, Jae Eun


    Currently, many hospital are hastening to introduce digital radiography systems. This is a direct result of the intentions to improve medical services and to digitalized radiology information systems, and is also leading to the improvement of medical imaging technology. Throughout F/S system's long history, many people have researched the image quality and dosage concerning these systems, and as a result, huge improvements in the dosage of patients were possible. Similarly, I believe that DR systems need the same kind of effort. Of course, decreases in dosage that ignore image quality are unthinkable. The results of experiments conducted by five hospitals during a period of 3 months brought to us the conclusions listed below. Based on the comparison and analysis of the exposure control of F/S systems and DR systems, DR systems generally showed higher exposure control for parts of the phantom that became thicker, and the exposure control improved rapidly as the thickness increased. DR systems still proved to be somewhat deficient in resolution measurements compared to existing F/S systems. The image processing part of DR systems contributed much to these result. Under conditions used clinically, the dosage measurements of DR systems were generally higher regardless of region. According to the evaluation of image quality, DR systems showed a higher degree of satisfaction as the thickness of the region became thinner. As mentioned above and based on the mutual relationship experiments between the dosage and image quality of F/S systems and DR systems, research to increase the satisfaction of DR systems must be considered

  11. MR imaging of the pediatric central nervous system utilization review

    Barnes, P.D.; Prince, J.R.; Galloway, D.C.; Ross-Duggan, J.; Lester, P.D.; Yamanashi, W.S.


    MR has been done in over 500 pediatric and adolescent patients (ages 5 days to 20 years) with central nervous system (CNS) disease (brain, n = 331; spine, n = 218), including high-field and special coil application in 362 cases. T1-weighted, multiplanar MR imaging provides superior anatomic delineation of organogenetic CNS malformations, while multiparameter (T1, T2, p) MR is usually necessary for more complete characterization of histogenetic malformations, as well as acquired conditions. MR imaging is a desirable method for the initial and definitive evaluation of many cranial and spinal conditions of childhood (more-invasive procedures were obviated in 164 patients). CT or other modalities may be added when MR imaging does not satisfy the clinical query

  12. Backscatter absorption gas imaging systems and light sources therefore

    Kulp, Thomas Jan [Livermore, CA; Kliner, Dahv A. V. [San Ramon, CA; Sommers, Ricky [Oakley, CA; Goers, Uta-Barbara [Campbell, NY; Armstrong, Karla M [Livermore, CA


    The location of gases that are not visible to the unaided human eye can be determined using tuned light sources that spectroscopically probe the gases and cameras that can provide images corresponding to the absorption of the gases. The present invention is a light source for a backscatter absorption gas imaging (BAGI) system, and a light source incorporating the light source, that can be used to remotely detect and produce images of "invisible" gases. The inventive light source has a light producing element, an optical amplifier, and an optical parametric oscillator to generate wavelength tunable light in the IR. By using a multi-mode light source and an amplifier that operates using 915 nm pump sources, the power consumption of the light source is reduced to a level that can be operated by batteries for long periods of time. In addition, the light source is tunable over the absorption bands of many hydrocarbons, making it useful for detecting hazardous gases.

  13. A global "imaging'' view on systems approaches in immunology.

    Ludewig, Burkhard; Stein, Jens V; Sharpe, James; Cervantes-Barragan, Luisa; Thiel, Volker; Bocharov, Gennady


    The immune system exhibits an enormous complexity. High throughput methods such as the "-omic'' technologies generate vast amounts of data that facilitate dissection of immunological processes at ever finer resolution. Using high-resolution data-driven systems analysis, causal relationships between complex molecular processes and particular immunological phenotypes can be constructed. However, processes in tissues, organs, and the organism itself (so-called higher level processes) also control and regulate the molecular (lower level) processes. Reverse systems engineering approaches, which focus on the examination of the structure, dynamics and control of the immune system, can help to understand the construction principles of the immune system. Such integrative mechanistic models can properly describe, explain, and predict the behavior of the immune system in health and disease by combining both higher and lower level processes. Moving from molecular and cellular levels to a multiscale systems understanding requires the development of methodologies that integrate data from different biological levels into multiscale mechanistic models. In particular, 3D imaging techniques and 4D modeling of the spatiotemporal dynamics of immune processes within lymphoid tissues are central for such integrative approaches. Both dynamic and global organ imaging technologies will be instrumental in facilitating comprehensive multiscale systems immunology analyses as discussed in this review. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Modeling digital breast tomosynthesis imaging systems for optimization studies

    Lau, Beverly Amy

    Digital breast tomosynthesis (DBT) is a new imaging modality for breast imaging. In tomosynthesis, multiple images of the compressed breast are acquired at different angles, and the projection view images are reconstructed to yield images of slices through the breast. One of the main problems to be addressed in the development of DBT is the optimal parameter settings to obtain images ideal for detection of cancer. Since it would be unethical to irradiate women multiple times to explore potentially optimum geometries for tomosynthesis, it is ideal to use a computer simulation to generate projection images. Existing tomosynthesis models have modeled scatter and detector without accounting for oblique angles of incidence that tomosynthesis introduces. Moreover, these models frequently use geometry-specific physical factors measured from real systems, which severely limits the robustness of their algorithms for optimization. The goal of this dissertation was to design the framework for a computer simulation of tomosynthesis that would produce images that are sensitive to changes in acquisition parameters, so an optimization study would be feasible. A computer physics simulation of the tomosynthesis system was developed. The x-ray source was modeled as a polychromatic spectrum based on published spectral data, and inverse-square law was applied. Scatter was applied using a convolution method with angle-dependent scatter point spread functions (sPSFs), followed by scaling using an angle-dependent scatter-to-primary ratio (SPR). Monte Carlo simulations were used to generate sPSFs for a 5-cm breast with a 1-cm air gap. Detector effects were included through geometric propagation of the image onto layers of the detector, which were blurred using depth-dependent detector point-spread functions (PRFs). Depth-dependent PRFs were calculated every 5-microns through a 200-micron thick CsI detector using Monte Carlo simulations. Electronic noise was added as Gaussian noise as a

  15. Advances in study of molecular imaging reporte gene systems

    Wu Tao; An Rui


    The use of molecular imaging reporter gene systems has allowed gene therapy to move from the laboratory to the clinical application, which provides methodology to monitor the expression of therapeutic gene noninvasively and achieve quantitative outcome in vivo. Recently, the radionuclide reporter gene still is the focus many studies, but MRI and optical reporter gene have gradually played a important part in reporter gene systems. On the basis of combination of multi-subject, for example applied chemistry and molecular biology, more and more new modified reporter genes and molecular probes have spread out. This paper mainly introduces the advantages and disadvantages of reporter gene system and development trends. (authors)

  16. Skin condition measurement by using multispectral imaging system (Conference Presentation)

    Jung, Geunho; Kim, Sungchul; Kim, Jae Gwan


    There are a number of commercially available low level light therapy (LLLT) devices in a market, and face whitening or wrinkle reduction is one of targets in LLLT. The facial improvement could be known simply by visual observation of face, but it cannot provide either quantitative data or recognize a subtle change. Clinical diagnostic instruments such as mexameter can provide a quantitative data, but it costs too high for home users. Therefore, we designed a low cost multi-spectral imaging device by adding additional LEDs (470nm, 640nm, white LED, 905nm) to a commercial USB microscope which has two LEDs (395nm, 940nm) as light sources. Among various LLLT skin treatments, we focused on getting melanin and wrinkle information. For melanin index measurements, multi-spectral images of nevus were acquired and melanin index values from color image (conventional method) and from multi-spectral images were compared. The results showed that multi-spectral analysis of melanin index can visualize nevus with a different depth and concentration. A cross section of wrinkle on skin resembles a wedge which can be a source of high frequency components when the skin image is Fourier transformed into a spatial frequency domain map. In that case, the entropy value of the spatial frequency map can represent the frequency distribution which is related with the amount and thickness of wrinkle. Entropy values from multi-spectral images can potentially separate the percentage of thin and shallow wrinkle from thick and deep wrinkle. From the results, we found that this low cost multi-spectral imaging system could be beneficial for home users of LLLT by providing the treatment efficacy in a quantitative way.

  17. Bioluminescent system for dynamic imaging of cell and animal behavior

    Hara-Miyauchi, Chikako [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Laboratory for Cell Function Dynamics, Brain Science Institute, RIKEN, Saitama 351-0198 (Japan); Department of Biophysics and Biochemistry, Graduate School of Health Care Sciences, Tokyo Medical and Dental University, Tokyo 113-8510 (Japan); Tsuji, Osahiko [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Hanyu, Aki [Division of Biochemistry, The Cancer Institute of the Japanese Foundation for Cancer Research, Tokyo 135-8550 (Japan); Okada, Seiji [Department of Advanced Medical Initiatives, Faculty of Medical Sciences, Kyushu University, Fukuoka 812-8582 (Japan); Yasuda, Akimasa [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Fukano, Takashi [Laboratory for Cell Function Dynamics, Brain Science Institute, RIKEN, Saitama 351-0198 (Japan); Akazawa, Chihiro [Department of Biophysics and Biochemistry, Graduate School of Health Care Sciences, Tokyo Medical and Dental University, Tokyo 113-8510 (Japan); Nakamura, Masaya [Department of Orthopedic Surgery, Keio University School of Medicine, Tokyo 160-8582 (Japan); Imamura, Takeshi [Department of Molecular Medicine for Pathogenesis, Ehime University Graduate School of Medicine, Toon, Ehime 791-0295 (Japan); Core Research for Evolutional Science and Technology, The Japan Science and Technology Corporation, Tokyo 135-8550 (Japan); Matsuzaki, Yumi [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Okano, Hirotaka James, E-mail: [Department of Physiology, Keio University School of Medicine, Tokyo 160-8582 (Japan); Division of Regenerative Medicine Jikei University School of Medicine, Tokyo 150-8461 (Japan); and others


    Highlights: Black-Right-Pointing-Pointer We combined a yellow variant of GFP and firefly luciferase to make ffLuc-cp156. Black-Right-Pointing-Pointer ffLuc-cp156 showed improved photon yield in cultured cells and transgenic mice. Black-Right-Pointing-Pointer ffLuc-cp156 enabled video-rate bioluminescence imaging of freely-moving animals. Black-Right-Pointing-Pointer ffLuc-cp156 mice enabled tracking real-time drug delivery in conscious animals. -- Abstract: The current utility of bioluminescence imaging is constrained by a low photon yield that limits temporal sensitivity. Here, we describe an imaging method that uses a chemiluminescent/fluorescent protein, ffLuc-cp156, which consists of a yellow variant of Aequorea GFP and firefly luciferase. We report an improvement in photon yield by over three orders of magnitude over current bioluminescent systems. We imaged cellular movement at high resolution including neuronal growth cones and microglial cell protrusions. Transgenic ffLuc-cp156 mice enabled video-rate bioluminescence imaging of freely moving animals, which may provide a reliable assay for drug distribution in behaving animals for pre-clinical studies.

  18. An Automated, Image Processing System for Concrete Evaluation

    Baumgart, C.W.; Cave, S.P.; Linder, K.E.


    Allied Signal Federal Manufacturing ampersand Technologies (FM ampersand T) was asked to perform a proof-of-concept study for the Missouri Highway and Transportation Department (MHTD), Research Division, in June 1997. The goal of this proof-of-concept study was to ascertain if automated scanning and imaging techniques might be applied effectively to the problem of concrete evaluation. In the current evaluation process, a concrete sample core is manually scanned under a microscope. Voids (or air spaces) within the concrete are then detected visually by a human operator by incrementing the sample under the cross-hairs of a microscope and by counting the number of ''pixels'' which fall within a void. Automation of the scanning and image analysis processes is desired to improve the speed of the scanning process, to improve evaluation consistency, and to reduce operator fatigue. An initial, proof-of-concept image analysis approach was successfully developed and demonstrated using acquired black and white imagery of concrete samples. In this paper, the automated scanning and image capture system currently under development will be described and the image processing approach developed for the proof-of-concept study will be demonstrated. A development update and plans for future enhancements are also presented

  19. Bioluminescent system for dynamic imaging of cell and animal behavior

    Hara-Miyauchi, Chikako; Tsuji, Osahiko; Hanyu, Aki; Okada, Seiji; Yasuda, Akimasa; Fukano, Takashi; Akazawa, Chihiro; Nakamura, Masaya; Imamura, Takeshi; Matsuzaki, Yumi; Okano, Hirotaka James


    Highlights: ► We combined a yellow variant of GFP and firefly luciferase to make ffLuc-cp156. ► ffLuc-cp156 showed improved photon yield in cultured cells and transgenic mice. ► ffLuc-cp156 enabled video-rate bioluminescence imaging of freely-moving animals. ► ffLuc-cp156 mice enabled tracking real-time drug delivery in conscious animals. -- Abstract: The current utility of bioluminescence imaging is constrained by a low photon yield that limits temporal sensitivity. Here, we describe an imaging method that uses a chemiluminescent/fluorescent protein, ffLuc-cp156, which consists of a yellow variant of Aequorea GFP and firefly luciferase. We report an improvement in photon yield by over three orders of magnitude over current bioluminescent systems. We imaged cellular movement at high resolution including neuronal growth cones and microglial cell protrusions. Transgenic ffLuc-cp156 mice enabled video-rate bioluminescence imaging of freely moving animals, which may provide a reliable assay for drug distribution in behaving animals for pre-clinical studies.

  20. The impact of mammographic imaging systems on density measurement

    Damases, Christine N.; Brennan, Patrick C.; McEntee, Mark F.


    The purpose of this study is to investigate whether having a mammogram on differing manufacturer equipment will affect a woman's breast density (BD) measurement. The data set comprised of 40 cases, each containing a combined image of the left craniocaudal (LCC) and left mediolateral oblique (LMLO). These images were obtained from 20 women age between 42-89 years. The images were acquired on two imaging systems (GE and Hologic) one year apart. Volumetric BD was assessed by using Volpara Density Grade (VDG) and average BD% (AvBD%). Twenty American Board of Radiology (ABR) examiners assessed the same images using the BIRADS BD scale 1-4. Statistical comparisons were performed on the means using Mann-Whitney, on correlation using Spearman's rank coefficient of correlation and agreement using Cohen's Kappa. The absolute median BIRADS difference between GE and Hologic was 0.225 (2.00 versus 2.00; pperfect agreement for VDG (κ=0.933; p<0.001).

  1. Image restoration for civil engineering structure monitoring using imaging system embedded on UAV

    Vozel, Benoit; Dumoulin, Jean; Chehdi, Kacem


    Nowadays, civil engineering structures are periodically surveyed by qualified technicians (i.e. alpinist) operating visual inspection using heavy mechanical pods. This method is far to be safe, not only for civil engineering structures monitoring staff, but also for users. Due to the unceasing traffic increase, making diversions or closing lanes on bridge becomes more and more difficult. New inspection methods have to be found. One of the most promising technique is to develop inspection method using images acquired by a dedicated monitoring system operating around the civil engineering structures, without disturbing the traffic. In that context, the use of images acquired with an UAV, which fly around the structures is of particular interest. The UAV can be equipped with different vision system (digital camera, infrared sensor, video, etc.). Nonetheless, detection of small distresses on images (like cracks of 1 mm or less) depends on image quality, which is sensitive to internal parameters of the UAV (vibration modes, video exposure times, etc.) and to external parameters (turbulence, bad illumination of the scene, etc.). Though progresses were made at UAV level and at sensor level (i.e. optics), image deterioration is still an open problem. These deteriorations are mainly represented by motion blur that can be coupled with out-of-focus blur and observation noise on acquired images. In practice, deteriorations are unknown if no a priori information is available or dedicated additional instrumentation is set-up at UAV level. Image restoration processing is therefore required. This is a difficult problem [1-3] which has been intensively studied over last decades [4-12]. Image restoration can be addressed by following a blind approach or a myopic one. In both cases, it includes two processing steps that can be implemented in sequential or alternate mode. The first step carries out the identification of the blur impulse response and the second one makes use of this

  2. Design and development of an airborne multispectral imaging system

    Kulkarni, Rahul R.; Bachnak, Rafic; Lyle, Stacey; Steidley, Carl W.


    Advances in imaging technology and sensors have made airborne remote sensing systems viable for many applications that require reasonably good resolution at low cost. Digital cameras are making their mark on the market by providing high resolution at very high rates. This paper describes an aircraft-mounted imaging system (AMIS) that is being designed and developed at Texas A&M University-Corpus Christi (A&M-CC) with the support of a grant from NASA. The approach is to first develop and test a one-camera system that will be upgraded into a five-camera system that offers multi-spectral capabilities. AMIS will be low cost, rugged, portable and has its own battery power source. Its immediate use will be to acquire images of the Coastal area in the Gulf of Mexico for a variety of studies covering vast spectra from near ultraviolet region to near infrared region. This paper describes AMIS and its characteristics, discusses the process for selecting the major components, and presents the progress.

  3. Color management systems: methods and technologies for increased image quality

    Caretti, Maria


    All the steps in the imaging chain -- from handling the originals in the prepress to outputting them on any device - - have to be well calibrated and adjusted to each other, in order to reproduce color images in a desktop environment as accurate as possible according to the original. Today most of the steps in the prepress production are digital and therefore it is realistic to believe that the color reproduction can be well controlled. This is true thanks to the last years development of fast, cost effective scanners, digital sources and digital proofing devices not the least. It is likely to believe that well defined tools and methods to control this imaging flow will lead to large cost and time savings as well as increased overall image quality. Until now, there has been a lack of good, reliable, easy-to- use systems (e.g. hardware, software, documentation, training and support) in an extent that has made them accessible to the large group of users of graphic arts production systems. This paper provides an overview of the existing solutions to manage colors in a digital pre-press environment. Their benefits and limitations are discussed as well as how they affect the production workflow and organization. The difference between a color controlled environment and one that is not is explained.

  4. Switching theory-based steganographic system for JPEG images

    Cherukuri, Ravindranath C.; Agaian, Sos S.


    Cellular communications constitute a significant portion of the global telecommunications market. Therefore, the need for secured communication over a mobile platform has increased exponentially. Steganography is an art of hiding critical data into an innocuous signal, which provide answers to the above needs. The JPEG is one of commonly used format for storing and transmitting images on the web. In addition, the pictures captured using mobile cameras are in mostly in JPEG format. In this article, we introduce a switching theory based steganographic system for JPEG images which is applicable for mobile and computer platforms. The proposed algorithm uses the fact that energy distribution among the quantized AC coefficients varies from block to block and coefficient to coefficient. Existing approaches are effective with a part of these coefficients but when employed over all the coefficients they show there ineffectiveness. Therefore, we propose an approach that works each set of AC coefficients with different frame work thus enhancing the performance of the approach. The proposed system offers a high capacity and embedding efficiency simultaneously withstanding to simple statistical attacks. In addition, the embedded information could be retrieved without prior knowledge of the cover image. Based on simulation results, the proposed method demonstrates an improved embedding capacity over existing algorithms while maintaining a high embedding efficiency and preserving the statistics of the JPEG image after hiding information.

  5. Brain magnetic resonance imaging findings in patients with systemic sclerosis.

    Mohamed, Reem H A; Nassef, Amr A


    Systemic sclerosis is a multisystem disease where functional and structural abnormalities of small blood vessels prevail. Recently, transient ischemic attacks, ischemic stroke, and hemorrhages have been reported as primary consequence of vascular central nervous system affection in systemic sclerosis. Magnetic resonance imaging (MRI) is considered to be the most sensitive diagnostic technique for detecting symptomatic and asymptomatic lesions in the brain in cases of multifocal diseases. Evaluate brain changes in patients with systemic sclerosis using MRI. Thirty female patients with systemic sclerosis aged 27-61 years, with disease duration of 1-9 years and with no history of other systemic disease or cerebrovascular accidents, were enrolled. An age-matched female control group of 30 clinically normal subjects, underwent brain MR examination. Central nervous system involvement in the form of white matter hyperintense foci of variable sizes were found in significantly abundant forms in systemic sclerosis patients on MR evaluation than in the age-related control group, signifying a form of central nervous system vasculopathy. Such foci showed no definite correlation with disease duration, yet they showed significant correlation to severity of peripheral vascular disease, headaches, fainting attacks and depression in the group under study. Asymptomatic as well as symptomatic central nervous system ischemic vasculopathy is not uncommon in systemic sclerosis patients and MRI is considered a sensitive noninvasive screening tool for early detection of CNS involvement in patients with systemic sclerosis.

  6. Functional MR imaging on an open 1T MR imaging system: exploiting the advantages of an open MR imaging system for functional MR imaging

    van de Giessen, E.; Groot, P. F. C.; Booij, J.; van den Brink, W.; Veltman, D. J.; Nederveen, A. J.


    Open MR imaging scanners are designed for imaging of specific patient groups that cannot be routinely scanned with conventional MR imaging scanners (eg, patients with obesity and claustrophobia). This study aims to determine whether BOLD sensitivity on an open 1T scanner is adequate for fMRI for

  7. CMOS Image Sensor and System for Imaging Hemodynamic Changes in Response to Deep Brain Stimulation.

    Zhang, Xiao; Noor, Muhammad S; McCracken, Clinton B; Kiss, Zelma H T; Yadid-Pecht, Orly; Murari, Kartikeya


    Deep brain stimulation (DBS) is a therapeutic intervention used for a variety of neurological and psychiatric disorders, but its mechanism of action is not well understood. It is known that DBS modulates neural activity which changes metabolic demands and thus the cerebral circulation state. However, it is unclear whether there are correlations between electrophysiological, hemodynamic and behavioral changes and whether they have any implications for clinical benefits. In order to investigate these questions, we present a miniaturized system for spectroscopic imaging of brain hemodynamics. The system consists of a 144 ×144, [Formula: see text] pixel pitch, high-sensitivity, analog-output CMOS imager fabricated in a standard 0.35 μm CMOS process, along with a miniaturized imaging system comprising illumination, focusing, analog-to-digital conversion and μSD card based data storage. This enables stand alone operation without a computer, nor electrical or fiberoptic tethers. To achieve high sensitivity, the pixel uses a capacitive transimpedance amplifier (CTIA). The nMOS transistors are in the pixel while pMOS transistors are column-parallel, resulting in a fill factor (FF) of 26%. Running at 60 fps and exposed to 470 nm light, the CMOS imager has a minimum detectable intensity of 2.3 nW/cm(2) , a maximum signal-to-noise ratio (SNR) of 49 dB at 2.45 μW/cm(2) leading to a dynamic range (DR) of 61 dB while consuming 167 μA from a 3.3 V supply. In anesthetized rats, the system was able to detect temporal, spatial and spectral hemodynamic changes in response to DBS.

  8. Micro and nano devices in passive millimetre wave imaging systems

    Appleby, R.


    The impact of micro and nano technology on millimetre wave imaging from the post war years to the present day is reviewed. In the 1950s whisker contacted diodes in mixers and vacuum tubes were used to realise both radiometers and radars but required considerable skill to realise the performance needed. Development of planar semiconductor devices such as Gunn and Schottky diodes revolutionised mixer performance and provided considerable improvement. The next major breakthrough was high frequency transistors based on gallium arsenide which were initially used at intermediate frequencies but later after further development at millimeter wave frequencies. More recently Monolithic Microwave Integrated circuits(MMICs) offer exceptional performance and the opportunity for innovative design in passive imaging systems. In the future the use of micro and nano technology will continue to drive system performance and we can expect to see integration of antennae, millimetre wave and sub millimetre wave circuits and signal processing.

  9. The OMERACT rheumatoid arthritis magnetic resonance imaging (MRI) scoring system

    Østergaard, Mikkel; Peterfy, Charles G.; Bird, Paul


    Objective: The Outcome Measures in Rheumatology (OMERACT) Rheumatoid Arthritis (RA) Magnetic Resonance Imaging (MRI) scoring system (RAMRIS), evaluating bone erosion, bone marrow edema/osteitis, and synovitis, was introduced in 2002, and is now the standard method of objectively quantifying...... inflammation and damage by MRI in RA trials. The objective of this paper was to identify subsequent advances and based on them, to provide updated recommendations for the RAMRIS. Methods: MRI studies relevant for RAMRIS and technical and scientific advances were analyzed by the OMERACT MRI in Arthritis Working...... Group, which used these data to provide updated considerations on image acquisition, RAMRIS definitions, and scoring systems for the original and new RA pathologies. Further, a research agenda was outlined. Results: Since 2002, longitudinal studies and clinical trials have documented RAMRIS variables...

  10. Target plane imaging system for the Nova laser

    Swift, C.D.; Bliss, E.S.; Jones, W.A.; Reeves, R.J.; Seppala, L.G.; Shelton, R.T.; VanArsdall, P.J.


    The Nova laser, in operation since December 1984, is capable of irradiating targets with light at 1.05 μm, 0.53 μm, and 0.35 μm. Correct alignment of these harmonic beams uses a system called a target plane imager (TPI). It is a large microscope (four meters long, weighing one thousand kilograms) that relays images from the target chamber center to a video optics module located on the outside of the chamber. Several modes of operation are possible including: near-field viewing and far-field viewing at three magnifications and three wavelengths. In addition, the entire instrument can be scanned in X,Y,Z to examine various planes near chamber center. Performance of this system and its computer controls will be described

  11. Digital optical tomography system for dynamic breast imaging

    Flexman, Molly L.; Khalil, Michael A.; Al Abdi, Rabah; Kim, Hyun K.; Fong, Christopher J.; Desperito, Elise; Hershman, Dawn L.; Barbour, Randall L.; Hielscher, Andreas H.


    Diffuse optical tomography has shown promising results as a tool for breast cancer screening and monitoring response to chemotherapy. Dynamic imaging of the transient response of the breast to an external stimulus, such as pressure or a respiratory maneuver, can provide additional information that can be used to detect tumors. We present a new digital continuous-wave optical tomography system designed to simultaneously image both breasts at fast frame rates and with a large number of sources and detectors. The system uses a master-slave digital signal processor-based detection architecture to achieve a dynamic range of 160 dB and a frame rate of 1.7 Hz with 32 sources, 64 detectors, and 4 wavelengths per breast. Included is a preliminary study of one healthy patient and two breast cancer patients showing the ability to identify an invasive carcinoma based on the hemodynamic response to a breath hold.

  12. Electronic bulletin board system for image and information exchange

    Halama, J.R.; Henkin, R.E.; Wagner, R.H.


    This paper provides nuclear medicine professionals access to an electronic bulletin board (EBB) for image and information exchange. EBB users access the system remotely via modem and personal computer. A public message board is maintained containing messages posted by users. New messages or replies to existing messages may be posted. A public library board contains documents and images for users to access by transmitting them locally for off-line review. Comments and replies may be posted in the library board. New files may be posted in the library at any time. The EBB programs were developed on a multi-user computer system, allowing simultaneous access of users and on-line conferencing among active users

  13. Depth-resolved ballistic imaging in a low-depth-of-field optical Kerr gated imaging system

    Zheng, Yipeng; Tan, Wenjiang, E-mail:; Si, Jinhai; Ren, YuHu; Xu, Shichao; Hou, Xun [Key Laboratory for Physical Electronics and Devices of the Ministry of Education and Shaanxi Key Lab of Information Photonic Technique, School of Electronics and Information Engineering, Xi' an Jiaotong University, Xianning-xilu 28, Xi' an 710049 (China); Tong, Junyi [Departments of Applied Physics, Xi' an University of Technology, Xi' an 710048 (China)


    We demonstrate depth-resolved imaging in a ballistic imaging system, in which a heterodyned femtosecond optical Kerr gate is introduced to extract useful imaging photons for detecting an object hidden in turbid media and a compound lens is proposed to ensure both the depth-resolved imaging capability and the long working distance. Two objects of about 15-μm widths hidden in a polystyrene-sphere suspension have been successfully imaged with approximately 600-μm depth resolution. Modulation-transfer-function curves with the object in and away from the object plane have also been measured to confirm the depth-resolved imaging capability of the low-depth-of-field (low-DOF) ballistic imaging system. This imaging approach shows potential for application in research of the internal structure of highly scattering fuel spray.

  14. Impulse radar imaging system for concealed object detection

    Podd, F. J. W.; David, M.; Iqbal, G.; Hussain, F.; Morris, D.; Osakue, E.; Yeow, Y.; Zahir, S.; Armitage, D. W.; Peyton, A. J.


    Electromagnetic systems for imaging concealed objects at checkpoints typically employ radiation at millimetre and terahertz frequencies. These systems have been shown to be effective and provide a sufficiently high resolution image. However there are difficulties and current electromagnetic systems have limitations particularly in accurately differentiating between threat and innocuous objects based on shape, surface emissivity or reflectivity, which are indicative parameters. In addition, water has a high absorption coefficient at millimetre wavelength and terahertz frequencies, which makes it more difficult for these frequencies to image through thick damp clothing. This paper considers the potential of using ultra wideband (UWB) in the low gigahertz range. The application of this frequency band to security screening appears to be a relatively new field. The business case for implementing the UWB system has been made financially viable by the recent availability of low-cost integrated circuits operating at these frequencies. Although designed for the communication sector, these devices can perform the required UWB radar measurements as well. This paper reports the implementation of a 2 to 5 GHz bandwidth linear array scanner. The paper describes the design and fabrication of transmitter and receiver antenna arrays whose individual elements are a type of antipodal Vivaldi antenna. The antenna's frequency and angular response were simulated in CST Microwave Studio and compared with laboratory measurements. The data pre-processing methods of background subtraction and deconvolution are implemented to improve the image quality. The background subtraction method uses a reference dataset to remove antenna crosstalk and room reflections from the dataset. The deconvolution method uses a Wiener filter to "sharpen" the returned echoes which improves the resolution of the reconstructed image. The filter uses an impulse response reference dataset and a signal

  15. Tracker: Image-Processing and Object-Tracking System Developed

    Klimek, Robert B.; Wright, Theodore W.


    extracting numerical instrumentation data that are embedded in images. All the results are saved in files for further data reduction and graphing. There are currently three Tracking Systems (workstations) operating near the laboratories and offices of Lewis Microgravity Science Division researchers. These systems are used independently by students, scientists, and university-based principal investigators. The researchers bring their tapes or films to the workstation and perform the tracking analysis. The resultant data files generated by the tracking process can then be analyzed on the spot, although most of the time researchers prefer to transfer them via the network to their offices for further analysis or plotting. In addition, many researchers have installed Tracker on computers in their office for desktop analysis of digital image sequences, which can be digitized by the Tracking System or some other means. Tracker has not only provided a capability to efficiently and automatically analyze large volumes of data, saving many hours of tedious work, but has also provided new capabilities to extract valuable information and phenomena that was heretofore undetected and unexploited.

  16. The Advanced Gamma-ray Imaging System (AGIS): Simulation Studies

    Fegan, Stephen; Buckley, J. H.; Bugaev, S.; Funk, S.; Konopelko, A.; Maier, G.; Vassiliev, V. V.; Simulation Studies Working Group; AGIS Collaboration


    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation instrument in ground-based very high energy gamma-ray astronomy. It has the goal of achieving significant improvement in sensitivity over current experiments. We present the results of simulation studies of various possible designs for AGIS. The primary characteristics of the array performance, collecting area, angular resolution, background rejection, and sensitivity are discussed.

  17. The Advanced Gamma-ray Imaging System (AGIS): Simulation Studies

    Maier, G.; Collaboration, for the AGIS


    The Advanced Gamma-ray Imaging System (AGIS) is a next-generation ground-based gamma-ray observatory being planned in the U.S. The anticipated sensitivity of AGIS is about one order of magnitude better than the sensitivity of current observatories, allowing it to measure gammaray emmission from a large number of Galactic and extra-galactic sources. We present here results of simulation studies of various possible designs for AGIS. The primary characteristics of the array performance - collect...

  18. Biomedical image acquisition system using a gamma camera

    Jara B, A.T.; Sevillano, J.; Del Carpio S, J.A.


    A gamma camera images PC acquisition board has been developed. The digital system has been described using VHDL and has been synthesized and implemented in a Altera Max7128S CPLD and two PALs 16L8. The use of programmable-logic technologies has afforded a higher scale integration and a reduction of the digital delays and also has allowed us to modify and bring up to date the entire digital design easily. (orig.)

  19. Implementation of real-time digital endoscopic image processing system

    Song, Chul Gyu; Lee, Young Mook; Lee, Sang Min; Kim, Won Ky; Lee, Jae Ho; Lee, Myoung Ho


    Endoscopy has become a crucial diagnostic and therapeutic procedure in clinical areas. Over the past four years, we have developed a computerized system to record and store clinical data pertaining to endoscopic surgery of laparascopic cholecystectomy, pelviscopic endometriosis, and surgical arthroscopy. In this study, we developed a computer system, which is composed of a frame grabber, a sound board, a VCR control board, a LAN card and EDMS. Also, computer system controls peripheral instruments such as a color video printer, a video cassette recorder, and endoscopic input/output signals. Digital endoscopic data management system is based on open architecture and a set of widely available industry standards; namely Microsoft Windows as an operating system, TCP/IP as a network protocol and a time sequential database that handles both images and speech. For the purpose of data storage, we used MOD and CD- R. Digital endoscopic system was designed to be able to store, recreate, change, and compress signals and medical images. Computerized endoscopy enables us to generate and manipulate the original visual document, making it accessible to a virtually unlimited number of physicians.

  20. An expert system for the interpretation of cranial CTSCAN images

    Kumar, R.; Srihari, S.N.


    An experimental system for Interpretation of Cranial CT SCAN Images has been developed. Given a Cranial CT SCAN slice of a patient the system (which is an artificial intelligence (AI) based computer program) finds and labels neuroanatomical landmarks e.g. skull bone, CSF cavities, tissue and distinct abnormalities, present within the CT slice. If abnormalities are found, the system determines the kind of abnormality present e.g. hematoma, tumor, edema, etc., and where the abnormality was detected. The system described is a rule-based one. The rules are knowledge engineered from the radiologist. The system can be viewed as a series of mappings beginning from the matrix of ct numbers, representing a ct slice of a patient, to a symbolic description of the image in terms of black and white regions and their properties. The rules operate on this symbolic description and diagnose each region to be normal or abnormal, and if abnormal then the kind of abnormality present. The system developed so far is an experimental one and far from routine clinical applications. Essentially, the report presents a frame-work for labeling regions in each ct slice

  1. Performances of different digital mammography imaging systems: Evaluation and comparison

    Bisogni, M.G. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy)]. E-mail:; Bulajic, D. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); International Centre for Theoretical Physics, Trieste (Italy); Delogu, P. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); Fantacci, M.E. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); Novelli, M. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); Quattrocchi, M. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); Rosso, V. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy); Stefanini, A. [Dipartimento di Fisica ' E. Fermi' , Universita di Pisa, e Sezione INFN di Pisa, Pisa (Italy)


    Digital mammography is entering routine clinical use and many commercial systems are now in use in the radiological units for screening and diagnostic mammography. At the same time, the research in the digital mammography field is very active in the development of more and more performing devices. In this paper we present the performance of single photon counting pixel detectors (MedipixI) tailored for digital mammographic applications. These devices are based on semiconductor (Si and GaAs) pixel detectors of different thickness, read-out by custom designed integrated circuits. To assess the imaging capability of such systems, the images of a mammographic phantom have been acquired in standard conditions for a clinical examination. The signal-to-noise ratio (SNR) of details simulating tumor masses has been evaluated. The same phantom has been also radiographed by three different commercial digital mammographic systems in the same reference conditions and a comparison in terms of SNR has been carried out. The spatial resolution of the single photon counting systems has also been evaluated by measuring the line spread function with the edge technique and then calculating the Modulation Transfer Function (MTF). The MTFs of the single photon counting systems have been compared with the MTFs of the commercial systems.

  2. Performances of different digital mammography imaging systems: Evaluation and comparison

    Bisogni, M.G.; Bulajic, D.; Delogu, P.; Fantacci, M.E.; Novelli, M.; Quattrocchi, M.; Rosso, V.; Stefanini, A.


    Digital mammography is entering routine clinical use and many commercial systems are now in use in the radiological units for screening and diagnostic mammography. At the same time, the research in the digital mammography field is very active in the development of more and more performing devices. In this paper we present the performance of single photon counting pixel detectors (MedipixI) tailored for digital mammographic applications. These devices are based on semiconductor (Si and GaAs) pixel detectors of different thickness, read-out by custom designed integrated circuits. To assess the imaging capability of such systems, the images of a mammographic phantom have been acquired in standard conditions for a clinical examination. The signal-to-noise ratio (SNR) of details simulating tumor masses has been evaluated. The same phantom has been also radiographed by three different commercial digital mammographic systems in the same reference conditions and a comparison in terms of SNR has been carried out. The spatial resolution of the single photon counting systems has also been evaluated by measuring the line spread function with the edge technique and then calculating the Modulation Transfer Function (MTF). The MTFs of the single photon counting systems have been compared with the MTFs of the commercial systems

  3. [Development of image quality assurance support system using image recognition technology in radiography in lacked images of chest and abdomen].

    Shibuya, Toru; Kato, Kyouichi; Eshima, Hidekazu; Sumi, Shinichirou; Kubo, Tadashi; Ishida, Hideki; Nakazawa, Yasuo


    In order to provide a precise radiography for diagnosis, it is required that we avoid radiography with defects by having enough evaluation. Conventionally, evaluation was performed only by observation of a radiological technologist (RT). The evaluation support system was developed for providing a high quality assurance without depending on RT observation only. The evaluation support system, called as the Image Quality Assurance Support System (IQASS), is characterized in that "image recognition technology" for the purpose of diagnostic radiography of chest and abdomen areas. The technique of the system used in this study. Of the 259 samples of posterior-anterior (AP) chest, lateral chest, and upright abdominal x-rays, the sensitivity and specificity was 93.1% and 91.8% in the chest AP, 93.3% and 93.6% in the chest lateral, and 95.0% and 93.8% in the upright abdominal x-rays. In the light of these results, it is suggested that AIQAS could be applied to practical usage for the RT.

  4. The Advanced Gamma-Ray Imaging System (AGIS)

    Otte, Nepomuk

    The Advanced Gamma-ray Imaging System (AGIS) is a concept for the next generation of imag-ing atmospheric Cherenkov telescope arrays. It has the goal of providing an order of magnitude increase in sensitivity for Very High Energy Gamma-ray ( 100 GeV to 100 TeV) astronomy compared to currently operating arrays such as CANGAROO, HESS, MAGIC, and VERITAS. After an overview of the science such an array would enable, we discuss the development of the components of the telescope system that are required to achieve the sensitivity goal. AGIS stresses improvements in several areas of IACT technology including component reliability as well as exploring cost reduction possibilities in order to achieve its goal. We discuss alterna-tives for the telescopes and positioners: a novel Schwarzschild-Couder telescope offering a wide field of view with a relatively smaller plate scale, and possibilities for rapid slewing in order to address the search for and/or study of Gamma-ray Bursts in the VHE gamma-ray regime. We also discuss options for a high pixel count camera system providing the necessary finer solid angle per pixel and possibilities for a fast topological trigger that would offer improved realtime background rejection and lower energy thresholds.

  5. Image-Based 3D Face Modeling System

    Vladimir Vezhnevets


    Full Text Available This paper describes an automatic system for 3D face modeling using frontal and profile images taken by an ordinary digital camera. The system consists of four subsystems including frontal feature detection, profile feature detection, shape deformation, and texture generation modules. The frontal and profile feature detection modules automatically extract the facial parts such as the eye, nose, mouth, and ear. The shape deformation module utilizes the detected features to deform the generic head mesh model such that the deformed model coincides with the detected features. A texture is created by combining the facial textures augmented from the input images and the synthesized texture and mapped onto the deformed generic head model. This paper provides a practical system for 3D face modeling, which is highly automated by aggregating, customizing, and optimizing a bunch of individual computer vision algorithms. The experimental results show a highly automated process of modeling, which is sufficiently robust to various imaging conditions. The whole model creation including all the optional manual corrections takes only 2∼3 minutes.

  6. Constraint processing in our extensible language for cooperative imaging system

    Aoki, Minoru; Murao, Yo; Enomoto, Hajime


    The extensible WELL (Window-based elaboration language) has been developed using the concept of common platform, where both client and server can communicate with each other with support from a communication manager. This extensible language is based on an object oriented design by introducing constraint processing. Any kind of services including imaging in the extensible language is controlled by the constraints. Interactive functions between client and server are extended by introducing agent functions including a request-respond relation. Necessary service integrations are satisfied with some cooperative processes using constraints. Constraints are treated similarly to data, because the system should have flexibilities in the execution of many kinds of services. The similar control process is defined by using intentional logic. There are two kinds of constraints, temporal and modal constraints. Rendering the constraints, the predicate format as the relation between attribute values can be a warrant for entities' validity as data. As an imaging example, a processing procedure of interaction between multiple objects is shown as an image application for the extensible system. This paper describes how the procedure proceeds in the system, and that how the constraints work for generating moving pictures.

  7. An image analyzer system for the analysis of nuclear traces

    Cuapio O, A.


    Inside the project of nuclear traces and its application techniques to be applied in the detection of nuclear reactions of low section (non detectable by conventional methods), in the study of accidental and personal neutron dosemeters, and other but, are developed. All these studies are based on the fact that the charged particles leave latent traces of dielectric that if its are engraved with appropriate chemical solutions its are revealed until becoming visible to the optical microscope. From the analysis of the different trace forms, it is possible to obtain information of the characteristic parameters of the incident particles (charge, mass and energy). Of the density of traces it is possible to obtain information of the flow of the incident radiation and consequently of the received dose. For carry out this analysis has been designed and coupled different systems, that it has allowed the solution of diverse outlined problems. Notwithstanding it has been detected that to make but versatile this activity is necessary to have an Image Analyzer System that allow us to digitize, to process and to display the images with more rapidity. The present document, presents the proposal to carry out the acquisition of the necessary components for to assembling an Image Analyzing System, like support to the mentioned project. (Author)

  8. Biometric iris image acquisition system with wavefront coding technology

    Hsieh, Sheng-Hsun; Yang, Hsi-Wen; Huang, Shao-Hung; Li, Yung-Hui; Tien, Chung-Hao


    Biometric signatures for identity recognition have been practiced for centuries. Basically, the personal attributes used for a biometric identification system can be classified into two areas: one is based on physiological attributes, such as DNA, facial features, retinal vasculature, fingerprint, hand geometry, iris texture and so on; the other scenario is dependent on the individual behavioral attributes, such as signature, keystroke, voice and gait style. Among these features, iris recognition is one of the most attractive approaches due to its nature of randomness, texture stability over a life time, high entropy density and non-invasive acquisition. While the performance of iris recognition on high quality image is well investigated, not too many studies addressed that how iris recognition performs subject to non-ideal image data, especially when the data is acquired in challenging conditions, such as long working distance, dynamical movement of subjects, uncontrolled illumination conditions and so on. There are three main contributions in this paper. Firstly, the optical system parameters, such as magnification and field of view, was optimally designed through the first-order optics. Secondly, the irradiance constraints was derived by optical conservation theorem. Through the relationship between the subject and the detector, we could estimate the limitation of working distance when the camera lens and CCD sensor were known. The working distance is set to 3m in our system with pupil diameter 86mm and CCD irradiance 0.3mW/cm2. Finally, We employed a hybrid scheme combining eye tracking with pan and tilt system, wavefront coding technology, filter optimization and post signal recognition to implement a robust iris recognition system in dynamic operation. The blurred image was restored to ensure recognition accuracy over 3m working distance with 400mm focal length and aperture F/6.3 optics. The simulation result as well as experiment validates the proposed code

  9. Portable multiwire proportional chamber imaging system for high resolution 125I imaging

    Lazewatsky, J.L.; Lanza, R.C.; Murray, B.W.; Bolon, C.; Burns, R.E.; Szulc, M.


    A dedicated multiwire proportional chamber system designed to image 125 I labeled venous thrombi is described. The chamber is filled with a Kr-Co 2 gas mixture at one atmosphere pressure and utilizes an externally mounted delay line readout. A pair of crossed x-ray grids form a collimator which yields an optimum system efficiency of 3.1 x 10 -4 for a fixed spatial resolution of 0.74 cm. The chamber is further designed to be lightweight and portable for in-hospital use

  10. A new image navigation system for MR-guided cryosurgery

    Mogami, Takuji; Dohi, Michiko; Harada, Junta


    The purpose of this study was to evaluate the feasibility of Interactive Scan Control (ISC), a new MR image navigation system, during percutaneous puncture in cryosurgery. With the ISC system in place, percutaneous MR-guided cryosurgery was performed in 26 cases, with the ISC system being used in 11 cases (five renal tumors, three uterine fibroids and three metastatic liver tumors). The ISC system comprised infrared cameras and an MR-compatible optical tracking tool that was directly connected to a cryoprobe. Tumor sizes ranged from 1.2 cm (metastatic liver tumor) to 9.0 cm (uterine fibroid), for a mean size of 3.9 cm. With ISC, one to three cryoprobes with a diameter of 2 mm or 3 mm were advanced into the tumors with the guidance of an MR fluoroscopic image. Two freeze-thaw cycles were used for cryosurgery. During the cryosurgery, the formation of iceballs was monitored on MR images. Follow-up dynamic CT or MRI as well as physical examinations were conducted after two weeks and six weeks. Placement of probes was successfully performed under the control of the ISC system. During cryosurgery, engulfment of the tumors by iceballs was carefully monitored by MRI. Necrosis of the cryoablated area was confirmed in all renal tumors by follow-up dynamic CT. The size regression of the uterine fibroids was observed through follow-up MRI. Two of the three cases of metastatic liver tumor were ablated completely. Additional therapy for a residual tumor was performed on one patient with a metastatic liver tumor. A small amount of pneumothorax was the only complication found in a patient with a metastatic liver tumor. MR-guided cryosurgery with this new navigation system was feasible with low morbidity and allowed for safe and accurate puncture with a cryoprobe. (author)

  11. Standard practice for determining relative image quality response of industrial radiographic imaging systems

    American Society for Testing and Materials. Philadelphia


    1.1 This standard provides a practice whereby industrial radiographic imaging systems may be comparatively assessed using the concept of relative image quality response (RIQR). The RIQR method presented within this practice is based upon the use of equivalent penetrameter sensitivity (EPS) described within Practice E 1025 and subsection 5.2 of this practice. Figure 1 illustrates a relative image quality indicator (RIQI) that has four different steel plaque thicknesses (.015, .010, .008, and .005 in.) sequentially positioned (from top to bottom) on a ¾-in. thick steel plate. The four plaques contain a total of 14 different arrays of penetrameter-type hole sizes designed to render varied conditions of threshold visibility ranging from 1.92 % EPS (at the top) to .94 % EPS (at the bottom) when exposed to nominal 200 keV X-ray radiation. Each “EPS” array consists of 30 identical holes; thus, providing the user with a quantity of threshold sensitivity levels suitable for relative image qualitative response com...

  12. Imaging system for obtaining space- and time-resolved plasma images on TMX

    Koehler, H.A.; Frerking, C.E.


    A Reticon 50 x 50 photodiode array camera has been placed on Livermore's Tandem Mirror Experiment to view a 56-cm diameter plasma source of visible, vacuum-ultraviolet, and x-ray photons. The compact camera views the source through a pinhole, filters, a fiber optic coupler, a microchannel plate intensifier (MCPI), and a reducer. The images are digitized (at 3.3 MHz) and stored in a large, high-speed memory that has a capacity of 45 images. A local LSI-11 microprocessor provides immediate processing and display of the data. The data are also stored on floppy disks that can be further processed on the large Livermore Computer System. The temporal resolution is limited by the fastest MCPI gate. The number of images recorded is determined by the read-out time of the Reticon camera (minimum 0.9 msec). The spatial resolution of approximately 1.4 cm is fixed by the geometry and the pinhole of 0.025 cm. Typical high-quality color representation of some plasma images are included

  13. Application of image simulation in weapon system development

    Willers, CJ


    Full Text Available systems. Index Terms—image simulation, scene modelling, weapon eval- uation, infrared I. INTRODUCTION Simulation is used increasingly to support military system development throughout all the product life cycle phases, from concept analysis... the theoretical models. The signature 0 2 4 6 8 10 12 14 0 0.1 0.2 0.3 0.4 0.5 Wavelength [ m]� Tr a n sm itt an ce Path length = 10 000 m Sub-arctic Summer: 14 C ambient, 75% RH, Navy maritime aerosol, 23 km visibility Very high humidity: 35 C...

  14. Data acquisition system for a proton imaging apparatus

    Sipala, V; Bruzzi, M; Bucciolini, M; Candiano, G; Capineri, L; Cirrone, G A P; Civinini, C; Cuttone, G; Lo Presti, D; Marrazzo, L; Mazzaglia, E; Menichelli, D; Randazzo, N; Talamonti, C; Tesi, M; Valentini, S


    New developments in the proton-therapy field for cancer treatments, leaded Italian physics researchers to realize a proton imaging apparatus consisting of a silicon microstrip tracker to reconstruct the proton trajectories and a calorimeter to measure their residual energy. For clinical requirements, the detectors used and the data acquisition system should be able to sustain about 1 MHz proton rate. The tracker read-out, using an ASICs developed by the collaboration, acquires the signals detector and sends data in parallel to an FPGA. The YAG:Ce calorimeter generates also the global trigger. The data acquisition system and the results obtained in the calibration phase are presented and discussed.

  15. A novel fusion imaging system for endoscopic ultrasound

    Gruionu, Lucian Gheorghe; Saftoiu, Adrian; Gruionu, Gabriel


    BACKGROUND AND OBJECTIVE: Navigation of a flexible endoscopic ultrasound (EUS) probe inside the gastrointestinal (GI) tract is problematic due to the small window size and complex anatomy. The goal of the present study was to test the feasibility of a novel fusion imaging (FI) system which uses...... time was 24.6 ± 6.6 min, while the time to reach the clinical target was 8.7 ± 4.2 min. CONCLUSIONS: The FI system is feasible for clinical use, and can reduce the learning curve for EUS procedures and improve navigation and targeting in difficult anatomic locations....

  16. Imaging the glutamatergic system in vivo - relevance to schizophrenia

    Bressan, R.A.; Pilowsky, L.S. [Inst. of Psychiatry, London (United Kingdom); Inst. of Nuclear Medicine, University College of London Medical School (United Kingdom)


    Schizophrenia is a devastating psychiatric illness. Its pathophysiology is not fully clarified. Animal data, in vitro and indirect in vivo imaging support glutamatergic N-methyl-D-aspartate (NMDA) receptor hypofunction in the disorder. A lack of suitable ligands has obstructed direct evaluation of the NMDA receptor hypofunction hypothesis of schizophrenia. Many research groups are working towards developing appropriate single-photon emission tomography and positron emission tomography ligands for the NMDA receptor. This paper briefly presents evidence for links between glutamatergic system dysfunction and schizophrenia. It reviews the radioligands to evaluate glutamatergic receptors in vivo and discusses issues in developing novel ligands for the glutamatergic system. (orig.)

  17. Imaging the glutamatergic system in vivo - relevance to schizophrenia

    Bressan, R.A.; Pilowsky, L.S.


    Schizophrenia is a devastating psychiatric illness. Its pathophysiology is not fully clarified. Animal data, in vitro and indirect in vivo imaging support glutamatergic N-methyl-D-aspartate (NMDA) receptor hypofunction in the disorder. A lack of suitable ligands has obstructed direct evaluation of the NMDA receptor hypofunction hypothesis of schizophrenia. Many research groups are working towards developing appropriate single-photon emission tomography and positron emission tomography ligands for the NMDA receptor. This paper briefly presents evidence for links between glutamatergic system dysfunction and schizophrenia. It reviews the radioligands to evaluate glutamatergic receptors in vivo and discusses issues in developing novel ligands for the glutamatergic system. (orig.)

  18. Application of object modeling technique to medical image retrieval system

    Teshima, Fumiaki; Abe, Takeshi


    This report describes the results of discussions on the object-oriented analysis methodology, which is one of the object-oriented paradigms. In particular, we considered application of the object modeling technique (OMT) to the analysis of a medical image retrieval system. The object-oriented methodology places emphasis on the construction of an abstract model from real-world entities. The effectiveness of and future improvements to OMT are discussed from the standpoint of the system's expandability. These discussions have elucidated that the methodology is sufficiently well-organized and practical to be applied to commercial products, provided that it is applied to the appropriate problem domain. (author)

  19. Calibration, Projection, and Final Image Products of MESSENGER's Mercury Dual Imaging System

    Denevi, Brett W.; Chabot, Nancy L.; Murchie, Scott L.; Becker, Kris J.; Blewett, David T.; Domingue, Deborah L.; Ernst, Carolyn M.; Hash, Christopher D.; Hawkins, S. Edward; Keller, Mary R.; Laslo, Nori R.; Nair, Hari; Robinson, Mark S.; Seelos, Frank P.; Stephens, Grant K.; Turner, F. Scott; Solomon, Sean C.


    We present an overview of the operations, calibration, geodetic control, photometric standardization, and processing of images from the Mercury Dual Imaging System (MDIS) acquired during the orbital phase of the MESSENGER spacecraft's mission at Mercury (18 March 2011-30 April 2015). We also provide a summary of all of the MDIS products that are available in NASA's Planetary Data System (PDS). Updates to the radiometric calibration included slight modification of the frame-transfer smear correction, updates to the flat fields of some wide-angle camera (WAC) filters, a new model for the temperature dependence of narrow-angle camera (NAC) and WAC sensitivity, and an empirical correction for temporal changes in WAC responsivity. Further, efforts to characterize scattered light in the WAC system are described, along with a mosaic-dependent correction for scattered light that was derived for two regional mosaics. Updates to the geometric calibration focused on the focal lengths and distortions of the NAC and all WAC filters, NAC-WAC alignment, and calibration of the MDIS pivot angle and base. Additionally, two control networks were derived so that the majority of MDIS images can be co-registered with sub-pixel accuracy; the larger of the two control networks was also used to create a global digital elevation model. Finally, we describe the image processing and photometric standardization parameters used in the creation of the MDIS advanced products in the PDS, which include seven large-scale mosaics, numerous targeted local mosaics, and a set of digital elevation models ranging in scale from local to global.

  20. Automated endoscopic navigation and advisory system from medical image

    Kwoh, Chee K.; Khan, Gul N.; Gillies, Duncan F.


    In this paper, we present a review of the research conducted by our group to design an automatic endoscope navigation and advisory system. The whole system can be viewed as a two-layer system. The first layer is at the signal level, which consists of the processing that will be performed on a series of images to extract all the identifiable features. The information is purely dependent on what can be extracted from the 'raw' images. At the signal level, the first task is performed by detecting a single dominant feature, lumen. Few methods of identifying the lumen are proposed. The first method used contour extraction. Contours are extracted by edge detection, thresholding and linking. This method required images to be divided into overlapping squares (8 by 8 or 4 by 4) where line segments are extracted by using a Hough transform. Perceptual criteria such as proximity, connectivity, similarity in orientation, contrast and edge pixel intensity, are used to group edges both strong and weak. This approach is called perceptual grouping. The second method is based on a region extraction using split and merge approach using spatial domain data. An n-level (for a 2' by 2' image) quadtree based pyramid structure is constructed to find the most homogenous large dark region, which in most cases corresponds to the lumen. The algorithm constructs the quadtree from the bottom (pixel) level upward, recursively and computes the mean and variance of image regions corresponding to quadtree nodes. On reaching the root, the largest uniform seed region, whose mean corresponds to a lumen is selected that is grown by merging with its neighboring regions. In addition to the use of two- dimensional information in the form of regions and contours, three-dimensional shape can provide additional information that will enhance the system capabilities. Shape or depth information from an image is estimated by various methods. A particular technique suitable for endoscopy is the shape from shading