WorldWideScience

Sample records for shaw sha88 presented

  1. Preimages for Step-Reduced SHA-2

    DEFF Research Database (Denmark)

    Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian

    2009-01-01

    In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...

  2. Dicty_cDB: SHA665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  3. Shaw on Hamlet

    Science.gov (United States)

    Dukore, Bernard F.

    1971-01-01

    Shaw's preoccupation with Hamlet resonates in his creative writing. Article documents this statement not only by examining his novels and plays but by searching through prefaces, postscripts, reviews, letters, speeches, etc. that span Shaw's lifetime. (Author/RB)

  4. The first collision for full SHA-1

    NARCIS (Netherlands)

    M.M.J. Stevens (Marc); E. Bursztein (Elie); P. Karpman (Pierre); A. Albertini (Ange); Y. Markov (Yarik)

    2017-01-01

    textabstractSHA-1 is a widely used 1995 NIST cryptographic hash function standard that was officially deprecated by NIST in 2011 due to fundamental security weaknesses demonstrated in various analyses and theoretical attacks. Despite its deprecation, SHA-1 remains widely used in 2017 for document

  5. 76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256

    Science.gov (United States)

    2011-03-02

    ... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...

  6. Dicty_cDB: SHA393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  7. [Diagnosis and treatment characteristics of head-wind sha in She medicine].

    Science.gov (United States)

    Zou, Guangyi; Xu, Xiangdong; Zheng, Songming; Yan, Lianhe; Lei, Houxing; Zhang, Qiao-ling; Xiang, Yingmei; Ye, Yiping; Song, Liwei

    2015-03-01

    The diagnosis and treatment characteristics of head-wind sha in She medicine were analyzed and summarized. By visiting She-nationality villages and towns in Zhejiang province and Fujian province and interviewing hundreds of doctors of She medicine, the sha diagnosis, sha differentiation, experience and theory of treatment were arranged, and a comprehensive summary on theory and application of head-wind sha in She medicine such as pathogeny, name of disease, mechanism, diagnosis, differential diagnosis and treatment was made. It is believed that the methods of diagnosis and treatment in She medicine for head-wind sha could effectively enhance curative effect, safety and patients' quality of life, and the further research should be carried out.

  8. LDPC and SHA based iris recognition for image authentication

    Directory of Open Access Journals (Sweden)

    K. Seetharaman

    2012-11-01

    Full Text Available We introduce a novel way to authenticate an image using Low Density Parity Check (LDPC and Secure Hash Algorithm (SHA based iris recognition method with reversible watermarking scheme, which is based on Integer Wavelet Transform (IWT and threshold embedding technique. The parity checks and parity matrix of LDPC encoding and cancellable biometrics i.e., hash string of unique iris code from SHA-512 are embedded into an image for authentication purpose using reversible watermarking scheme based on IWT and threshold embedding technique. Simply by reversing the embedding process, the original image, parity checks, parity matrix and SHA-512 hash are extracted back from watermarked-image. For authentication, the new hash string produced by employing SHA-512 on error corrected iris code from live person is compared with hash string extracted from watermarked-image. The LDPC code reduces the hamming distance for genuine comparisons by a larger amount than for the impostor comparisons. This results in better separation between genuine and impostor users which improves the authentication performance. Security of this scheme is very high due to the security complexity of SHA-512, which is 2256 under birthday attack. Experimental results show that this approach can assure more accurate authentication with a low false rejection or false acceptance rate and outperforms the prior arts in terms of PSNR.

  9. Shaw's Comedy, Language Arts: 5113.90.

    Science.gov (United States)

    Dade County Public Schools, Miami, FL.

    This guide provides the teacher with strategies to aid students in examining five representative plays by Bernard Shaw and in comparing his comedy with the comic art of Oscar Wilde, Richard Sheridan, Ben Jonson, and William Shakespeare. Performance objectives include isolating elements which pertain to the life and times of Shaw, delineating…

  10. Mapping PetaSHA Applications to TeraGrid Architectures

    Science.gov (United States)

    Cui, Y.; Moore, R.; Olsen, K.; Zhu, J.; Dalguer, L. A.; Day, S.; Cruz-Atienza, V.; Maechling, P.; Jordan, T.

    2007-12-01

    The Southern California Earthquake Center (SCEC) has a science program in developing an integrated cyberfacility - PetaSHA - for executing physics-based seismic hazard analysis (SHA) computations. The NSF has awarded PetaSHA 15 million allocation service units this year on the fastest supercomputers available within the NSF TeraGrid. However, one size does not fit all, a range of systems are needed to support this effort at different stages of the simulations. Enabling PetaSHA simulations on those TeraGrid architectures to solve both dynamic rupture and seismic wave propagation have been a challenge from both hardware and software levels. This is an adaptation procedure to meet specific requirements of each architecture. It is important to determine how fundamental system attributes affect application performance. We present an adaptive approach in our PetaSHA application that enables the simultaneous optimization of both computation and communication at run-time using flexible settings. These techniques optimize initialization, source/media partition and MPI-IO output in different ways to achieve optimal performance on the target machines. The resulting code is a factor of four faster than the orignial version. New MPI-I/O capabilities have been added for the accurate Staggered-Grid Split-Node (SGSN) method for dynamic rupture propagation in the velocity-stress staggered-grid finite difference scheme (Dalguer and Day, JGR, 2007), We use execution workflow across TeraGrid sites for managing the resulting data volumes. Our lessons learned indicate that minimizing time to solution is most critical, in particular when scheduling large scale simulations across supercomputer sites. The TeraShake platform has been ported to multiple architectures including TACC Dell lonestar and Abe, Cray XT3 Bigben and Blue Gene/L. Parallel efficiency of 96% with the PetaSHA application Olsen-AWM has been demonstrated on 40,960 Blue Gene/L processors at IBM TJ Watson Center. Notable

  11. Shaw Air Force Base Capital Improvement Program Environmental Assessment

    Science.gov (United States)

    2010-05-01

    A FB Capital Im provem ent Program Environm ental A ssessm ent 3-21 Figure 3.6-1. W ater R esources at Shaw A FB under the Proposed A ction...Figure 3.6-2. W ater R esources at Shaw A FB under A lternative 1 0 Key c::::J Shaw!IFB C’l1 Proposed Project ~ Number -- Creek/Stream c:::::J w

  12. SHA-1, SAT-solving, and CNF

    CSIR Research Space (South Africa)

    Motara, YM

    2017-09-01

    Full Text Available the intersection between the SHA-1 preimage problem, the encoding of that problem for SAT-solving, and SAT-solving. The results demonstrate that SAT-solving is not yet a viable approach to take to solve the preimage problem, and also indicate that some...

  13. Structure health assessment and warning system (SHAWS)

    Science.gov (United States)

    Bock, Daniel M.; Kim, Keehoon; Mapar, Jalal

    2008-03-01

    We are developing a Structure Health Assessment and Warning System (SHAWS) based on building displacement measurements and wireless communication. SHAWS will measure and predict the stability/instability of a building, determine whether it is safe for emergency responders to enter during an emergency, and provide individual warnings on the condition of the structure. SHAWS incorporates remote sensing nodes (RSNs) installed on the exterior frame of a building. Each RSN includes a temperature sensor, a three-axis accelerometer making static-acceleration measurements, and a ZigBee wireless system (IEEE 802.15.4). The RSNs will be deployed remotely using an air cannon delivery system, with each RSN having an innovative adhesive structure for fast (<10 min) and strong installation under emergency conditions. Once the building has moved past a threshold (~0.25 in./building story), a warning will be issued to emergency responders. In addition to the RSNs, SHAWS will include a base station located on an emergency responder's primary vehicle, a PDA for mobile data display to guide responders, and individual warning modules that can be worn by each responder. The individual warning modules will include visual and audio indicators with a ZigBee receiver to provide the proper degree of warning to each responder.

  14. Second-Preimage Analysis of Reduced SHA-1

    DEFF Research Database (Denmark)

    Rechberger, Christian

    2010-01-01

    Many applications using cryptographic hash functions do not require collision resistance, but some kind of preimage resistance. That's also the reason why the widely used SHA-1 continues to be recommended in all applications except digital signatures after 2010. Recent work on preimage and second...

  15. Insight into the mechanism of action of temporin-SHa, a new broad-spectrum antiparasitic and antibacterial agent.

    Directory of Open Access Journals (Sweden)

    Zahid Raja

    Full Text Available Antimicrobial peptides (AMPs are promising drugs to kill resistant pathogens. In contrast to bacteria, protozoan parasites, such as Leishmania, were little studied. Therefore, the antiparasitic mechanism of AMPs is still unclear. In this study, we sought to get further insight into this mechanism by focusing our attention on temporin-SHa (SHa, a small broad-spectrum AMP previously shown to be active against Leishmania infantum. To improve activity, we designed analogs of SHa and compared the antibacterial and antiparasitic mechanisms. [K3]SHa emerged as a highly potent compound active against a wide range of bacteria, yeasts/fungi, and trypanosomatids (Leishmania and Trypanosoma, with leishmanicidal intramacrophagic activity and efficiency toward antibiotic-resistant strains of S. aureus and antimony-resistant L. infantum. Multipassage resistance selection demonstrated that temporins-SH, particularly [K3]SHa, are not prone to induce resistance in Escherichia coli. Analysis of the mode of action revealed that bacterial and parasite killing occur through a similar membranolytic mechanism involving rapid membrane permeabilization and depolarization. This was confirmed by high-resolution imaging (atomic force microscopy and field emission gun-scanning electron microscopy. Multiple combined techniques (nuclear magnetic resonance, surface plasmon resonance, differential scanning calorimetry allowed us to detail peptide-membrane interactions. [K3]SHa was shown to interact selectively with anionic model membranes with a 4-fold higher affinity (KD = 3 x 10-8 M than SHa. The amphipathic α-helical peptide inserts in-plane in the hydrophobic lipid bilayer and disrupts the acyl chain packing via a detergent-like effect. Interestingly, cellular events, such as mitochondrial membrane depolarization or DNA fragmentation, were observed in L. infantum promastigotes after exposure to SHa and [K3]SHa at concentrations above IC50. Our results indicate that these

  16. Roles of putative sodium-hydrogen antiporter (SHA) genes in S. coelicolor A3(2) culture with pH variation.

    Science.gov (United States)

    Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun

    2011-09-01

    Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.

  17. Hyperbolic prisms and foams in Hele-Shaw cells

    Energy Technology Data Exchange (ETDEWEB)

    Tufaile, A., E-mail: tufaile@usp.br [Soft Matter Laboratory, Escola de Artes, Ciencias e Humanidades, Universidade de Sao Paulo, 03828-000, Sao Paulo (Brazil); Tufaile, A.P.B. [Soft Matter Laboratory, Escola de Artes, Ciencias e Humanidades, Universidade de Sao Paulo, 03828-000, Sao Paulo (Brazil)

    2011-10-03

    The propagation of light in foams creates patterns which are generated due to the reflection and refraction of light. One of these patterns is observed by the formation of multiple mirror images inside liquid bridges in a layer of bubbles in a Hele-Shaw cell. We are presenting the existence of these patterns in foams and their relation with hyperbolic geometry and Sierpinski gaskets using the Poincare disk model. The images obtained from the experiment in foams are compared to the case of hyperbolic optical elements. -- Highlights: → The chaotic scattering of light in foams generating deltoid patterns is based on hyperbolic geometry. → The deltoid patterns are obtained through the Plateau borders in a Hele-Shaw cell. → The Plateau borders act like hyperbolic prism. → Some effects of the refraction and reflection of the light rays were studied using a hyperbolic prism.

  18. Prediction of Instability for Miscible Displacements in a Hele-Shaw Cell Prévision de l'instabilité pour des déplacements miscibles dans une cellule Hele-Shaw

    Directory of Open Access Journals (Sweden)

    Coskuner G.

    2006-11-01

    Full Text Available A universal dimensionless scaling group and its critical value at the onset of instability for a miscible displacement in a Hele-Shaw cell is derived. The derivation is based on a variational technique and it is capable of considering, for the first time, the effect of the length of a Hele-Shaw cell on the criterion for the onset of instability. The theory is verified by comparing it with forty-four Hele-Shaw cell experiments. On calcule un groupe universel sans dimension de mise à l'échelle et sa valeur critique au départ de l'instabilité dans un déplacement miscible dans une cellule Hele-Shaw. Ce calcul est basé sur une technique variationnelle et permet, pour la première fois, de prendre en compte l'effet de la longueur d'une cellule Hele-Shaw sur le critère d'apparition d'instabilité. La théorie est vérifiée en la comparant avec des expériences réalisées avec quarante-quatre cellules Hele-Shaw.

  19. Effects of Gua-Sha therapy on breast engorgement: a randomized controlled trial.

    Science.gov (United States)

    Chiu, Jin-Yu; Gau, Meei-Ling; Kuo, Shu-Yu; Chang, Yung-Hsien; Kuo, Su-Chen; Tu, Hui-Chuan

    2010-03-01

    Breast engorgement is a common problem that affects the initiation and duration of breastfeeding. Limited solutions are available to relieve the discomfort associated with breast engorgement. Thus, further investigation of methods to achieve effective relief of symptoms is critical to promote breastfeeding success. : The purpose of this study was to determine the effects of two breast care methods, that is, scraping (Gua-Sha) therapy (administered to the experimental group) and traditional breast care (i.e., massage and heating; administered to the control group). A randomized controlled trial was conducted on 54 postpartum women at a Level III medical teaching hospital. Participant inclusion criteria included postpartum breastfeeding women (a) who had an uncomplicated delivery and (b) who were experiencing breast engorgement problems. The Gua-Sha protocol selected appropriate acupoint positions, which included ST16, ST18, SP17, and CV17. Each position was lightly scraped seven times in two cycles. For the control group, we used hot packs and massage for 20 min in accordance with recommendations given in an obstetrical technique textbook. Results showed no statistical differences between the two groups at baseline. Body temperature, breast temperature, breast engorgement, pain levels, and discomforting levels were statistically different between the two groups at 5 and 30 min after intervention (p account. Our findings provided empirical evidence supporting that Gua-Sha therapy may be used as an effective technique in the management of breast engorgement. By using Gua-Sha therapy, nurses can handle breast engorgement problems more effectively in primary care and hence help patients both physically and psychologically.

  20. Metal complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid and benzohydroxamic acid. Crystal and molecular structure of [Cu(phen)2(Cl)]Cl x H2Sha, a model for a peroxidase-inhibitor complex.

    Science.gov (United States)

    O'Brien, E C; Farkas, E; Gil, M J; Fitzgerald, D; Castineras, A; Nolan, K B

    2000-04-01

    Stability constants of iron(III), copper(II), nickel(II) and zinc(II) complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid (HAha) and benzohydroxamic acid (HBha) have been determined at 25.0 degrees C, I=0.2 mol dm(-3) KCl in aqueous solution. The complex stability order, iron(III) > copper(II) > nickel(II) approximately = zinc(II) was observed whilst complexes of H2Sha were found to be more stable than those of the other two ligands. In the preparation of ternary metal ion complexes of these ligands and 1,10-phenanthroline (phen) the crystalline complex [Cu(phen)2(Cl)]Cl x H2Sha was obtained and its crystal structure determined. This complex is a model for hydroxamate-peroxidase inhibitor interactions.

  1. Multiple bubbles in a Hele-Shaw cell

    International Nuclear Information System (INIS)

    Vasconcelos, G.L.

    1994-01-01

    A new class of exact solutions is reported for an infinite stream of identical groups of bubbles moving with a constant velocity U in a Hele-Shaw cell when surface tension is neglected. It is suggested that the existence of these solutions might explain some of the complex behavior observed in recent experiments on rising bubbles in a Hele-Shaw cell. Solutions for a finite number of bubbles in a channel are also obtained. In this case, it is shown that solutions with an arbitrary bubble velocity U>V, where V is the fluid velocity at infinity, can in general be obtained from a simple transformation of the solutions for U=2V

  2. D.SYM.4 SHA-3 Design and Cryptanalysis Report

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Thomsen, Søren Steffen

    2011-01-01

    The competition to select a new secure hash function standard SHA-3 was initiated in response to surprising progress in the cryptanalysis of existing hash function constructions that started in 2004. In this report we survey design and cryptanalytic results of those 14 candidates that remain in t...

  3. On security arguments of the second round SHA-3 candidates

    DEFF Research Database (Denmark)

    Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart

    2012-01-01

    of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...... and review arguments and bounds against classes of differential attacks.We discuss all the SHA-3 candidates at a high functional level, analyze, and summarize the security reduction results and bounds against differential attacks. Additionally, we generalize the well-known proof of collision resistance...

  4. Rotating Hele-Shaw cell with a time-dependent angular velocity

    Science.gov (United States)

    Anjos, Pedro H. A.; Alvarez, Victor M. M.; Dias, Eduardo O.; Miranda, José A.

    2017-12-01

    Despite the large number of existing studies of viscous flows in rotating Hele-Shaw cells, most investigations analyze rotational motion with a constant angular velocity, under vanishing Reynolds number conditions in which inertial effects can be neglected. In this work, we examine the linear and weakly nonlinear dynamics of the interface between two immiscible fluids in a rotating Hele-Shaw cell, considering the action of a time-dependent angular velocity, and taking into account the contribution of inertia. By using a generalized Darcy's law, we derive a second-order mode-coupling equation which describes the time evolution of the interfacial perturbation amplitudes. For arbitrary values of viscosity and density ratios, and for a range of values of a rotational Reynolds number, we investigate how the time-dependent angular velocity and inertia affect the important finger competition events that traditionally arise in rotating Hele-Shaw flows.

  5. A one-time pad color image cryptosystem based on SHA-3 and multiple chaotic systems

    Science.gov (United States)

    Wang, Xingyuan; Wang, Siwei; Zhang, Yingqian; Luo, Chao

    2018-04-01

    A novel image encryption algorithm is proposed that combines the SHA-3 hash function and two chaotic systems: the hyper-chaotic Lorenz and Chen systems. First, 384 bit keystream hash values are obtained by applying SHA-3 to plaintext. The sensitivity of the SHA-3 algorithm and chaotic systems ensures the effect of a one-time pad. Second, the color image is expanded into three-dimensional space. During permutation, it undergoes plane-plane displacements in the x, y and z dimensions. During diffusion, we use the adjacent pixel dataset and corresponding chaotic value to encrypt each pixel. Finally, the structure of alternating between permutation and diffusion is applied to enhance the level of security. Furthermore, we design techniques to improve the algorithm's encryption speed. Our experimental simulations show that the proposed cryptosystem achieves excellent encryption performance and can resist brute-force, statistical, and chosen-plaintext attacks.

  6. How to apply SHA 2011 at a subnational level in China's practical situation: take children health expenditure as an example.

    Science.gov (United States)

    Li, Mingyang; Zheng, Ang; Duan, Wenjuan; Mu, Xin; Liu, Chunli; Yang, Yang; Wang, Xin

    2018-06-01

    System of Health Accounts 2011 (SHA 2011) is a new health care accounts system, revised from SHA 1.0 by the Organisation for Economic Co-operation and Development (OECD), the World Health Organization (WHO) and Eurostat. It keeps the former tri-axial relationship and develops three analytical interfaces, in order to fix the existing shortcomings and make it more convenient for analysis and comparison across countries. SHA 2011 was introduced in China in 2014, and little about its application in China has been reported. This study takes children as an example to study how to apply SHA 2011 at the subnational level in the practical situation of China's health system. Multistage random sampling method was applied and 3 532 517 samples from 252 institutions were included in the study. Official yearbooks and account reports helped the estimation of provincial data. The formula to calculate Current Health Expenditure (CHE) was introduced step-by-step. STATA 10.0 was used for statistics. Under the frame of SHA 2011, the CHE for children in Liaoning was calculated as US$ 0.74 billion in 2014; 98.56% of the expenditure was spent in hospital and the allocation to primary health care institutions was insufficient. Infection, maternal and prenatal diseases cost the most in terms of Global Burden of Disease (GBD), and respiratory system diseases took the leading place in terms of International Classification of Disease Tenth Revision (ICD-10). In addition, medical income contributed most to the health financing. The method to apply SHA 2011 at the subnational level is feasible in China. It makes health accounts more adaptable to rapidly developing health systems and makes the financing data more readily available for analytical use. SHA 2011 is a better health expenditure accounts system to reveal the actual burden on residents and deserves further promotion in China as well as around the world.

  7. A comparative study of Message Digest 5(MD5) and SHA256 algorithm

    Science.gov (United States)

    Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.

    2018-03-01

    The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.

  8. Faraday waves in a Hele-Shaw cell

    Science.gov (United States)

    Li, Jing; Li, Xiaochen; Chen, Kaijie; Xie, Bin; Liao, Shijun

    2018-04-01

    We investigate Faraday waves in a Hele-Shaw cell via experimental, numerical, and theoretical studies. Inspired by the Kelvin-Helmholtz-Darcy theory, we develop the gap-averaged Navier-Stokes equations and end up with the stable standing waves with half frequency of the external forced vibration. To overcome the dependency of a numerical model on the experimental parameter of wave length, we take two-phase flow into consideration and a novel dispersion relation is derived. The numerical results compare well with our experimental data, which effectively validates our proposed mathematical model. Therefore, this model can produce robust solutions of Faraday wave patterns and resolve related physical phenomena, which demonstrates the practical importance of the present study.

  9. A Novel Digital Background Calibration Technique for 16 bit SHA-less Multibit Pipelined ADC

    Directory of Open Access Journals (Sweden)

    Swina Narula

    2016-01-01

    Full Text Available In this paper, a high resolution of 16 bit and high speed of 125MS/s, multibit Pipelined ADC with digital background calibration is presented. In order to achieve low power, SHA-less front end is used with multibit stages. The first and second stages are used here as a 3.5 bit and the stages from third to seventh are of 2.5 bit and last stage is of 3-bit flash ADC. After bit alignment and truncation of total 19 bits, 16 bits are used as final digital output. To precise the remove linear gain error of the residue amplifier and capacitor mismatching error, a digital background calibration technique is used, which is a combination of signal dependent dithering (SDD and butterfly shuffler. To improve settling time of residue amplifier, a special circuit of voltage separation is used. With the proposed digital background calibration technique, the spurious-free dynamic range (SFDR has been improved to 97.74 dB @30 MHz and 88.9 dB @150 MHz, and the signal-to-noise and distortion ratio (SNDR has been improved to 79.77 dB @ 30 MHz, and 73.5 dB @ 150 MHz. The implementation of the Pipelined ADC has been completed with technology parameters of 0.18μm CMOS process with 1.8 V supply. Total power consumption is 300 mW by the proposed ADC.

  10. A Special Class of Univalent Functions in Hele-Shaw Flow Problems

    Directory of Open Access Journals (Sweden)

    Paula Curt

    2011-01-01

    Full Text Available We study the time evolution of the free boundary of a viscous fluid for planar flows in Hele-Shaw cells under injection. Applying methods from the theory of univalent functions, we prove the invariance in time of Φ-likeness property (a geometric property which includes starlikeness and spiral-likeness for two basic cases: the inner problem and the outer problem. We study both zero and nonzero surface tension models. Certain particular cases are also presented.

  11. MHD Hele-Shaw flow of Rivlin-Ericksen fluid

    International Nuclear Information System (INIS)

    Ghosh, B.C.; Sengupta, P.R.

    1995-01-01

    In this paper, an attempt has been made to study the MHD Hele-Shaw flow of Rivlin-Ericksen visco-elastic fluid assuming the pressure gradient to be proportional to exp (-nt). The velocity components are obtained and the effect of visco-elasticity is discussed on velocity components. (author). 8 refs

  12. Gas driven displacement in a Hele-Shaw cell with chemical reaction

    Science.gov (United States)

    White, Andrew; Ward, Thomas

    2011-11-01

    Injecting a less viscous fluid into a more viscous fluid produces instabilities in the form of fingering which grow radially from the less viscous injection point (Saffman & Taylor, Proc. R. Soc. Lon. A, 1958). For two non-reacting fluids in a radial Hele-Shaw cell the ability of the gas phase to penetrate the liquid phase is largely dependent on the gap height, liquid viscosity and gas pressure. In contrast combining two reactive fluids such as aqueous calcium hydroxide and carbon dioxide, which form a precipitate, presents a more complex but technically relevant system. As the two species react calcium carbonate precipitates and increases the aqueous phase visocosity. This change in viscosity may have a significant impact on how the gas phase penetrates the liquid phase. Experimental are performed in a radial Hele-Shaw cell with gap heights O(10-100) microns by loading a single drop of aqueous calcium hydroxide and injecting carbon dioxide into the drop. The calcium hydroxide concentration, carbon dioxide pressure and gap height are varied and images of the gas penetration are analyzed to determine residual film thickness and bursting times.

  13. BioShaDock: a community driven bioinformatics shared Docker-based tools registry.

    Science.gov (United States)

    Moreews, François; Sallou, Olivier; Ménager, Hervé; Le Bras, Yvan; Monjeaud, Cyril; Blanchet, Christophe; Collin, Olivier

    2015-01-01

    Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  14. Henri Bergson y George Bernard Shaw: hábito, vida, muerte

    Directory of Open Access Journals (Sweden)

    Álvaro Cortina Urdampilleta

    2015-01-01

    Full Text Available Este artículo indaga en algunos aspectos de la antropología filosófica expuesta en la obra del francés Henri Bergson. Para ello, nos serviremos de la confrontación de su doctrina original con la de un bergsoniano sui generis, el intelectual y dramaturgo irlandés George Bernard Shaw. El Prefacio. A medio siglo infiel, de Shaw, incluido en su obra más ambiciosa, Vuelta a Matusalén. Un Pentateuco Metabiológico, de 1921, será el texto base con el que haremos dialogar a Bergson con este periférico bergsonismo. Tomaremos como hilo conductor la teoría sobre el hábito, en el contexto de la metafísica de la evolución de los seres orgánicos, y lo llevaremos hasta el concepto límite, que parece conciliar ambas posturas: la idea de muerte superable. Ni en Bergson ni en Shaw los hábitos (la Cultura forman parte integral de la esencia del hombre, y la muerte (cuestión en la que Bergson es mucho más elusivo juega en ellos un rol anfibio, entre Cultura y Naturaleza.

  15. Data harmonization and federated analysis of population-based studies : the BioSHaRE project

    NARCIS (Netherlands)

    Doiron, Dany; Burton, Paul; Marcon, Yannick; Gaye, Amadou; Wolffenbuttel, Bruce H R; Perola, Markus; Stolk, Ronald P; Foco, Luisa; Minelli, Cosetta; Waldenberger, Melanie; Holle, Rolf; Kvaløy, Kirsti; Hillege, Hans L; Tassé, Anne-Marie; Ferretti, Vincent; Fortier, Isabel

    2013-01-01

    ABSTRACTS BACKGROUND: Individual-level data pooling of large population-based studies across research centres in international research projects faces many hurdles. The BioSHaRE (Biobank Standardisation and Harmonisation for Research Excellence in the European Union) project aims to address these

  16. Ferromagnetic shadow mask for spray coating of polymer patterns

    DEFF Research Database (Denmark)

    Keller, Stephan Sylvest; Bosco, Filippo; Boisen, Anja

    2013-01-01

    We present the fabrication of a wafer-scale shadow mask with arrays of circular holes with diameters of 150–400 μm. Standard UV photolithography is used to define 700 μm thick SU-8 structures followed by electroplating of nickel and etching of the template. The ferromagnetic properties of the sha......We present the fabrication of a wafer-scale shadow mask with arrays of circular holes with diameters of 150–400 μm. Standard UV photolithography is used to define 700 μm thick SU-8 structures followed by electroplating of nickel and etching of the template. The ferromagnetic properties...

  17. 77 FR 5781 - Record of Decision for the Air Space Training Initiative Shaw Air Force Base, South Carolina...

    Science.gov (United States)

    2012-02-06

    ... DEPARTMENT OF DEFENSE Department of the Air Force Record of Decision for the Air Space Training Initiative Shaw Air Force Base, South Carolina Final Environmental Impact Statement ACTION: Notice of... signed the ROD for the Airspace Training Initiative Shaw Air Force Base, South Carolina Final...

  18. An assembly of steadily translating bubbles in a Hele–Shaw channel

    International Nuclear Information System (INIS)

    Crowdy, Darren

    2009-01-01

    This paper presents new solutions for any finite number of bubbles steadily translating along a Hele–Shaw channel. This constitutes a nonlinear free boundary problem. The solutions can be written down explicitly in terms of a special transcendental function called the Schottky–Klein prime function. This work generalizes the exact solutions for a single bubble in a channel found by Tanveer (1987 Phys. Fluids 30 651–8) as well as the solutions for streams of bubbles aligned along the channel centreline due to Vasconcelos (1994 Phys. Rev. E 50 R3306–9)

  19. Robert R. Shaw, MD: thoracic surgical hero, Afghanistan medical pioneer, champion for the patient, never a surgical society president.

    Science.gov (United States)

    Urschel, Harold C; Urschel, Betsey Bradley

    2012-06-01

    Dr Robert R. Shaw arrived in Dallas to practice Thoracic Surgery in 1937, as John Alexander's 7th Thoracic Surgical Resident from Michigan University Medical Center. Dr Shaw's modus operandi was, "You can accomplish almost anything, if you don't care who gets the credit." He was a remarkable individual who cared the most about the patient and very little about getting credit for himself. From 1937 to 1970, Dr Shaw established one of the largest lung cancer surgical centers in the world in Dallas, Texas. It was larger than M.D. Anderson and Memorial Sloan-Kettering Hospitals put together regarding the surgical treatment of lung cancer patients. To accomplish this, he had the help of Dr Donald L. Paulson, who trained at the Mayo Clinic and served as Chief of Thoracic Surgery at Brook Army Hospital during the Second World War. Following the War, because of his love for Texas, he ended up as a partner of Dr Shaw in Dallas. Together, they pursued the development of this very large surgical lung cancer center. Dr Shaw and his wife Ruth went to Afghanistan with Medico multiple times to teach men modern cardiac and thoracic surgery. They also served as consultants on Medico's Ship of Hope in Africa. Dr Shaw initiated multiple new operations including: 1) resection of Pancoast's cancer of the lung after preoperative irradiation; 2) upper lobe of the lung bronchoplasty, reattaching (and saving) the lower lobe to prevent the "disabling" pneumonectomy; and 3) resections of pulmonary mucoid impaction of the lung in asthmatics. Because of his humility and giving "the credit to others," Dr Shaw was never President of a major medical or surgical association. Copyright © 2012 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  20. Side channel analysis of some hash based MACs: A response to SHA-3 requirements

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Okeya, Katsuyuki

    2008-01-01

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...

  1. Characterization of biocomposites of sheep hydroxyapatite (SHA)/shellac/sugar as bone filler material

    Science.gov (United States)

    Triyono, Joko; Rizha, Yushak; Triyono, Teguh

    2018-04-01

    The use of biomaterials in orthopedics is increasing. This led to the growth of innovations in the field of medicine, one of them is the development of biomaterials. Study of Sheep Hydroxyapatite (SHA)/shellac/sugar biocomposite characterization was to determine the phase of the material, porosity, hardness and compressive strength of them. This research was conducted to develop new types of biomaterials that can be used as bone filler material. The analysis that used in this research was dry methods. The results showed that observation of XRD (X-Ray Diffraction) shows the pattern of diffraction 2θ: 31.6472°, 32.7753°, 32.0723°, The highest hardness of SHA/shellac/sugar ratio was 70:30% (7.38±0.1395 VHN) and the lowest at 50:50% (4.91±0.37 VHN). The highest Diametral Tensile Strength (DTS) test was 70:30% (5.43±1.395 MPa) and the lowest at 50:50% (3.10±0.26 MPa). SEM observations are performed to see the material porosity.

  2. Life support and euthanasia, a perspective on Shaw's new perspective.

    Science.gov (United States)

    Busch, Jacob; Rodogno, Raffaele

    2011-02-01

    It has recently been suggested by Shaw (2007) that the distinction between voluntary active euthanasia, such as giving a patient a lethal overdose with the intention of ending that patient's life, and voluntary passive euthanasia, such as removing a patient from a ventilator, is much less obvious than is commonly acknowledged in the literature. This is argued by suggesting a new perspective that more accurately reflects the moral features of end-of-life situations. The argument is simply that if we consider the body of a mentally competent patient who wants to die, a kind of 'unwarranted' life support, then the distinction collapses. We argue that all Shaw has provided is a perspective that makes the conclusion that there is little distinction between voluntary active euthanasia and voluntary passive euthanasia only seemingly more palatable. In doing so he has yet to convince us that this perspective is superior to other perspectives and thus more accurately reflects the moral features of the situations pertaining to this issue.

  3. Henry Selby Hele-Shaw LLD, DSc, EngD, FRS, WhSch (1854-1941: Engineer, inventor and educationist

    Directory of Open Access Journals (Sweden)

    Jane Carruthers

    2010-03-01

    Full Text Available H.S. Hele-Shaw (1854–1941 was one of the most outstanding engineering scientists of his generation and an eminent figure in engineering education during the late-19th and early-20th centuries. His work in hydrodynamics (the Hele-Shaw cell and Hele-Shaw pump and his important contribution to the successful development of high-speed aircraft (his variable pitch airscrew, continues to be relevant today. In 1922, as President of the Institution of Mechanical Engineers, he introduced the National Certificate scheme in Britain. It is not well known that Hele-Shaw spent two years in South Africa (1904–1905 attached to the Transvaal Technical Institute, a forerunner of the University of the Witwatersrand. One of only three Fellows of the Royal Society of London in southern Africa in 1905, he was a founder Council member of the Royal Society of South Africa and one of the hosts of the 1905 visit to southern Africa by the British Association for the Advancement of Science. The purpose of this paper is to highlight the time he spent in South Africa and to contextualise it within the larger perspective of his engineering career.

  4. On a Hele-Shaw flow with a time-dependent gap in the presence of surface tension

    International Nuclear Information System (INIS)

    Savina, T V; Nepomnyashchy, A A

    2015-01-01

    The introduction of surface tension into a Hele-Shaw problem makes it more realistic from the physical viewpoint, but more difficult from the mathematical viewpoint. In this paper we discuss a Hele-Shaw flow with a time-dependent gap taking into account the surface tension of the free boundary. We use the Schwarz function method to find asymptotic solutions for the interior problem in the case when the initial shape of the droplet is a weakly distorted circle. (paper)

  5. Universality Results for Multi-phase Hele-Shaw Flows

    Science.gov (United States)

    Daripa, Prabir

    2013-03-01

    Saffman-Taylor instability is a well known viscosity driven instability of an interface separating two immiscible fluids. We study linear stability of displacement processes in a Hele-Shaw cell involving an arbitrary number of immiscible fluid phases. This is a problem involving many interfaces. Universal stability results have been obtained for this multi-phase immiscible flow in the sense that the results hold for arbitrary number of interfaces. These stability results have been applied to design displacement processes that are considerably less unstable than the pure Saffman-Taylor case. In particular, we derive universal formula which gives specific values of the viscosities of the fluid layers corresponding to smallest unstable band. Other similar universal results will also be presented. The talk is based on the following paper. This work was supported by the Qatar National Research Fund (a member of The Qatar Foundation).

  6. Determining the number of fingers in the lifting Hele-Shaw problem

    Science.gov (United States)

    Miranda, Jose; Dias, Eduardo

    2013-11-01

    The lifting Hele-Shaw cell flow is a variation of the celebrated radial viscous fingering problem for which the upper cell plate is lifted uniformly at a specified rate. This procedure causes the formation of intricate interfacial patterns. Most theoretical studies determine the total number of emerging fingers by maximizing the linear growth rate, but this generates discrepancies between theory and experiments. In this work, we tackle the number of fingers selection problem in the lifting Hele-Shaw cell by employing the recently proposed maximum-amplitude criterion. Our linear stability analysis accounts for the action of capillary, viscous normal stresses, and wetting effects, as well as the cell confinement. The comparison of our results with very precise laboratory measurements for the total number of fingers shows a significantly improved agreement between theoretical predictions and experimental data. We thank CNPq (Brazilian Sponsor) for financial support.

  7. George Bernard Shaw's "Androcles and the Lion": A Postmodernist Study

    Science.gov (United States)

    Hooti, Noorbakhsh; Jeihouni, Mojtaba

    2012-01-01

    This study makes an attempt to analyze the manifold aspects of Shaw's "Androcles and the Lion" on a postmodernist standpoint, meanwhile, demonstrates the dominion of modernism, which is portrayed through the vehicle of comedy with a bitter ironic language through the play. Regardless of the historical period in which the play occurs, the…

  8. Scaling crossover in thin-film drag dynamics of fluid drops in the Hele-Shaw cell

    Science.gov (United States)

    Okumura, Ko; Yahashi, Misato; Kimoto, Natsuki

    2016-11-01

    We study both experimentally and theoretically the descending motion due to gravity of a fluid drop surrounded by another immiscible fluid in a confined space between two parallel plates, i.e., in the Hele-Shaw cell. As a result, we show a new scaling regime of a nonlinear drag friction in viscous liquid that replaces the well-known Stokes' drag friction through a clear collapse of experimental data thanks to the scaling law. In the novel regime, the dissipation in the liquid thin film formed between the drop and cell walls governs the dynamics. The crossover of this scaling regime to another scaling regime in which the dissipation inside the droplet is dominant is clearly demonstrated and a phase diagram separating these scaling regimes is presented. To be published as, Y. Yahashi, N. Kimoto and K. Okumura, Scaling crossover in thin-film drag dynamics of fluid drops in the Hele-Shaw cell, Sci. Rep.(CC BY 4.0). This research was partly supported by ImPACT Program of Council for Science, Technology and Innovation (Cabinet Office, Government of Japan).

  9. Hele-Shaw beach creation by breaking waves: a mathematics-inspired experiment

    NARCIS (Netherlands)

    Thornton, Anthony Richard; van der Horn, Avraham/Bram; van der Horn, Avraham J.; Gagarina, Elena; Zweers, Wout; van der Meer, Roger M.; Bokhove, Onno

    2014-01-01

    Fundamentals of nonlinear wave-particle interactions are studied experimentally in a Hele-Shaw configuration with wave breaking and a dynamic bed. To design this configuration, we determine, mathematically, the gap width which allows inertial flows to survive the viscous damping due to the side

  10. Universality Results for Multi-layer Radial Hele-Shaw Flows

    Science.gov (United States)

    Daripa, Prabir; Gin, Craig; Daripa Research Team

    2014-03-01

    Saffman-Taylor instability is a well known viscosity driven instability of an interface separating two immiscible fluids. We study linear stability of this displacement process in multi-layer radial Hele-Shaw geometry involving an arbitrary number of immiscible fluid phases. Universal stability results have been obtained and applied to design displacement processes that are considerably less unstable than the pure Saffman-Taylor case. In particular, we derive universal formula which gives specific values of the viscosities of the fluid layers corresponding to smallest unstable band. Other similar universal results will also be presented. The talk is based on ongoing work. Supported by an NPRP Grant # 08-777-1-141 from the Qatar National Research Fund (a member of the Qatar Foundation). The statements made herein are solely the responsibility of the authors.

  11. The esophagus anatomic-histology of bull frog ("Rana catesbeiana" Shaw, 1802 Anatomo-histologia do esôfago da rã touro ("Rana catesbeiana" Shaw, 1802

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Lino Pinto

    2008-04-01

    Full Text Available Aiming to describe the esophage functional morpho – histology of bull frog (Rana catebeiana Shaw, 1802, twenty bull frog, mean body weight of 85.00 ± 2.03 g, were used. The esophageal mucosa architecture is defined by thick longitudinal folds, showing an esophageal ciliated pseudostratified epithelium with mucous cells and pluricellular glands; the esophageal muscular coat is composed by inner circular muscular lamina, and by outer longitudinal muscular lamina.Com o objetivo de descrever a anatomo histologia funcional do esôfago da rã touro (Rana catesbeiana Shaw, 1802, foram utilizados 20 (vinte exemplares de rã touro com peso médio de 85,00 ± 2,03 g. Verificou-se que a arquitetura da mucosa esofágica é definida por pregas espessas e longitudinais, com epitélio esofágico do tipo pseudo estratificado ciliado com células mucosas e glândulas pluricelulares; a túnica muscular esofágica é constituida pela túnica muscular circular, mais interna, e pela túnica muscular longitudinal, mais externa.

  12. Self-Expression or Teacher Influence: The Shaw System of Finger-Painting.

    Science.gov (United States)

    Stankiewicz, Mary Ann

    1984-01-01

    Finger painting is often regarded as the epitome of free expression for children. However, a careful review of the history of Ruth Shaw's finger-painting system reveals that it was dominated by specific techniques and stylistic conventions taught without a critical understanding of art history or appreciation. (IS)

  13. A geochemical evaluation of the Ash Sha'ib mineral prospect, Asir quadrangle, Kingdom of Saudi Arabia

    Science.gov (United States)

    Allcott, Glenn H.

    1970-01-01

    The mineralized zone at the remotely located Ash Sha'ib ancient mine contains only a small tonnage of moderately low grade sulfide- bearing rock. Based on present data the gross value of the deposit, with a value of $25.00 or more per ton, is $20,000,000. A belt of metasedimentary rocks, intruded by gabbro to the south and granite to the north, was the host for fissure vein-replacement type mineralization. Most of the mineralization is in a siliceous dolomite transected by fissures. The main sulfide mineral is sphalerite, but minor amounts of chalcopyrlte and argentlferous galena contribute to the value of the mineralized sections.

  14. The ethics of killing human/great-ape chimeras for their organs: a reply to Shaw et al.

    Science.gov (United States)

    Palacios-González, César

    2016-06-01

    The aim of this paper is to critically examine David Shaw, Wybo Dondorp, and Guido de Wert's arguments in favour of the procurement of human organs from human/nonhuman-primate chimeras, specifically from great-ape/human chimeras. My main claim is that their arguments fail and are in need of substantial revision. To prove this I first introduce the topic, and then reconstruct Shaw et al.'s position and arguments. Next, I show that Shaw et al.: (1) failed to properly apply the subsidiarity and proportionality principles; (2) neglected species overlapping cases in their ethical assessment; (3) ignored the ethics literature on borderline persons; and (4) misunderstood McMahan's two-tiered moral theory. These mistakes render an important part of their conclusions either false or problematic to the point that they would no longer endorse them. Finally I will briefly mention a possible multipolar solution to the human organ shortage problem that would reduce the need for chimeras' organs.

  15. Computer simulation of viscous fingering in a lifting Hele-Shaw cell

    Indian Academy of Sciences (India)

    We simulate viscous fingering generated by separating two plates with a constant force, in a lifting Hele-Shaw cell. Variation in the patterns for different fluid viscosity and lifting force is studied. Viscous fingering is strongly affected by anisotropy. We report a computer simulation study of fingering patterns, where circular or ...

  16. Narsisisme dan Kompleks Oedipus yang Tergambar dalam Pygmalion, Karya George Bernard Shaw

    Directory of Open Access Journals (Sweden)

    Essy Syam

    2017-06-01

    Full Text Available Abstract This writing analyzes narcisism and oedipuis complex as refelcted in a literary work entitles “pygmalion” written by George Bernard Shaw. Thus, the objective of this analysis is to show and to analyze how narcisism and Oedipus complex are suffered from the protagonist of this work. To reach that objective, this analysis applies psychoanalitical analysis  to demonstrate the mental condition of the main character. Related to that idea, this analysis applies adescriptive analysis method in which the result of the analysis will be described clearly. From teh presented description, it will show how the main character of this work lives his life and in his interaction with other characters will describe his mental condition.   Keywords: Pygmalion, psychoanalisis, Narcisism, Oedipus Complex.    Abstrak Tulisan ini menganalisis kasus Narsisme dan Kompleks Oedipus yang tergambar pada sebuah karya sastra berjudul Pygmalion yang ditulis oleh George  Bernard Shaw.  Maka tujuan penelitian ini adalah untuk memperlihatkan dan menganalisis bagaimana kasus narsisme dan kompleks oedipus yang dialami oleh tokoh utama karya ini. Untuk mencapai tujuan itu, kajian ini menerapkan kajian psikoanalisis  untuk memperlihatkan kondisi kejiwaan tokoh utama yang mengalami gangguan jiwa yang dimanakan Narsisime dan Kompleks Oedipus.  Kajian ini menerapkan metode deskriptif analisis dimana hasil analisis akan dideskripsikan dengan jelas. Dari deskripsi yang dijabarkan akan memperlihatkan bagaimana tokoh utama karya ini dalam kehidupannya dan interaksinya dengan tokoh yang lain memperlihatkan kondisi jiwanya.   Kata Kunci: Pygmalion, Psikoanalisis. Narsisime, Kompleks Oedipus

  17. Sloshing in a Hele-Shaw cell: experiments and theory

    OpenAIRE

    Viola , Francesco; Gallaire , Francois; Dollet , Benjamin

    2017-01-01

    International audience; The response of the free liquid surface in a Hele-Shaw cell subjected to a horizontal oscillation is investigated. We study the low-oscillation-amplitude regime and we show, by varying the fluid viscosity, ν, and the forcing frequency, ω, that the ratio between the Stokes viscous length, 2ν/ω, and the cell thickness greatly affects the amplitude and phase lag of the gravity waves. In particular, the sloshing system undergoes an under-damped/overdamped transition for su...

  18. New archeointensity results from the reconstructed ancient kiln by the Tsunakawa-Shaw method

    Science.gov (United States)

    Yamamoto, Y.; Hatakeyama, T.; Kitahara, Y.; Saito, T.

    2017-12-01

    Yamamoto et al. (2015) reported that baked clay samples from the floor of a reconstructed ancient kiln provided a reliable Tsunakawa-Shaw (LTD-DHT Shaw) archeointensity (AI) estimate of 47.3 +/- 2.2 microT which is fairly consistent with the in situ geomagnetic field of 46.4 microT at the time of the reconstruction. The reconstruction was conducted to reproduce an excavated kiln of the seventh century in Japan and Sue-type potteries of contemporary style were also fired (Nakajima et al., 1974). Two of the potteries with reddish color were recently subjected to the Tsunakawa-Shaw archeointensity determinations, resulting in reliable AI estimates of 45.4 +/- 2.3 (N=6) and 48.2 +/- 2.7 microT (N=15) when specimens were heated in air in laboratory (Yamamoto et al., 2017 JpGU-AGU Joint Meeting). We have had another opportunity to take samples from a new reconstructed ancient kiln in Japan which was fired in autumn 2016. The samples were two Sue-type potteries with grayish color (bowl-type and plate-type) and some blocks collected from inner wall of the kiln body. They were cut into mini specimens and then subjected to the Tsunakawa-Shaw experiment. Heating in laboratory was done either in air or vacuum.For the bowl-type pottery, AIs of 46.9 +/- 2.8 (N=6, air) and 45.3 +/- 2.3 microT (N=6, vacuum) are obtained. They are indistinguishable each other and consistent with the IGRF field of 47.4 microT at the reconstructed location in 2016. For the plate-type pottery, AIs result in 41.8 +/- 1.3 (N=4, air) and 43.9 +/- 3.9 microT (N=4, vacuum). They are also indistinguishable each other but the former AI is slightly lower than the IGRF field.For the inner wall, AIs of 45.0 (N=1, air) and 46.8 microT (N=1, vacuum) are obtained from a right-side wall, and those of 45.5 +/- 2.5 (N=2, air) and 47.7 +/- 3.0 microT (N=2, vacuum) are observed from a left-side wall. They are all indistinguishable and consistent with the IGRF field.

  19. Elastic fingering in rotating Hele-Shaw flows

    KAUST Repository

    Carvalho, Gabriel D.; Gadê lha, Hermes; Miranda, José A.

    2014-01-01

    The centrifugally driven viscous fingering problem arises when two immiscible fluids of different densities flow in a rotating Hele-Shaw cell. In this conventional setting an interplay between capillary and centrifugal forces makes the fluid-fluid interface unstable, leading to the formation of fingered structures that compete dynamically and reach different lengths. In this context, it is known that finger competition is very sensitive to changes in the viscosity contrast between the fluids. We study a variant of such a rotating flow problem where the fluids react and produce a gellike phase at their separating boundary. This interface is assumed to be elastic, presenting a curvature-dependent bending rigidity. A perturbative weakly nonlinear approach is used to investigate how the elastic nature of the interface affects finger competition events. Our results unveil a very different dynamic scenario, in which finger length variability is not regulated by the viscosity contrast, but rather determined by two controlling quantities: a characteristic radius and a rigidity fraction parameter. By properly tuning these quantities one can describe a whole range of finger competition behaviors even if the viscosity contrast is kept unchanged. © 2014 American Physical Society.

  20. Elastic fingering in rotating Hele-Shaw flows

    KAUST Repository

    Carvalho, Gabriel D.

    2014-05-21

    The centrifugally driven viscous fingering problem arises when two immiscible fluids of different densities flow in a rotating Hele-Shaw cell. In this conventional setting an interplay between capillary and centrifugal forces makes the fluid-fluid interface unstable, leading to the formation of fingered structures that compete dynamically and reach different lengths. In this context, it is known that finger competition is very sensitive to changes in the viscosity contrast between the fluids. We study a variant of such a rotating flow problem where the fluids react and produce a gellike phase at their separating boundary. This interface is assumed to be elastic, presenting a curvature-dependent bending rigidity. A perturbative weakly nonlinear approach is used to investigate how the elastic nature of the interface affects finger competition events. Our results unveil a very different dynamic scenario, in which finger length variability is not regulated by the viscosity contrast, but rather determined by two controlling quantities: a characteristic radius and a rigidity fraction parameter. By properly tuning these quantities one can describe a whole range of finger competition behaviors even if the viscosity contrast is kept unchanged. © 2014 American Physical Society.

  1. BioShaDock: a community driven bioinformatics shared Docker-based tools registry [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    François Moreews

    2015-12-01

    Full Text Available Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  2. Mental Health Inequalities in Adolescents Growing Up in Post-Apartheid South Africa: Cross-Sectional Survey, SHaW Study.

    Science.gov (United States)

    Das-Munshi, Jayati; Lund, Crick; Mathews, Catherine; Clark, Charlotte; Rothon, Catherine; Stansfeld, Stephen

    2016-01-01

    South Africa is one of the most 'unequal' societies in the world. Despite apartheid ending more than 20 years ago, material inequalities remain interwoven with ethnic/racial inequalities. There is limited research on the prevalence/predictors of common mental disorders (CMD) among young people. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa. Cross-sectional associations of race/ethnicity and material disadvantage with CMD and Post Traumatic Stress Disorder (PTSD) were assessed in a stratified random sample representative of school-attendees, aged 14-15 years, in a large metropolitan area of Cape Town. Validated instruments assessed mental disorders; these included: Harvard Trauma Questionnaire (PTSD); Short Moods and Feelings Questionnaire (depression); Zung self-rated anxiety scale (anxiety). Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys. Response rate was 88% (1034 of 1169 individuals). Adolescents experienced a high prevalence of depression (41%), anxiety (16%) and PTSD (21%). A gradient between material disadvantage and CMD/ PTSD was evident across all ethnic/racial groups. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk (RR) of CMD in black children was 2.27 (95% CI:1.24, 4.15) and for PTSD was RR: 2.21 (95% CI:1.73, 2.83). Relative risk of CMD was elevated in children self-identifying as 'coloured' (RR: 1.73, 95% CI:1.11, 2.70). Putative mediators (violence, racially motivated bullying, social support, self-esteem) partially accounted for differences in CMD and fully for PTSD. Adolescent mental health inequalities in Cape Town are associated with

  3. Mixing foams and grains in Hele-Shaw cells

    Energy Technology Data Exchange (ETDEWEB)

    Tufaile, A P B; Tufaile, A; Haddad, T A S, E-mail: tufaile@usp.b [Escola de Artes, Ciencias e Humanidades da Universidade de Sao Paulo, R. Arlindo Bettio, 1000, 03828-000, Sao Paulo (Brazil)

    2010-09-01

    We have observed some features of the coexistence of foams and granular materials in Hele-Shaw cells. The most part of the liquid and granular material stays at the bottom of the cell, with only a small quantity of the mixture resting on the froth. The fractal dimensions of the final states of the foams are close to the values obtained from the Random Apollonian Packing model. The disperse structure of the granular material affects the probability distribution of number of sides of the foam bubbles. The nearest neighbor distances between the peaks of the sand piles at the bottom of the cell are close to a lognormal distribution.

  4. Tsunakawa-Shaw method - an absolute paleointensity technique using alternating field demagnetization

    Science.gov (United States)

    Yamamoto, Y.; Mochizuki, N.; Shibuya, H.; Tsunakawa, H.

    2015-12-01

    Among geologic materials volcanic rocks have been typically used to deduce an absolute paleointensity. In the last decade, however, there seems a becoming consensus that volcanic rocks are not so ideal materials due to such as magnetic grains other than non-interacting single domain particles. One approach to obtain a good paleointensity estimate from the rocks is to reduce and correct the non-ideality, suppress alterations in laboratory and screen out suspicious results. We have been working on a development and an application of the Tsunakawa-Shaw method, which has been previously called the LTD-DHT Shaw method. This method is an AF(alternating field)-based technique and thus a paleointensity is estimated using coercivity spectra. To reduce the non-ideality, all remanences undergo low-temperature demagnetization (LTD) before any AF demagnetizations to remove multi-domain like component. To correct the non-ideality, anhysteretic remanent magnetizations (ARMs) are imparted with their directions parallel to natural remanent magnetizations and laboratory-imparted thermoremanent magnetizations (TRMs) and measured before and after laboratory heating. These ARMs are used to correct remanence anisotropies, possible interaction effects originated from the non-ideal grains and TRM changes caused by laboratory alterations. TRMs are imparted by heating specimens above their Curie temperatures and then cooling to room temperature at once to simulate nature conditions. These cycles are done in vacuum to suppress alterations in laboratory. Obtained results are judged by selection criteria, including a check for validity of the ARM corrections.It has been demonstrated that successful paleointensities are obtained from historical lavas in Japan and Hawaii, and from baked clay samples from a reconstructed ancient kiln, with the flow-mean precision of 5-10%. In case of old volcanic rocks, however, the method does not necessarily seem to be perfect. We will summarize these points in

  5. Mental Health Inequalities in Adolescents Growing Up in Post-Apartheid South Africa: Cross-Sectional Survey, SHaW Study.

    Directory of Open Access Journals (Sweden)

    Jayati Das-Munshi

    Full Text Available South Africa is one of the most 'unequal' societies in the world. Despite apartheid ending more than 20 years ago, material inequalities remain interwoven with ethnic/racial inequalities. There is limited research on the prevalence/predictors of common mental disorders (CMD among young people. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa.Cross-sectional associations of race/ethnicity and material disadvantage with CMD and Post Traumatic Stress Disorder (PTSD were assessed in a stratified random sample representative of school-attendees, aged 14-15 years, in a large metropolitan area of Cape Town. Validated instruments assessed mental disorders; these included: Harvard Trauma Questionnaire (PTSD; Short Moods and Feelings Questionnaire (depression; Zung self-rated anxiety scale (anxiety. Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys.Response rate was 88% (1034 of 1169 individuals. Adolescents experienced a high prevalence of depression (41%, anxiety (16% and PTSD (21%. A gradient between material disadvantage and CMD/ PTSD was evident across all ethnic/racial groups. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk (RR of CMD in black children was 2.27 (95% CI:1.24, 4.15 and for PTSD was RR: 2.21 (95% CI:1.73, 2.83. Relative risk of CMD was elevated in children self-identifying as 'coloured' (RR: 1.73, 95% CI:1.11, 2.70. Putative mediators (violence, racially motivated bullying, social support, self-esteem partially accounted for differences in CMD and fully for PTSD.Adolescent mental health inequalities in Cape Town are associated with

  6. Contracting bubbles in Hele-Shaw cells with a power-law fluid

    International Nuclear Information System (INIS)

    McCue, Scott W; King, John R

    2011-01-01

    The problem of bubble contraction in a Hele-Shaw cell is studied for the case in which the surrounding fluid is of power-law type. A small perturbation of the radially symmetric problem is first considered, focussing on the behaviour just before the bubble vanishes, it being found that for shear-thinning fluids the radially symmetric solution is stable, while for shear-thickening fluids the aspect ratio of the bubble boundary increases. The borderline (Newtonian) case considered previously is neutrally stable, the bubble boundary becoming elliptic in shape with the eccentricity of the ellipse depending on the initial data. Further light is shed on the bubble contraction problem by considering a long thin Hele-Shaw cell: for early times the leading-order behaviour is one-dimensional in this limit; however, as the bubble contracts its evolution is ultimately determined by the solution of a Wiener–Hopf problem, the transition between the long thin limit and the extinction limit in which the bubble vanishes being described by what is in effect a similarity solution of the second kind. This same solution describes the generic (slit-like) extinction behaviour for shear-thickening fluids, the interface profiles that generalize the ellipses that characterize the Newtonian case being constructed by the Wiener–Hopf calculation

  7. Investigation and visualization of liquid–liquid flow in a vertically mounted Hele-Shaw cell: flow regimes, velocity and shape of droplets

    International Nuclear Information System (INIS)

    Shad, S; Gates, I D; Maini, B B

    2009-01-01

    The motion and shape of a liquid drop flowing within a continuous, conveying liquid phase in a vertical Hele-Shaw cell were investigated experimentally. The continuous phase was more viscous and wetted the bounding walls of the Hele-Shaw cell. The gap between the Hele-Shaw plates was set equal to 0.0226 cm. Four different flow regimes were observed: (a) small-droplet flow, (b) elongated-droplet flow, (c) churn flow and (d) channel flow. At low capillary number, that is, when capillary forces are larger than viscous forces, the droplet shape was irregular and changed with time and distance, and it moved with lower velocity than that of the conveying phase. At higher capillary number, several different shapes of stabilized elongated and flattened drops were observed. In contrast to gas–liquid systems, the velocities of droplets are higher than that of conveying liquid. New correlations derived from dimensionless analysis and fitted to the experimental data were generated to predict the elongated-drop velocity and aspect ratio

  8. Investigation and visualization of liquid-liquid flow in a vertically mounted Hele-Shaw cell: flow regimes, velocity and shape of droplets

    Science.gov (United States)

    Shad, S.; Gates, I. D.; Maini, B. B.

    2009-11-01

    The motion and shape of a liquid drop flowing within a continuous, conveying liquid phase in a vertical Hele-Shaw cell were investigated experimentally. The continuous phase was more viscous and wetted the bounding walls of the Hele-Shaw cell. The gap between the Hele-Shaw plates was set equal to 0.0226 cm. Four different flow regimes were observed: (a) small-droplet flow, (b) elongated-droplet flow, (c) churn flow and (d) channel flow. At low capillary number, that is, when capillary forces are larger than viscous forces, the droplet shape was irregular and changed with time and distance, and it moved with lower velocity than that of the conveying phase. At higher capillary number, several different shapes of stabilized elongated and flattened drops were observed. In contrast to gas-liquid systems, the velocities of droplets are higher than that of conveying liquid. New correlations derived from dimensionless analysis and fitted to the experimental data were generated to predict the elongated-drop velocity and aspect ratio.

  9. Premixed combustion of coconut oil in a hele-shaw cell

    Directory of Open Access Journals (Sweden)

    Hadi Saroso

    2014-12-01

    Full Text Available Coconut oil combustion characteristic is observed experimentally by evaporating oil in the boiler then mix it with air before being burned at various equivalence ratios in the Hele-shaw cell. The result shows that, coconut oil tends to break into glycerol and fatty acid due to hydrolysis reaction producing the flame propagation, where the fatty acid flame propagates first then glycerol flame. Micro-explosion occurs when moisture from fatty acid combustion is absorbed by glycerol and higher heating due to higher flame speed produces more micro-explosion.

  10. Non-Newtonian Hele-Shaw Flow and the Saffman-Taylor Instability

    International Nuclear Information System (INIS)

    Kondic, L.; Shelley, M.J.; Palffy-Muhoray, P.

    1998-01-01

    We explore the Saffman-Taylor instability of a gas bubble expanding into a shear thinning liquid in a radial Hele-Shaw cell. Using Darcy close-quote s law generalized for non-Newtonian fluids, we perform simulations of the full dynamical problem. The simulations show that shear thinning significantly influences the developing interfacial patterns. Shear thinning can suppress tip splitting, and produce fingers which oscillate during growth and shed side branches. Emergent length scales show reasonable agreement with a general linear stability analysis. copyright 1998 The American Physical Society

  11. Dealing with completeness, structural hierarchy, and seismic coupling issues: three major challenges for #Fault2SHA

    Science.gov (United States)

    Valensise, Gianluca; Barba, Salvatore; Basili, Roberto; Bonini, Lorenzo; Burrato, Pierfrancesco; Carafa, Michele; Kastelic, Vanja; Fracassi, Umberto; Maesano, Francesco Emanuele; Tarabusi, Gabriele; Tiberti, Mara Monica; Vannoli, Paola

    2016-04-01

    The vast majority of active faulting studies are performed at the scale of individual, presumably seismogenic faults or fault strands. Most SHA approaches and models, however, require homogeneus information on potential earthquake sources over the entire tectonic domain encompassing the site(s) of interest. Although it is out of question that accurate SHA must rely on robust investigations of individual potential earthquake sources, it is only by gathering this information in regionally extensive databases that one can address some of the most outstanding issues in the use of #Fault2SHA. We will briefly recall three issues that are particularly relevant in the investigation of seismogenic faulting in southern Europe. A fundamental challenge is the completeness of the geologic record of active faulting. In most tectonic environments many potential seismogenic faults are blind or hidden, or deform the lower crust without leaving a discernible signal at the surface, or occur offshore, or slip so slowly that nontectonic erosional-depositional processes easily outpace their surface effects. Investigating only well-expressed faults is scientifically rewarding but also potentially misleading as it draws attention on the least insidious faults, leading to a potential underestimation of the regional earthquake potential. A further issue concerns the hierarchy of fault systems. Most active faults do not comprise seismogenic sources per se but are part of larger systems, and slip only in conjunction with the master fault of each system. In the most insidious cases, only secondary faults are expressed at the surface while the master fault lies hidden beneath them. This may result in an overestimation of the true number of seismogenic sources that occur in each region and in a biased identification of the characteristics of the main player in each system. Recent investigations of geologic and geodetic vs earthquake release budgets have shown that the "seismic coupling", which

  12. Theatre as a Vortex of Behaviour in Dutch Multicultural Society: A Discourse Analysis of "Aïsha" in the Public Sphere

    NARCIS (Netherlands)

    van Heugten, L.

    2013-01-01

    In 2001, a music theatre production exploring Islam’s early history from a female perspective was shut down before it reached the stage. The cancellation of Aïsha and the Women of Madina by Rotterdam’s Independent Theatre (O.T.) generated a media storm as speculations about censorship mounted. To

  13. Analisis Isi Lambung Ikan Senangin (Eleutheronema tetradactylum Shaw di Perairan Dumai

    Directory of Open Access Journals (Sweden)

    Titrawani Titrawani

    2016-03-01

    Full Text Available The research about stomach content analysis of thraedfin fish (Eleutheronema tetradactylum Shaw “senangin fish” in Dumai aquatic was taken out on July until Maret 2011. The research aimed to know the kind of senangin fish’s food include main food, supplement food and additional food. The used analysis based on Natarjan and Jingran in Effendi (1979, by analysis index of preponderance (Higher Part Index. Based on them main food of senangin fish are  Crustacea,  Engraulidae and animal debric.

  14. Paleomagnetic intensity of Aso pyroclastic flows: Additional results with LTD-DHT Shaw method, Thellier method with pTRM-tail check

    Science.gov (United States)

    Maruuchi, T.; Shibuya, H.

    2009-12-01

    For the sake to calibrate the absolute value of the ’relative paleointensity variation curve’ drawn from sediment cores, Takai et al. (2002) proposed to use pyroclastic flows co-bearing with wide spread tephras. The pyroclastic flows prepare volcanic rocks with TRM, which let us determine absolute paleointensity, and the tephras prepare the correlation with sediment stratigraphy. While 4 out of 6 pyroclastic flows are consistent with Sint-800 paleointensity variation curve, two flows, Aso-2 and Aso-4, show weaker and stronger than Sint-800 beyond the error, respectively. We revisited the paleointensity study of Aso pyroclastic flows, adding LTD- DHT Shaw method, the pTRM-tail check in Thellier experiment, and LTD-DHT Shaw method by using volcanic glasses. We prepared 11 specimens from 3 sites of Aso-1 welded tuff for LTD-DHT Shaw method experiments, and obtained 6 paleointensities satisfied a set of strict criteria. They yield an average paleointensity of 21.3±5.8uT, which is smaller than 31.0±3.4uT provided by Takai et al. (2002). For Aso-2 welded tuff, 11 samples from 3 sites were submitted to Thellier experiments, and 6 passed a set of pretty stringent criteria including pTRM-tail check, which is not performed by Takai et al. (2002). They give an average paleointensity of 20.2±1.5uT, which is virtually identical to 20.2±1.0uT (27 samples) given by Takai et al. (2002). Although the success rate was not good in LTD-DHT Shaw method, 2 out of 12 specimens passed the criteria, and gave 25.8±3.4uT, which is consistent with Takai et al. (2002). In addition, we obtained a reliable paleointensity from a volcanic glass in LTD-DHT Shaw method, it gives a paleointensity of 23.6 uT. It is also consitent with Takai et al. (2002). For Aso-3 welded tuff, we performed only LTD-DHT Shaw method for one specimen from one site yet. It gives a paleointensity of 43.0uT, which is higher than 31.8±3.6uT given by Takai et al. (2002). Eight sites were set for Aso-4 welded tuff

  15. Interfacial elastic fingering in Hele-Shaw cells: A weakly nonlinear study

    KAUST Repository

    Carvalho, Gabriel D.

    2013-11-11

    We study a variant of the classic viscous fingering instability in Hele-Shaw cells where the interface separating the fluids is elastic, and presents a curvature-dependent bending rigidity. By employing a second-order mode-coupling approach we investigate how the elastic nature of the interface influences the morphology of emerging interfacial patterns. This is done by focusing our attention on a conventionally stable situation in which the fluids involved have the same viscosity. In this framework, we show that the inclusion of nonlinear effects plays a crucial role in inducing sizable interfacial instabilities, as well as in determining the ultimate shape of the pattern-forming structures. Particularly, we have found that the emergence of either narrow or wide fingers can be regulated by tuning a rigidity fraction parameter. Our weakly nonlinear findings reinforce the importance of the so-called curvature weakening effect, which favors the development of fingers in regions of lower rigidity. © 2013 American Physical Society.

  16. Interfacial elastic fingering in Hele-Shaw cells: A weakly nonlinear study

    KAUST Repository

    Carvalho, Gabriel D.; Miranda, José A.; Gadê lha, Hermes

    2013-01-01

    We study a variant of the classic viscous fingering instability in Hele-Shaw cells where the interface separating the fluids is elastic, and presents a curvature-dependent bending rigidity. By employing a second-order mode-coupling approach we investigate how the elastic nature of the interface influences the morphology of emerging interfacial patterns. This is done by focusing our attention on a conventionally stable situation in which the fluids involved have the same viscosity. In this framework, we show that the inclusion of nonlinear effects plays a crucial role in inducing sizable interfacial instabilities, as well as in determining the ultimate shape of the pattern-forming structures. Particularly, we have found that the emergence of either narrow or wide fingers can be regulated by tuning a rigidity fraction parameter. Our weakly nonlinear findings reinforce the importance of the so-called curvature weakening effect, which favors the development of fingers in regions of lower rigidity. © 2013 American Physical Society.

  17. Genealogy of John and Charles Bell: their relationship with the children of Charles Shaw of Ayr.

    Science.gov (United States)

    Kaufman, M

    2005-11-01

    The Reverend William Bell had six children who survived infancy. Two of his sons entered the legal profession and two other sons became distinguished anatomists and surgeons--John Bell, said for 20 years to have been the leading operating surgeon in Britain and throughout the world--and Sir Charles Bell, possibly the most distinguished anatomist and physiologist of his day. Information is not known about the fifth son or their sister. Charles Shaw, a lawyer of Ayr, had four sons and two daughters who survived infancy. Two of his sons, John and Alexander, became anatomists and later surgeons at the Middlesex Hospital, and both worked closely with Charles Bell at the Great Windmill Street School of Anatomy. His third son entered the law and his fourth son became a distinguished soldier. The two daughters of Charles Shaw married into the Bell family: Barbara married George Joseph Bell and Marion married Mr (later Sir) Charles Bell.

  18. Bubble extinction in Hele-Shaw flow with surface tension and kinetic undercooling regularization

    International Nuclear Information System (INIS)

    Dallaston, Michael C; McCue, Scott W

    2013-01-01

    We perform an analytic and numerical study of an inviscid contracting bubble in a two-dimensional Hele-Shaw cell, where the effects of both surface tension and kinetic undercooling on the moving bubble boundary are not neglected. In contrast to expanding bubbles, in which both boundary effects regularize the ill-posedness arising from the viscous (Saffman–Taylor) instability, we show that in contracting bubbles the two boundary effects are in competition, with surface tension stabilizing the boundary, and kinetic undercooling destabilizing it. This competition leads to interesting bifurcation behaviour in the asymptotic shape of the bubble in the limit it approaches extinction. In this limit, the boundary may tend to become either circular, or approach a line or ‘slit’ of zero thickness, depending on the initial condition and the value of a nondimensional surface tension parameter. We show that over a critical range of surface tension values, both these asymptotic shapes are stable. In this regime there exists a third, unstable branch of limiting self-similar bubble shapes, with an asymptotic aspect ratio (dependent on the surface tension) between zero and one. We support our asymptotic analysis with a numerical scheme that utilizes the applicability of complex variable theory to Hele-Shaw flow. (paper)

  19. 34 CFR 668.88 - Hearing.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Hearing. 668.88 Section 668.88 Education Regulations of... Proceedings § 668.88 Hearing. (a) A hearing is an orderly presentation of arguments and evidence conducted by a hearing official. (b) If the hearing official, the designated department official who brought a...

  20. Myeloid differentiation factor 88 (MyD88-deficiency increases risk of diabetes in mice.

    Directory of Open Access Journals (Sweden)

    Toru Hosoi

    Full Text Available BACKGROUND: Multiple lines of evidence suggest innate immune response pathways to be involved in the development of obesity-associated diabetes although the molecular mechanism underling the disease is unknown. Recent observations suggest that saturated fatty acids can act as a ligand for toll-like receptor (TLR 4, which is thought to mediate obesity-associated insulin resistance. Myeloid differentiation factor 88 (MyD88 is an adapter protein for TLR/IL-1 receptor signaling, which is involved in the activation of inflammatory pathways. To evaluate molecular mechanisms linking obesity-associated diabetes down-stream of TLR4, we investigated physiological role of MyD88 in high-fat diet (HFD-induced obesity. METHODOLOGY/PRINCIPAL FINDINGS: In the present study, we found MyD88-deficient mice fed a HFD had increased circulating levels of insulin, leptin and cholesterol, as well as liver dysfunction (increased induction of ALT levels, increased activation of JNK and cleavage of PARP, which were linked to the onset of severe diabetes. On the other hand, TNF-alpha would not be involved in HFD-induced diabetes in MyD88-deficient mice, because TNF-alpha level was attenuated in MyD88-deficient mice fed with HFD. CONCLUSIONS/SIGNIFICANCE: The present finding of an unexpected role for MyD88 in preventing diabetes may provide a potential novel target/strategy for treating metabolic syndrome.

  1. Cation ordering in orthopyroxenes and cooling rates of meteorites: Low temperature cooling rates of Estherville, Bondoc and Shaw

    Science.gov (United States)

    Ganguly, J.; Yang, H.; Ghose, S.

    1993-01-01

    The cooling rates of meteorites provide important constraints on the size of their parent bodies, and their accretionary and evolutionary histories. However, the cooling rates obtained so far from the commonly used metallographic, radiometric and fission-track methods have been sometimes quite controversial, such as in the case of the mesosiderites and the meteorite Shaw. We have undertaken a systematic study of the cooling rates of meteorites using a different approach, which involves single crystal x-ray determination of Fe(2+)-Mg ordering in orthopyroxenes (OP(x)) in meteorites, subject to bulk compositional constraints, and numerical simulation of the evolution of the ordering state as a function of cooling rate, within the framework of the thermodynamic and kinetic principles governing cation ordering. We report the results obtained for OP(x) crystals from Shaw and two mesosiderites, Estherville and Bondoc.

  2. Design Approach and Implementation of Application Specific Instruction Set Processor for SHA-3 BLAKE Algorithm

    Science.gov (United States)

    Zhang, Yuli; Han, Jun; Weng, Xinqian; He, Zhongzhu; Zeng, Xiaoyang

    This paper presents an Application Specific Instruction-set Processor (ASIP) for the SHA-3 BLAKE algorithm family by instruction set extensions (ISE) from an RISC (reduced instruction set computer) processor. With a design space exploration for this ASIP to increase the performance and reduce the area cost, we accomplish an efficient hardware and software implementation of BLAKE algorithm. The special instructions and their well-matched hardware function unit improve the calculation of the key section of the algorithm, namely G-functions. Also, relaxing the time constraint of the special function unit can decrease its hardware cost, while keeping the high data throughput of the processor. Evaluation results reveal the ASIP achieves 335Mbps and 176Mbps for BLAKE-256 and BLAKE-512. The extra area cost is only 8.06k equivalent gates. The proposed ASIP outperforms several software approaches on various platforms in cycle per byte. In fact, both high throughput and low hardware cost achieved by this programmable processor are comparable to that of ASIC implementations.

  3. Shocks and finite-time singularities in Hele-Shaw flow

    Energy Technology Data Exchange (ETDEWEB)

    Teodorescu, Razvan [Los Alamos National Laboratory; Wiegmann, P [UNIV OF MONTREAL; Lee, S-y [UNIV OF CHICAGO

    2008-01-01

    Hele-Shaw flow at vanishing surface tension is ill-defined. In finite time, the flow develops cusplike singularities. We show that the ill-defined problem admits a weak dispersive solution when singularities give rise to a graph of shock waves propagating in the viscous fluid. The graph of shocks grows and branches. Velocity and pressure jump across the shock. We formulate a few simple physical principles which single out the dispersive solution and interpret shocks as lines of decompressed fluid. We also formulate the dispersive solution in algebro-geometrical terms as an evolution of Krichever-Boutroux complex curve. We study in details the most generic (2,3) cusp singularity which gives rise to an elementary branching event. This solution is self-similar and expressed in terms of elliptic functions.

  4. Three dimensional vortices and interfaces in Hele-Shaw cells

    International Nuclear Information System (INIS)

    Pumir, A.

    1987-06-01

    A model of nonviscous flow, based on the Biot-Savart equations is used to examine the existence of singularities in three dimensional, incompressible, hydrodynamic equations. The results suggest a fairly simple physical mechanism, which could lead to the formation of singularities in the nonviscous case: two vortex tubes with opposite circulations pair up and stretch each other, until the radii of the vortex cores become extremely small, causing a divergence of the vorticity. The cases of a perfect and a slightly viscous fluid are considered. The results are unclear as to whether the vorticity of a slightly viscous fluid can become infinite or not, and whether singularities exist. The dynamics of hydrodynamic interfaces are also investigated. The propagation of bubbles in a slightly viscous fluid, in a Hele-Shaw cell are described [fr

  5. The angle of repose of spherical grains in granular Hele–Shaw cells: a molecular dynamics study

    International Nuclear Information System (INIS)

    Maleki, Hamed; Ebrahimi, Fatemeh; Oskoee, Ehsan Nedaaee

    2008-01-01

    We report the results of three-dimensional molecular dynamic simulations on the angle of repose of a sandpile formed by pouring mono-sized cohesionless spherical grains into a granular Hele–Shaw cell. In particular, we are interested in investigating the effects of those variables which may have a significant impact on the pattern formation of granular mixtures in Hele–Shaw cells. The results indicate that the frictional forces influence the formation of piles on the grain level remarkably. Furthermore, we see that increasing grain insertion rate decreases the angle of repose slightly. We also find that the cell thickness is a significant factor and the angle of repose decays when the size of the gap between the lateral walls increases. In addition to agreeing with the experimental exponential decay law, our results are in accordance with a recently proposed model which takes into account the arching effects. Using grains with different sizes reveals that the behaviour of the angle of repose when both size and cell thickness are varied is controlled by a scaled function of the ratio of these two variables

  6. Droplet formation in Hele-Shaw T-junction.

    Science.gov (United States)

    Ricouvier, Joshua; Yazhgur, Pavel; Leshansky, Alexander; Tabeling, Patrick; Microflusa Team

    The development of digital microfluidics has attracted considerable interest towards generation of highly monodisperse microdroplets. T-junction has become an essential element of most of microfluidic chips. Despite its importance, theoretical analysis of droplet formation at T-junction is still incomplete due to complexity of physics involved. We focused on droplet generation at the Hele-Shaw T-junction. The effect of various experimental parameters, such as channel geometry, flow rates, surface tension and fluid viscosities, was thoroughly investigated. Our results show that the experimental system exhibits three distinct regimes (squeezing, dripping and jetting regimes) and point out the effect of confinement on the transitions. We demonstrate that the size of the ''plug'' droplet depends not only on the flow rate ratio (as described in the literature), but also on the capillary number and the channel cross-section aspect ratio. Quasi-2D flow equations allow us to perform numerical simulations and to compare them with experimental results. The Microflusa project receives funding from the European Union's Horizon 2020 research and innovation programme under Grant Agreement No. 664823.

  7. Structure of thallium and lead calculated from Shaw local pseudopotential and molecular dynamics

    Directory of Open Access Journals (Sweden)

    Gasser J. G.

    2011-05-01

    Full Text Available Recently, we (Es Sbihi Phil. Mag 2010 have successfully calculated, by molecular dynamics, the static structure factor of liquid bismuth at different temperatures. Our results were in very good agreement with the Waseda experimental data. Our assumption was to consider the true density of states which presents a gap as measured by Indlekofer (J. Non-Cryst. Solids 1989 and calculated by Hafner-Jank (Phys. Rev. B 1990 for liquid bismuth. The number of electrons at the Fermi energy has been calculated with three conduction electrons for bismuth (number of p electrons. With this assumption, the structures were determined with an effective ion-ion potential constructed from the Shaw local Optimised Model Potential (OMP and the Ichimaru-Utsumi dielectric function. In the present paper, we generalize our assumptions to liquid thallium and lead which also present such a gap. Their calculated structures are also very close to the experimental ones. This confirms that the number of conduction electrons on the Fermi sphere is consistent with the number of p electrons as has been even shown for our electronic transport properties of liquid lead (A. Ben Abdellah, Phys. Rev. B 2003.

  8. Electrokinetic Fingering In Hele-Shaw Cells

    Science.gov (United States)

    Mirzadeh, Mohammad; Bazant, Martin

    2016-11-01

    Large scale flow problems in porous media, such as those encountered in underground oil reservoirs, are typically described by the Darcy's law. However, it is well known that many underground rock formations contain surface groups and minerals that dissociate in the presence of water. Convection of these charges by the pressure driven flow can then set up streaming current and streaming potential that affects the flow. Furthermore, electric fields that are often used to enhance oil recovery, e.g. by reducing the oil's viscosity through electro-thermal heating, drive electro-osmotic flows that could set up very large pressure in small pores. The full description of fluid flow thus requires a solution to the fully coupled electrokinetic problem. In their seminal work, Saffman and Taylor showed that the moving interface between two immiscible fluids in a porous medium becomes unstable if pushed by the low-viscosity fluid. Here we report on the role of electrokinetic phenomena on stability of these viscous fronts in Hele-Shaw cells by using analytic as well as numerical approaches. Interestingly, we find that the instability could be suppressed if the right physical conditions are met or otherwise enhanced, leading to greater mixing of two fluids.

  9. Environmental Assessment for Wing Infrastructure Development Outlook (WINDO) Plan Shaw Air Force Base, South Carolina

    Science.gov (United States)

    2004-10-01

    officially established on August 30, 1941 and was named after 1st Lt. Ervin D. Shaw, a Sumter County resident who was killed in action during World War I...Examples of the animal species likely to occur within this community include the cottontail, mockingbird , American robin, and crow. At the Poinsett...include the white-tailed deer, red fox, raccoon, opossum, striped skunk, cottontail, meadowlark, mockingbird , American kestrel, fence lizard, and

  10. Rayleigh-Benard convection in a Hele-Shaw cell - a numerical study

    International Nuclear Information System (INIS)

    Guenther, C.; Mueller, U.

    1987-05-01

    Free convection in narrow vertical gaps heated from below gives rise to several different flow patterns as has been demonstrated by previous experimental investigations. A numerical study is presented aimed at simulating the observed flow phenomena in Hele-Shaw cells of small lateral extend. The numerical study is based on the assumption that the flow is essentially two-dimensional. This allows an approach using a one-term Galerkin approximation with respect to the direction perpendicular to the gap and a finite difference scheme with regard to the coordinates in the plane of the gap. The calculations result in realistic values of the critical Rayleigh numbers for the onset of steady and oscillatory convection. Most of the observed unsteady flow patterns can be simulated numerically. It is shown that five different stable flow patterns can occur at one particular Rayleigh number. The different stable flow patterns are coupled by a variety of complex transitions. Moreover the calculations show that a realistic description of the observed flow phenomena can not be obtained by a simplified model using the Darcy law in the momentum equation and implying slip flow at the small confining boundaries. (orig.) [de

  11. Centrifugal fingering in a curved Hele-Shaw cell: A generalized Euler's elastica shape for the two-fluid interface

    Science.gov (United States)

    Miranda, Jose; Brandao, Rodolfo

    2017-11-01

    We study a family of generalized elastica-like equilibrium shapes that arise at the interface separating two fluids in a curved rotating Hele-Shaw cell. This family of stationary interface solutions consists of shapes that balance the competing capillary and centrifugal forces in such a curved flow environment. We investigate how the emerging interfacial patterns are impacted by changes in the geometric properties of the curved Hele-Shaw cell. A vortex-sheet formalism is used to calculate the two-fluid interface curvature, and a gallery of possible shapes is provided to highlight a number of peculiar morphological features. A linear perturbation theory is employed to show that the most prominent aspects of these complex stationary patterns can be fairly well reproduced by the interplay of just two interfacial modes. The connection of these dominant modes to the geometry of the curved cell, as well as to the fluid dynamic properties of the flow, is discussed. We thank CNPq (Brazilian Research Council) for financial support under Grant No. 304821/2015-2.

  12. A high speed low power low offset dynamic comparator used in SHA-less pipelined ADC

    Science.gov (United States)

    Shubin, Liu; Zhangming, Zhu; Yintang, Yang; Lianxi, Liu

    2014-05-01

    A novel fully differential high speed high resolution low offset CMOS dynamic comparator has been implemented in the SMIC 0.18 μm process used for a sample-and-hold amplifier (SHA)-less pipelined analog-to-digital converters (ADC). Based on the analysis and optimization between delay time and offset, an enhanced reset architecture with transmission gate was introduced to speed up the comparison and reset procedure. Four inputs with two cross coupled differential pairs, reconstituted bias circuit for tail current transistor and common centroid layouts make the comparator more robust against mismatch and process variations. The simulation results demonstrate that the proposed design achieves 1 mV sensitivity at 2.2 GHz sampling rate with a power consumption of 510 μW, while the mean offset voltage is equal to 10.244 mV.

  13. Wavelength selection in injection-driven Hele-Shaw flows: A maximum amplitude criterion

    Science.gov (United States)

    Dias, Eduardo; Miranda, Jose

    2013-11-01

    As in most interfacial flow problems, the standard theoretical procedure to establish wavelength selection in the viscous fingering instability is to maximize the linear growth rate. However, there are important discrepancies between previous theoretical predictions and existing experimental data. In this work we perform a linear stability analysis of the radial Hele-Shaw flow system that takes into account the combined action of viscous normal stresses and wetting effects. Most importantly, we introduce an alternative selection criterion for which the selected wavelength is determined by the maximum of the interfacial perturbation amplitude. The effectiveness of such a criterion is substantiated by the significantly improved agreement between theory and experiments. We thank CNPq (Brazilian Sponsor) for financial support.

  14. Innovation in hydroelectric power plant design in early twentieth century. Casto Fernández-Shaw's Engineering Architecture in La Jándula dam

    Directory of Open Access Journals (Sweden)

    A. B. Berrocal Menárguez

    2017-09-01

    Full Text Available The power plant location in the first hydroelectrial dams was a relevant issue at the end of XIX century and early XX. Different solutions were tried, some of them with very interesting aesthetics results and hydraulic and structural implications. Such is the case of La Jándula dam, inaugurated in 1930, that includes the power station inside the dam. This article examines the possible national and international inspirations of this singular solution, corroborating the hypothesis of its unprecedented nature. The collaboration of the architect Casto Fernández-Shaw in the design and integration of the engine room was decisive, because it achieved a result of an aesthetic quality and formal expressiveness unprecedented in a work of hydraulic engineering, as well as the birth of a style Shaw himself defined as architectural engineering.

  15. Side channel analysis of some hash based MACs:A response to SHA-3 requirements

    DEFF Research Database (Denmark)

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...... function which is more resistant to known side channel attacks (SCA) when plugged into HMAC, or that has an alternative MAC mode which is more resistant to known SCA than the other submitted alternatives. In response to this, we perform differential power analysis (DPA) on the possible smart card...... implementations of some of the recently proposed MAC alternatives to NMAC (a fully analyzed variant of HMAC) and HMAC algorithms and NMAC/HMAC versions of some recently proposed hash and compression function modes. We show that the recently proposed BNMAC and KMDP MAC schemes are even weaker than NMAC...

  16. RANCANG BANGUN APLIKASI ANTIVIRUS KOMPUTER DENGAN MENGGUNAKAN METODE SECURE HASH ALGORITHM 1 (SHA1 DAN HEURISTIC STRING

    Directory of Open Access Journals (Sweden)

    I Gusti Made Panji Indrawinatha

    2016-12-01

    Full Text Available Virus komputer merupakan perangkat lunak berbahaya yang dapat merusak data dan menggandakan diri pada sistem komputer. Untuk mendeteksi dan membersihkan virus dari sistem komputer, maka dibuatlah aplikasi antivirus. Dalam mendeteksi berbagai jenis virus sebuah aplikasi antivirus biasanya menggunakan beberapa metode. Pada penelitian ini akan membahas perancangan sebuah aplikasi antivirus menggunakan metode Secure Hash Algorithm 1 (SHA1 dan heuristic string sebagai metode pendeteksian virus. Dari pengujian yang dilakukan diperoleh hasil dimana saat tidak menggunakan heuristic, antivirus hanya mendeteksi 12 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 35%. sedangkan saat menggunakan heuristic, antivirus berhasil mendeteksi 31 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 91%.

  17. A study of gas bubbles in liquid mercury in a vertical Hele-Shaw cell

    Energy Technology Data Exchange (ETDEWEB)

    Klaasen, B.; Blanpain, B. [KU Leuven, Research Group for High Temperature Processes and Industrial Ecology, Department of Metallurgy and Materials Engineering, Leuven (Belgium); Verhaeghe, F. [KU Leuven, Research Group for High Temperature Processes and Industrial Ecology, Department of Metallurgy and Materials Engineering, Leuven (Belgium); Umicore Group Research and Development, Olen (Belgium); Fransaer, J. [KU Leuven, Research Group for Materials with Novel Functionality, Department of Metallurgy and Materials Engineering, Leuven (Belgium)

    2014-01-15

    High-quality observations of mesoscopic gas bubbles in liquid metal are vital for a further development of pyrometallurgical gas injection reactors. However, the opacity of metals enforces the use of indirect imaging techniques with limited temporal or spatial resolution. In addition, accurate interface tracking requires tomography which further complicates the design of a high-temperature experimental setup. In this paper, an alternative approach is suggested that circumvents these two main restrictions. By injecting gas in a thin layer of liquid metal entrapped between two flat and closely spaced plates, bubbles in a Hele-Shaw flow regime are generated. The resulting quasi-2D multiphase flow phenomena can be fully captured from a single point of view and, when using a non-wetted transparent plate material, the bubbles can be observed directly. The feasibility of this approach is demonstrated by observations on buoyancy-driven nitrogen bubbles in liquid mercury in a vertical Hele-Shaw cell. By using a moving high-speed camera to make continuous close up recordings of individual bubbles, the position and geometry of these bubbles are quantified with a high resolution along their entire path. After a thorough evaluation of the experimental accuracy, this information is used for a detailed analysis of the bubble expansion along the path. While the observed bubble growth is mainly caused by the hydrostatic pressure gradient, a careful assessment of the volume variations for smaller bubbles shows that an accurate bubble description should account for significant dynamic pressure variations that seem to be largely regime dependent. (orig.)

  18. Billy Shaw Dam and Reservoir: Environmental assessment and finding of no significant impacts

    International Nuclear Information System (INIS)

    1997-03-01

    This notice announces BPA's decision to fund the construction, operation, and maintenance of the Billy Shaw Dam and Reservoir on the Duck Valley Reservation. This project is part of a continuing effort to address system-wide fish and wildlife losses caused by the development of the hydropower system in the Columbia River Basin. BPA has prepared an Environmental Assessment (EA) evaluating the potential environmental impacts of the proposed project. Based on the analysis in the EA, BPA has determined that the Proposed Action is not a major Federal action significantly affecting the quality of the human environment, within the meaning of the National Environmental Policy Act (NEPA) of 1969. Therefore, the preparation of an Environmental Impact Statement (EIS) is not required and BPA is issuing this FONSI

  19. The canine MHC class Ia allele DLA-88*508:01 presents diverse self- and canine distemper virus-origin peptides of varying length that have a conserved binding motif.

    Science.gov (United States)

    Ross, Peter; Nemec, Paige S; Kapatos, Alexander; Miller, Keith R; Holmes, Jennifer C; Suter, Steven E; Buntzman, Adam S; Soderblom, Erik J; Collins, Edward J; Hess, Paul R

    2018-03-01

    Ideally, CD8+ T-cell responses against virally infected or malignant cells are defined at the level of the specific peptide and restricting MHC class I element, a determination not yet made in the dog. To advance the discovery of canine CTL epitopes, we sought to determine whether a putative classical MHC class Ia gene, Dog Leukocyte Antigen (DLA)-88, presents peptides from a viral pathogen, canine distemper virus (CDV). To investigate this possibility, DLA-88*508:01, an allele prevalent in Golden Retrievers, was expressed as a FLAG-tagged construct in canine histiocytic cells to allow affinity purification of peptide-DLA-88 complexes and subsequent elution of bound peptides. Pattern analysis of self peptide sequences, which were determined by liquid chromatography-tandem mass spectrometry (LC-MS/MS), permitted binding preferences to be inferred. DLA-88*508:01 binds peptides that are 9-to-12 amino acids in length, with a modest preference for 9- and 11-mers. Hydrophobic residues are favored at positions 2 and 3, as are K, R or F residues at the C-terminus. Testing motif-matched and -unmatched synthetic peptides via peptide-MHC surface stabilization assay using a DLA-88*508:01-transfected, TAP-deficient RMA-S line supported these conclusions. With CDV infection, 22 viral peptides ranging from 9-to-12 residues in length were identified in DLA-88*508:01 eluates by LC-MS/MS. Combined motif analysis and surface stabilization assay data suggested that 11 of these 22 peptides, derived from CDV hemagglutinin, large polymerase, matrix, nucleocapsid, and V proteins, were processed and presented, and thus, potential targets of anti-viral CTL in DLA-88*508:01-bearing dogs. The presentation of diverse self and viral peptides indicates that DLA-88 is a classical MHC class Ia gene. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. Universality Results for Multi-Layer Hele-Shaw and Porous Media Flows

    Science.gov (United States)

    Daripa, Prabir

    2012-11-01

    Saffman-Taylor instability is a well known viscosity driven instability of an interface. Motivated by a need to understand the effect of various injection policies currently in practice for chemical enhanced oil recovery, we study linear stability of displacement processes in a Hele-Shaw cell involving injection of an arbitrary number of immiscible fluid phases in succession. This is a problem involving many interfaces. Universal stability results have been obtained for this multi-layer (multi-region) flow in the sense that the results hold with arbitrary number of interfaces. These stability results have been applied to design injection policies that are considerably less unstable than the pure Saffman-Taylor case. In particular, we determine specific values of the viscosity of the fluid layers corresponding to smallest unstable band. Moreover, we discuss universal selection principle of optimal viscous profiles. The talk is based on following papers. Qatar National Fund (a member of the Qatar Foundation).

  1. Identification and function of myeloid differentiation factor 88 (MyD88 in Litopenaeus vannamei.

    Directory of Open Access Journals (Sweden)

    Shuang Zhang

    Full Text Available Myeloid differentiation factor 88 (MyD88 is a universal and essential signaling protein in Toll-like receptor/interleukin-1 receptor-induced activation of nuclear factor-kappa B. In this study, two MyD88 protein variants (LvMyD88 and LvMyD88-1 were identified in Litopenaeus vannamei. The LvMyD88 cDNA is 1,848 bp in length and contains an open reading frame (ORF of 1,428 bp, whereas the LvMyD88-1 cDNA is 1,719 bp in length and has an ORF of 1,299 bp. Both variants encode proteins with death and Toll/interleukin-1 receptor domains and share 91% sequence identity. In healthy L. vannamei, the LvMyD88 genes were highly expressed in hemocytes but at a low level in the hepatopancreas. The LvMyD88s expression was induced in hemocytes after challenge with lipopolysaccharide, CpG-ODN2006, Vibrio parahaemolyticus, Staphyloccocus aureus, and white spot syndrome virus, but not by poly I∶C. Overexpression of LvMyD88 and LvMyD88-1 in Drosophila Schneider 2 cells led to activation of antimicrobial peptide genes and wsv069 (ie1, wsv303, and wsv371. These results suggested that LvMyD88 may play a role in antibacterial and antiviral response in L. vannamei. To our knowledge, this is the first report on MyD88 in shrimp and a variant of MyD88 gene in invertebrates.

  2. Billy Shaw Dam and Reservoir : Environmental Assessment and Finding of No Significant Impacts.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration; Shoshone-Paiute Tribes of the Duck Valley Reservation, Nevada.

    1997-03-01

    This notice announces BPA`s decision to fund the construction, operation, and maintenance of the Billy Shaw Dam and Reservoir on the Duck Valley Reservation. This project is part of a continuing effort to address system-wide fish and wildlife losses caused by the development of the hydropower system in the Columbia River Basin. BPA has prepared an Environmental Assessment (EA) evaluating the potential environmental impacts of the proposed project. Based on the analysis in the EA, BPA has determined that the Proposed Action is not a major Federal action significantly affecting the quality of the human environment, within the meaning of the National Environmental Policy Act (NEPA) of 1969. Therefore, the preparation of an Environmental Impact Statement (EIS) is not required and BPA is issuing this FONSI.

  3. Molecular identification and functional analysis of two variants of myeloid differentiation factor 88 (MyD88) from disk abalone (Haliotis discus discus).

    Science.gov (United States)

    Priyathilaka, Thanthrige Thiunuwan; Bathige, S D N K; Lee, Seongdo; Lee, Jehee

    2018-02-01

    Myeloid differentiation factor 88 (MyD88) is a crucial adaptor protein of the Toll-like receptor (TLR)- and interleukin 1 receptor-mediated signaling pathways and is involved in a diverse array of inflammatory responses via NF-κB activation. In the present study, two MyD88 variants were identified from disk abalone (Haliotis discus discus) and designated AbMyD88-2 and AbMyD88-X. The deduced AbMyD88-2 and AbMyD88-X comprised 433 and 354 amino acids with predicted molecular masses of 48.85 kDa and 40.17 kDa, respectively. AbMyD88-2 and AbMyD88-X possessed typical MyD88 domain structural features including an N-terminal death domain (DD) and C-terminal toll interleukin 1 receptor (TIR) domain similar to those in mammals. Expression analysis of AbMyD88-2 and AbMyD88-X mRNA at different early embryonic developmental stages of abalone by qPCR revealed that their constitutive expression at all developmental stages analyzed with the considerably higher values at the 16-cell (AbMyD88-2) and morula stages (AbMyD88-X). In unchallenged disk abalones, AbMyD88-2 was highly expressed in muscles, while AbMyD88-X mRNA was predominantly transcribed in hemocytes. Moreover, AbMyD88-2 and AbMyD88-X mRNA were differentially modulated in abalone hemocytes after a challenge with live bacteria (Vibrio parahaemolyticus, Listeria monocytogenes), virus (viral hemorrhagic septicemia virus), and pathogen-associated molecular patterns (lipopolysaccharides and Poly I:C). Overexpression of AbMyD88-2 and AbMyD88-X in HEK293T cells induced the activation of the NF-κB promoter. AbMyD88-2 and AbMyD88-X involvement in inflammatory responses was characterized by their overexpression in RAW264.7 murine macrophage cells. These results revealed comparatively higher NO (Nitric oxide) production, induction of inflammatory mediator genes (iNOS and COX2), and proinflammatory genes (IL1β, IL6 and TNFα) expression in abalone MyD88s-overexpressing cells than in mock control in the presence or absence of LPS

  4. Propagation of a finite bubble in a Hele-Shaw channel of variable depth

    Science.gov (United States)

    Juel, Anne; Franco-Gomez, Andres; Thompson, Alice; Hazel, Andrew

    2017-11-01

    We study the propagation of finite bubbles in a Hele-Shaw channel, where a centred rail is introduced to provide a small axially-uniform depth constriction. We demonstrate experimentally that this channel geometry can be used as a passive sorting device. Single air bubbles carried within silicone oil are generally transported on one side of the rail. However, for flow rates marginally larger than a critical value, a narrow band of bubble sizes on the order of the rail width can propagate over the rail, while bubbles of other sizes segregate to the side of the rail. The width of this band of bubble sizes increases with flow rate and the size of the most stable bubble can be tuned by varying the rail width. We present a depth-averaged theory which reveals that the mechanism relies on a non-trivial interaction between capillary and viscous forces that is fully dynamic, rather than being a simple modification of capillary static solutions. In contrast, for larger bubbles and sufficiently large imposed flow rates, we find that initially centred bubbles do not converge onto a steady mode of propagation. Instead they transiently explore weakly unstable steady modes, an evolution which results in their break-up and eventual settling into a steady state of changed topology. The financial support of CONICYT and the Leverhulme Trust are gratefully acknowledged.

  5. The effect of a crosslinking chemical reaction on pattern formation in viscous fingering of miscible fluids in a Hele-Shaw cell

    Science.gov (United States)

    Bunton, Patrick H.; Tullier, Michael P.; Meiburg, Eckart; Pojman, John A.

    2017-10-01

    Viscous fingering can occur in fluid motion whenever a high mobility fluid displaces a low mobility fluid in a Darcy type flow. When the mobility difference is primarily attributable to viscosity (e.g., flow between the two horizontal plates of a Hele-Shaw cell), viscous fingering (VF) occurs, which is sometimes termed the Saffman-Taylor instability. Alternatively, in the presence of differences in density in a gravity field, buoyancy-driven convection can occur. These instabilities have been studied for decades, in part because of their many applications in pollutant dispersal, ocean currents, enhanced petroleum recovery, and so on. More recent interest has emerged regarding the effects of chemical reactions on fingering instabilities. As chemical reactions change the key flow parameters (densities, viscosities, and concentrations), they may have either a destabilizing or stabilizing effect on the flow. Hence, new flow patterns can emerge; moreover, one can then hope to gain some control over flow instabilities through reaction rates, flow rates, and reaction products. We report effects of chemical reactions on VF in a Hele-Shaw cell for a reactive step-growth cross-linking polymerization system. The cross-linked reaction product results in a non-monotonic viscosity profile at the interface, which affects flow stability. Furthermore, three-dimensional internal flows influence the long-term pattern that results.

  6. Numerical simulation of particle jet formation induced by shock wave acceleration in a Hele-Shaw cell

    Science.gov (United States)

    Osnes, A. N.; Vartdal, M.; Pettersson Reif, B. A.

    2018-05-01

    The formation of jets from a shock-accelerated cylindrical shell of particles, confined in a Hele-Shaw cell, is studied by means of numerical simulation. A number of simulations have been performed, systematically varying the coupling between the gas and solid phases in an effort to identify the primary mechanism(s) responsible for jet formation. We find that coupling through drag is sufficient for the formation of jets. Including the effect of particle volume fraction and particle collisions did not alter the general behaviour, but had some influence on the length, spacing and number of jets. Furthermore, we find that the jet selection process starts early in the dispersal process, during the initial expansion of the particle layer.

  7. Healthy Buildings '88

    International Nuclear Information System (INIS)

    Berglund, B.; Lindvall, T.; Maansson, L.G.

    1988-06-01

    The Healthy Buildings '88 Conference focuses on the technical solutions and functional requirements contributing to Healthy Buildings for people to live and work in. The main object of the Conference is to give architects, consultants, real-estate owners and manufacturers of building materials recommendations on choice of materials and choice of systems and on how to combine materials and systems. The program includes overview lectures, plenary symposia with invited speakers, workshops, poster presentations and an exhibition of scientific, educational and technical material. One part of the conference is devoted to the problem of radon in residential buildings

  8. 9 CFR 381.88 - Parasites.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Parasites. 381.88 Section 381.88 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY... § 381.88 Parasites. Organs or other parts of carcasses which are found to be infested with parasites, or...

  9. 21 CFR 808.88 - Pennsylvania.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Pennsylvania. 808.88 Section 808.88 Food and Drugs... and Local Exemptions § 808.88 Pennsylvania. (a) The following Pennsylvania medical device requirements... the condition that, in enforcing this requirement, Pennsylvania apply the definition of “used hearing...

  10. Identification, functional characterization and expression pattern of myeloid differentiation factor 88 (MyD88) in Sepiella japonica.

    Science.gov (United States)

    Huo, Liping; Bao, Miaomiao; Lv, Zhenming; Chi, Changfeng; Wang, Tianming; Liu, Huihui

    2018-05-01

    Myeloid differentiation factor 88 (MyD88) is an adaptor protein involved in the interleukin-1 receptor and Toll-like receptor-induced activation of nuclear factor-κB (NF-κB). In this study a novel isoform of MyD88 in Sepiella japonica (SjMyD88) was cloned and functionally characterized (GenBank accession no. AQY56781.1). The complete cDNA sequence of SjMyD88 was 1912 bp and contained a 1017 bp open reading frame encoding 338 amino acid residues, which was similar to its mollusk orthologues in the length. BLASTp analysis suggested the deduced amino acids sequence of SjMyD88 shared high identity to the known MyD88, for instance, 64% identity with Octopus bimaculoides. Sequence analysis revealed two conserved domains, the N-terminal DD and the C-terminal TIR domain appeared in SjMyD88, which was consistent with MyD88 proteins from other species. The fusion expression of SjMyD88 and green fluorescent protein (EGFP) in HEK293 cells was conducted and cytoplasm localization was detected. Meanwhile, the TIR-pmCherry fusion protein showed red fluorescence and mainly distributed in the cytoplasm. After cotransfection MyD88-EGFP and TIR-pmCherry red obviously overlapped and changed to yellowish green. The results suggested that there was the interaction between homologous TIR-pmcherry and MyD88-EGFP. Tissues expression profiles analysis showed that SjMyD88 ubiquitously expressed in all tested tissues with the highest expression in the gills and livers except reproductive related tissue, and it was significantly induced in livers under LPS stress. These data provide insight into the roles of SjMyD88 in the TLR signaling pathway of S. japonica in response to pathogenic bacteria. Copyright © 2018. Published by Elsevier Ltd.

  11. Nutritional status of care-dependent people with dementia in shared-housing arrangements--a one-year follow-up.

    Science.gov (United States)

    Meyer, Saskia; Gräske, Johannes; Worch, Andreas; Wolf-Ostermann, Karin

    2015-12-01

    Malnutrition in the elderly is an important nursing challenge. Persons with dementia disease are often affected by malnutrition. During recent years, shared-housing arrangements (SHA) for older care-dependent people, frequently with dementia disease, have evolved in Germany. SHA can be an alternative to traditional residential care in nursing homes. The prevalence of malnutrition in SHA is compared to the prevalence in community dwellings and lower than the prevalence of malnutrition in nursing homes. There are no scientific data about the development of the nutritional status of older care-dependent people in SHA over one year. The aim of this study is to describe the nutritional status of care-dependent people with dementia disease living in SHA and to investigate changes over a period of one year. A longitudinal study with a one-year follow-up was performed. Standardised interviews with nurses were conducted concerning nutritional status (Mini Nutritional Assessment--MNA), cognitive capacities (Mini Mental State Examination--MMSE), activities of daily living (Extended Barthel-Index--EBI) and socio-demographic characteristics. Nutritional data were available for 45 residents at baseline and 36 residents at follow-up. At baseline, 45 residents with an average age of 78.4 years living in SHA in the state of Berlin, Germany, were included in the study. Predominantly, residents were female (73.3%) and diagnosed with dementia (88.9%), with a moderate to severe cognitive impairment (MMSE: 10.8) and low daily living abilities (EBI: 33.7). Most residents (80.6%) have a risk of malnutrition regarding the MNA. The average MNA score did decline slightly within one year (t0 = 20.8 vs. t1 = 19.7). Regular screenings for malnutrition using validated standardised assessments, which are easy to apply, should be implemented in SHA to avoid nutritional and health-related problems arising from malnutrition. Flexible structures for care, as in SHA, can facilitate coping with

  12. Installation tests for BERSAFE 88

    International Nuclear Information System (INIS)

    Bamfield, R.D.; Haigh, R.

    1989-02-01

    A set of ten test problems for each of the four BERSAFE stress analysis programs is provided. These problems along with this report, which forms part of the BERSAFE 88 documentation, constitute a test of the customers' BERSAFE installation. On running the problems and attaining results identical to those presented here, the customer should have some confidence that his system is operating correctly. (author)

  13. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    International Nuclear Information System (INIS)

    Lin, Wen-Yang; Lin, Feng-Huei; Sadhasivam, S.; Savitha, S.

    2010-01-01

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  14. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Wen-Yang; Lin, Feng-Huei [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Sadhasivam, S., E-mail: rahulsbio@yahoo.co.in [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Savitha, S. [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China)

    2010-05-10

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  15. Economic values for production traits for different sheep breeds in Kosovo

    Directory of Open Access Journals (Sweden)

    Hysen Bytyqi

    2015-10-01

    Full Text Available Generally, all traits of economic importance should be included in the breeding goal of livestock breeding programmes. The main aim of this study was to examine economic values for a combination of dairy and meat traits of the dual purpose Bardhoka (BAR, Balusha (BAL, Sharri (SHA and Kosova (KOS sheep breeds in Kosovo. The underlying herd model is based on a deterministic approach considering a sheep flock with milk production, lamb fattening and replacement stock. In order to examine the economic impact for different sheep breeds, the production traits considered were milk (milk yield and fattening (daily gain. For each lactation cycle among the breeds the main revenues resulted from selling milk (€ 61.82/46.03/26.37/27.22 and fattened lambs (€ 34.06/39.88/35.42/33.92 for BAR/BAL/ SHA/KOS, respectively. For BAR and BAL the economic value per average ewe place and year was € 37.7 for both breeds, while for SHA and KOS it was € 35.1 and € 32.5, respectively. For lamb fattening, daily gain was found to have the highest economic value at € 7.00 for BAL, SHA and KOS, while for BAR it was € 6.67. The relative economic values for milk yield and daily gain for BAR, BAL, SHA and KOS were 84.96:15.04, 84.42:15.58, 83.45:16.55, and 82.36:17.64, respectively.

  16. Of mice and men: evolution and the socialist utopia. William Morris, H.G. Wells, and George Bernard Shaw.

    Science.gov (United States)

    Hale, Piers J

    2010-01-01

    During the British socialist revival of the 1880s competing theories of evolution were central to disagreements about strategy for social change. In News from Nowhere (1891), William Morris had portrayed socialism as the result of Lamarckian processes, and imagined a non-Malthusian future. H.G. Wells, an enthusiastic admirer of Morris in the early days of the movement, became disillusioned as a result of the Malthusianism he learnt from Huxley and his subsequent rejection of Lamarckism in light of Weismann's experiments on mice. This brought him into conflict with his fellow Fabian, George Bernard Shaw, who rejected neo-Darwinism in favour of a Lamarckian conception of change he called "creative evolution."

  17. Efficient topology optimization in MATLAB using 88 lines of code

    DEFF Research Database (Denmark)

    Andreassen, Erik; Clausen, Anders; Schevenels, Mattias

    2011-01-01

    The paper presents an efficient 88 line MATLAB code for topology optimization. It has been developed using the 99 line code presented by Sigmund (Struct Multidisc Optim 21(2):120–127, 2001) as a starting point. The original code has been extended by a density filter, and a considerable improvemen...... of the basic code to include recent PDE-based and black-and-white projection filtering methods. The complete 88 line code is included as an appendix and can be downloaded from the web site www.topopt.dtu.dk....

  18. 49 CFR 393.88 - Television receivers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Television receivers. 393.88 Section 393.88... NECESSARY FOR SAFE OPERATION Miscellaneous Parts and Accessories § 393.88 Television receivers. Any motor vehicle equipped with a television viewer, screen or other means of visually receiving a television...

  19. 50 CFR 18.88 - Cross-examination.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Cross-examination. 18.88 Section 18.88... PLANTS (CONTINUED) MARINE MAMMALS Notice and Hearing on Section 103 Regulations § 18.88 Cross-examination... examination; and (2) Exclude cross-examination questions that are immaterial, irrelevant or unduly repetitious...

  20. 50 CFR 260.88 - Political activity.

    Science.gov (United States)

    2010-10-01

    ... part in political management or in political campaigns. Political activities in city, county, State, or... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Political activity. 260.88 Section 260.88... Products for Human Consumption Miscellaneous § 260.88 Political activity. All inspectors and licensed...

  1. 19 CFR 141.88 - Computed value.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

  2. Bubble propagation in Hele-Shaw channels with centred constrictions

    Science.gov (United States)

    Franco-Gómez, Andrés; Thompson, Alice B.; Hazel, Andrew L.; Juel, Anne

    2018-04-01

    We study the propagation of finite bubbles in a Hele-Shaw channel, where a centred occlusion (termed a rail) is introduced to provide a small axially uniform depth constriction. For bubbles wide enough to span the channel, the system’s behaviour is similar to that of semi-infinite fingers and a symmetric static solution is stable. Here, we focus on smaller bubbles, in which case the symmetric static solution is unstable and the static bubble is displaced towards one of the deeper regions of the channel on either side of the rail. Using a combination of experiments and numerical simulations of a depth-averaged model, we show that a bubble propagating axially due to a small imposed flow rate can be stabilised in a steady symmetric mode centred on the rail through a subtle interaction between stabilising viscous forces and destabilising surface tension forces. However, for sufficiently large capillary numbers Ca, the ratio of viscous to surface tension forces, viscous forces in turn become destabilising thus returning the bubble to an off-centred propagation regime. With decreasing bubble size, the range of Ca for which steady centred propagation is stable decreases, and eventually vanishes through the coalescence of two supercritical pitchfork bifurcations. The depth-averaged model is found to accurately predict all the steady modes of propagation observed experimentally, and provides a comprehensive picture of the underlying steady bifurcation structure. However, for sufficiently large imposed flow rates, we find that initially centred bubbles do not converge onto a steady mode of propagation. Instead they transiently explore weakly unstable steady modes, an evolution which results in their break-up and eventual settling into a steady propagating state of changed topology.

  3. 40 CFR 763.88 - Assessment.

    Science.gov (United States)

    2010-07-01

    ... ACBM in the school building. (2) Each accredited inspector providing a written assessment shall sign... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Assessment. 763.88 Section 763.88 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT ASBESTOS...

  4. Instability of displacement of Oldroyd-B fluid by air in a Hele-Shaw cell

    Science.gov (United States)

    Daripa, Prabir

    2014-03-01

    We study the displacement of an Oldroyd-B fluid in a Hele-Shaw cell when driven by air. In particular, we explicitly obtain an analytical expression for the growth rate of instability which depends on the relaxation and retardation (time) constants, denoted by λ, and λ1 respectively, appearing in the Oldroyd-B constitutive relations. When these two constants are zero, we recover the classical Saffman-Taylor result for a Newtonian liquid displaced by air. Our results show that this displacement process is more unstable than the case when a Newtonian fluid is displaced by air. The analytical results are plotted and compared with numerical results on this unstable displacement process available in the literature. The agreement is found to be excellent. In particular, results show that the non-Newtonian case (i.e., Oldroyd-B) is more unstable than the Newtonian case. Supported by an NPRP Grant # 08-777-1-141 from the Qatar National Research Fund (a member of the Qatar Foundation). The statements made herein are solely the responsibility of the author.

  5. Why There Are 88 Keys on the Piano: "88 Logic-The Mackay Method for Piano." Volume 1

    Science.gov (United States)

    Mackay, Stephen R.

    2005-01-01

    Background: After trying to define the reason why the piano ended up with 88 keys, I found patterns to explain ways of playing the piano with an 8:8 ratio which gives purpose to why the piano has 88 keys on it. Purpose: The first purpose is to enable piano teachers and music students to benefit from understanding how to play piano and be…

  6. Seniors' experiences of living in special housing accommodation

    Science.gov (United States)

    Hellberg, Ingela; Augustsson, Veronica; Hellström Muhli, Ulla

    2011-01-01

    This article presents a hermeneutic phenomenological analysis of interview material in which 12 seniors living in Special Housing Accommodation (SHA) facilities reflect on the experience of living in such facilities. Of particular interest in the analysis is living in a SHA as a phenomenon. The finding shows that the phenomenon of lived experience in a SHA seems to be a state of ambiguity regarding one's existence, which is made up of several constituents (elements of meaning). The analysis contributes to the understanding of how the phenomenon of SHA living is coming into existence as a need, due to an individual's failing health; however, the SHA is not considered to be a true home. Accordingly, this has consequences to the subject position for the seniors in that they have to navigate between existing and not existing. The seniors learn to cope with living in the SHA by lowering their expectations of life and existence while the SHA provides the prerequisites for their existence. An implication for promoting care is to support the seniors to enable a full existence of life within SHA living. PMID:21412446

  7. 42 CFR 32.88 - Examinations and treatment.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Examinations and treatment. 32.88 Section 32.88... Hansen's Disease § 32.88 Examinations and treatment. Patients will be provided necessary clinical examinations which may be required for the diagnosis of primary or secondary conditions, and such treatment as...

  8. Growth of fingers at an unstable diffusing interface in a porous medium or hele-shaw cell

    Energy Technology Data Exchange (ETDEWEB)

    Wooding, R A

    1969-11-27

    Waves at an unstable horizontal interface, between 2 fluids moving vertically through a saturated porous medium, are observed to grow rapidly to become fingers (i.e., the amplitude greatly exceeds the wavelength). For a diffusing interface, in experiments using a Hele-Shaw cell, the mean amplitude taken over many fingers grows approx. as (time)U2D, followed by a transition to a growth proportional to time. Correspondingly, the mean wave number decreases approx. as (time)U-1/2D. Because of the rapid increase in amplitude, longitudinal dispersion ultimately becomes negligible relative to wave growth. To represent the observed quantities at large time, the transport equation is suitably weighted and averaged over the horizontal plane. Hyperbolic equations result, and the ascending and descending zones containing the fronts of the fingers are replaced by discontinuities. These averaged equations form an open set, but closure is achieved by assuming a law for the mean wave number based on similarity. (22 refs.)

  9. The comparison of CAP88-PC version 2.0 versus CAP88-PC version 1.0

    International Nuclear Information System (INIS)

    Yakubovich, B.A.; Klee, K.O.; Palmer, C.R.; Spotts, P.B.

    1997-12-01

    40 CFR Part 61 (Subpart H of the NESHAP) requires DOE facilities to use approved sampling procedures, computer models, or other approved procedures when calculating Effective Dose Equivalent (EDE) values to members of the public. Currently version 1.0 of the approved computer model CAP88-PC is used to calculate EDE values. The DOE has upgraded the CAP88-PC software to version 2.0. This version provides simplified data entry, better printing characteristics, the use of a mouse, and other features. The DOE has developed and released version 2.0 for testing and comment. This new software is a WINDOWS based application that offers a new graphical user interface with new utilities for preparing and managing population and weather data, and several new decay chains. The program also allows the user to view results before printing. This document describes a test that confirmed CAP88-PC version 2.0 generates results comparable to the original version of the CAP88-PC program

  10. 7 CFR 800.88 - Loss of identity.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Loss of identity. 800.88 Section 800.88 Agriculture... Methods and Procedures § 800.88 Loss of identity. (a) Lots. Except as noted in paragraph (d) of this... personnel performing a reinspection, appeal inspection, or Board appeal inspection service, the identity of...

  11. A well-posed numerical method to track isolated conformal map singularities in Hele-Shaw flow

    International Nuclear Information System (INIS)

    Baker, G.; Siegel, M.; Tanveer, S.

    1995-01-01

    We present a new numerical method for calculating an evolving 2D Hele-Shaw interface when surface tension effects are neglected. In the case where the flow is directed from the less viscous fluid into the more viscous fluid, the motion of the interface is ill-posed; small deviations in the initial condition will produce significant changes in the ensuing motion. The situation is disastrous for numerical computation, as small roundoff errors can quickly lead to large inaccuracies in the computed solution. Our method of computation is most easily formulated using a conformal map from the fluid domain into a unit disk. The method relies on analytically continuing the initial data and equations of motion into the region exterior to the disk, where the evolution problem becomes well-posed. The equations are then numerically solved in the extended domain. The presence of singularities in the conformal map outside of the disk introduces specific structures along the fluid interface. Our method can explicitly track the location of isolated pole and branch point singularities, allowing us to draw connections between the development of interfacial patterns and the motion of singularities as they approach the unit disk. In particular, we are able to relate physical features such as finger shape, side-branch formation, and competition between fingers to the nature and location of the singularities. The usefulness of this method in studying the formation of topological singularities (self-intersections of the interface) is also pointed out. 47 refs., 10 figs., 1 tab

  12. Coordination polymer nanobamboos of {Fe(x)In(1-x)}-MIL-88B: induced formation of a virtual In-MIL-88B.

    Science.gov (United States)

    Park, Shin Ae; Lee, Hee Jung; Cho, Yea Jin; Choi, Sora; Oh, Moonhyun

    2014-05-05

    A precise fabrication of nanobamboo structures made from hybrid coordination polymers of the type {Fex In1-x }-MIL-88B is demonstrated. The compositions of the hybrid coordination polymer nanobamboos of {Fex In1-x }-MIL-88B (x=0.06, 0.19, or 0.75) are regulated by altering the amount of metal ions used in the reactions. Interestingly, the formation of a virtual In-MIL-88B (precise structure, {Fe0.06 In0.94 }-MIL-88B), which cannot be created in a typical reaction, is induced by the assistance of a Fe-MIL-88B structure. The a and c cell parameters of {Fe0.06 In0.94 }-MIL-88B are calculated at 10.95 and 19.86 Å, respectively. These values of {Fe0.06 In0.94 }-MIL-88B are larger than those of pure Fe-MIL-88B owing to the large ionic size of In(3+) within the framework. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. IFT88 influences chondrocyte actin organization and biomechanics.

    Science.gov (United States)

    Wang, Z; Wann, A K T; Thompson, C L; Hassen, A; Wang, W; Knight, M M

    2016-03-01

    Primary cilia are microtubule based organelles which control a variety of signalling pathways important in cartilage development, health and disease. This study examines the role of the intraflagellar transport (IFT) protein, IFT88, in regulating fundamental actin organisation and mechanics in articular chondrocytes. The study used an established chondrocyte cell line with and without hypomorphic mutation of IFT88 (IFT88(orpk)). Confocal microscopy was used to quantify F-actin and myosin IIB organisation. Viscoelastic cell and actin cortex mechanics were determined using micropipette aspiration with actin dynamics visualised in live cells transfected with LifeACT-GFP. IFT88(orpk) cells exhibited a significant increase in acto-myosin stress fibre organisation relative to wild-type (WT) cells in monolayer and an altered response to cytochalasin D. Rounded IFT88(orpk) cells cultured in suspension exhibited reduced cortical actin expression with reduced cellular equilibrium modulus. Micropipette aspiration resulted in reduced membrane bleb formation in IFT88(orpk) cells. Following membrane blebbing, IFT88(orpk) cells exhibited slower reformation of the actin cortex. IFT88(orpk) cells showed increased actin deformability and reduced cortical tension confirming that IFT regulates actin cortex mechanics. The reduced cortical tension is also consistent with the reduced bleb formation. This study demonstrates for the first time that the ciliary protein IFT88 regulates fundamental actin organisation and the stiffness of the actin cortex leading to alterations in cell deformation, mechanical properties and blebbing in an IFT88 chondrocyte cell line. This adds to the growing understanding of the role of primary cilia and IFT in regulating cartilage biology. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  14. An herbal medicine, Go-sha-jinki-gan (GJG, increases muscle weight in severe muscle dystrophy model mice

    Directory of Open Access Journals (Sweden)

    Yusei Takemoto

    2017-12-01

    Full Text Available Go-sha-jinki-gan (GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. Using a newly established mouse model for Duchenne muscular dystrophy (DMD, DBA/2-mdx, we showed that GJG significantly increased the body and skeletal muscle weights in comparison to the control DBA/2-mdx mice, regardless of gender. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Both the skeletal muscle regenerative ability and the accumulation of fibrosis (the dystrophic pathology in GJG-fed DBA/2-mdx mice were comparable to those in control DBA/2-mdx mice, suggesting that the cellular target of GJG is myofibers, with no contribution from the muscle satellite cells neither in an direct nor in an indirect manner. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.

  15. Palaeointensity Results from 1951 and 1995 Lava Flows, Fogo, Cape Verde: A Comparison between Thellier and LTD-DHT Shaw Methods

    Science.gov (United States)

    Brown, M. C.; Cropsey, J.; Bowles, J. A.; Feinberg, J. M.

    2009-12-01

    As part of an ongoing effort to link the success rate of palaeointensity experiments to specific rock magnetic properties, we present new palaeointensity results from basaltic lavas erupted in 1951 and 1995 on the island of Fogo, Cape Verde. Both Thellier and LTD-DHT Shaw palaeointensity experiments were used to estimate the historical field strength. The intensity of the field during these eruptions is constrained by data from the Mbour geomagnetic observatory (Senegal) and IGRF10. In 1951, the magnetic field intensity at Fogo was approximately 33.8 µT during the eruption of three distinct surface flows, covering approximately 14 km2. The field intensity was approximately 32.5 µT during a 1995 eruption of one large flow that extends 4 km2 across the caldera floor. Different volcanic textures were sampled from multiple sites within both the 1951 and 1995 lava flows, including glass-rich pahoehoe and aa flows, highly vesicular flows, and massive non-vesicular lava. Detailed rock magnetic measurements demonstrate that each site and texture displays distinctively different rock magnetic properties. We assess possible links between the outcome of the Thellier and LTD-DHT palaeointensity experiments and the distribution of magnetic domain states, average oxidation state, and laboratory induced alteration.

  16. 38 CFR 4.88a - Chronic fatigue syndrome.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Chronic fatigue syndrome. 4.88a Section 4.88a Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE... Deficiencies § 4.88a Chronic fatigue syndrome. (a) For VA purposes, the diagnosis of chronic fatigue syndrome...

  17. Preliminary analysis of the sandstone accumulation situation at Sha-3 of the Paleogene Series Shakhetsze in the Khekou basin of the Tsziyan region

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S

    1984-01-01

    The Khekou basin of the second order which is located in the Eastern part of the Tsziyan basin in the oil and gas Bokhayvan'skiy pool has an area of about 900 km/sup 2/. The main productive level occurs in sandstone beds in the Sha-3 subseries (reaching thickness of about 400 m) of the Shakhetsze series. The Bonan oil field was discovered in this region in 1975. The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels. Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields.

  18. 10 CFR 71.88 - Air transport of plutonium.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Air transport of plutonium. 71.88 Section 71.88 Energy... Controls and Procedures § 71.88 Air transport of plutonium. (a) Notwithstanding the provisions of any..., whether for import, export, or domestic shipment, is not transported by air or delivered to a carrier for...

  19. 47 CFR 1.88 - Predesignation pleading procedure.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Predesignation pleading procedure. 1.88 Section... Rules of Practice and Procedure Miscellaneous Proceedings § 1.88 Predesignation pleading procedure. In... staff, in its discretion, may in writing, advise such licensee of the general nature of the...

  20. Application of the ReNuMa model in the Sha He river watershed: tools for watershed environmental management.

    Science.gov (United States)

    Sha, Jian; Liu, Min; Wang, Dong; Swaney, Dennis P; Wang, Yuqiu

    2013-07-30

    Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen (DN) and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River (SHR) watershed in China. The Regional Nutrient Management model (ReNuMa) was used to infer the primary sources of DN in the SHR watershed. This model is based on the Generalized Watershed Loading Functions (GWLF) and the Net Anthropogenic Nutrient Input (NANI) framework, modified to improve the characterization of subsurface hydrology and septic system loads. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. PATFIT-88

    International Nuclear Information System (INIS)

    Kirkegaard, P.; Pedersen, N.J.; Eldrup, M.

    1989-02-01

    A data processing system has been developed for analyzing positron annihilation lifetime and angular correlation spectra on mainframe and Personal Computers (PCs). The system is based on the PATFIT programs previously developed for use on mainframe computers. It consists of the three fitting programs POSITRONFIT, RESOLUTION and ACARFIT and three associated programs for easy editing of the input data to the fitting programs, as well as a graphics program for the display of measured and fitted spectra. They can be used directly on any IBM-compatible PC. The PATFIT-88 software is available from Risoe National Laboratory. (author) 5 ills., 46 refs

  2. VERY LARGE ARRAY OH ZEEMAN OBSERVATIONS OF THE STAR-FORMING REGION S88B

    Energy Technology Data Exchange (ETDEWEB)

    Sarma, A. P.; Eftimova, M. [Physics Department, DePaul University, 2219 N. Kenmore Ave., Byrne Hall 211, Chicago, IL 60614 (United States); Brogan, C. L. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Bourke, T. L. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Troland, T. H., E-mail: asarma@depaul.edu [Department of Physics and Astronomy, University of Kentucky, Lexington, KY 40506 (United States)

    2013-04-10

    We present observations of the Zeeman effect in OH thermal absorption main lines at 1665 and 1667 MHz taken with the Very Large Array toward the star-forming region S88B. The OH absorption profiles toward this source are complicated, and contain several blended components toward a number of positions. Almost all of the OH absorbing gas is located in the eastern parts of S88B, toward the compact continuum source S88B-2 and the eastern parts of the extended continuum source S88B-1. The ratio of 1665/1667 MHz OH line intensities indicates the gas is likely highly clumped, in agreement with other molecular emission line observations in the literature. S88-B appears to present a similar geometry to the well-known star-forming region M17, in that there is an edge-on eastward progression from ionized to molecular gas. The detected magnetic fields appear to mirror this eastward transition; we detected line-of-sight magnetic fields ranging from 90 to 400 {mu}G, with the lowest values of the field to the southwest of the S88B-1 continuum peak, and the highest values to its northeast. We used the detected fields to assess the importance of the magnetic field in S88B by a number of methods; we calculated the ratio of thermal to magnetic pressures, we calculated the critical field necessary to completely support the cloud against self-gravity and compared it to the observed field, and we calculated the ratio of mass to magnetic flux in terms of the critical value of this parameter. All these methods indicated that the magnetic field in S88B is dynamically significant, and should provide an important source of support against gravity. Moreover, the magnetic energy density is in approximate equipartition with the turbulent energy density, again pointing to the importance of the magnetic field in this region.

  3. VERY LARGE ARRAY OH ZEEMAN OBSERVATIONS OF THE STAR-FORMING REGION S88B

    International Nuclear Information System (INIS)

    Sarma, A. P.; Eftimova, M.; Brogan, C. L.; Bourke, T. L.; Troland, T. H.

    2013-01-01

    We present observations of the Zeeman effect in OH thermal absorption main lines at 1665 and 1667 MHz taken with the Very Large Array toward the star-forming region S88B. The OH absorption profiles toward this source are complicated, and contain several blended components toward a number of positions. Almost all of the OH absorbing gas is located in the eastern parts of S88B, toward the compact continuum source S88B-2 and the eastern parts of the extended continuum source S88B-1. The ratio of 1665/1667 MHz OH line intensities indicates the gas is likely highly clumped, in agreement with other molecular emission line observations in the literature. S88-B appears to present a similar geometry to the well-known star-forming region M17, in that there is an edge-on eastward progression from ionized to molecular gas. The detected magnetic fields appear to mirror this eastward transition; we detected line-of-sight magnetic fields ranging from 90 to 400 μG, with the lowest values of the field to the southwest of the S88B-1 continuum peak, and the highest values to its northeast. We used the detected fields to assess the importance of the magnetic field in S88B by a number of methods; we calculated the ratio of thermal to magnetic pressures, we calculated the critical field necessary to completely support the cloud against self-gravity and compared it to the observed field, and we calculated the ratio of mass to magnetic flux in terms of the critical value of this parameter. All these methods indicated that the magnetic field in S88B is dynamically significant, and should provide an important source of support against gravity. Moreover, the magnetic energy density is in approximate equipartition with the turbulent energy density, again pointing to the importance of the magnetic field in this region.

  4. The MyD88+ phenotype is an adverse prognostic factor in epithelial ovarian cancer.

    LENUS (Irish Health Repository)

    d'Adhemar, Charles J

    2014-01-01

    The prognosis of epithelial ovarian cancer is poor in part due to the high frequency of chemoresistance. Recent evidence points to the Toll-like receptor-4 (TLR4), and particularly its adaptor protein MyD88, as one potential mediator of this resistance. This study aims to provide further evidence that MyD88 positive cancer cells are clinically significant, stem-like and reproducibly detectable for the purposes of prognostic stratification. Expression of TLR4 and MyD88 was assessed immunohistochemically in 198 paraffin-embedded ovarian tissues and in an embryonal carcinoma model of cancer stemness. In parallel, expression of TLR4 and MyD88 mRNA and regulatory microRNAs (miR-21 and miR-146a) was assessed, as well as in a series of chemosensitive and resistant cancer cells lines. Functional analysis of the pathway was assessed in chemoresistant SKOV-3 ovarian cancer cells. TLR4 and MyD88 expression can be reproducibly assessed via immunohistochemistry using a semi-quantitative scoring system. TLR4 expression was present in all ovarian epithelium (normal and neoplastic), whereas MyD88 was restricted to neoplastic cells, independent of tumour grade and associated with reduced progression-free and overall survival, in an immunohistological specific subset of serous carcinomas, p<0.05. MiR-21 and miR-146a expression was significantly increased in MyD88 negative cancers (p<0.05), indicating their participation in regulation. Significant alterations in MyD88 mRNA expression were observed between chemosensitive and chemoresistant cells and tissue. Knockdown of TLR4 in SKOV-3 ovarian cells recovered chemosensitivity. Knockdown of MyD88 alone did not. MyD88 expression was down-regulated in differentiated embryonal carcinoma (NTera2) cells, supporting the MyD88+ cancer stem cell hypothesis. Our findings demonstrate that expression of MyD88 is associated with significantly reduced patient survival and altered microRNA levels and suggest an intact\\/functioning TLR4\\/MyD88

  5. The MyD88+ phenotype is an adverse prognostic factor in epithelial ovarian cancer.

    Directory of Open Access Journals (Sweden)

    Charles J d'Adhemar

    Full Text Available The prognosis of epithelial ovarian cancer is poor in part due to the high frequency of chemoresistance. Recent evidence points to the Toll-like receptor-4 (TLR4, and particularly its adaptor protein MyD88, as one potential mediator of this resistance. This study aims to provide further evidence that MyD88 positive cancer cells are clinically significant, stem-like and reproducibly detectable for the purposes of prognostic stratification. Expression of TLR4 and MyD88 was assessed immunohistochemically in 198 paraffin-embedded ovarian tissues and in an embryonal carcinoma model of cancer stemness. In parallel, expression of TLR4 and MyD88 mRNA and regulatory microRNAs (miR-21 and miR-146a was assessed, as well as in a series of chemosensitive and resistant cancer cells lines. Functional analysis of the pathway was assessed in chemoresistant SKOV-3 ovarian cancer cells. TLR4 and MyD88 expression can be reproducibly assessed via immunohistochemistry using a semi-quantitative scoring system. TLR4 expression was present in all ovarian epithelium (normal and neoplastic, whereas MyD88 was restricted to neoplastic cells, independent of tumour grade and associated with reduced progression-free and overall survival, in an immunohistological specific subset of serous carcinomas, p<0.05. MiR-21 and miR-146a expression was significantly increased in MyD88 negative cancers (p<0.05, indicating their participation in regulation. Significant alterations in MyD88 mRNA expression were observed between chemosensitive and chemoresistant cells and tissue. Knockdown of TLR4 in SKOV-3 ovarian cells recovered chemosensitivity. Knockdown of MyD88 alone did not. MyD88 expression was down-regulated in differentiated embryonal carcinoma (NTera2 cells, supporting the MyD88+ cancer stem cell hypothesis. Our findings demonstrate that expression of MyD88 is associated with significantly reduced patient survival and altered microRNA levels and suggest an intact/functioning TLR4

  6. Intraflagellar transport 88 (IFT88) is crucial for craniofacial development in mice and is a candidate gene for human cleft lip and palate.

    Science.gov (United States)

    Tian, Hua; Feng, Jifan; Li, Jingyuan; Ho, Thach-Vu; Yuan, Yuan; Liu, Yang; Brindopke, Frederick; Figueiredo, Jane C; Magee, William; Sanchez-Lara, Pedro A; Chai, Yang

    2017-03-01

    Ciliopathies are pleiotropic human diseases resulting from defects of the primary cilium, and these patients often have cleft lip and palate. IFT88 is required for the assembly and function of the primary cilia, which mediate the activity of key developmental signaling pathways. Through whole exome sequencing of a family of three affected siblings with isolated cleft lip and palate, we discovered that they share a novel missense mutation in IFT88 (c.915G > C, p.E305D), suggesting this gene should be considered a candidate for isolated orofacial clefting. In order to evaluate the function of IFT88 in regulating craniofacial development, we generated Wnt1-Cre;Ift88fl/fl mice to eliminate Ift88 specifically in cranial neural crest (CNC) cells. Wnt1-Cre;Ift88fl/flpups died at birth due to severe craniofacial defects including bilateral cleft lip and palate and tongue agenesis, following the loss of the primary cilia in the CNC-derived palatal mesenchyme. Loss of Ift88 also resulted in a decrease in neural crest cell proliferation during early stages of palatogenesis as well as a downregulation of the Shh signaling pathway in the palatal mesenchyme. Importantly, Osr2KI-Cre;Ift88fl/flmice, in which Ift88 is lost specifically in the palatal mesenchyme, exhibit isolated cleft palate. Taken together, our results demonstrate that IFT88 has a highly conserved function within the primary cilia of the CNC-derived mesenchyme in the lip and palate region in mice and is a strong candidate as an orofacial clefting gene in humans. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. 28 CFR 8.8 - Advertisement and declaration of forfeiture.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Advertisement and declaration of forfeiture. 8.8 Section 8.8 Judicial Administration DEPARTMENT OF JUSTICE FBI FORFEITURE AUTHORITY FOR CERTAIN STATUTES § 8.8 Advertisement and declaration of forfeiture. (a) The notice required by customs...

  8. Mineralogical and chemical characterization of iron-, manganese-, and copper-containing synthetic hydroxyapatites

    Science.gov (United States)

    Sutter, B.; Ming, D. W.; Clearfield, A.; Hossner, L. R.

    2003-01-01

    The National Aeronautics and Space Administration's (NASA) Advanced Life Support (ALS) Program is evaluating the use of Fe-, Mn-, and Cu-containing synthetic hydroxyapatite (SHA) as a slow release fertilizer for crops that might be grown on the International Space Station or at Lunar and Martian outposts. Separate Fe-, Mn-, and Cu-containing SHA materials along with a transition-metal free SHA (pure-SHA) were synthesized using a precipitation method. Chemical and mineralogical analyses determined if and how Fe, Mn, and Cu were incorporated into the SHA structure. X-ray diffraction (XRD), Rietveld refinement, and transmission electron microscopy (TEM) confirmed that SHA materials with the apatite structure were produced. Chemical analyses indicated that the metal containing SHA materials were deficient in Ca relative to pure-SHA. The shift in the infrared PO4-mu 3 vibrations, smaller unit cell parameters, smaller particle size, and greater structural strain for Fe-, Mn-, and Cu-containing SHA compared with pure-SHA suggested that Fe, Mn, and Cu were incorporated into SHA structure. Rietveld analyses revealed that Fe, Mn, and Cu substituted into the Ca2 site of SHA. An Fe-rich phase was detected by TEM analyses and backscattered electron microscopy in the Fe-containing SHA material with the greatest Fe content. The substitution of metals into SHA suggests that metal-SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P.

  9. Growth-direction dependence of steady-state Saffman-Taylor flow in an anisotropic Hele-Shaw cell

    International Nuclear Information System (INIS)

    McCloud, K.V.; Maher, J.V.

    1996-01-01

    Selection of steady-state fingers has been measured in a Hele-Shaw cell perturbed by having a square lattice etched onto one of the plates. Flows at different orientations θ between the direction of flow and the lattice axes have been studied, in a wide range of observable tip velocities where the perturbation was made microscopic in the sense that the capillary length of the flow was much greater than the etched lattice cell size. The full range of dynamically interesting angles for the square lattice was examined, and above a threshold, the microscopic perturbation always results in wider fingers than are selected in the unperturbed case. There is some dependence of the width of the fingers on the orientation of the flow, with fingers at θ=0 degree being the widest with respect to the unperturbed fingers, and fingers at 45 degree being the least wide, although still wider than the unperturbed fingers. All observed solutions are symmetric, centered in the channel, and have the relation between tip-curvature and finger width expected of members of the Saffman-Taylor family of solutions. Selected solutions narrow again at tip velocities where the perturbation can no longer be considered microscopic. copyright 1996 The American Physical Society

  10. Periprosthetic bone remodelling of short-stem total hip arthroplasty: a systematic review.

    Science.gov (United States)

    Yan, Shuang G; Weber, Patrick; Steinbrück, Arnd; Hua, Xingyi; Jansson, Volkmar; Schmidutz, Florian

    2017-11-27

    Short-stem hip arthroplasty (SHA) was designed to preserve bone stock and provide an improved load transfer. To gain more evidence regarding the load transfer, this review analysed the periprosthetic bone remodelling of SHA in comparison to standard hip arthroplasty (THA). PubMed and ScienceDirect were screened to extract dual-energy X-ray absorptiometry (DXA) studies evaluating the periprosthetic bone remodelling of SHA and two proven THA designs. From the studies included, the postoperative change in periprosthetic bone mineral density (BMD) after one year and the trend over two years was determined. Fifteen studies with four SHAs (CFP, Metha, Nanos, Fitmore) and two THAs (CLS and Bicontact) designs were included. All SHA and THA stems revealed an initial decrease at the calcar and major trochanter (Gruen 1 and 7) with the Metha, Nanos and Fitmore showing a smaller and more balanced remodelling compared to THA. The pattern after one year and the trend over two years argue for a methaphyseal anchorage of the Metha and Nanos, whereas the Fitmore and CFP seem to anchor metha-diaphyseal. Clearly different pattern of bone remodelling were observed between all four SHAs. Periprosthetic bone remodelling is also present in SHA, with the main bone reduction observed proximally. However, certain SHA stems show a more balanced remodelling compared to THA, arguing for a favourable load transfer. Also, the femoral length where bone remodelling occurs is clearly shorter in SHA. As distinctively different pattern between the SHA designs were observed, they should not be judged as a single implant group.

  11. Iron metal-organic frameworks MIL-88B and NH2-MIL-88B for the loading and delivery of the gasotransmitter carbon monoxide.

    Science.gov (United States)

    Ma, Mingyan; Noei, Heshmat; Mienert, Bernd; Niesel, Johanna; Bill, Eckhard; Muhler, Martin; Fischer, Roland A; Wang, Yuemin; Schatzschneider, Ulrich; Metzler-Nolte, Nils

    2013-05-17

    Crystals of MIL-88B-Fe and NH2-MIL-88B-Fe were prepared by a new rapid microwave-assisted solvothermal method. High-purity, spindle-shaped crystals of MIL-88B-Fe with a length of about 2 μm and a diameter of 1 μm and needle-shaped crystals of NH2-MIL-88B-Fe with a length of about 1.5 μm and a diameter of 300 nm were produced with uniform size and excellent crystallinity. The possibility to reduce the as-prepared frameworks and the chemical capture of carbon monoxide in these materials was studied by in situ ultrahigh vacuum Fourier-transform infrared (UHV-FTIR) spectroscopy and Mössbauer spectroscopy. CO binding occurs to unsaturated coordination sites (CUS). The release of CO from the as-prepared materials was studied by a myoglobin assay in physiological buffer. The release of CO from crystals of MIL-88B-Fe with t(1/2) = 38 min and from crystals of NH2-MIL-88B-Fe with t(1/2) = 76 min were found to be controlled by the degradation of the MIL materials under physiological conditions. These MIL-88B-Fe and NH2-MIL-88B-Fe materials show good biocompatibility and have the potential to be used in pharmacological and therapeutic applications as carriers and delivery vehicles for the gasotransmitter carbon monoxide. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Using choice architecture to exploit a university Distinct Urban Mine.

    Science.gov (United States)

    Pierron, Xavier; Williams, Ian D; Shaw, Peter J; Cleaver, Victoria

    2017-10-01

    There are widespread concerns regarding the potential future scarcity of ferrous and non-ferrous materials. However, there are already potentially rich reserves of secondary materials via high ownership of Electrical and Electronic Equipment (EEE) in economically-developed nations. Young people are particularly high consumers of EEE, thus university students and campuses may present an opportunity to harness this potential. University Distinct Urban Mines (DUM) may be used to exemplify how potential reserves of secondary metals may be exploited, and could contribute to the transition from a linear to a circular economy. This study aimed to evaluate small household appliances (SHA) DUM from a UK university, with the objectives to identify and quantify student households' SHA ownership, WEEE recycling, stockpiling and discarding habits amongst student households, assess and evaluate the monetary potential of SHA DUM at UK level, and propose methods to exploit DUM for universities in the UK. To this purpose, a quantitative survey was undertaken to measure students' ownership and discarding behaviour with respect to SHA. The amounts of ferrous and non-ferrous materials were then estimated and converted to monetary values from secondary materials market data to appraise the SHA DUM overall value. Thirty-five per cent of SHA are discarded in the general refuse. Broken personal care appliances (PCA) tend to be discarded due to hygiene and small size factors. When in working order, SHA tend to be equally reused, recycled or stockpiled. We conclude that a total of 189 tonnes of ferrous and non-ferrous materials were available via discarding or being stockpiled at the University of Southampton. Extrapolated to UK higher education level, discarded and stockpiled SHA represent a potential worth ∼USD 11 million. To initiate DUM exploitation within Higher Education campuses, we suggest improving users' choice architecture by providing collection methods specific to broken SHA

  13. Isolation and expression of two polyketide synthase genes from Trichoderma harzianum 88 during mycoparasitism.

    Science.gov (United States)

    Yao, Lin; Tan, Chong; Song, Jinzhu; Yang, Qian; Yu, Lijie; Li, Xinling

    2016-01-01

    Metabolites of mycoparasitic fungal species such as Trichoderma harzianum 88 have important biological roles. In this study, two new ketoacyl synthase (KS) fragments were isolated from cultured Trichoderma harzianum 88 mycelia using degenerate primers and analysed using a phylogenetic tree. The gene fragments were determined to be present as single copies in Trichoderma harzianum 88 through southern blot analysis using digoxigenin-labelled KS gene fragments as probes. The complete sequence analysis in formation of pksT-1 (5669bp) and pksT-2 (7901bp) suggests that pksT-1 exhibited features of a non-reducing type I fungal PKS, whereas pksT-2 exhibited features of a highly reducing type I fungal PKS. Reverse transcription polymerase chain reaction indicated that the isolated genes are differentially regulated in Trichoderma harzianum 88 during challenge with three fungal plant pathogens, which suggests that they participate in the response of Trichoderma harzianum 88 to fungal plant pathogens. Furthermore, disruption of the pksT-2 encoding ketosynthase-acyltransferase domains through Agrobacterium-mediated gene transformation indicated that pksT-2 is a key factor for conidial pigmentation in Trichoderma harzianum 88. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  14. MyD88 expression in the rat dental follicle: Implications for osteoclastogenesis and tooth eruption

    Science.gov (United States)

    Liu, Dawen; Yao, Shaomian; Wise, Gary E.

    2010-01-01

    Myeloid differentiation factor 88 (MyD88) is a key adaptor molecule in the interleukin-1 (IL-1) and IL-18 Toll-like receptor signaling pathway. Because it is present in dental follicle (DF) cells in vitro, the purpose of this study was to determine its chronological expression in vivo, as well as its possible role in osteoclastogenesis and tooth eruption. An oligo DNA microarray was used to determine gene expression of MyD88 in vivo in the DFs from the first mandibular molars of postnatal rats from days 1–11. The results showed that MyD88 was expressed maximally at day 3. Using siRNA to knock down MyD88 expression in the DF cells also reduced the gene expression of nuclear factor-kappa B-1 (NFKB1) and monocyte chemoattractant protein 1 (MCP-1). IL-1α up-regulated the expression of NFKB1, MCP-1 and receptor activator of nuclear factor kappa B ligand (RANKL), but knockdown of MyD88 nullified this IL-1α effect. Conditioned medium from DF cells with MyD88 knocked down reduced chemotactic activity for mononuclear cells and reduced osteoclastogenesis as opposed to controls. In conclusion, the maximal expression of MyD88 at day 3 in the DF may contribute to the major burst of osteoclastogenesis needed for eruption by up-regulating MCP-1 and RANKL expression. PMID:20662905

  15. Natural convection heat transfer in an anisotropic porous cavity heated from the side. 2nd Report. experiment by hele-shaw cell; Tosuiritsu ni ihosei wo yusuru howa takoshitsu sonai no sokuho kanetsu ni yoru shizen tairyu netsu dentatsu. 2. Hele shaw cell ni yoru jikken

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, S; Okajima, A; Kiwata, T [Kanazawa University, Ishikawa (Japan). Faculty of Engineering

    2000-11-25

    Natural convection heat transfer and flow structure in an anisotropic porous medium of square cavity saturated with Boussinesq fluid has been studied experimentally using a Hele-Shaw cell. The permeability ratio defined by K=K{sub y}/K{sub x} was put to three different values; 0.4, 1 and 2.5. The convection patterns at three different permeability ratios are visualized for several different Rayleigh numbers by the pH indicator method. When K is 0.25, the visualized flow is mainly in the vertical direction. On the contrary for K=4 the convecting flow is in the horizontal direction. The average heat transfer coefficients are also measured, and the corresponding Nusselt number are plotted as a function of K. It is found that the corresponding Nusselt numbers are scaled with (KRa){sup 1/2}. The experimental results of flow pattern and heat transfer are accord with those obtained by our previous theory. (author)

  16. Capacitance level probe, Type FSK 88

    International Nuclear Information System (INIS)

    Vogt, W.

    2001-01-01

    The aim of the capacitive level probe, Type FSK 88, is to supervise the level within vessels continuously and to signalize alterations immediately. Since 1987 the level probe is installed in the pool for burn up fuel elements and in the reactor containment sump of BWRs, PWRs and WWERs. The capacitive level probe of type FSK 88 was qualified for Loss of Coolant Accidents and seismic events according to international rules. The measuring principle takes credit from the fact that the dielectric with different dielectric constants in a condensator changes the capacity of the condensator. (Authors)

  17. Waves on a Hele-Shaw Cell: Simulations of Acoustic Emissions During Aerofracture

    Science.gov (United States)

    Turkaya, Semih; Toussaint, Renaud; Kvalheim Eriksen, Fredrik; Daniel, Guillaume; Grude Flekkøy, Eirik; Jørgen Måløy, Knut

    2016-04-01

    In this work, we develop a numerical model to explain the lab scale experimental setup [1] modeling the aerofractures in a porous medium. The mentioned experimental setup consists in a rectangular Hele-Shaw cell with three closed boundaries and one semi-permeable boundary which enables the flow of the fluid but not the solid particles. During the experiments, the fluid (pressurized air) is injected into the system with a constant injection pressure from the point opposite to the semi-permeable boundary. At the large enough injection pressures, the fluid also displaces grains (80 μm grain size) and creates channels and fractures towards the semi-permeable boundary. This analogue model is developed in a linear geometry, with confinement and at a lower porosity to study the instabilities developing during the fast motion of a fluid in dense porous materials: fracturing, fingering, and channeling. Different sources of the signal (air vibration in the carved area, changes in the effective stress due to fluid-solid interactions [2]) are separately analyzed and are investigated further using a far field approximation of Lamb waves presented by Goyder & White [3]. In the analysis phase, power spectrum of different timewindows (5 ms) obtained from the recorded signal are computed. Then, the evolution of this power spectrum is compared with the experimental findings. In the power spectrum, it is possible to see some characteristic structure like peaks in specific frequency ranges. These "peaks" are strongly influenced by the size and branching of the channels, compaction of the medium, vibration of air in the pores and the fundamental frequency of the plate. We found that, in the synthetic dataset, the peaks in the low frequency range (f Daniel G, Flekkøy EG, Måløy KJ. "Bridging aero-fracture evolution with the characteristics of the acoustic emissions in a porous medium." Front. Phys., 3 (2015): 70. doi: 10.3389/fphy.2015.00070 2. Niebling MJ, Toussaint R, Flekkøy EG

  18. Wind turbine certification - the committee draft by IEC-TC88-WG9

    Energy Technology Data Exchange (ETDEWEB)

    Hauge Madsen, P [Risoe National Lab., Wind Energy and Atmospheric Physics Dept., Roskilde (Denmark)

    1999-03-01

    In 1995 the Technical Committee TC88 of the International Electrotechnical Commission decided to start a new work item, namely to prepare a standard for the certification procedures for wind turbines with respect to safety, performance, interaction with the public grid, environmental requirements and the documentation requested by the certification bodies. The purpose was to provide a common basis for certification of wind turbines, including a basis for accreditation of certification bodies and mutual recognition of certificates. A working group (WG9) was created to prepare a committee draft. WG9 submitted the result late in 1998 to TC88. This paper presents the committee draft Standard, which defines a certification system for Wind Turbine Generator Systems. Key issues in the evaluation of conformity with these standards and identified needs for other technical criteria and procedures are presented. (au) 10 refs.

  19. 40 CFR 600.113-88 - Fuel economy calculations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...

  20. Phenomenological study of nuclear structure of neutron-rich 88Rb isotope

    Science.gov (United States)

    Gupta, Surbhi; Gupta, Anuradha; Bharti, Arun

    2018-05-01

    A theoretical study of the nuclear structure of odd-odd 88Rb nucleus in the A ˜100 mass region is carried out by using the angular-momentum-projection technique implemented in the Projected Shell Model (PSM). The influence of the high-j orbitals, h11/2 for neutrons and g9/2 for protons on the structure of 88Rb isotope is investigated in the present case by assuming an axial symmetry in the deformed basis. For this isotope, PSM calculations are performed to obtain the yrast line and also the description of the formation of the yrast level structure from multi-quasi-particle configurations. The back-bending in moment of inertia and transition energies have also been calculated and compared with the experimental data.

  1. 21 CFR 312.88 - Safeguards for patient safety.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Safeguards for patient safety. 312.88 Section 312... Severely-debilitating Illnesses § 312.88 Safeguards for patient safety. All of the safeguards incorporated within parts 50, 56, 312, 314, and 600 of this chapter designed to ensure the safety of clinical testing...

  2. 32 CFR 552.88 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... CEMETERIES REGULATIONS AFFECTING MILITARY RESERVATIONS Fort Lewis Land Use Policy § 552.88 Responsibilities... other criminal activity on the range complex. (c) DEH. Coordinate with the Ft. Lewis Area Access Section... of Ft. Lewis Land Use Policy and area access procedures, and provide periodic updates through media...

  3. IMMEDIATE COMPLICATIONS AFTER 88 HEPATECTOMIES - BRAZILIAN CONSECUTIVE SERIES.

    Science.gov (United States)

    Amico, Enio Campos; Alves, José Roberto; João, Samir Assi; Guimarães, Priscila Luana Franco Costa; Medeiros, Joafran Alexandre Costa de; Barreto, Élio José Silveira da Silva

    2016-01-01

    Hepatectomies have been increasingly recommended and performed in Brazil; they present great differences related to immediate complications. Assessing the immediate postoperative complications in a series of 88 open liver resections. Prospective database of patients subjected to consecutive hepatectomies over nine years. The post-hepatectomy complications were categorized according to the Clavien-Dindo classification; complications presenting grade equal to or greater than 3 were considered major complications. Hepatic resections involving three or more resected liver segments were considered major hepatectomies. Eighty-four patients were subjected to 88 hepatectomies, mostly were minor liver resections (50 cases, 56.8%). Most patients had malignant diseases (63 cases; 71.6%). The mean hospitalization time was 10.9 days (4-43). Overall morbidity and mortality rates were 37.5% and 6.8%, respectively. The two most common immediate general complications were intra-peritoneal collections (12.5%) and pleural effusion (12.5%). Bleeding, biliary fistula and liver failure were identified in 6.8%, 4.5% and 1.1% of the cases, respectively, among the hepatectomy-specific complications. The patients operated in the second half of the series showed better results, which were apparently influenced by the increased surgical expertise, by the modification of the hepatic parenchyma section method and by the increased organ preservation. No Brasil as hepatectomias têm sido cada vez mais indicadas e realizadas, apresentando grandes diferenças relacionadas às complicações imediatas. Avaliar as complicações pós-operatórias imediatas em uma série de 88 ressecções hepáticas abertas. Foi utilizada uma base de dados prospectiva de pacientes submetidos à hepatectomias consecutivas em nove anos. As complicações pós-hepatectomia seguiram a Classificação de Clavien-Dindo, sendo consideradas complicações maiores aquelas as quais apresentaram grau igual ou maior que 3. Foram

  4. The -938C>A Polymorphism in MYD88 Is Associated with Susceptibility to Tuberculosis: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Kalliopi Aggelou

    2016-01-01

    Full Text Available Introduction. Tuberculosis (TB is a major disease worldwide, caused by Mycobacterium tuberculosis (MTB infection. The Toll-Like Receptor (TLR pathway plays a crucial role in the recognition of MTB. Aim. The present study aimed to investigate the involvement of myeloid differentiation primary response protein 88 (MYD88 gene polymorphisms in TB. Materials and Methods. A total of 103 TB cases and 92 control subjects were genotyped for the MYD88 -938C>A (rs4988453 and 1944C>G (rs4988457 polymorphisms. Results. The MYD88 -938CA and -938AA genotypes were associated with an increased risk for tuberculosis with odds ratio (OR of 5.71 (95% confidence intervals [CIs] 2.89–11.28, p=0.01. Conclusions. The MYD88 -938C>A genetic polymorphism is associated with increased susceptibility to TB and may serve as a marker to screen individuals who are at risk.

  5. Synthesis spherical porous hydroxyapatite/graphene oxide composites by ultrasonic-assisted method for biomedical applications.

    Science.gov (United States)

    Duan, Peizhen; Shen, Juan; Zou, Guohong; Xia, Xu; Jin, Bo; Yu, Jiaxin

    2018-04-10

    Spherical porous hydroxyapatite (SHA)/graphene oxide (GO) composites with different GO (w/w) content of 16%, 40%, and 71% have been fabricated through a facile and controllable ultrasonic-assisted method at room temperature. The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization. Results showed SHA were covered by GO, and SHA/GO composites had an irregular surface with different degrees of wrinkles. The elastic modulus and hardness of SHA/GO-3 composites were up to 12.45 ± 0.33 GPa and 686.67 ± 26.95 MPa, which indicated that the contents of GO had an effect on SHA/GO composites. And the mechanical properties of SHA/GO-2 composites were similar to SHA particles. The biomimetic mineralization in SBF solution showed the bone-like apatite layer on composites surface, which demonstrated that the SHA/GO materials had osseointegration property. Moreover, in vitro cytocompatibility of SHA/GO-2 composites and pure GO were evaluated by cell adhesion and proliferation tests using MC3T3-E1 cells, which demonstrated that the SHA/GO composites can act as a good template for the cells growth and adhesion. These results suggested that the SHA/GO composites will be a promising material for biomedical application.

  6. Interferon-inducible MyD88 protein inhibits hepatitis B virus replication

    International Nuclear Information System (INIS)

    Xiong Wei; Wang Xun; Liu Xiaoying; Xiang Li; Zheng Lingjie; Yuan Zhenghong

    2004-01-01

    Myeloid differential primary response protein (MyD88) is a critical component in the signaling cascade through Toll-like receptors (TLRs) and is induced by α interferon (IFN-α). To examine the role of MyD88 in the antiviral activity of IFN-α against hepatitis B virus (HBV), we established MyD88 stably expressing cell lines and studied HBV replication in these lines after transient transfection. The levels of HBV proteins and viral replicative intermediates were effectively reduced in MyD88-expressing cells. A significant reduction of total and cytoplasmic viral RNAs in MyD88 stably expressing cells was also observed. Using a nuclear factor-κB (NF-κB) dependent reporter assay, it was shown that activation of NF-κB was moderately increased in the presence of expression of MyD88, and further significantly increased by co-expression of HBV. These results suggest a novel mechanism for the inhibition of HBV replication by IFN-α via expression of MyD88 protein involving activation of NF-κB signaling pathway and downregulation of viral transcription

  7. Autonomy, Affinity, and the Assessment of Damages: Acb v Thomson Medical Pte Ltd [2017] SGCA 20 and Shaw v Kovak [2017] EWCA Civ 1028.

    Science.gov (United States)

    Purshouse, Craig

    2017-11-17

    In ACB v Thomson Medical Pte Ltd [2017] SGCA 20 and Shaw v Kovak [2017] EWCA Civ 1028, the idea that 'lost autonomy' should be recognised as a new form of actionable damage in the tort of negligence was rejected in Singapore and England, respectively. This, it will be argued, was the correct outcome. Protecting an interest in autonomy via the tort of negligence would undermine the coherence of that tort. In ACB, however, a new, different, form of damage was recognised: loss of 'genetic affinity'. This commentary will discuss some problems that protecting an interest in 'genetic affinity' raises before critiquing the approach to assessing damages in ACB. © The Author 2017. Published by Oxford University Press; all rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Reliability of the modified Gross Motor Function Measure-88 (GMFM-88) for children with both Spastic Cerebral Palsy and Cerebral Visual Impairment: A preliminary study.

    Science.gov (United States)

    Salavati, M; Krijnen, W P; Rameckers, E A A; Looijestijn, P L; Maathuis, C G B; van der Schans, C P; Steenbergen, B

    2015-01-01

    The aims of this study were to adapt the Gross Motor Function Measure-88 (GMFM-88) for children with Cerebral Palsy (CP) and Cerebral Visual Impairment (CVI) and to determine the test-retest and interobserver reliability of the adapted version. Sixteen paediatric physical therapists familiar with CVI participated in the adaptation process. The Delphi method was used to gain consensus among a panel of experts. Seventy-seven children with CP and CVI (44 boys and 33 girls, aged between 50 and 144 months) participated in this study. To assess test-retest and interobserver reliability, the GMFM-88 was administered twice within three weeks (Mean=9 days, SD=6 days) by trained paediatric physical therapists, one of whom was familiar with the child and one who wasn't. Percentages of identical scores, Cronbach's alphas and intraclass correlation coefficients (ICC) were computed for each dimension level. All experts agreed on the proposed adaptations of the GMFM-88 for children with CP and CVI. Test-retest reliability ICCs for dimension scores were between 0.94 and 1.00, mean percentages of identical scores between 29 and 71, and interobserver reliability ICCs of the adapted GMFM-88 were 0.99-1.00 for dimension scores. Mean percentages of identical scores varied between 53 and 91. Test-retest and interobserver reliability of the GMFM-88-CVI for children with CP and CVI was excellent. Internal consistency of dimension scores lay between 0.97 and 1.00. The psychometric properties of the adapted GMFM-88 for children with CP and CVI are reliable and comparable to the original GMFM-88. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Translanguaging as a teaching resource in early language learning of English as a an additional language (EAL)

    OpenAIRE

    Portolés, Laura; Martí, Otilia

    2017-01-01

    Tradicionalment, l'ensenyament de llengües s'ha basat en un enfocament monolingüe i l'estricta separació de llengües a l'aula s'ha considerat un requisit indefugible per garantir l'èxit d'aquest procés d'aprenentatge. No obstant això, s'ha demostrat que l'ús flexible del repertori lingüístic de l'alumnat, conegut com a translanguaging, també pot resultar beneficiós per tal d'aprendre l'anglès com a llengua estrangera (vid. Jones i Lewis, 2014).El present estudi té com a objectiu examinar el t...

  10. 29 CFR 1918.88 - Log operations.

    Science.gov (United States)

    2010-07-01

    ...) SAFETY AND HEALTH REGULATIONS FOR LONGSHORING Handling Cargo § 1918.88 Log operations. (a) Working in..., the employer shall ensure that employees remain clear of areas where logs being dumped could strike...

  11. Characterization of the Canine MHC Class I DLA-88*50101 Peptide Binding Motif as a Prerequisite for Canine T Cell Immunotherapy.

    Directory of Open Access Journals (Sweden)

    Sharon M Barth

    Full Text Available There are limitations in pre-clinical settings using mice as a basis for clinical development in humans. In cancer, similarities exist between humans and dogs; thus, the dog patient can be a link in the transition from laboratory research on mouse models to clinical trials in humans. Knowledge of the peptides presented on MHC molecules is fundamental for the development of highly specific T cell-based immunotherapies. This information is available for human MHC molecules but is absent for the canine MHC. In the present study, we characterized the binding motif of dog leukocyte antigen (DLA class I allele DLA-88*50101, using human C1R and K562 transfected cells expressing the DLA-88*50101 heavy chain. MHC class I immunoaffinity-purification revealed 3720 DLA-88*50101 derived peptides, which enabled the determination of major anchor positions. The characterized binding motif of DLA-88*50101 was similar to HLA-A*02:01. Peptide binding analyses on HLA-A*02:01 and DLA-88*50101 via flow cytometry showed weak binding of DLA-88*50101 derived peptides to HLA-A*02:01, and vice versa. Our results present for the first time a detailed peptide binding motif of the canine MHC class I allelic product DLA-88*50101. These data support the goal of establishing dogs as a suitable animal model for the evaluation and development of T cell-based cancer immunotherapies, benefiting both dog and human patients.

  12. Description of Eimeria motelo sp. n. (Apicomplexa: Eimeriidae from the yellow footed tortoise, Geochelone denticulata (Chelonia: Testudinidae, and replacement of Eimeria carinii Lainson, Costa & Shaw, 1990 by Eimeria lainsoni nom. nov.

    Directory of Open Access Journals (Sweden)

    Lada Hurková

    2000-12-01

    Full Text Available Eimeria motelo sp. n. is described from faeces of the yellow-footed tortoise, Geochelone denticulata (L.. Oocysts are irregularly ellipsoidal or cylindrical, with slightly expressed lobed protrusions and irregularities at the poles, possibly caused by wrinkling of the oocyst wall, 17 (15-19 × 9.4 (8.5-11 µm, shape index (length/width being 1.81 (1.45-2. The oocyst wall is smooth, single-layered, 0.5 µm thick with no micropyle. There are no polar bodies. Sporocysts are ellipsoidal, 8.9 (7.5-10 × 4.4 (4-5 µm, shape index 2.03 (1.7-2.5. A sporocyst residuum is present, composed of many granules of irregular size. The sporozoites are elongate, lying lengthwise in the sporocysts. Comparison with other species of the genus Eimeria parasitising members of family Testudinidae indicates that the presently described coccidium represents a new species. The name of Eimeria carinii Lainson, Costa & Shaw, 1990 is found to be preoccupied by a homonym, Eimeria carinii Pinto 1928 given to a coccidium from Rattus norvegicus. Therefore, it is replaced by Eimeria lainsoni nom. nov.

  13. Empirical modeling of solvent extraction of uranium from sulphuric acid medium using PC-88A and TOPO as extractants

    International Nuclear Information System (INIS)

    Biswas, S.; Roy, S.B.; Pathak, P.N.; Manchanda, V.K.; Singh, D.K.

    2011-01-01

    Extraction behavior of uranium (VI) from sulphuric acid medium using PC-88A (H 2 A 2 , dimer form) and a mixture of PC-88A + TOPO in n-dodecane has been investigated. The extraction data have been used to develop a mathematical model correlating percentage extraction (%E) with PC-88A and TOPO concentration. It can be used to predict the steady-state concentrations of metal ion under the conditions of the present work. (author)

  14. Assisted suicide and the killing of people? Maybe. Physician-assisted suicide and the killing of patients? No: the rejection of Shaw's new perspective on euthanasia.

    Science.gov (United States)

    McLachlan, Hugh V

    2010-05-01

    David Shaw presents a new argument to support the old claim that there is not a significant moral difference between killing and letting die and, by implication, between active and passive euthanasia. He concludes that doctors should not make a distinction between them. However, whether or not killing and letting die are morally equivalent is not as important a question as he suggests. One can justify legal distinctions on non-moral grounds. One might oppose physician-assisted suicide and active euthanasia when performed by doctors on patients whether or not one is in favour of the legalisation of assisted suicide and active euthanasia. Furthermore, one can consider particular actions to be contrary to appropriate professional conduct even in the absence of legal and ethical objections to them. Someone who wants to die might want only a doctor to kill him or to help him to kill himself. However, we are not entitled to everything that we want in life or death. A doctor cannot always fittingly provide all that a patient wants or needs. It is appropriate that doctors provide their expert advice with regard to the performance of active euthanasia but they can and should do so while, qua doctors, they remain hors de combat.

  15. Selective recognition of 6-mercaptopurine based on luminescent metal-organic frameworks Fe-MIL-88NH₂.

    Science.gov (United States)

    Sun, Zhengjuan; Liu, Yali; Li, Yuanfang

    2015-03-15

    A novel and rapid spectrofluorometry method for the recognition of 6-mercaptopurine (6-MP) has been developed based on luminescent metal-organic frameworks Fe-MIL-88NH2 as fluorescent probe. The strong fluorescence of Fe-MIL-88NH2 at 430 nm could be quenched by 6-MP directly, and the Fe-MIL-88NH2 shows high selectivity for 6-MP compared to other thiol-containing amino acids such as homocysteine (Hcy), cysteine (Cys), glutathione (GSH), etc. Under optimal conditions, the relative fluorescence intensity was linearly proportional to the concentration of 6-MP in the range of 5-600 μM with the detection limit at 1.17 μM (S/N=3). Furthermore, the present approach has been successfully applied to the determination of 6-MP in human serum samples. The possible fluorescence quenching mechanism has also been investigated, where it is revealed that the quenching was attributed to competition of absorption of the light source energy as well as electron transfer between Fe-MIL-88NH2 and 6-MP. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. Levels in 146Ce and the N = 88 isotones

    International Nuclear Information System (INIS)

    Gowdy, G.M.; Chrien, R.E.; Chu, Y.Y.

    1981-01-01

    An investigation of the level structure of 146 Ce following the beta decay of the low-spin isomer of 146 La has been carried out at the ISOL facility TRISTAN at Brookhaven National Laboratory. The half-life for the low spin isomer was found to be 6.0 +- 0.4s. A partial level scheme for 146 Ce below 2 MeV is given. The level energies and some B(E2) values extracted from our data have been compared with IBA-2 calculations done entirely with extrapolated parameters from neighboring Z nuclei in order to check the predictive power of the model. Systematics of the Z = 58 isotopes and N = 88 isotones indicate that although 146 Ce is more deformed than its isotones with Z greater than or equal to 60, the transition to the well-deformed region can probably more correctly be thought to occur after 146 Ce, between N = 88 and N = 90, as it does for Z greater than or equal to 60. The abrupt onset of deformation present in the higher Z isotopes is not seen in the Ce isotopes where the trend is found to be rather smooth throughout

  17. Remodeling of Sensorimotor Brain Connectivity in Gpr88-Deficient Mice.

    Science.gov (United States)

    Arefin, Tanzil Mahmud; Mechling, Anna E; Meirsman, Aura Carole; Bienert, Thomas; Hübner, Neele Saskia; Lee, Hsu-Lei; Ben Hamida, Sami; Ehrlich, Aliza; Roquet, Dan; Hennig, Jürgen; von Elverfeldt, Dominik; Kieffer, Brigitte Lina; Harsan, Laura-Adela

    2017-10-01

    Recent studies have demonstrated that orchestrated gene activity and expression support synchronous activity of brain networks. However, there is a paucity of information on the consequences of single gene function on overall brain functional organization and connectivity and how this translates at the behavioral level. In this study, we combined mouse mutagenesis with functional and structural magnetic resonance imaging (MRI) to determine whether targeted inactivation of a single gene would modify whole-brain connectivity in live animals. The targeted gene encodes GPR88 (G protein-coupled receptor 88), an orphan G protein-coupled receptor enriched in the striatum and previously linked to behavioral traits relevant to neuropsychiatric disorders. Connectivity analysis of Gpr88-deficient mice revealed extensive remodeling of intracortical and cortico-subcortical networks. Most prominent modifications were observed at the level of retrosplenial cortex connectivity, central to the default mode network (DMN) whose alteration is considered a hallmark of many psychiatric conditions. Next, somatosensory and motor cortical networks were most affected. These modifications directly relate to sensorimotor gating deficiency reported in mutant animals and also likely underlie their hyperactivity phenotype. Finally, we identified alterations within hippocampal and dorsal striatum functional connectivity, most relevant to a specific learning deficit that we previously reported in Gpr88 -/- animals. In addition, amygdala connectivity with cortex and striatum was weakened, perhaps underlying the risk-taking behavior of these animals. This is the first evidence demonstrating that GPR88 activity shapes the mouse brain functional and structural connectome. The concordance between connectivity alterations and behavior deficits observed in Gpr88-deficient mice suggests a role for GPR88 in brain communication.

  18. Final report for LDRD Project 93633 : new hash function for data protection.

    Energy Technology Data Exchange (ETDEWEB)

    Draelos, Timothy John; Dautenhahn, Nathan; Schroeppel, Richard Crabtree; Tolk, Keith Michael; Orman, Hilarie (PurpleStreak, Inc.); Walker, Andrea Mae; Malone, Sean; Lee, Eric; Neumann, William Douglas; Cordwell, William R.; Torgerson, Mark Dolan; Anderson, Eric; Lanzone, Andrew J.; Collins, Michael Joseph; McDonald, Timothy Scott; Caskey, Susan Adele

    2009-03-01

    The security of the widely-used cryptographic hash function SHA1 has been impugned. We have developed two replacement hash functions. The first, SHA1X, is a drop-in replacement for SHA1. The second, SANDstorm, has been submitted as a candidate to the NIST-sponsored SHA3 Hash Function competition.

  19. 29 CFR 37.88 - Who may contact CRC about a complaint?

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Who may contact CRC about a complaint? 37.88 Section 37.88... PROVISIONS OF THE WORKFORCE INVESTMENT ACT OF 1998 (WIA) Compliance Procedures § 37.88 Who may contact CRC... contact CRC for information about the complaint. The Director will determine what information, if any...

  20. Dementia-specific quality of life instruments and their appropriateness in shared-housing arrangements--a literature study.

    Science.gov (United States)

    Gräske, Johannes; Fischer, Thomas; Kuhlmey, Adelheid; Wolf-Ostermann, Karin

    2012-01-01

    Shared-housing arrangements (SHA) in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia. To evaluate the impact of SHA on the quality of life (QoL) of residents, an appropriate setting- and dementia-specific QoL instrument is needed. This article aims to identify QoL instruments that relate to the core domains of SHA. After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA. None of the existing instruments was identified as having been developed for SHA. Matching of the instrument domains with the SHA core domains leads to the conclusion that Quality of Life-Alzheimer's Disease, Dementia Quality of Life, Alzheimer Disease-Related Quality of Life, and QUALIDEM are adequate instruments for measuring the dementia-specific QoL of persons living in SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA. The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust (e.g., reliability and validity) will further elucidation of the appropriateness of the instruments for SHA. Copyright © 2012 Mosby, Inc. All rights reserved.

  1. Generation and tests of the new version 88 library for HAMMER system

    International Nuclear Information System (INIS)

    Chalhoub, E.S.; Anaf, J.

    1988-08-01

    A new library, version 88, for the HAMMER system, was generated using the ENDF/B-IV FRENDL evaluated nuclear data libraries. It is composed of epithermal and thermal libraries obtained by processing the new versions of ETOG-3 and FLANGE-II codes, respectively. Test results for two benchmark critical assemblies are presented. (author) [pt

  2. The national socialism of the group valhalla 88: construction of a nazi movement in Brazil

    Directory of Open Access Journals (Sweden)

    Guilherme Ignácio Franco de Andrade

    2014-06-01

    Full Text Available In this article, the racial issues present in the national-socialist ideology professed by the group Valhalla 88 are investigated. The primary element of Nazi ideology is Aryanism (eugenics, i.e., “race purification,” because the “chosen people” have the “right” to rule the world due to their “racial superiority” as understood by Adolf Hitler. The group Valhalla 88 seeks to spread national-socialist ideology, and the group’s interpretation of this ideology seeks to manipulate and adapt these ideas to provide a political alternative.

  3. MEETING: Lattice 88

    Energy Technology Data Exchange (ETDEWEB)

    Mackenzie, Paul

    1989-03-15

    The forty-year dream of understanding the properties of the strongly interacting particles from first principles is now approaching reality. Quantum chromodynamics (QCD - the field theory of the quark and gluon constituents of strongly interacting particles) was initially handicapped by the severe limitations of the conventional (perturbation) approach in this picture, but Ken Wilson's inventions of lattice gauge theory and renormalization group methods opened new doors, making calculations of masses and other particle properties possible. Lattice gauge theory became a major industry around 1980, when Monte Carlo methods were introduced, and the first prototype calculations yielded qualitatively reasonable results. The promising developments over the past year were highlighted at the 1988 Symposium on Lattice Field Theory - Lattice 88 - held at Fermilab.

  4. MEETING: Lattice 88

    International Nuclear Information System (INIS)

    Mackenzie, Paul

    1989-01-01

    The forty-year dream of understanding the properties of the strongly interacting particles from first principles is now approaching reality. Quantum chromodynamics (QCD - the field theory of the quark and gluon constituents of strongly interacting particles) was initially handicapped by the severe limitations of the conventional (perturbation) approach in this picture, but Ken Wilson's inventions of lattice gauge theory and renormalization group methods opened new doors, making calculations of masses and other particle properties possible. Lattice gauge theory became a major industry around 1980, when Monte Carlo methods were introduced, and the first prototype calculations yielded qualitatively reasonable results. The promising developments over the past year were highlighted at the 1988 Symposium on Lattice Field Theory - Lattice 88 - held at Fermilab

  5. 'CM 88' - A multiple disease resistant chickpea mutant variety

    International Nuclear Information System (INIS)

    Haq, M.A.; Hassan, Mahmudul; Sadiq, M.

    2001-01-01

    Full text: Chickpea is the most important grain legume crop of Pakistan. Ascochyta blight (Ascochyta rabiei) and Fusarium wilt (Fusarium oxysporum F. sp cicer) are most serious diseases, having the potential to devastate a crop. A multiple disease resistant and high yielding mutant CM 88 has been developed through 100 Gy gamma irradiation treatment of variety 'C 727'. This was once a widely grown and popular variety, which lost its resistance to Ascochyta and was replaced. The selection of mutants was performed in the M2 generation grown in the Ascochyta blight nursery and sixteen mutants were selected. In the subsequent generations CM 88 proved resistant to both Ascochyta blight and Fusarium wilt, and exhibited superiority in agronomic characteristics. CM 88 was also tested for many years in the various yield trials on research stations and farmers fields throughout the country. In these trials it out yielded both the parent and standard varieties. The mutant CM 88 has been approved by the Punjab Seed Council on 27 October 1994 for general cultivation in the Punjab Province, especially the Thal area which accounts for more than 70% of the area under chickpea cultivation. (author)

  6. Nuclear structure of 88Sr and 90Zr investigated by (e,e') and (p,p') reactions

    International Nuclear Information System (INIS)

    Bijl, L.T. van der.

    1982-01-01

    In this thesis the results are presented and discussed from two experiments, performed to investigate the nuclear structure of two N = 50 nuclei: a high resolution inelastic proton scattering experiment on 90 Zr, described in chapter II, and a high resolution inelastic electron scattering experiment on 88 Sr, described in chapters III and IV. The results obtained in the 88 Sr(e,e') experiment for the 1 + state at 3.486 MeV excitation energy are described separately in chapter V. The 90 Zr(p,p') experiment was performed at a bombarding energy of 25 MeV with a resolution of 12 to 16 keV. The 88 Sr(e,e') measurements were performed at two laboratories with an overall resolution between 20 and 60 keV. (Auth.)

  7. Nuclear pore protein NUP88 activates anaphase-promoting complex to promote aneuploidy

    NARCIS (Netherlands)

    Naylor, R.M.; Jeganathan, K.B.; Cao, X.; Deursen, J.M. van

    2016-01-01

    The nuclear pore complex protein NUP88 is frequently elevated in aggressive human cancers and correlates with reduced patient survival; however, it is unclear whether and how NUP88 overexpression drives tumorigenesis. Here, we show that mice overexpressing NUP88 are cancer prone and form intestinal

  8. Interaction between toxic azo dye C.I. Acid Red 88 and serum albumins

    International Nuclear Information System (INIS)

    Naveenraj, Selvaraj; Solomon, Rajadurai Vijay; Venuvanalingam, Ponnambalam; Asiri, Abdullah M.; Anandan, Sambandam

    2013-01-01

    Serum albumin-toxic dye interaction studies will be of paramount importance in the field of toxicology due to its relation towards the distribution and transportation of dye in blood. In this regard, the binding between C.I. Acid Red 88 (AR88) and serum albumins (HSA and BSA) was investigated by using combination of spectroscopic and molecular modeling methods. The fluorescence results revealed that AR88 interact with serum albumins through the combination of static and dynamic quenching mechanism. The distance “r” between serum albumin and AR88 was obtained according to the Forster resonance energy transfer (FRET) theory. Synchronous fluorescence and CD spectral results showed alterations in the microenvironment and conformation of serum albumins. The molecular docking method is also employed to understand the interaction of AR88 with serum albumins. All these studies confirm that BSA has more affinity towards AR88 than that of HSA which suggests that AR88 is more easily transported in the body of bovid than human and so it is more hazardous to bovids. -- Highlights: • AR88 interacts with serum albumin through the combination of both static and dynamic quenching mechanism. • The binding site of AR88 in serum albumins is nearer to tryptophan moiety. • Circular Dichroism spectra showed that AR88 alters α-helicity of serum albumin. • This interaction study could be greatly imperative for further investigations in toxicology

  9. Implementation of 4-way Superscalar Hash MIPS Processor Using FPGA

    Science.gov (United States)

    Sahib Omran, Safaa; Fouad Jumma, Laith

    2018-05-01

    Due to the quick advancements in the personal communications systems and wireless communications, giving data security has turned into a more essential subject. This security idea turns into a more confounded subject when next-generation system requirements and constant calculation speed are considered in real-time. Hash functions are among the most essential cryptographic primitives and utilized as a part of the many fields of signature authentication and communication integrity. These functions are utilized to acquire a settled size unique fingerprint or hash value of an arbitrary length of message. In this paper, Secure Hash Algorithms (SHA) of types SHA-1, SHA-2 (SHA-224, SHA-256) and SHA-3 (BLAKE) are implemented on Field-Programmable Gate Array (FPGA) in a processor structure. The design is described and implemented using a hardware description language, namely VHSIC “Very High Speed Integrated Circuit” Hardware Description Language (VHDL). Since the logical operation of the hash types of (SHA-1, SHA-224, SHA-256 and SHA-3) are 32-bits, so a Superscalar Hash Microprocessor without Interlocked Pipelines (MIPS) processor are designed with only few instructions that were required in invoking the desired Hash algorithms, when the four types of hash algorithms executed sequentially using the designed processor, the total time required equal to approximately 342 us, with a throughput of 4.8 Mbps while the required to execute the same four hash algorithms using the designed four-way superscalar is reduced to 237 us with improved the throughput to 5.1 Mbps.

  10. Spline and spline wavelet methods with applications to signal and image processing

    CERN Document Server

    Averbuch, Amir Z; Zheludev, Valery A

    This volume provides universal methodologies accompanied by Matlab software to manipulate numerous signal and image processing applications. It is done with discrete and polynomial periodic splines. Various contributions of splines to signal and image processing from a unified perspective are presented. This presentation is based on Zak transform and on Spline Harmonic Analysis (SHA) methodology. SHA combines approximation capabilities of splines with the computational efficiency of the Fast Fourier transform. SHA reduces the design of different spline types such as splines, spline wavelets (SW), wavelet frames (SWF) and wavelet packets (SWP) and their manipulations by simple operations. Digital filters, produced by wavelets design process, give birth to subdivision schemes. Subdivision schemes enable to perform fast explicit computation of splines' values at dyadic and triadic rational points. This is used for signals and images upsampling. In addition to the design of a diverse library of splines, SW, SWP a...

  11. 36 CFR 223.88 - Bidding methods.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.88... methods. (a) Competitive sales of National Forest timber shall be offered through either sealed or oral auction bidding. The method chosen for each sale will: (1) Insure open and fair competition, (2) Insure...

  12. An 88-Year-Old Man with Sudden Onset Abdominal Pain

    Directory of Open Access Journals (Sweden)

    Mohammad Manouchehrifar

    2015-07-01

    Full Text Available An 88-year-old man presented to the emergency department with sudden onset of abdominal pain since 6 hours before. He was a known case of chronic renal failure that underwent hemodialysis three times a week. He also suffered from hypertension and benign prostatic hyperplasia. The patients’ on-arrival vital signs were as follows: systolic blood pressure: 100/60 mmHg, pulse rate: 88/minute, respiratory rate: 25/minute, oral temperature: 36◦C, oxygen saturation 93% in room air.  He had severely ill appearance on admission. Distended abdomen was considerable but had normal bowel sound and clearly, pain was disproportionate to physical examination. His electrocardiogram showed sinus rhythm and venous blood gas analysis revealed the following: pH=6.96, PaCO2=49 mmHg, HCO3=11 mEq/L, Base excess= -20.  The bedside ultrasonography showed echogenic particles in hepatic parenchyma and same findings that were passing through the portal vein. Chest and abdominal X-rays were reported as normal. The patient underwent abdominal and pelvic computed tomography (CT scan with oral contrast.What is your diagnosis?

  13. Depression Mechanism of Strontium Ions in Bastnaesite Flotation with Salicylhydroxamic Acid as Collector

    Directory of Open Access Journals (Sweden)

    Shiming Cao

    2018-02-01

    Full Text Available Metal ions are widely present in flotation pulp. Metal ions change solution chemistry and mineral surface properties, consequently affecting mineral flotation. In this work, the effect of strontium ions on bastnaesite flotation with salicylhydroxamic acid (SHA was investigated by microflotation tests, contact angle measurements, zeta-potential measurements, and X-ray photoelectron spectroscopy (XPS analysis. Microflotation tests confirmed that the addition of strontium ions decreased bastnaesite floatability, compared with that in the absence of strontium ions. Contact angle measurements suggested that the pretreatment of strontium ions decreased SHA adsorption. Zeta potential measurements confirmed that the bastnaesite was depressed by the adsorption of positively charged strontium species, and the lower adsorption capacity of SHA onto the bastnaesite surfaces was obtained after modifying with strontium ions. XPS analysis demonstrated that strontium ions adsorbed onto the bastnaesite surfaces through the interaction between strontium ions and oxygen atoms of surface ≡ CeOH 0 groups. This occurrence hindered surface Ce sites which chelated with SHA and therefore, decreased bastnaesite floatability.

  14. Significance of TLR4/MyD88 expression in breast cancer

    Science.gov (United States)

    Chen, Xiangjin; Zhao, Feng; Zhang, Huihao; Zhu, Youzhi; Wu, Kunlin; Tan, Guozheng

    2015-01-01

    Objective: To investigate the expression of TLR4/MyD88 in breast cancer, and explore the relationship between their expression and breast cancer tumor growth and invasion. Methods: We examined the protein expression of TLR4 and MyD88 in 60 cases of histologically confirmed breast cancer. The relationship of their protein expressions with clinical features including age at diagnosis, tumor size and stage, lymph node metastasis and distant metastasis were analyzed. Results: The IHC results showed that TLR4 and MyD88 were expressed in 63.3% (38/60) and 58.3% (35/60) of malignant breast tumors respectively. TLR4 expression in breast cancer were significantly higher than in fibroadenoma (n = 4, 20.0%) and adjacent normal tissues (n = 2, 10.0%) (P fibroadenoma (n = 4, 20.0%) and adjacent normal tissue (n = 3, 15.0%) (P fibroadenoma and adjacent normal tissues (P < 0.05). The protein expressions of TLR4 and MyD88 were also significantly associated with poor clinical features (P < 0.05). Conclusion: TLR4 and MyD88 expression might be associated with breast cancer growth and regional and distant metastases. PMID:26261595

  15. Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary].

    Science.gov (United States)

    2013-02-01

    The Maryland State Highway Administration (SHA) has a commitment to : maintaining at least 84 percent of the SHA pavement network in : acceptable overall condition. The SHA also intends to increase the use of : recycled materials and to use products ...

  16. C5a receptor (CD88) blockade protects against MPO-ANCA GN.

    Science.gov (United States)

    Xiao, Hong; Dairaghi, Daniel J; Powers, Jay P; Ertl, Linda S; Baumgart, Trageen; Wang, Yu; Seitz, Lisa C; Penfold, Mark E T; Gan, Lin; Hu, Peiqi; Lu, Bao; Gerard, Norma P; Gerard, Craig; Schall, Thomas J; Jaen, Juan C; Falk, Ronald J; Jennette, J Charles

    2014-02-01

    Necrotizing and crescentic GN (NCGN) with a paucity of glomerular immunoglobulin deposits is associated with ANCA. The most common ANCA target antigens are myeloperoxidase (MPO) and proteinase 3. In a manner that requires activation of the alternative complement pathway, passive transfer of antibodies to mouse MPO (anti-MPO) induces a mouse model of ANCA NCGN that closely mimics human disease. Here, we confirm the importance of C5aR/CD88 in the mediation of anti-MPO-induced NCGN and report that C6 is not required. We further demonstrate that deficiency of C5a-like receptor (C5L2) has the reverse effect of C5aR/CD88 deficiency and results in more severe disease, indicating that C5aR/CD88 engagement enhances inflammation and C5L2 engagement suppresses inflammation. Oral administration of CCX168, a small molecule antagonist of human C5aR/CD88, ameliorated anti-MPO-induced NCGN in mice expressing human C5aR/CD88. These observations suggest that blockade of C5aR/CD88 might have therapeutic benefit in patients with ANCA-associated vasculitis and GN.

  17. Effects of testosterone on contractile properties of sexually dimorphic forelimb muscles in male bullfrogs (Rana catesbeiana, Shaw 1802

    Directory of Open Access Journals (Sweden)

    Aaron R. Kampe

    2013-07-01

    This study examined the effects of testosterone (T on the contractile properties of two sexually dimorphic forelimb muscles and one non-dimorphic muscle in male bullfrogs (Rana catesbeiana, Shaw 1802. The dimorphic muscles in castrated males with testosterone replacement (T+ achieved higher forces and lower fatigability than did castrated males without replaced testosterone (T0 males, but the magnitude of the differences was low and many of the pair-wise comparisons of each muscle property were not statistically significant. However, when taken as a whole, the means of seven contractile properties varied in the directions expected of masculine values in T+ animals in the sexually dimorphic muscles. Moreover, these data, compared with previous data on male and female bullfrogs, show that values for T+ males are similar to normal males and are significantly different from females. The T0 males tended to be intermediate in character between T+ males and females, generally retaining masculine values. This suggests that the exposure of young males to T in their first breeding season produces a masculinizing effect on the sexually dimorphic muscles that is not reversed between breeding seasons when T levels are low. The relatively minor differences in contractile properties between T+ and T0 males may indicate that as circulating T levels rise during breeding season in normal males, contractile properties can be enhanced rapidly to maximal functional levels for breeding success.

  18. The evaluation of marine traffic noise and its effect on the Chinese White Dolphins in Sha Chau and Lung Kwu Chau Marine Park, Hong Kong

    Science.gov (United States)

    Chan, T.

    2016-12-01

    The Hong Kong International Airport (HKIA) handles a large amount of air traffic, at 68.5 million passengers per year (approx. 40.1 million flights per year). Given that flight demand is forecast to reach 97 million passengers per year (approx 60.2 million flights per year) by 2030, the HKIA must optimise runway capacity in order to meet growing demand. Hence, the Airport Authority Hong Kong (AAHK) has put forward a proposal to expand the airport into a three-runway system by building a third runway. However, this presents many environmental constraints. These include major impacts on marine ecology; especially the Chinese White Dolphins (Sousa chinensis) that live around the Sha Chau and Lung Kwu Chau Marine Park north to the airport. Due to that the third runway will reclaim approximately 650 hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park. This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation (often discerned by a "click" sound) to communicate and navigate, increasing marine traffic (re-routing) causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries. Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years (2013-2016) has shown that noise pollution is increasing (as indicated by the increase of frequencies around 100 125 kHz) and that it has caused disruption in regular dolphin movement (irregular clicking sequence) .

  19. Cloning, annotation and expression analysis of mycoparasitism-related genes in Trichoderma harzianum 88.

    Science.gov (United States)

    Yao, Lin; Yang, Qian; Song, Jinzhu; Tan, Chong; Guo, Changhong; Wang, Li; Qu, Lianhai; Wang, Yun

    2013-04-01

    Trichoderma harzianum 88, a filamentous soil fungus, is an effective biocontrol agent against several plant pathogens. High-throughput sequencing was used here to study the mycoparasitism mechanisms of T. harzianum 88. Plate confrontation tests of T. harzianum 88 against plant pathogens were conducted, and a cDNA library was constructed from T. harzianum 88 mycelia in the presence of plant pathogen cell walls. Randomly selected transcripts from the cDNA library were compared with eukaryotic plant and fungal genomes. Of the 1,386 transcripts sequenced, the most abundant Gene Ontology (GO) classification group was "physiological process". Differential expression of 19 genes was confirmed by real-time RT-PCR at different mycoparasitism stages against plant pathogens. Gene expression analysis revealed the transcription of various genes involved in mycoparasitism of T. harzianum 88. Our study provides helpful insights into the mechanisms of T. harzianum 88-plant pathogen interactions.

  20. Gross motor function in children with spastic Cerebral Palsy and Cerebral Visual Impairment: A comparison between outcomes of the original and the Cerebral Visual Impairment adapted Gross Motor Function Measure-88 (GMFM-88-CVI).

    Science.gov (United States)

    Salavati, M; Rameckers, E A A; Waninge, A; Krijnen, W P; Steenbergen, B; van der Schans, C P

    2017-01-01

    To investigate whether the adapted version of the Gross Motor Function Measure-88 (GMFM-88) for children with Cerebral Palsy (CP) and Cerebral Visual Impairment (CVI) results in higher scores. This is most likely to be a reflection of their gross motor function, however it may be the result of a better comprehension of the instruction of the adapted version. The scores of the original and adapted GMFM-88 were compared in the same group of children (n=21 boys and n=16 girls), mean (SD) age 113 (30) months with CP and CVI, within a time span of two weeks. A paediatric physical therapist familiar with the child assessed both tests in random order. The GMFCS level, mental development and age at testing were also collected. The Wilcoxon signed-rank test was used to compare two different measurements (the original and adapted GMFM-88) on a single sample, (the same child with CP and CVI; pchildren with CP and CVI showed a positive difference in percentage score on at least one of the five dimensions and positive percentage scores for the two versions differed on all five dimensions for fourteen children. For six children a difference was seen in four dimensions and in 10 children difference was present in three dimensions (GMFM dimension A, B& C or C, D & E) (pchildren with CP and CVI that is not adversely impacted bytheir visual problems. On the basis of these findings, we recommend using the adapted GMFM-88 to measure gross motor functioning in children with CP and CVI. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Is synovitis detected on non-contrast-enhanced magnetic resonance imaging associated with serum biomarkers and clinical signs of effusion? Data from the Osteoarthritis Initiative.

    Science.gov (United States)

    Deveza, L A; Kraus, V B; Collins, J E; Guermazi, A; Roemer, F W; Nevitt, M C; Hunter, D J

    2017-09-20

    To determine the relationship between synovitis detected on non-contrast-enhanced (non-CE) magnetic resonance imaging (MRI), biochemical markers of inflammation, and clinical assessment of effusion in people with knee osteoarthritis (OA). We examined data from the OA Biomarkers Consortium within the Osteoarthritis Initiative (n = 600). Non-CE MRIs were semi-quantitatively scored (grades 0-3) for severity of Hoffa synovitis and effusion synovitis. Serum (s) matrix metalloproteinase-3 (sMMP-3), hyaluronic acid (sHA), and nitrated epitope of the α-helical region of type II collagen (sColl2-1NO2) were quantified. The bulge and patellar tap clinical tests were performed at baseline and performance characteristics were assessed for the detection of effusion synovitis on MRI. Multinomial logistic regression adjusted for covariates was used to assess the association between biochemical and imaging markers at baseline and over 12 and 24 months. At baseline, sHA and sMMP-3 were associated with moderate to large (score ≥ 2, n = 117) effusion synovitis, with odds ratio = 1.35 and 1.30 per 1 standard deviation in biochemical markers (95% confidence intervals 1.07, 1.71 and 1.00, 1.69), c-statistics 0.640 and 0.626, respectively. The c-statistics for the presence of Hoffa synovitis (score ≥ 2) were 0.693, 0.694, and 0.694 for sHA, sMMP-3, and sColl2-1NO2, respectively. There was no significant association between biochemical markers (baseline and 12 and 24 month time-integrated concentrations) and changes in MRI markers. The bulge and patellar tap signs were 22.0% and 4.3% sensitive and 88.8% and 94.8% specific, respectively, for detecting effusion synovitis (score ≥ 1) on MRI. sHA and sMMP-3 were modestly associated with effusion synovitis at baseline. Clinical signs of effusion are insensitive but highly specific for the presence of any effusion synovitis on non-CE MRI.

  2. Evaluation of cross sections for neutron monitor reactions {sup 90}Zr(n,x){sup 89,88}Zr, {sup 88,87,86}Y from threshold to 100 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Baosheng, Yu; Qingbiao, Shen; Dunjiu, Cai [Chinese Nuclear Data Center, Beijing, BJ (China)

    1996-06-01

    The cross sections for {sup 90}Zr(n,x){sup 89,88}Zr and {sup 90}Zr(n,x){sup 88,87,86}Y reactions in intermediate energy region are useful in neutron field monitor, safety and material damage research. Below 20 MeV, the evaluated cross sections for {sup 90}Zr(n,2n){sup 89}Zr reaction are recommended based on the recent experimental data, including the new measured results in CIAE (Above 20 MeV). The measured cross sections are still insufficient to do evaluation. So the evaluation for {sup 90}Zr(n,x){sup 89,88}Zr and {sup 90}Zr(n,x){sup 88,87,86}Y reactions from threshold to 100 MeV are based on experimental and calculated data. (2 figs.).

  3. MYD88 L265P Mutations Are Correlated with 6q Deletion in Korean Patients with Waldenström Macroglobulinemia

    Directory of Open Access Journals (Sweden)

    Jung-Ah Kim

    2014-01-01

    Full Text Available Waldenström macroglobulinemia (WM is a malignant lymphoplasma-proliferative disorder with IgM monoclonal gammopathy. A recent whole-genome study identified MYD88 L265P as the key mutation in WM. We investigated MYD88 mutations in conjunction with cytogenetic study in 22 consecutive Korean WM patients. Conventional G-banding and interphase fluorescence in situ hybridization (FISH were performed at regions including 6q21 using bone marrow (BM aspirates. Sixteen patients were subjected to Sanger sequencing-based MYD88 mutation study. Five patients (28% showed cytogenetic aberrations in G-banding. The incidence of 6q21 deletion was 17% by conventional G-banding and 37% by FISH. Ten patients (45% showed cytogenetic aberrations using FISH: 6q deletion in eight (37% and IGH rearrangement in four (18%. Two patients had both the 6q deletion and IGH rearrangement, and two had only the IGH rearrangement. Eleven patients (69% presented with the MYD88 L265P mutation. MYD88 mutations were significantly associated with the presence of 6q deletions (P=0.037. Six patients with the 6q deletion for whom sequencing was possible were found to harbor MYD88 mutations. The MYD88 L265P mutation was also associated with increased lymphocyte burden in BM biopsy. This is the first report of high frequency MYD88 L265P mutations in Korean WM patients.

  4. Synthesis of 125 I - Salicyl Hydroxamic Acid for Urinary Bladder Imaging

    International Nuclear Information System (INIS)

    Ibrahim, I.T.; Abou EL Zahab, M.; Hamed, M.

    2015-01-01

    Salicylhydroxamic acid is a salicylate derivative. Radiolabeling of Salicyl hydroxamic acid ( SHA ) with iodine-125 may have considerable interest for imaging of urinary bladder. This study is aimed to optimize the radiolabeling yield of Salicyl hydroxamic with radio iodine (125-123) using chloramine - T (CAT) as an oxidizing agent with respect to factors that affect the reaction conditions such as SHA amount, CAT amount, reaction time and ph of the reaction mixture. In - vitro stability of the radiolabeled complex was checked and it was found to be stable for up to 24 h. 125 I-SHA was injected via intravenous administration routes into normal male Sprague – Dawley rats. Bio - distribution studies have revealed that 125 I-SHA was excreted in urine with extent that it could give a clear image for urinary bladder especially if the bladder it tightly closed. The amount of 125 I - Salicyl hydroxamic excreted was increased in case of giving potassium bicarbonate to rat before injection of 125 I-SHA. The result of biodistribution study of 125 I - SHA in experimental animal suggest ed the possibility of using 123 I-SHA to image the urinary bladder

  5. Use of gamma ray strength functions for predicting the neutron capture cross section of 88Y

    International Nuclear Information System (INIS)

    Gardner, D.G.; Gardner, M.A.

    1977-01-01

    The present study indicates that the estimation of the gamma-ray strength function is the approach least subject to error when unmeasured capture cross sections are to be computed. An estimate is given for the 88 γ(n,γ) cross section

  6. Characterizing and modeling of an 88 MW grate-fired boiler burning wheat straw: Experience and lessons

    DEFF Research Database (Denmark)

    Yin, Chungen; Rosendahl, Lasse Aistrup; Clausen, Sønnik

    2012-01-01

    and availability. To better understand grate-firing of biomass and to establish a reliable but relatively simple Computational Fluid Dynamics (CFD) modeling methodology for industrial applications, biomass combustion in a number of different grate boilers has been measured and modeled. As one of the case studies......, modeling effort on an 88 MW grate-fired boiler burning wheat straw is presented in this paper. Different modeling issues and their expected impacts on CFD analysis of the kind of grate boilers are discussed. The modeling results are compared with in-flame measurements in the 88 MW boiler, which shows...... measures will be tested in a modern 500 kW grate boiler rig...

  7. Micrometeorological measurements during the Blackmo 88 spray trials

    Science.gov (United States)

    D. E. Anderson; D. R. Miller; Y. S. Wang; W. E. Yendol; M. L. McManus

    1991-01-01

    Instrumentation was arrayed on a 120 foot tower to detail the local atmospheric conditions during the Blackmo 88 spray experiment. Measurements were continuous for 30 minute periods encompassing each spray pass.

  8. MyD88-dependent dendritic and epithelial cell crosstalk orchestrates immune responses to allergens.

    Science.gov (United States)

    Thomas, S Y; Whitehead, G S; Takaku, M; Ward, J M; Xu, X; Nakano, K; Lyons-Cohen, M R; Nakano, H; Gowdy, K M; Wade, P A; Cook, D N

    2018-05-01

    Sensitization to inhaled allergens is dependent on activation of conventional dendritic cells (cDCs) and on the adaptor molecule, MyD88. However, many cell types in the lung express Myd88, and it is unclear how signaling in these different cell types reprograms cDCs and leads to allergic inflammation of the airway. By combining ATAC-seq with RNA profiling, we found that MyD88 signaling in cDCs maintained open chromatin at select loci even at steady state, allowing genes to be rapidly induced during allergic sensitization. A distinct set of genes related to metabolism was indirectly controlled in cDCs through MyD88 signaling in airway epithelial cells (ECs). In mouse models of asthma, Myd88 expression in ECs was critical for eosinophilic inflammation, whereas Myd88 expression in cDCs was required for Th17 cell differentiation and consequent airway neutrophilia. Thus, both cell-intrinsic and cell-extrinsic MyD88 signaling controls gene expression in cDCs and orchestrates immune responses to inhaled allergens.

  9. Meal from tilapia filleting industrial waste in the feed of the bullfrog tadpoles (Rana Catesbeiana Shaw, 1802/ Inclusão de farinha de resíduos da indústria de filetagem de tilápias na alimentação de girinos de rã-touro (Rana Catesbeiana Shaw,1802

    Directory of Open Access Journals (Sweden)

    Cleiton Manske

    2007-08-01

    Full Text Available The objective of this experiment was to evaluate the inclusion of meal of tilapia industrial waster in bullfrog tadpoles’ diets (Rana Catesbeina Shaw, 1802. Two hundred fifty tadpoles with initial weight and length of 0,18 ± 0,05g and 2,50 ± 0,18 centimeters were used, respectively, they were used and distributed in 25 aquariums of 30 liter each in a complete randomized design with five treatments and five repetitions. The tadpoles were fed four times a day with diets containing 0, 5, 10 and 15% of inclusion of tilapia filleting and another diet with 0% of supplemented tilapia filleting with synthetic methionine, being supplied four times a day at ease. The experiment period was 30 days. The diets with tilapia filleting inclusion and methionine supplementation did not have influence in the final weight and length averages, feed survival and conversion of bullfrog tadpoles. It cam be used until 15% of tilapia filleting inclusion in the bullfrog tadpoles food. The synthetic methionine supplementation in diets for bullfrog tadpoles is not necessary in diets with levels over 0,47% of the total methionine.Este experimento objetivou avaliar a inclusão da farinha de resíduos de filetagem de tilápias (FT em rações para girinos de rã-touro (Rana Catesbeina Shaw,1802. Foram utilizados 250 girinos com peso e comprimento inicial de 0,18 ± 0,05g e 2,50 ± 0,18 cm, respectivamente, distribuídos em 25 aquários de 30 L cada, em um delineamento inteiramente casualizado com cinco tratamentos e cinco repetições. Os girinos foram alimentados quatro vezes ao dia, com rações contendo 0, 5, 10, 15% de inclusão de FT e outra ração com 0% de FT suplementada com metionina sintética, sendo fornecidas quatro vezes ao dia a vontade. O período do experimento foi de 30 dias. As rações com inclusão de FT e suplementação de metionina não influenciaram nas médias de peso final, comprimento final, sobrevivência e conversão alimentar dos girinos de r

  10. 33 CFR 88.11 - Law enforcement vessels.

    Science.gov (United States)

    2010-07-01

    ... NAVIGATION RULES ANNEX V: PILOT RULES § 88.11 Law enforcement vessels. (a) Law enforcement vessels may display a flashing blue light when engaged in direct law enforcement or public safety activities. This... lights. (b) The blue light described in this section may be displayed by law enforcement vessels of the...

  11. Pyramidatine (Z88) Sensitizes Vincristine-Resistant Human Oral Cancer (KB/VCR) Cells to Chemotherapeutic Agents by Inhibition of P-glycoprotein.

    Science.gov (United States)

    Liu, Zulong; Zhu, Hengrui; Qu, Shijin; Tang, Lisha; Cao, Lihuan; Yu, Wenbo; Yang, Xianmei; Jiang, Songmin; Zhu, Dayuan; Tan, Changheng; Yu, Long

    2018-01-01

    Multi-drug resistance (MDR) remains a major impediment in cancer therapy. A major goal for scientists is to discover more effective compounds that are able to circumvent MDR and simultaneously have minimal adverse side effects. In the present study, we aim to determine the anti-MDR effects of pyramidatine (Z88), a cinnamic acid-derived bisamide compound isolated from the leaves of Aglaia perviridis, on KB/VCR (vincristineresistant human oral cancer cells) and MCF-7/ADR (adriamycin-resistant human breast adenocarcinoma) cells. Cell viability and average resistant fold (RF) of Z88 were examined by Cell Counting Kit-8 (CCK-8) assay. Flow cytometry, western blot, RT-PCR, Rhodamine 123 accumulation assay and P-glycoprotein (P-gp) ATPase assay were used to demonstrate the anti-MDR activity and mechanism of Z88. The average RF of Z88 is 0.09 and 0.51 in KB/VCR and MCF-7/ADR cells. A CCK-8 assay showed that Z88 could enhance the cytotoxicity of VCR toward KB/VCR cells. A FACS analysis revealed that Z88 could enhance the VCR-induced apoptosis as well as G2/M arrest in a dose-dependent manner in KB/VCR cells. Western blot results showed that the expression levels of PARP, Bax, and cyclin B1 all increased after treatment with 0.2 µmol/L (µM) of VCR combined with 10 µM of Z88 for 24 h in KB/VCR cells. Z88 also could enhance the accumulation of rhodamine 123. Further studies showed that Z88 could inhibit the verapamil stimulated Pgp ATPase activity. Additionally, qPCR detection and western blot assays revealed that Z88 could decrease the expression of P-gp at both RNA and protein level. Z88 exerted potent anti-MDR activity in vitro and its mechanisms are associated with dualinhibition of the function and expression of P-gp. These findings encourage efforts to develop more effective reversal agents to circumvent MDR based on Z88. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  12. Computació distribuïda sobre dispositius mòbils

    OpenAIRE

    Marugán Calles, Jose Carlos

    2015-01-01

    En aquest projecte, s'ha desenvolupat una plataforma que ajuda a la paral·lelització d’aplicacions utilitzant dispositius mòbils com a nodes o processadors. Per al seu desenvolupament, el projecte s'ha dividit en tres subprojectes (client, servidor i proveïdor). La plataforma de computació distribuïda i paral·lelització es compon dels subprojectes client i servidor. El subprojecte proveïdor s'ha desenvolupat per utilitzar la plataforma de computació distribuïda creada, i concretament, s'ha de...

  13. 75 FR 47805 - Combined Notice of Filings #1

    Science.gov (United States)

    2010-08-09

    ....E. Shaw Plasma Trading, LLC. Description: The Shaw Parties submits notification of cancellation of.... Applicants: D.E. Shaw Plasma Power, LLC. Description: The Shaw Parties submits notification of cancellation... and self-recertifications. The Commission encourages electronic submission of protests and...

  14. 21 CFR 520.88f - Amoxicillin trihydrate tablets.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.88f Amoxicillin... days, review diagnosis and change therapy. Federal law restricts this drug to use by or on the order of...

  15. 27 CFR 6.88 - Equipment and supplies.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF THE TREASURY LIQUORS âTIED-HOUSEâ Exceptions § 6.88 Equipment and supplies. (a) General. The act by an industry member of selling equipment or supplies to a retailer does not constitute a means... a price not less than the cost to the industry member who initially purchased them, and if the price...

  16. WSR-88D observations of volcanic ash

    Science.gov (United States)

    Wood, J.; Scott, C.; Schneider, D.

    2007-01-01

    Conclusions that may impact operations are summarized below: ??? Current VCPs may not be optimal for the scharacterization of volcanic events. Therefore, the development of a new VCP that combines the enhanced low level elevation density and increased temporal resolution of VCP 12 with the enhanced sensitivity of VCP 31. ??? Given currently available scan strategies, this preliminary investigation would suggest that it is advisable to use VCP 12 during the initial explosive phase of an eruptive event. Once the maximum reflectivity has dropped below 30 dBZ, VCP 31 should be used. ??? This study clearly indicates that WSR-88D Level II data offers many advantages over Level III data currently available in Alaska. The ability to access this data would open up greater opportunities for research. Given the proximity of WSR-88D platforms to active volcanoes in Alaska, as well as in the western Lower 48 states and Hawaii, radar data will likely play a major operational role when volcanic eruptions again pose a threat to life and property. The utilization of this tool to its maximum capability is vital.

  17. Perbandingan Algoritma Enkripsi GGHN(8,8 dan RC4 Untuk Video Conference

    Directory of Open Access Journals (Sweden)

    Satriyo Satriyo

    2012-01-01

    Full Text Available Encryption is a solutions to secure the information transmitted through the medium of communication that can not be intercepted by unauthorized parties. This study implemented two algorithms i.e. RC4 and GGHN (8.8 in video conference. This study compared the speed  of  both  encryption  and  decryption  of  the  encryption  algorithm,  and  perform  measurements  of  bandwidth .  From  the  results  of measurements of the speed can be concluded that the RC4 algorithm is 1.53 times and 1.34 times faster than GGHN(8,8 for encryption and  decryption  audio  data.  The  encryption  and  decryption  video  data  RC4  are  1.44  times  and  1.09  times  faster  than  GHN(8,8. Bandwidth  usage  for  video  conferencing  without  encryption  and  bandwidth  usage  on  a  video  conference  with  RC4  encryption  and GGHN (8.8 is the same.Keywords: Video Conference; RC4; GGHN(8,8; Real Time Protocol.

  18. Summary of the Blackmo 88 spray experiment

    Science.gov (United States)

    D. R. Miller; W. E. Yendol; M. L. McManus; D. E. Anderson; K. Mierzejewski

    1991-01-01

    The Blackmo 88 spray trial experiment was conducted for two primary purposes: To quantify the effects of local micrometeorological processes, in and near the canopy, on the deposition patterns of aerially applied BT in a mature oak forest; To generate a data set containing simultaneous measurements of spray deposition and detailed micrometeorology, in a canopy of known...

  19. 9 CFR 3.88 - Primary conveyances (motor vehicle, rail, air, and marine).

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.88 Section 3.88 Animals and Animal Products ANIMAL AND PLANT HEALTH... conveyances (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used to...

  20. Natural loss-of-function mutation of myeloid differentiation protein 88 disrupts its ability to form Myddosomes

    NARCIS (Netherlands)

    Nagpal, K.; Plantinga, T.S.; Sirois, C.M.; Monks, B.G.; Latz, E.; Netea, M.G.; Golenbock, D.T.

    2011-01-01

    Myeloid differentiation protein 88 (MyD88) is a key signaling adapter in Toll-like receptor (TLR) signaling. MyD88 is also one of the most polymorphic adapter proteins. We screened the reported nonsynonymous coding mutations in MyD88 to identify variants with altered function. In reporter assays, a

  1. The Italian Project S2 - Task 4:Near-fault earthquake ground motion simulation in the Sulmona alluvial basin

    Science.gov (United States)

    Stupazzini, M.; Smerzini, C.; Cauzzi, C.; Faccioli, E.; Galadini, F.; Gori, S.

    2009-04-01

    Recently the Italian Department of Civil Protection (DPC), in cooperation with Istituto Nazionale di Geofisica e Vulcanologia (INGV) has promoted the 'S2' research project (http://nuovoprogettoesse2.stru.polimi.it/) aimed at the design, testing and application of an open-source code for seismic hazard assessment (SHA). The tool envisaged will likely differ in several important respects from an existing international initiative (Open SHA, Field et al., 2003). In particular, while "the OpenSHA collaboration model envisions scientists developing their own attenuation relationships and earthquake rupture forecasts, which they will deploy and maintain in their own systems", the main purpose of S2 project is to provide a flexible computational tool for SHA, primarily suited for the needs of DPC, which not necessarily are scientific needs. Within S2, a crucial issue is to make alternative approaches available to quantify the ground motion, with emphasis on the near field region. The SHA architecture envisaged will allow for the use of ground motion descriptions other than those yielded by empirical attenuation equations, for instance user generated motions provided by deterministic source and wave propagation simulations. In this contribution, after a brief presentation of Project S2, we intend to illustrate some preliminary 3D scenario simulations performed in the alluvial basin of Sulmona (Central Italy), as an example of the type of descriptions that can be handled in the future SHA architecture. In detail, we selected some seismogenic sources (from the DISS database), believed to be responsible for a number of destructive historical earthquakes, and derive from them a family of simplified geometrical and mechanical source models spanning across a reasonable range of parameters, so that the extent of the main uncertainties can be covered. Then, purely deterministic (for frequencies Journal of Seismology, 1, 237-251. Field, E.H., T.H. Jordan, and C.A. Cornell (2003

  2. Computational studies on LiP H isolated from Ganoderma lucidum GD88

    Directory of Open Access Journals (Sweden)

    Parambayil Nayana

    2015-01-01

    Full Text Available Ganoderma lucidum is a basidiomycete fungus that produces ligninase for the modification of lignin. Lignin peroxidase (LiP is a glycoprotein that acts on the recalcitrant cell wall component lignin. In the present study, the phylogenetic analysis of Ganoderma lucidum GD88 with the partial coding sequence (cds of other LiP isoforms was performed using MEGA6. After determination of the open reading frame, the +3 frame nucleotide sequence was converted to protein using the EMBOSS Transseq and the secondary structure was predicted using the Chou and Fasman Secondary Structure Prediction server (CFSSP. Protein modeling was also performed by SWISS-MODEL. The obtained result shows that the lipH partial cds of Ganoderma lucidum GD88 is homologous to the lipD gene of Phanerochaete chrysosporium. The secondary structure prediction result revealed that the percent content of the helix (67 is higher than the percent contents of sheet (53.4 and turns (13.6. According to the generated model, LiP H protein is a homodimer with chains A and B. The heme acts as a ligand and plays a major role in structure stabilization.

  3. Signaling through MyD88 regulates leukocyte recruitment after brain injury

    DEFF Research Database (Denmark)

    Babcock, Alicia A; Toft-Hansen, Henrik; Owens, Trevor

    2008-01-01

    hippocampus. We now show that significant leukocyte entry into the EC occurs within 3-12 h of stab injury. Whereas T cells showed small, gradual increases over 8 days, macrophage infiltration was pronounced and peaked within 12-24 h. MyD88 deficiency significantly reduced macrophage and T cell recruitment...... for TNF-alpha, IL-1beta, and CCL2, which increased >50-fold after stab injury in C57BL/6 mice at the time of peak expression, were severely reduced in injured MyD88 knockout mice. Leukocyte recruitment and gene expression were unaffected in TLR2-deficient or TLR4 mutant mice. No significant differences...... in gene expression were observed in mice lacking IL-1R or IL-18R. These data show that MyD88-dependent signaling mediates proinflammatory gene expression and leukocyte recruitment after CNS injury....

  4. Toll-like receptors and cancer: MYD88 mutation and inflammation

    Directory of Open Access Journals (Sweden)

    James Q Wang

    2014-07-01

    Full Text Available Pattern recognition receptors (PRRs expressed on immune cells are crucial for the early detection of invading pathogens, in initiating early innate immune response and in orchestrating the adaptive immune response. PRRs are activated by specific pathogen-associated molecular patterns (PAMPs that are present in pathogenic microbes or nucleic acids of viruses or bacteria. However, inappropriate activation of these PRRs, such as the Toll-like receptors (TLRs, due to genetic lesions or chronic inflammation has been demonstrated to be a major cause of many haematological malignancies. Gain-of-function mutations in the TLR adaptor protein MYD88 found in 39% of the activated B cell type of diffuse large B cell lymphomas (ABC-DLBCL and almost 100% of Waldenström’s macroglobulinemia (WM further highlight the involvement of TLRs in these malignancies. MYD88 mutations result in the chronic activation of TLR signalling pathways, thus the constitutive activation of the transcription factor NFκB to promote cell survival and proliferation. These recent insights into TLR pathway driven malignancies warrant the need for a better understanding of TLRs in cancers and the development of novel anti-cancer therapies targeting TLRs. This review focuses on Toll-like receptors function and signalling in normal or inflammatory conditions, and how mutations can also hijack the TLR signalling pathways to give rise to cancer. Lastly, we discuss how potential therapeutic agents could be used to restore normal responses to TLRs and have long lasting anti-tumour effects.

  5. New insights into health financing: First results of the international data collection under the System of Health Accounts 2011 framework.

    Science.gov (United States)

    Mueller, Michael; Morgan, David

    2017-07-01

    International comparisons of health spending and financing are most frequently carried out using datasets of international organisations based on the System of Health Accounts (SHA). This accounting framework has recently been updated and 2016 saw the first international data collection under the new SHA 2011 guidelines. In addition to reaching better comparability of health spending figures and greater country coverage, the updated framework has seen changes in the dimension of health financing leading to important consequences when analysing health financing data. This article presents the first results of health spending and financing data collected under this new framework and highlights the areas where SHA 2011 has become a more useful tool for policy analysis, by complementing data on expenditure of health financing schemes with information about their revenue streams. It describes the major conceptual changes in the scope of health financing and highlights why comprehensive analyses based on SHA 2011 can provide for a more complete description and comparison of health financing across countries, facilitate a more meaningful discussion of fiscal sustainability of health spending by also analysing the revenues of compulsory public schemes and help to clarify the role of governments in financing health care - which is generally much bigger than previously documented. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. IPHAS J025827.88+635234.9 and IPHAS J051814.33+294113.0: Two probable eclipsing intermediate polars

    Science.gov (United States)

    Joshi, Arti; Pandey, Jeewan Chandra

    2018-04-01

    We present photometry in the R-band and linear polarimetry of two cataclysmic variables, namely IPHAS J025827.88 + 635234.9 and IPHAS J051814.33 + 294113.0. The data were obtained from 1-m class tele-scopes of the Aryabhatta Research Institute of Observational Sciences (ARIES; Nainital, India). In addition to the deep eclipse, strong short-period oscillations are also found. We derived a pulse period of (1203 ± 25) s for IPHAS J025827.88 + 635234.9 and (3277 ± 81) s for IPHAS J051814.33 + 294113.0. The presence of both orbital and spin modulations in these systems indicate that they belong to a class of intermediate polars. The full width at half depth of the eclipse is also found to be variable from epoch to epoch for IPHAS J025827.88 + 635234.9. The presence of a variable linear polarization of high value in these two sources indicates that these systems possess a strong magnetic field.

  7. Comparative study of hydroxyapatite from eggshells and synthetic hydroxyapatite for bone regeneration.

    Science.gov (United States)

    Lee, Sang-Woon; Kim, Seong-Gon; Balázsi, Csaba; Chae, Weon-Sik; Lee, Hee-Ok

    2012-03-01

    The objective of this study was to evaluate the physical properties of synthetic hydroxyapatite (sHA) and hydroxyapatite from eggshells (eHA) by Fourier-transform infrared (FT-IR) and x-ray diffraction (XRD) and to compare the regenerative ability of the bone using sHA and eHA in a rabbit calvarial defect model. FT-IR and XRD were used to compare the physical properties of sHA and eHA. sHA was purchased from Sigma, and eHA was kindly donated from the Hungarian academy of science. Sixteen New Zealand white rabbits were used for the animal study. After the formation of a bilateral parietal bony defect (diameter 8.0 mm), either sHA or eHA was grafted into the defect. The defect in the control was left unfilled. Bone regeneration was evaluated by histomorphometry at 4 and 8 weeks after the operation. The peak broadening of the XRD experiments were in agreement with scanning electron microscope observation; the sHA had a smaller granule size than the eHA. The eHA had impurities phases of CaO (International Center for Diffraction Data (ICDD) 075-0264) and Ca(OH)(2) (ICDD 072-0156). Total new bone was 17.11 ± 10.24% in the control group, 28.81 ± 12.63% in sHA group, and 25.68 ± 10.89% in eHA group at 4 weeks after the operation. The difference was not statistically significant (P > .05). Total new bone at 8 weeks after the operation was 27.50 ± 10.89% in the control group, 38.62 ± 17.42% in sHA group, and 41.99 ± 8.44% in the eHA group. When comparing the sHA group to the control group, the difference was not statistically significant (P > .05). However, the eHA group was significantly different from the control group (P = .038). When comparing the eHA group to the sHA group, the difference was not statistically significant (P > .05). Both types of HA showed higher bone formation than the unfilled control. However, eHA had significantly higher bone formation than the unfilled control at 8 weeks after operation. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. GP88 (PC-Cell Derived Growth Factor, progranulin stimulates proliferation and confers letrozole resistance to aromatase overexpressing breast cancer cells

    Directory of Open Access Journals (Sweden)

    Sabnis Gauri

    2011-06-01

    Full Text Available Abstract Background Aromatase inhibitors (AI that inhibit breast cancer cell growth by blocking estrogen synthesis have become the treatment of choice for post-menopausal women with estrogen receptor positive (ER+ breast cancer. However, some patients display de novo or acquired resistance to AI. Interactions between estrogen and growth factor signaling pathways have been identified in estrogen-responsive cells as one possible reason for acquisition of resistance. Our laboratory has characterized an autocrine growth factor overexpressed in invasive ductal carcinoma named PC-Cell Derived Growth Factor (GP88, also known as progranulin. In the present study, we investigated the role GP88 on the acquisition of resistance to letrozole in ER+ breast cancer cells Methods We used two aromatase overexpressing human breast cancer cell lines MCF-7-CA cells and AC1 cells and their letrozole resistant counterparts as study models. Effect of stimulating or inhibiting GP88 expression on proliferation, anchorage-independent growth, survival and letrozole responsiveness was examined. Results GP88 induced cell proliferation and conferred letrozole resistance in a time- and dose-dependent fashion. Conversely, naturally letrozole resistant breast cancer cells displayed a 10-fold increase in GP88 expression when compared to letrozole sensitive cells. GP88 overexpression, or exogenous addition blocked the inhibitory effect of letrozole on proliferation, and stimulated survival and soft agar colony formation. In letrozole resistant cells, silencing GP88 by siRNA inhibited cell proliferation and restored their sensitivity to letrozole. Conclusion Our findings provide information on the role of an alternate growth and survival factor on the acquisition of aromatase inhibitor resistance in ER+ breast cancer.

  9. Mutation of cysteine-88 in the Saccharomyces cerevisiae RAD6 protein abolishes its ubiquitin-conjugating activity and its various biological functions

    International Nuclear Information System (INIS)

    Sung, P.; Prakash, S.; Prakash, L.

    1990-01-01

    The RAD6 gene of Saccharomyces cerevisiae is required for DNA repair, DNA damage-induced mutagenesis, and sporulation. RAD6 protein is a ubiquitin-conjugating enzyme (E2) that has been shown to attach multiple molecules of ubiquitin to histones H2A and H2B. We have now examined whether the E2 activity of RAD6 is involved in its various biological functions. Since the formation of a thioester adduct between E2 and ubiquitin is necessary for E2 activity, the single cysteine residue (Cys-88) present in RAD6 was changed to alanine or valine. The mutant proteins were overproduced in yeast cells and purified to near homogeneity. We show that the rad6 Ala-88 and rad6 Val-88 mutant proteins lack the capacity for thioester formation with ubiquitin and, as a consequence, are totally devoid of any E2 activity. The rad6 Ala-88 and rad6 Val-88 mutations confer a defect in DNA repair, mutagenesis, and sporulation equivalent to that in the rad6 null allele. We suggest that the biological functions of RAD6 require its E2 activity. (author)

  10. Cirrus Cloud Optical Thickness and Effective Diameter Retrieved by MODIS: Impacts of Single Habit Assumption, 3-D Radiative Effects, and Cloud Inhomogeneity

    Science.gov (United States)

    Zhou, Yongbo; Sun, Xuejin; Mielonen, Tero; Li, Haoran; Zhang, Riwei; Li, Yan; Zhang, Chuanliang

    2018-01-01

    For inhomogeneous cirrus clouds, cloud optical thickness (COT) and effective diameter (De) provided by the Moderate Resolution Imaging Spectrometer (MODIS) Collection 6 cloud products are associated with errors due to the single habit assumption (SHA), independent pixel assumption (IPA), photon absorption effect (PAE), and plane-parallel assumption (PPA). SHA means that every cirrus cloud is assumed to have the same shape habit of ice crystals. IPA errors are caused by three-dimensional (3D) radiative effects. PPA and PAE errors are caused by cloud inhomogeneity. We proposed a method to single out these different errors. These errors were examined using the Spherical Harmonics Discrete Ordinate Method simulations done for the MODIS 0.86 μm and 2.13 μm bands. Four midlatitude and tropical cirrus cases were studied. For the COT retrieval, the impacts of SHA and IPA were especially large for optically thick cirrus cases. SHA errors in COT varied distinctly with scattering angles. For the De retrieval, SHA decreased De under most circumstances. PAE decreased De for optically thick cirrus cases. For the COT and De retrievals, the dominant error source was SHA for overhead sun whereas for oblique sun, it could be any of SHA, IPA, and PAE, varying with cirrus cases and sun-satellite viewing geometries. On the domain average, the SHA errors in COT (De) were within -16.1%-42.6% (-38.7%-2.0%), whereas the 3-D radiative effects- and cloud inhomogeneity-induced errors in COT (De) were within -5.6%-19.6% (-2.9%-8.0%) and -2.6%-0% (-3.7%-9.8%), respectively.

  11. A radiochemical separation of spallogenic 88Zr in the carrier-free state for radioisotopic photoneutron sources

    International Nuclear Information System (INIS)

    Whipple, R.E.; Grant, P.M.; Daniels, R.J.; Daniels, W.R.; O'Brien, H.A.Jr.

    1976-01-01

    As the precursor of its 88 Y daughter, 88 Zr could be advantageously included in the active component of the 88 Y-Be photoneutron source for several reasons. The spallation of Mo targets with medium-energy protons at LAMPF procedure has been developed to separate radiozirconium from the target material and various spallogenic impurities. 88 Zr can consequently be obtained carrier-free and in quantitative yield. (author)

  12. First LHCf measurement of photon spectra at pseudorapidity >8.8 in LHC 7TeV pp collisions

    CERN Multimedia

    CERN. Geneva

    2011-01-01

    As the first analysis, LHCf derived energy spectra of single photons at pseudorapidity ranges of 8.8 to 9.0 and 10.9 to infinity. Detail analysis procedure and comparison of the energy spectra between LHCf measurements and MC predictions using major interaction models are presented. A brief summary of recent UHECR observations and a preliminary work of the impact of LHCf measurements to the UHECR interpretation will be also presented.

  13. Utility of MYD88 in the Differential Diagnosis and Choice of Second-Line Therapy in a Case of Nonsecretory Lymphoplasmacytic Lymphoma versus Free Light Chain Waldenstrom’s Macroglobulinemia

    Directory of Open Access Journals (Sweden)

    D. Kazmierski

    2017-01-01

    Full Text Available The MYD88 L265P somatic variant (MYD88 has a high prevalence in Waldenstrom’s Macroglobulinemia (WM, a form of lymphoplasmacytic lymphoma (LPL associated with monoclonal IgM. Although the role of MYD88 in WM was initially reported in 2012, it was not until 2016 that MYD88 testing was included in the National Cancer Care Network (NCCN Guidelines. We present a case illustrating the utility of MYD88 status in distinguishing atypical forms of WM from marginal zone lymphoma (MZL and in selecting second-line therapy with ibrutinib. In 2012, a 64-year-old male presented with dyspnea on exertion, a hemoglobin of 5.6 g/dL, a platelet count of 86,000, and monoclonal IgM kappa on serum immunofixation but no detectable M-spike. Bone marrow biopsy revealed 95% monoclonal B-lymphocytes with lymphoplasmacytic differentiation favoring a diagnosis of LPL/WM over MZL, with a favorable response to chemotherapy. This diagnosis was called into question 3 years later following relapse, and MZL was favored based on the lack of MYD88 mutation. One year later, however, repeat bone marrow biopsy detected the MYD88 mutation and therapy with ibrutinib yielded a favorable response. The distinction between certain lymphomas can be problematic and in this case MYD88 was helpful in clarifying a diagnosis of atypical LPL/WM from MZL and in selecting effective second-line therapy.

  14. New advances of TMEM88 in cancer initiation and progression, with special emphasis on Wnt signaling pathway.

    Science.gov (United States)

    Ge, Yun-Xuan; Wang, Chang-Hui; Hu, Fu-Yong; Pan, Lin-Xin; Min, Jie; Niu, Kai-Yuan; Zhang, Lei; Li, Jun; Xu, Tao

    2018-01-01

    Transmembrane protein 88 (TMEM88), a newly discovered protein localized on the cell membrane. Recent studies showed that TMEM88 was involved in the regulation of several types of cancer. TMEM88 was expressed at significantly higher levels in breast cancer (BC) cell line than in normal breast cell line with co-localized with Dishevelled (DVL) in the cytoplasm of BC cell line. TMEM88 silencing in the ovarian cancer cell line CP70 resulted in significant upregulation of Wnt downstream genes (c-Myc, cyclin-D1) and other Wnt target genes including JUN, PTIX2, CTNNB1 (β-catenin), further supporting that TMEM88 inhibits canonical Wnt signaling pathway. Wnt signaling pathway has been known to play important roles in many diseases, especially in cancer. For instance, hepatocellular carcinoma (HCC) has become one of the most common tumors harboring mutations in the Wnt signaling pathway. As the inhibitor of Wnt signaling, TMEM88 has been considered to act as an oncogene or a tumor suppressor. Up-regulated TMEM88 or gene therapy approaches could be an effective therapeutic approach against tumor as TMEM88 inhibits Wnt signaling through direct interaction with DVL. Here, we review the current knowledge on the functional role and potential clinical application of TMEM88 in the control of various cancers. Highlights Wnt signaling displays an important role in several pathogenesis of cancer. Wnt signaling pathway is activated during cancer development. TMEM88 has an impact on cancer by inhibiting canonical Wnt signaling. We discuss the importance and new applications of TMEM88 in cancer therapy. © 2017 Wiley Periodicals, Inc.

  15. ACHEMA yearbook '88. Vol. 2

    International Nuclear Information System (INIS)

    Behrens, D.

    1987-01-01

    In Volume 2 entitled 'Industrial and Laboratory Equipment, Machinery, Plant and Processes' the chemical engineering companies have been given the opportunity to report in a comprehensive way on new trends of development and performances together with data on their companies and managements as well as on their product ranges and their exhibition highlights at ACHEMA 88. With its attractive layout and four-colour printing as well as the option of making available separate prints, Volume 2 represents an efficient means of communication which has been used by some 265 companies. The information contained in Volume 2 and 3 is also stored in the DECHEMA data bank DEQUIP (Dechema Equipment Suppliers Data Bank), which is accessible online throughout the world. (orig./HK) [de

  16. Revision after shoulder replacement for acute fracture of the proximal humerus

    DEFF Research Database (Denmark)

    Brorson, Stig; Salomonsson, Björn; Jensen, Steen L

    2017-01-01

    Background and purpose - For more than half a century, stemmed hemiarthroplasty (SHA) has been used in the treatment of comminuted and displaced fractures of the proximal humerus. Reverse shoulder arthroplasty (RSA) has been increasingly popular in cases where it is difficult to obtain satisfactory...... to the national shoulder arthroplasty registries in Denmark, Sweden, and Norway. We included 6,756 shoulder arthroplasties performed for acute fractures between 2004 and 2013. Results - There were 6,112 SHAs (90%) and 565 RSAs (8.4%). The cumulative arthroplasty survival rate after 5 years was 0.96 for both SHA...... and RSA. The relative risk of revision of RSA was 1.4 (95% CI: 0.9-2.2) with SHA as reference. For both types of arthroplasty, the most common reason for revision was infection (SHA 0.8%, RSA 2.1%). The relative risk of revision due to infection was 3.1 (95% CI: 1.6-5.9) for RSA with SHA as reference...

  17. A sensitive and selective sensor for biothiols based on the turn-on fluorescence of the Fe-MIL-88 metal-organic frameworks-hydrogen peroxide system.

    Science.gov (United States)

    Sun, Zheng Juan; Jiang, Jun Ze; Li, Yuan Fang

    2015-12-21

    Herein, we present a novel strategy based on a "turn-on" fluorescence system made up of metal-organic frameworks Fe-MIL-88 and H2O2 for detecting biothiols in human serum. The nonfluorescent Fe-MIL-88 gives weak fluorescence in the presence of H2O2. Interestingly, it was found that biothiols such as glutathione (GSH), cysteine (Cys) or homocysteine (Hcy) could induce fluorescence turn-on of the Fe-MIL-88/H2O2 system. Under optimal conditions, the relative fluorescence intensity exhibited a good linear relationship in the range from 50 nM-10 μM for GSH (r = 0.994), 50 nM-10 μM for Cys (r = 0.990), and 50 nM-10 μM (r = 0.992) for Hcy; the detection limits of GSH, Cys and Hcy were 30 nM, 40 nM, and 40 nM respectively. Mechanism investigation reveals that biothiols could associate with Fe-MIL-88 via hydrogen bonding and electrostatic interaction followed by redox reaction between biothiols and Fe(3+) present in the Fe-MIL-88, Fe(3+) was thus reduced to Fe(2+), and then Fe(2+) could efficiently catalyze the decomposition of H2O2 to yield ˙OH radicals through the Fenton reaction. Besides, biothiols were able to reduce H2O2 to produce ˙OH radicals directly. Thus the Fe-MIL-88 as well as biothiols could cooperatively contribute to the activation of H2O2 to generate higher amounts of ˙OH radicals, which in turn oxidize the free ligand terephthalic acid (BDC) outside or within the Fe-MIL-88 structure to strongly fluorescent hydroxylated terephthalic acid (OHBDC), thereby turning on the fluorescence.

  18. Health outcomes and quality of life of residents of shared-housing arrangements compared to residents of special care units - results of the Berlin DeWeGE-study.

    Science.gov (United States)

    Wolf-Ostermann, Karin; Worch, Andreas; Fischer, Thomas; Wulff, Ines; Gräske, Johannes

    2012-11-01

    To compare different health outcomes as well as quality of life (QoL) between people with dementia living in shared-housing arrangements (SHA) and special care units (SCU) in nursing homes. Often situated in large apartments in mostly urban settings, SHA are a specific German kind of small-scale living facilities for older care-dependent persons, predominantly suffering from dementia. SHA are completely disconnected from traditional nursing homes. In a longitudinal design, all new residents of SHA and SCU suffering with dementia in Berlin were surveyed for one year. They were assessed when they moved into the SHA or SCU and again 6 and 12 months later. We surveyed physical and psychological health outcomes including ADL-functioning (Barthel), neuropsychiatric symptoms of dementia (NPI) and challenging behaviour (Cohen-Mansfield agitation inventory) as well as QoL (Qualidem). Fifty-six persons (43 women, 13 men) were recruited into the longitudinal study. The average age was 82·5 years at admission, participants mostly had a moderate level of cognitive impairment (mean Mini Mental State Examination = 13·3), prevalence of neuropsychiatric symptoms was high. During the one-year follow-up, analyses show a significant decrease in cognitive abilities but also of neuropsychiatric symptoms in both groups. In SHA, QoL increases on average during the one-year study period. Both types of facilities attract slightly different populations according to our data. Comparison of SHA residents to SCU residents documented no significant beneficial effects of settings in terms of health outcomes. As no clear advantage of either SHA or SCU in nursing homes can be demonstrated for residents with dementia who move in newly, it is impossible to give a clear evidence-based recommendation and the decision for one setting or the other can be made according solely to personal preference of the resident. © 2012 Blackwell Publishing Ltd.

  19. TRAM is involved in IL-18 signaling and functions as a sorting adaptor for MyD88.

    Directory of Open Access Journals (Sweden)

    Hidenori Ohnishi

    Full Text Available MyD88, a Toll/interleukin-1 receptor homology (TIR domain-containing adaptor protein, mediates signals from the Toll-like receptors (TLR or IL-1/IL-18 receptors to downstream kinases. In MyD88-dependent TLR4 signaling, the function of MyD88 is enhanced by another TIR domain-containing adaptor, Mal/TIRAP, which brings MyD88 to the plasma membrane and promotes its interaction with the cytosolic region of TLR4. Hence, Mal is recognized as the "sorting adaptor" for MyD88. In this study, a direct interaction between MyD88-TIR and another membrane-sorting adaptor, TRAM/TICAM-2, was demonstrated in vitro. Cell-based assays including RNA interference experiments and TRAM deficient mice revealed that the interplay between MyD88 and TRAM in cells is important in mediating IL-18 signal transduction. Live cell imaging further demonstrated the co-localized accumulation of MyD88 and TRAM in the membrane regions in HEK293 cells. These findings suggest that TRAM serves as the sorting adaptor for MyD88 in IL-18 signaling, which then facilitates the signal transduction. The binding sites for TRAM are located in the TIR domain of MyD88 and actually overlap with the binding sites for Mal. MyD88, the multifunctional signaling adaptor that works together with most of the TLR members and with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner in a distinct context.

  20. Eocene Acritarchs of Taiwan

    Directory of Open Access Journals (Sweden)

    Cheng-Long Shaw

    2001-03-01

    Full Text Available Four new taxa (Multiplicisphaeridium taiwanianum C. L. Shaw sp. nov., Trichosphaeridium taiwanianum C. L. Shaw sp. nov., Tylosphaeridium taiwanianum C. L. Shaw sp. nov., and Cymatiosphaera taiwaniana C. L. Shaw sp. nov. of the fossil acritarchs obtained from Eocene sediments from offshore of the Keelung area in northern Taiwan are reported. They belong to two subgroups, four genera.

  1. Nature of the bifunctional chelating agent used for radioimmunotherapy with yttrium-88 monoclonal antibodies: critical factors in determining in vivo survival and organ toxicity

    Energy Technology Data Exchange (ETDEWEB)

    Kozak, R.W.; Raubitschek, A.; Mirzadeh, S.; Brechbiel, M.W.; Junghaus, R.; Gansow, O.A.; Waldmann, T.A. (Center for Biologics Evaluation and Research, FDA, Bethesda, MD (USA))

    1989-05-15

    One factor that is critical to the potential effectiveness of radioimmunotherapy is the design of radiometal-chelated antibodies that will be stable in vivo. Stability in vivo depends on the condition that both the chelate linkage and radiolabeling procedures not alter antibody specificity and biodistribution. In addition, synthesis and selection of the chelating agent is critical for each radiometal in order to prevent inappropriate release of the radiometal in vivo. In the present study, we compare the in vivo stability of seven radioimmunoconjugates that use different polyaminocarboxylate chelating agents to complex yttrium-88 to the mouse anti-human interleukin-2 receptor monoclonal antibody, anti-Tac. Chelate linkage and radiolabeling procedures did not alter the immunospecificity of anti-Tac. In order to assess whether yttrium was inappropriately released from the chelate-coupled antibody in vivo, iodine-131-labeled and yttrium-88 chelate-coupled antibodies were simultaneously administered to the same animals to correlate the decline in yttrium and radioiodinated antibody activity. The four stable yttrium-88 chelate-coupled antibodies studied displayed similar iodine-131 and yttrium-88 activity, indicating minimal elution of yttrium-88 from the complex. In contrast, the unstable yttrium-88 chelate-coupled antibodies had serum yttrium-88 activities that declined much more rapidly than their iodine-131 activities, suggesting loss of the radiolabel yttrium-88 from the chelate. Furthermore, high rates of yttrium-88 elution correlated with deposition in bone. Four chelating agents emerged as promising immunotherapeutic reagents: isothiocyanate benzyl DTPA and its derivatives 1B3M, MX, and 1M3B.

  2. Changes in urinary Cu, Zn, and Se levels in cancer patients after treatment with Sha Shen Mai Men Dong Tang

    Directory of Open Access Journals (Sweden)

    Tung-Yuan Lai

    2016-04-01

    Full Text Available Sha Shen Mai Men Dong Tang (SMD-2; 沙參麥冬湯 shā shēn mài dōng tāng is a Chinese medicinal herb (CMH; 中草藥 zhōng cǎo yào used to treat symptoms associated with cancer therapy. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper (Cu, zinc (Zn, and selenium (Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy. Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial. Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment. Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations (GEEs. After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly. Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. Urinary Zn and Se levels and the ratios of Zn to Cu and Se to Cu, but not urinary Cu levels, increased significantly during and after treatment when assessed using the GEE model. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system.

  3. Limiting hazardous noise exposure from noisy toys: simple, sticky solutions.

    Science.gov (United States)

    Weinreich, Heather M; Jabbour, Noel; Levine, Samuel; Yueh, Bevan

    2013-09-01

    To assess noise levels of toys from the Sight & Hearing Association (SHA) 2010 Noisy Toys List and evaluate the change in noise of these toys after covering the speakers with tape or glue. One Group Pretest-Posttest Design. SHA 2010 Toys List (n = 18) toys were tested at distances of 0 and 25 cm from sound source in a soundproof booth using a digital sound-level meter. The dBA level of sound produced by toy was obtained. Toys with speakers (n = 16) were tested before and after altering speakers with plastic packing tape or nontoxic glue. Mean noise level for non-taped toys at 0 and 25 cm was 107.6 dBA (SD ± 8.5) and 82.5 dBA (SD ± 8.8), respectively. With tape, there was a statistically significant decrease in noise level at 0 and 25 cm: 84.2 dBA and 68.2 dBA (P toys. However, there was no significant difference between tape or glue. Overall, altering the toy can significantly decrease the sound a child may experience when playing with toys. However, some toys, even after altering, still produce sound levels that may be considered dangerous. Copyright © 2013 The American Laryngological, Rhinological and Otological Society, Inc.

  4. Measurement of 89Y (n, 2n)88Y cross sections

    International Nuclear Information System (INIS)

    Zhu Chuanxin

    2006-12-01

    The 89 Y(n, 2n) 88 Y cross sections in 13.5-14.8 MeV induced by D-T neutrons have been measured, using the activation method and related measurement technology. 89 Y(n,2n) 88 Y cross sections are 629-1053 mb. The relative accuracy is 1.7%. The results were compared with the experiment result by using large liquid scintillator and with the cross section data of ENDF/B-6 base, the ratio of ENDF/B-6 data to experiment values in 14.1 MeV is 0.99. (authors)

  5. The effect of phytohormones on the 133Cs and 88Sr accumulation in oilseed rape

    International Nuclear Information System (INIS)

    Guo Mengluo; Xu Changhe; Li Xinlei; Wang Dan

    2011-01-01

    The effect of uptake and distribution of 133 Cs and 88 Sr in the common plant-India mustard (Brassica napus L.) by exogenous phytohormones (Gibberelin-A 3 GA 3 , Salicylates, SA, 3-indole acetic acid, IAA) treatments were studied by using hydroponic experiment. The results shown as follows: the biomass of above-ground and that of roots of oilseed rape were obviously higher than that of contrary (non-hormone), and the accumulation of 133 Cs and 88 Sr increased as well, under the three phytohormones treatments. The distribution sequence of 133 Cs and 88 Sr in oilseed rape was roots>above-grounds, and the contents was 1 3 3 Cs> 88 Sr. The accumulation ability of phytohormones was GA>SA>IAA, the accumulation of 133 Cs or 88 Sr increased with the phytohormone concentration. The treatment of mid-level of Gibberelin-A 3 (500 mg/L) and Salicylates acid (500 μmol/L) increased the biomass, enrichment and the translocation factors under the low concentration of 133 Cs and 88 Sr stress (1 mmol/L). Therefore, the phyto-extraction efficiency was enhanced in oilseed rape by using exogenous phytohormones. (authors)

  6. Bilayered near-infrared fluorescent nanoparticles based on low molecular weight PEI for tumor-targeted in vivo imaging

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hao; Li, Ke [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China); Xu, Liang [The University of Kansas, Department of Molecular Biosciences (United States); Wu, Daocheng, E-mail: wudaocheng@mail.xjtu.edu.cn [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China)

    2014-12-15

    To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications.

  7. Bilayered near-infrared fluorescent nanoparticles based on low molecular weight PEI for tumor-targeted in vivo imaging

    International Nuclear Information System (INIS)

    Liu, Hao; Li, Ke; Xu, Liang; Wu, Daocheng

    2014-01-01

    To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications

  8. Antagonism in the extraction of uranium(VI) by the binary mixture of PC88A and benzimidazole

    International Nuclear Information System (INIS)

    Mukherjee, A.; Kamila, S.; Chakravortty, V.

    1999-01-01

    Extraction studies of uranium(VI) by the binary mixture of PC88A and benzimidazole show an antagonistic behavior in the concentration range 10 -5 -10 -6 M of PC88A and 0.005M of benzimidazole. Antagonism is observed due to the deprotonation of PC88A by benzimidazole forming an adduct resulting in the virtual removal of PC88A from the system. (author)

  9. Super VHS video cassette recorder, A-SB88; Super VHS video A-SB88

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    A super VHS video cassette recorder, A-SB88, was commercialized having no compromised aspects at all in picture quality, sound quality, operability, energy conservation, design, etc. In the picture quality, the VCR is mounted with the S-ET system capable of realizing a quality comparable to SVHS with a three-dimensional Y/C detached circuit for dynamic moving image detection, three-dimensional DNR(digital noise reduction) and TBC(time base corrector), FE(flying erase) circuit, and a normal tape. In the operability, it is provided with a remote control transfer in large LCD, 400x high speed rewind, reservation system capable of simply reserving a serial drama for example, and a function for searching the end of picture recording; also, in the environmental aspect, the stand-by power consumption was reduced to 1/10 of conventional models (ratio with Toshiba A-BS6 at display power off). (translated by NEDO)

  10. Radiation-hardened I2L 8*8 multiplier circuit

    International Nuclear Information System (INIS)

    Doyle, B.R.; Kreps, S.A.; Van Vonno, N.W.; Lake, G.W.

    1979-01-01

    Development of improved Substrate Fed I 2 L (SFL) processing has been combined with geometry and fanout constraints to design a radiation hardened LSI 8.8 Multiplier. This study describes details of the process and circuit design and gives resultant electrical and radiation test performance

  11. Gene structure, cDNA characterization and RNAi-based functional analysis of a myeloid differentiation factor 88 homolog in Tenebrio molitor larvae exposed to Staphylococcus aureus infection.

    Science.gov (United States)

    Patnaik, Bharat Bhusan; Patnaik, Hongray Howrelia; Seo, Gi Won; Jo, Yong Hun; Lee, Yong Seok; Lee, Bok Luel; Han, Yeon Soo

    2014-10-01

    Myeloid differentiation factor 88 (MyD88), an intracellular adaptor protein involved in Toll/Toll-like receptor (TLR) signal processing, triggers activation of nuclear factor-kappaB (NF-κB) transcription factors. In the present study, we analyzed the gene structure and biological function of MyD88 in a coleopteran insect, Tenebrio molitor (TmMyD88). The TmMyD88 gene was 1380 bp in length and consisted of five exons and four introns. The 5'-flanking sequence revealed several putative transcription factor binding sites, such as STAT-4, AP-1, cJun, cfos, NF-1 and many heat shock factor binding elements. The cDNA contained a typical death domain, a conservative Toll-like interleukin-1 receptor (TIR) domain, and a C-terminal extension (CTE). The TmMyD88 TIR domain showed three significantly conserved motifs for interacting with the TIR domain of TLRs. TmMyD88 was grouped within the invertebrate cluster of the phylogenetic tree and shared 75% sequence identity with the TIR domain of Tribolium castaneum MyD88. Homology modeling of the TmMyD88 TIR domain revealed five parallel β-strands surrounded by five α-helices that adopted loop conformations to function as an adaptor. TmMyD88 expression was upregulated 7.3- and 4.79-fold after 12 and 6h, respectively, of challenge with Staphylococcus aureus and fungal β-1,3 glucan. Silencing of the TmMyD88 transcript by RNA interference led to reduced resistance of the host to infection by S. aureus. These results indicate that TmMyD88 is required for survival against Staphylococcus infection. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. Validation test for CAP88 predictions of tritium dispersion at Los Alamos National Laboratory.

    Science.gov (United States)

    Michelotti, Erika; Green, Andrew; Whicker, Jeffrey; Eisele, William; Fuehne, David; McNaughton, Michael

    2013-08-01

    Gaussian plume models, such as CAP88, are used regularly for estimating downwind concentrations from stack emissions. At many facilities, the U.S. Environmental Protection Agency (U.S. EPA) requires that CAP88 be used to demonstrate compliance with air quality regulations for public protection from emissions of radionuclides. Gaussian plume models have the advantage of being relatively simple and their use pragmatic; however, these models are based on simplifying assumptions and generally they are not capable of incorporating dynamic meteorological conditions or complex topography. These limitations encourage validation tests to understand the capabilities and limitations of the model for the specific application. Los Alamos National Laboratory (LANL) has complex topography but is required to use CAP88 for compliance with the Clean Air Act Subpart H. The purpose of this study was to test the accuracy of the CAP88 predictions against ambient air measurements using released tritium as a tracer. Stack emissions of tritium from two LANL stacks were measured and the dispersion modeled with CAP88 using local meteorology. Ambient air measurements of tritium were made at various distances and directions from the stacks. Model predictions and ambient air measurements were compared over the course of a full year's data. Comparative results were consistent with other studies and showed the CAP88 predictions of downwind tritium concentrations were on average about three times higher than those measured, and the accuracy of the model predictions were generally more consistent for annual averages than for bi-weekly data.

  13. Downregulation of adaptor protein MyD88 compromises the angiogenic potential of B16 murine melanoma

    Science.gov (United States)

    Araya, Paula; Nuñez, Nicolás Gonzalo; Mena, Hebe Agustina; Bocco, José Luis; Negrotto, Soledad; Maccioni, Mariana

    2017-01-01

    The mechanisms that link inflammatory responses to cancer development remain a subject of intense investigation, emphasizing the need to better understand the cellular and molecular pathways that create a tumor promoting microenvironment. The myeloid differentiation primary response protein MyD88 acts as a main adaptor molecule for the signaling cascades initiated from Toll-like receptors (TLRs) and the interleukin 1 receptor (IL-1R). MyD88 has been shown to contribute to tumorigenesis in many inflammation-associated cancer models. In this study, we sought to better define the role of MyD88 in neoplastic cells using a murine melanoma model. Herein, we have demonstrated that MyD88 expression is required to maintain the angiogenic switch that supports B16 melanoma growth. By knocking down MyD88 we reduced TLR-mediated NF-κB activation with no evident effects over cell proliferation and survival. In addition, MyD88 downregulation was associated with a decrease of HIF1α levels and its target gene VEGF, in correlation with an impaired capability to induce capillary sprouting and tube formation of endothelial cells. Melanomas developed from cells lacking MyD88 showed an enhanced secretion of chemoattractant ligands such as CCL2, CXCL10 and CXCL1 and have an improved infiltration of macrophages to the tumor site. Our results imply that cell-autonomous signaling through MyD88 is required to sustain tumor growth and underscore its function as an important positive modulator of tumor angiogenesis. PMID:28662055

  14. Decree-Law No. 199/88, 31 May 1988.

    Science.gov (United States)

    1988-01-01

    This Decree-Law establishes criteria for the determination of final compensation for expropriation or nationalization of land or agricultural capital. The lack of legal definition of criteria for the determination of such final compensation was a gap in recent Portuguese legislation on land reform. Although the holdings of many landlords and farmers had been nationalized or expropriated after 11 March 1975, the compensation obtained prior to the enactment of this Decree-Law was provisional and reflected outdated values. This Decree-Law closes this gap by establishing the criteria for the determination of final compensation with adjusted value. Under it, any farmer whose land or capital has been nationalized or expropriated since March 1975 may apply for final compensation, from which shall be deducted the value of any provisional compensation previously obtained and any property previously devolved as a "right of reserve" pursuant to pertinent legislation (see Law No. 109/88 of 26 September 1988 and Decree No. 44/88 of 14 December 1988). The final compensation shall be determined by administrative procedure in which the Ministry of Agriculture, Fisheries, and Food; the Ministry of Finance; and the applicant are represented. full text

  15. Lactobacillus rhamnosus GR-1 Limits Escherichia coli-Induced Inflammatory Responses via Attenuating MyD88-Dependent and MyD88-Independent Pathway Activation in Bovine Endometrial Epithelial Cells.

    Science.gov (United States)

    Liu, Mingchao; Wu, Qiong; Wang, Mengling; Fu, Yunhe; Wang, Jiufeng

    2016-08-01

    Intrauterine Escherichia coli infection after calving reduces fertility and causes major economic losses in the dairy industry. We investigated the protective effect of the probiotic Lactobacillus rhamnosus GR-1 on E. coli-induced cell damage and inflammation in primary bovine endometrial epithelial cells (BEECs). L. rhamnosus GR-1 reduced ultrastructure alterations and the percentage of BEECs apoptosis after E. coli challenge. Increased messenger RNA (mRNA) expression of immune response indicators, including pattern recognition receptors (toll-like receptor [TLR]2, TLR4, nucleotide-binding oligomerization domain [NOD]1, and NOD2), inflammasome proteins (NOD-like receptor family member pyrin domain-containing protein 3, apoptosis-associated speck-like protein, and caspase-1), TLR4 downstream adaptor molecules (myeloid differentiation antigen 88 [MyD88], toll-like receptor adaptor molecule 2 [TICAM2]), nuclear transcription factor kB (NF-kB), and the inflammatory cytokines tumor necrosis factor (TNF)-α, interleukin (IL)-1β, IL-6, IL-8, IL-10, IL-18, and interferon (IFN)-β, was observed following E. coli challenge. However, these increases were attenuated by L. rhamnosus GR-1 pretreatment. Our data indicate that L. rhamnosus GR-1 ameliorates the E. coli-induced disruption of cellular ultrastructure, subsequently reducing the percentage of BEECs apoptosis and limiting inflammatory responses, partly via attenuation of MyD88-dependent and MyD88-independent pathway activation. Certain probiotics could potentially prevent postpartum uterine diseases in dairy cows, ultimately reducing the use of antibiotics.

  16. Genome shuffling of Lactobacillus plantarum C88 improves adhesion.

    Science.gov (United States)

    Zhao, Yujuan; Duan, Cuicui; Gao, Lei; Yu, Xue; Niu, Chunhua; Li, Shengyu

    2017-01-01

    Genome shuffling is an important method for rapid improvement in microbial strains for desired phenotypes. In this study, ultraviolet irradiation and nitrosoguanidine were used as mutagens to enhance the adhesion of the wild-type Lactobacillus plantarum C88. Four strains with better property were screened after mutagenesis to develop a library of parent strains for three rounds of genome shuffling. Fusants F3-1, F3-2, F3-3, and F3-4 were screened as the improved strains. The in vivo and in vitro tests results indicated that the population after three rounds of genome shuffling exhibited improved adhesive property. Random Amplified Polymorphic DNA results showed significant differences between the parent strain and recombinant strains at DNA level. These results suggest that the adhesive property of L. plantarum C88 can be significantly improved by genome shuffling. Improvement in the adhesive property of bacterial cells by genome shuffling enhances the colonization of probiotic strains which further benefits to exist probiotic function.

  17. 50 CFR 648.88 - Multispecies open access permit restrictions.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Multispecies open access permit... Management Measures for the NE Multispecies and Monkfish Fisheries § 648.88 Multispecies open access permit restrictions. (a) Handgear permit. A vessel issued a valid open access NE multispecies Handgear permit is...

  18. The temperature dependent strontium isotope fractionation (δ88/86Sr) during calcium carbonate precipitation

    International Nuclear Information System (INIS)

    Fietzke, J.; Eisenhauer, A.

    2006-01-01

    Full text: In order to study the influence of stable isotope fractionation during inorganic and biologically controlled CaCO 3 precipitation we have developed the analytical principles for the measurement of strontium (Sr) isotope fractionation. We have established a measurement protocol for the application on a MC-ICP-MS (AXIOM) using the common bracketing standard technique. The Sr-standard CRM NBS987 was used as reference material for all measurements and to calculate the Sr fractionation. Latter value is expressed by the δ-notation defined as: δ 88/86 Sr = [( 88 Sr/ 86 Sr)sample / ( 88 Sr/ 86 Sr)standard ] * 1000 -1. A first set of experiments focused on the temperature dependency of Sr-isotope fractionation. For this purpose inorganically precipitated aragonite and calcite was prepared under controlled conditions in a temperature range from 10 to 50 o C. In addition, cultured and naturally grown corals were analyzed for their δ 88/86 Sr values. Repeated measurements of IAPSO seawater standard showed a mean δ 88/86 Sr value of 0.383 ± 0.008 (2 SEM) being the isotopically heaviest material measured so far. The first results of the inorganically precipitated aragonite and the natural corals revealed a clear temperature dependency of the δ 88/86 Sr values. For inorganic aragonite the slope of this correlation is about 0.0055 permil/ o C. However, for naturally grown corals (Pavona clavus) a 6 fold steeper slope of 0.033 permil/ o C was determined. This strong temperature dependency implies the potential to use stable Sr isotopes as a new marine (paleo)temperature proxy. (author)

  19. Magnetodielectric effect in (1 - x)(Ba0.88Ca0.12)(Ti0.88Zr0.12)O3 - xCoFe2O4

    Science.gov (United States)

    Pan, Pengfei; Tao, Jin; Ma, Fusheng; Zhang, Ning

    2018-05-01

    Magnetodielectric (MD) materials have attracted considerable attention due to their intriguing physics and potential future applications. In this work, polycrystalline (1 - x)(Ba0.88Ca0.12)(Ti0.88Zr0.12)O3 - xCoFe2O4 (x = 0.10, 0.20, 0.30, 0.40) ceramic have been prepared via sol-gel method. The room temperature magnetic and ferroelectric behaviors of the synthesized composites were investigated. For the composite with x = 0.40, a MD ratio of 5.37% was achieved under a magnetic field of 1.5 T at f = 1 kHz. The measured "butterfly hysteresis" MD curves exhibit an obvious dielectric anomaly. Theoretical analysis suggests that the observed magnetodielectric effect is attributed to the magnetoresistance effect and magnetoelectric coupling.

  20. MyD88 But Not TRIF Is Essential for Osteoclastogenesis Induced by Lipopolysaccharide, Diacyl Lipopeptide, and IL-1α

    Science.gov (United States)

    Sato, Nobuaki; Takahashi, Naoyuki; Suda, Koji; Nakamura, Midori; Yamaki, Mariko; Ninomiya, Tadashi; Kobayashi, Yasuhiro; Takada, Haruhiko; Shibata, Kenichiro; Yamamoto, Masahiro; Takeda, Kiyoshi; Akira, Shizuo; Noguchi, Toshihide; Udagawa, Nobuyuki

    2004-01-01

    Myeloid differentiation factor 88 (MyD88) plays essential roles in the signaling of the Toll/interleukin (IL)-1 receptor family. Toll–IL-1 receptor domain-containing adaptor inducing interferon-β (TRIF)-mediated signals are involved in lipopolysaccharide (LPS)-induced MyD88-independent pathways. Using MyD88-deficient (MyD88−/−) mice and TRIF-deficient (TRIF−/−) mice, we examined roles of MyD88 and TRIF in osteoclast differentiation and function. LPS, diacyl lipopeptide, and IL-1α stimulated osteoclastogenesis in cocultures of osteoblasts and hemopoietic cells obtained from TRIF−/− mice, but not MyD88−/− mice. These factors stimulated receptor activator of nuclear factor-κB ligand mRNA expression in TRIF−/− osteoblasts, but not MyD88−/− osteoblasts. LPS stimulated IL-6 production in TRIF−/− osteoblasts, but not TRIF−/− macrophages. LPS and IL-1α enhanced the survival of TRIF−/− osteoclasts, but not MyD88−/− osteoclasts. Diacyl lipopeptide did not support the survival of osteoclasts because of the lack of Toll-like receptor (TLR)6 in osteoclasts. Macrophages expressed both TRIF and TRIF-related adaptor molecule (TRAM) mRNA, whereas osteoblasts and osteoclasts expressed only TRIF mRNA. Bone histomorphometry showed that MyD88−/− mice exhibited osteopenia with reduced bone resorption and formation. These results suggest that the MyD88-mediated signal is essential for the osteoclastogenesis and function induced by IL-1 and TLR ligands, and that MyD88 is physiologically involved in bone turnover. PMID:15353553

  1. Pretractament amb hidròlisi parcial de residus lignocel·lulòsics

    OpenAIRE

    González i Anadón, Glòria

    1985-01-01

    Aquest resum recull el treball realitzat sobre la hidròlisi àcida de la fracció hemicel?lulòsica de residus agrícoles, com un pretractament de la cel?lulosa present, cara a la hidròlisi enzimàtica. S'ha treballat amb palla de blat, a la qual s'ha sotmès a un procés de mòlta i garbellat a fi d'aconseguir un substrat el més homogeni possible. Un cop seleccionades les variables d'operació, s'han dut a terme experiències a diferents concentracions d'àcid sulfíric i diverses tem...

  2. Formation of long-period stacking ordered structures in Mg88M5Y7 (M = Ti, Ni and Pb) casting alloys

    International Nuclear Information System (INIS)

    Jin, Qian-Qian; Fang, Can-Feng; Mi, Shao-Bo

    2013-01-01

    Highlights: •Apart from 18R-LPSO, 14H-LPSO structure was determined in the Mg-Ni-Y alloys. •The appearance of twin-related structure in 18R-LPSO structure results from the stacking faults in the stacking sequence of the closely packed planes. •A new (Pb, Mg) 2 Y phase with a body-centered orthorhombic structure was determined in the Mg-Pb-Y alloy. •No LPSO structures were found in the Mg-Pb-Y and Mg-Ti-Y casting alloys. -- Abstract: Formation of long-period stacking ordered (LPSO) structures is investigated in Mg 88 M 5 Y 7 (M = Ti, Ni and Pb) casting alloys by means of electron microscopy and X-ray diffraction. In the Mg 88 Ni 5 Y 7 casting alloy, 14H-LPSO structure is observed in a small amount, which coexists with 18R-LPSO structure. The appearance of stacking faults in 18R-LPSO structure results in twin-related structure in the stacking sequence of the closely packed planes. A new (Pb, Mg) 2 Y phase with a body-centered orthorhombic structure is determined in the Mg 88 Pb 5 Y 7 alloy. No LPSO structures are found in the Mg 88 Pb 5 Y 7 and Mg 88 Ti 5 Y 7 casting alloys. In terms of the atomic radius and heat of mixing, the formation ability of LPSO structure in the present alloys is discussed

  3. Experimental and natural infections in MyD88- and IRAK-4-deficient mice and humans

    Science.gov (United States)

    von Bernuth, Horst; Picard, Capucine; Puel, Anne; Casanova, Jean-Laurent

    2013-01-01

    Most Toll-like-receptors (TLRs) and interleukin-1 receptors (IL-1Rs) signal via myeloid differentiation primary response 88 (MyD88) and interleukin-1 receptor-associated kinase 4 (IRAK-4). The combined roles of these two receptor families in the course of experimental infections have been assessed in MyD88- and IRAK-4-deficient mice for almost fifteen years. These animals have been shown to be susceptible to 46 pathogens: 27 bacteria, 8 viruses, 7 parasites, and 4 fungi. Humans with inborn MyD88 or IRAK-4 deficiency were first identified in 2003. They suffer from naturally occurring life-threatening infections caused by a small number of bacterial species, although the incidence and severity of these infections decrease with age. Mouse TLR- and IL-1R-dependent immunity mediated by MyD88 and IRAK-4 seems to be vital to combat a wide array of experimentally administered pathogens at most ages. By contrast, human TLR- and IL-1R-dependent immunity mediated by MyD88 and IRAK-4 seems to be effective in the natural setting against only a few bacteria and is most important in infancy and early childhood. The roles of TLRs and IL-1Rs in protective immunity deduced from studies in mutant mice subjected to experimental infections should therefore be reconsidered in the light of findings for natural infections in humans carrying mutations as discussed in this review. PMID:23255009

  4. On Field Theory of Open Strings, Tachyon Condensation and Closed Strings

    OpenAIRE

    Shatashvili, Samson L.

    2001-01-01

    I review the physical properties of different vacua in the background independent open string field theory. Talk presented at Strings 2001, Mumbai, India, http://theory.theory.tifr.res.in/strings/Proceedings/#sha-s.

  5. Performance of free-range chickens reared in production modules enriched with shade net and perches

    Directory of Open Access Journals (Sweden)

    MJB Santos

    2014-03-01

    Full Text Available An experiment was carried out to evaluate the effect of environmental enrichment in a free-range chicken production system on live performance as a function of microclimate, physiological parameters, and performance parameters. Four production modules were divided into four pens with 10 birds each, totaling 60 birds. The following treatments were applied: access to a paddock (TEST, access to a paddock with perches (PER, access to a paddock with artificial shade (SHA, and access to the paddock with perches and artificial shade (PESH. The PESH production module presented the best globe temperature (Tbg,ºC and enthalpy (h, kJ/kg, and thereby, the best thermal environmental conditions, which ensured the longest permanence time of the birds in the paddock. The SHA and PESH modules promoted the lowest respiratory rate and shank and comb temperatures. Live performance was influenced by the presence of environmental enrichment (modules SHA and PESH, with the highest live weight (LW and weight gain (WG and the lowest feed conversion ratio (FCR and metabolizable energy intake (MEI. Parts yield, such as giblets, were not influenced by production modules, except for PESH, which promoted higher offal weight. In general, chickens reared in enriched production modules presented greatest performance and comfort results and were considered close to optimal rearing conditions.

  6. 33 CFR 88.09 - Temporary exemption from light and shape requirements when operating under bridges.

    Science.gov (United States)

    2010-07-01

    ... and shape requirements when operating under bridges. 88.09 Section 88.09 Navigation and Navigable... Temporary exemption from light and shape requirements when operating under bridges. A vessel's navigation lights and shapes may be lowered if necessary to pass under a bridge. ...

  7. Regulatory research program for 1987/88

    International Nuclear Information System (INIS)

    1987-01-01

    The regulatory research program of Canada's Atomic Energy Control Board (AECB) is intended to augment the AECB's research program beyond the capability of in-house resources. The overall objective of the research program is to produce pertinent and independent information that will assist the Board and its staff in making correct, timely and credible decisions on regulating nuclear energy. The program covers the following areas: the safety of nuclear facilities, radioactive waste management, health physics, physical security, and the development of regulatory processes. Sixty-seven projects are planned for 1987/88; as well, there are some projects held in reserve in case funding becomes available. This information bulletin contains a list of the projects with a brief description of each

  8. Activation of TAK1 by MYD88 L265P drives malignant B-cell Growth in non-Hodgkin lymphoma

    International Nuclear Information System (INIS)

    Ansell, S M; Hodge, L S; Secreto, F J; Manske, M; Braggio, E; Price-Troska, T; Ziesmer, S; Li, Y; Johnson, S H; Hart, S N; Kocher, J-P A; Vasmatzis, G; Chanan-Kahn, A; Gertz, M; Fonseca, R; Dogan, A; Cerhan, J R; Novak, A J

    2014-01-01

    Massively parallel sequencing analyses have revealed a common mutation within the MYD88 gene (MYD88 L265P ) occurring at high frequencies in many non-Hodgkin lymphomas (NHLs) including the rare lymphoplasmacytic lymphoma, Waldenström's macroglobulinemia (WM). Using whole-exome sequencing, Sanger sequencing and allele-specific PCR, we validate the initial studies and detect the MYD88 L265P mutation in the tumor genome of 97% of WM patients analyzed (n=39). Due to the high frequency of MYD88 mutation in WM and other NHL, and its known effects on malignant B-cell survival, therapeutic targeting of MYD88 signaling pathways may be clinically useful. However, we are lacking a thorough characterization of the role of intermediary signaling proteins on the biology of MYD88 L265P -expressing B cells. We report here that MYD88 L265P signaling is constitutively active in both WM and diffuse large B-cell lymphoma cells leading to heightened MYD88 L265P , IRAK and TRAF6 oligomerization and NF-κB activation. Furthermore, we have identified the signaling protein, TAK1, to be an essential mediator of MYD88 L265P -driven signaling, cellular proliferation and cytokine secretion in malignant B cells. Our studies highlight the biological significance of MYD88 L265P in NHL and reveal TAK1 inhibition to be a potential therapeutic strategy for the treatment of WM and other diseases characterized by MYD88 L265P

  9. Decreased serum level of HMGB1 and MyD88 during human aging progress in healthy individuals.

    Science.gov (United States)

    Fu, Guo-Xiang; Chen, Alex F; Zhong, Yuan; Zhao, Jian; Gu, Ying-Jia

    2016-04-01

    Previous studies have suggested that high mobility group box-1 protein (HMGB1) binds to the toll-like receptor 4 (TLR4) signaling mediates the progression of various inflammatory diseases. But the roles of HMGB1 and TLR4 in aging remain poorly unknown. In this study, we aimed to investigate the serum levels of HMGB1 and myeloid differentiation factor 88 (MyD88), which is one of TLR4's intracellular adaptor proteins during human aging process and their relevance with cathepsin B (CTSB). This research was conducted using the blood samples provided by healthy people (n = 90, 63 men and 27 women). Subjects were subdivided into groups with respect to age: young (about 25 years old, n = 30), middle age (about 40 years old, n = 30), and aged (above 65 years old, n = 30). Altered serum levels of HMGB1, MyD88 and CTSB were measured using an enzyme-linked immunosorbent assay. The serum levels of HMGB1 and MyD88 were significantly decreased in the aged group compared with those in the young group. Linear regression analysis showed that HMGB1 and MyD88 positively correlated with CTSB among the whole healthy people. A negative correlation was determined between MyD88 and age. The serum levels of HMGB1 and MyD88 significantly decreased with age. MyD88, but not HMGB1, was negatively correlated with age.

  10. Andrographolide alleviates imiquimod-induced psoriasis in mice via inducing autophagic proteolysis of MyD88.

    Science.gov (United States)

    Shao, Fenli; Tan, Tao; Tan, Yang; Sun, Yang; Wu, Xingxin; Xu, Qiang

    2016-09-01

    Psoriasis is a chronic inflammatory skin disease with excessive activation of toll-like receptors (TLRs), which play important roles in developing psoriasis. Targeting TLR signaling remains a challenge for treating psoriasis. Here, we found that andrographolide (Andro), a small-molecule natural product, alleviated imiquimod- but not interleukin 23 (IL-23)-induced psoriasis in mice with reducing expressions of IL-23 and IL-1β in the skin. The improvement in imiquimod-induced psoriasis by Andro was not observed in microtubule-associated protein 1 light chain 3 beta (MAP1LC3B) knockout mice. Furthermore, Andro inhibited mRNA expressions of IL-23, IL-6 and IL-1β but not CD80 and CD86 in bone-marrow derived dendritic cells (BMDCs) treated with lipopolysaccharide (LPS) in a MAP1LC3B-dependent manner. In addition, Andro inhibited imiquimod-induced mRNA expressions of IL-23, IL-6, IL-1β, CD80 and CD86 in BMDCs from mice. Interestingly, Andro induced a degradation of myeloid differentiation factor 88 (MyD88) and blocked the recruitment of TNF receptor-associated factor 6 (TRAF6) to MyD88 upon LPS stimulation in BMDCs from mice. Blockade of autophagic proteolysis using NH4Cl or MAP1LC3B(-/-) BMDCs abolished the Andro-induced MyD88 degradation. In conclusion, Andro controls activation of MyD88-dependent cytokines and alleviates psoriasis in mice via inducing autophagic proteolysis of MyD88, which could be a novel strategy to treat psoriasis. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. IEC-TC88WG8 testing of rotor blades

    Energy Technology Data Exchange (ETDEWEB)

    Delft, D R.V. van [Delft Univ. of Technology, STEVIN Lab., Delft (Netherlands)

    1996-09-01

    In 1994 the TC88 of IEC installed a working group (WG8) to draft a guideline on blade testing. This paper gives a description of the task of the working group. Furthermore it gives a report of the progress of the work and summarizes the possible contents of the working group document on blade testing. (au)

  12. Sustainable practices and related performances at state highway agencies.

    Science.gov (United States)

    2010-12-01

    This report identifies seven ways in which an SHA can harm the environment: (1) excessive consumption of virgin materials; (2) unnecessary levels or amounts of storm water runoff; (3) release of environmental contaminants by SHA employees and conract...

  13. K88 Fimbrial Adhesin Targeting of Microspheres Containing Gentamicin Made with Albumin Glycated with Lactose

    Directory of Open Access Journals (Sweden)

    Andre-i Sarabia-Sainz

    2015-09-01

    Full Text Available The formulation and characterization of gentamicin-loaded microspheres as a delivery system targeting enterotoxigenic Escherichia coli K88 (E. coli K88 was investigated. Glycated albumin with lactose (BSA-glucose-β (4-1 galactose was used as the microsphere matrix (MS-Lac and gentamicin included as the transported antibiotic. The proposed target strategy was that exposed galactoses of MS-Lac could be specifically recognized by E. coli K88 adhesins, and the delivery of gentamicin would inhibit bacterial growth. Lactosylated microspheres (MS-Lac1, MS-Lac2 and MS-Lac3 were obtained using a water-in-oil emulsion, containing gentamicin, followed by crosslinking with different concentrations of glutaraldehyde. Electron microscopy displayed spherical particles with a mean size of 10–17 µm. In vitro release of gentamicin from MS-Lac was best fitted to a first order model, and the antibacterial activity of encapsulated and free gentamicin was comparable. MS-Lac treatments were recognized by plant galactose-specific lectins from Ricinus communis and Sophora japonica and by E. coli K88 adhesins. Results indicate MS-Lac1, produced with 4.2 mg/mL of crosslinker, as the best treatment and that lactosylated microsphere are promising platforms to obtain an active, targeted system against E. coli K88 infections.

  14. Gross motor function in children with spastic Cerebral Palsy and Cerebral Visual Impairment : A comparison between outcomes of the original and the Cerebral Visual Impairment adapted Gross Motor Function Measure-88 (GMFM-88-CVI)

    NARCIS (Netherlands)

    Salavati, M.; Rameckers, E. A. A.; Waninge, A.; Krijnen, W. P.; Steenbergen, B.; van der Schans, C. P.

    Purpose: To investigate whether the adapted version of the Gross Motor Function Measure 88 (GMFM-88) for children with Cerebral Palsy (CP) and Cerebral Visual Impairment (CVI) results in higher scores. This is most likely to be a reflection of their gross motor function, however it may be the result

  15. Servidor d'escriptoris remots

    OpenAIRE

    Cid Solé, Òscar

    2012-01-01

    El projecte que s'ha dut a terme és un estudi introductori del funcionament de la tecnologia NX fent ús d'una eina lliure com és FreeNX. Aquesta tecnologia està destinada a millorar el rendiment dels processos de comunicació que s'estableixen quan volem accedir a un escriptori remot. El resultat d'aquest estudi s'ha plasmat en un appliance que integra el servidor esmentat juntament amb una aplicació que s'ha desenvolupat per a la gestió d'escriptoris remots utilitzant el servidor FreeNX i els...

  16. Programación de un robot autónomo: diseño, construcción, programación e integración de un robot autónomo en el entorno Pyro

    OpenAIRE

    Dávila Molina, Antonio Jesús

    2007-01-01

    En aquest projecte, s'ha dissenyat, construït i programat un robot autònom, dotat de sistema de locomoció i sensors que li permeten navegar sense impactar en un entorn controlat. Per assolir aquests objectius s'ha dissenyat i programat una unitat de control que gestiona el hardware de baix volum de dades amb diferents modes d'operació, abstraient-lo en una única interfície. Posteriorment s'ha integrat aquest sistema en l'entorn de robòtica Pyro. Aquest entorn permet usar i adaptar, segons es ...

  17. Field-induced interplanar magnetic correlations in the high-temperature superconductor La1.88Sr0.12CuO4

    DEFF Research Database (Denmark)

    Rømer, A. T.; Jensen, P.; Jacobsen, H.

    2015-01-01

    We present neutron-scattering studies of the interplanar magnetic correlations in the high-temperature superconductor La1.88Sr0.12CuO4 (Tc=27 K). The correlations are studied both in a magnetic field applied perpendicular to the CuO2 planes, and in zero field under different cooling conditions. We...

  18. [Survival properties of ETEC surface-displayed K88ac-LT(B) on Lactobacillus casei].

    Science.gov (United States)

    Wei, Chunhua; Liu, Jiankui; Hou, Xilin; Wang, Guihua; Yu, Liyun

    2009-01-01

    K88ac-LT(B) gene derived from pQE30-K88ac-LT(B) was cloned into the expression vector pLA and then the recombinant vector was transformed into the competent cells Lactobacillus casei 525. The recombinant bacteria were grown at 37 degrees C, in MRS broth. Western blotting analysis with rabbit-anti-K88ac-LT(B) polyclonal serum indicated that the recombinant protein reacted with the specific antibodies. The results showed that the molecular weight of the recombinant protein was about 71.2 kD. The K88ac-LT(B) fusion protein on the cell surface was confirmed by immunofluorescence mciroscopy and flow cytometric analysis. In addition, the survival of recombinant Lactobacillus casei 525 was studied in imitative gastrointestinal environments such as artificial gastro fluid (pH 1.5-5.5), artificial intestinal fluid, bile(0.3-3.0 g/L). The results indicated that the recombinant strain survived well in artificial gastric fluids at pH 2.5-4.5 in 5 h. The recombinant Lactobacillus casei 525 could slowly grow in the artificial intestinal fluid for different time, and could survive in 0.3% bile.

  19. Regulator of calcineurin 1 differentially regulates TLR-dependent MyD88 and TRIF signaling pathways.

    Directory of Open Access Journals (Sweden)

    Zheng Pang

    Full Text Available Toll-like receptors (TLRs recognize the conserved molecular patterns in microorganisms and trigger myeloid differentiation primary response 88 (MyD88 and/or TIR-domain-containing adapter-inducing interferon-β (TRIF pathways that are critical for host defense against microbial infection. However, the molecular mechanisms that govern TLR signaling remain incompletely understood. Regulator of calcineurin-1 (RCAN1, a small evolutionarily conserved protein that inhibits calcineurin phosphatase activity, suppresses inflammation during Pseudomonas aeruginosa infection. Here, we define the roles for RCAN1 in P. aeruginosa lipopolysaccharide (LPS-activated TLR4 signaling. We compared the effects of P. aeruginosa LPS challenge on bone marrow-derived macrophages from both wild-type and RCAN1-deficient mice and found that RCAN1 deficiency increased the MyD88-NF-κB-mediated cytokine production (IL-6, TNF and MIP-2, whereas TRIF-interferon-stimulated response elements (ISRE-mediated cytokine production (IFNβ, RANTES and IP-10 was suppressed. RCAN1 deficiency caused increased IκBα phosphorylation and NF-κB activity in the MyD88-dependent pathway, but impaired ISRE activation and reduced IRF7 expression in the TRIF-dependent pathway. Complementary studies of a mouse model of P. aeruginosa LPS-induced acute pneumonia confirmed that RCAN1-deficient mice displayed greatly enhanced NF-κB activity and MyD88-NF-κB-mediated cytokine production, which correlated with enhanced pulmonary infiltration of neutrophils. By contrast, RCAN1 deficiency had little effect on the TRIF pathway in vivo. These findings demonstrate a novel regulatory role of RCAN1 in TLR signaling, which differentially regulates MyD88 and TRIF pathways.

  20. Desert dust induces TLR signaling to trigger Th2-dominant lung allergic inflammation via a MyD88-dependent signaling pathway

    International Nuclear Information System (INIS)

    He, Miao; Ichinose, Takamichi; Song, Yuan; Yoshida, Yasuhiro; Bekki, Kanae; Arashidani, Keiichi; Yoshida, Seiichi; Nishikawa, Masataka; Takano, Hirohisa; Shibamoto, Takayuki; Sun, Guifan

    2016-01-01

    Asian sand dust (ASD) is known to exacerbate asthma, although its mechanism is not yet well understood. In this study, when the effects on inflammatory response by LPS present in ASD was investigated by measuring the gene expression of cytokines and chemokines in RAW264.7 cells treated with ASD and/or polymyxin B (PMB), the ASD effects were attenuated by PMB, but not completely. When an in vitro study was performed using bone marrow-derived macrophages (BMDMs) from WT, TLR2 −/− , TLR4 −/− , and MyD88 −/− BALB/c mice and BMDMs from WT, TLR2 −/− , TLR4 −/− , TLR2/4 −/− , TLR7/9 −/− , and MyD88 −/− C57BL/6J mice, cytokine (IL-6, IL-12) production in BMDMs was higher in ASD-stimulated TLR2 −/− cells than in TLR4 −/− cells, whereas it was lower or undetectable in TLR2/4 −/− and MyD88 −/− cells. These results suggest that ASD causes cytokine production predominantly in a TLR4/MyD88-dependent pathway. When WT and TLRs 2 −/− , 4 −/− , and MyD88 −/− BALB/c mice were intratracheally challenged with OVA and/or ASD, ASD caused exacerbation of lung eosinophilia along with Th2 cytokine and eosinophil-relevant chemokine production. Serum OVA-specific IgE and IgG1 similar to WT was observed in TLRs 2 −/− , 4 −/− mice, but not in MyD88 −/− mice. The Th2 responses in TLR2 −/− mice were attenuated remarkably by PMB. These results indicate that ASD exacerbates lung eosinophilia in a MyD88-dependent pathway. TLRs 2 and 4 signaling may be important in the increase in lung eosinophilia. Also, the TLR4 ligand LPS and TLR2 ligand like β-glucan may be strong candidates for exacerbation of lung eosinophilia. - Highlights: • ASD enhanced Th2 response in TLR2 −/− , TLR4 −/− and WT mice, but not in MyD88 −/− . • Th2 responses in TLR2 −/− mice were attenuated by LPS inhibitor polymyxin B. • TLR2 and TLR4 signaling is important in allergic lung disease aggravation by ASD. • MyD88 is the key

  1. Unusual effects of manual grinding and subsequent annealing process observed in Gd5.09Ge2.03Si1.88 compound

    Science.gov (United States)

    Carvalho, A. M. G.; Alves, C. S.; Trevizoli, P. V.; dos Santos, A. O.; Gama, S.; Coelho, A. A.

    2018-03-01

    The Gd5.09Ge2.03Si1.88 compound, as well as other magnetocaloric materials, certainly will not be used in their un-manufactured as-cast condition in future magnetic refrigeration applications or other devices. In this work, we have studied the Gd5.09Ge2.03Si1.88 compound processed in different ways, mainly, the as-cast powder, the annealed powder, and the pressed and sintered powder. The annealed powder (1370 K/20 h) does not present the monoclinic phase and the first-order magneto-structural transition observed in the as-cast powder. The pressed and sintered powder also do not present the first-order transition. Furthermore, the compacting pressure shifts the second-order magnetic transition to lower temperatures. The behavior of cell parameters as a function of the compacting pressure indicates that T C is directly affected by parameter c change.

  2. 40 CFR 81.88 - Billings Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... Quality Control Regions § 81.88 Billings Intrastate Air Quality Control Region. The Metropolitan Billings Intrastate Air Quality Control Region (Montana) has been renamed the Billings Intrastate Air Quality Control... to by Montana authorities as follows: Sec. 481.168Great Falls Intrastate Air Quality Control Region...

  3. A D'-type symbiotic binary in the planetary nebula SMP LMC 88

    Science.gov (United States)

    Iłkiewicz, Krystian; Mikołajewska, Joanna; Miszalski, Brent; Kozłowski, Szymon; Udalski, Andrzej

    2018-05-01

    SMP LMC 88 is one of the planetary nebulae (PNe) in the Large Magellanic Cloud. We identify in its spectrum Raman scattered O VI lines at 6825 and 7083 Å. This unambiguously classifies the central object of the nebula as a symbiotic star (SySt). We identified the cold component to be a K-type giant, making this the first D'-type (yellow) SySt discovered outside the Galaxy. The photometric variability in SMP LMC 88 resembles the orbital variability of Galactic D'-type SySt with its low amplitude and sinusoidal light-curve shape. The SySt classification is also supported by the He I diagnostic diagram.

  4. Geothermal resource assessment of western San Luis Valley, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Zacharakis, Ted G.; Pearl, Richard Howard; Ringrose, Charles D.

    1983-01-01

    The Colorado Geological Survey initiated and carried out a fully integrated assessment program of the geothermal resource potential of the western San Luis Valley during 1979 and 1980. The San Luis Valley is a large intermontane basin located in southcentral Colorado. While thermal springs and wells are found throughout the Valley, the only thermal waters found along the western part of the Valley are found at Shaw Warm Springs which is a relatively unused spring located approximately 6 miles (9.66 km) north of Del Norte, Colorado. The waters at Shaws Warm Spring have a temperature of 86 F (30 C), a discharge of 40 gallons per minute and contain approximately 408 mg/l of total dissolved solids. The assessment program carried out din the western San Luis Valley consisted of: soil mercury geochemical surveys; geothermal gradient drilling; and dipole-dipole electrical resistivity traverses, Schlumberger soundings, Audio-magnetotelluric surveys, telluric surveys, and time-domain electro-magnetic soundings and seismic surveys. Shaw Warm Springs appears to be the only source of thermal waters along the western side of the Valley. From the various investigations conducted the springs appear to be fault controlled and is very limited in extent. Based on best evidence presently available estimates are presented on the size and extent of Shaw Warm Springs thermal system. It is estimated that this could have an areal extent of 0.63 sq. miles (1.62 sq. km) and contain 0.0148 Q's of heat energy.

  5. Mouse-hamster chimeric prion protein (PrP) devoid of N-terminal residues 23-88 restores susceptibility to 22L prions, but not to RML prions in PrP-knockout mice.

    Science.gov (United States)

    Uchiyama, Keiji; Miyata, Hironori; Yano, Masashi; Yamaguchi, Yoshitaka; Imamura, Morikazu; Muramatsu, Naomi; Das, Nandita Rani; Chida, Junji; Hara, Hideyuki; Sakaguchi, Suehiro

    2014-01-01

    Prion infection induces conformational conversion of the normal prion protein PrPC, into the pathogenic isoform PrPSc, in prion diseases. It has been shown that PrP-knockout (Prnp0/0) mice transgenically reconstituted with a mouse-hamster chimeric PrP lacking N-terminal residues 23-88, or Tg(MHM2Δ23-88)/Prnp 0/0 mice, neither developed the disease nor accumulated MHM2ScΔ23-88 in their brains after inoculation with RML prions. In contrast, RML-inoculated Tg(MHM2Δ23-88)/Prnp 0/+ mice developed the disease with abundant accumulation of MHM2ScΔ23-88 in their brains. These results indicate that MHM2Δ23-88 itself might either lose or greatly reduce the converting capacity to MHM2ScΔ23-88, and that the co-expressing wild-type PrPC can stimulate the conversion of MHM2Δ23-88 to MHM2ScΔ23-88 in trans. In the present study, we confirmed that Tg(MHM2Δ23-88)/Prnp 0/0 mice remained resistant to RML prions for up to 730 days after inoculation. However, we found that Tg(MHM2Δ23-88)/Prnp 0/0 mice were susceptible to 22L prions, developing the disease with prolonged incubation times and accumulating MHM2ScΔ23-88 in their brains. We also found accelerated conversion of MHM2Δ23-88 into MHM2ScΔ23-88 in the brains of RML- and 22L-inoculated Tg(MHM2Δ23-88)/Prnp 0/+ mice. However, wild-type PrPSc accumulated less in the brains of these inoculated Tg(MHM2Δ23-88)/Prnp 0/+ mice, compared with RML- and 22L-inoculated Prnp 0/+ mice. These results show that MHM2Δ23-88 itself can convert into MHM2ScΔ23-88 without the help of the trans-acting PrPC, and that, irrespective of prion strains inoculated, the co-expressing wild-type PrPC stimulates the conversion of MHM2Δ23-88 into MHM2ScΔ23-88, but to the contrary, the co-expressing MHM2Δ23-88 disturbs the conversion of wild-type PrPC into PrPSc.

  6. Novel behavior of heat of micellization of pluronics F68 and F88 in aqueous solutions.

    Science.gov (United States)

    Tsui, Hung-Wei; Hsu, Ya-Huei; Wang, Jing-Han; Chen, Li-Jen

    2008-12-16

    It is well understood that the heat of micellization for surfactants is monotonically decreased along with an increase in temperature. However, this behavior for polymeric surfactants has never been carefully examined. In this study, the heat of micellization of poly(ethylene oxide)-poly(propylene oxide)-poly(ethylene oxide) (PEO-PPO-PEO) triblock copolymers (Pluronics F68 and F88) in water as a function of temperature is carefully examined by using a high-sensitivity differential scanning calorimeter (HSDSC). The critical micelle temperature (CMT) decreases along with an increase in the concentration of Pluronic F68 (or F88). The heat of micellization decreases along with an increase in the temperature, as expected, when the CMT is higher than 55 and 42 degrees C for Pluronics F68 and F88, respectively. It is interesting to observe that the heat of micellization increases along with the temperature while the temperature is below 55 and 42 degrees C for Pluronics F68 and F88, respectively. The enthalpy-entropy compensation phenomenon for the micellization of Pluronics F68 and F88 in connection with the hydrophobicity is discussed.

  7. Modulation of spin-orbit torque efficiency by thickness control of heavy metal layers in Co/Pt multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Sethi, P.; Krishnia, S.; Li, S.H.; Lew, W.S., E-mail: wensiang@ntu.edu.sg

    2017-03-15

    We investigate and quantify spin-orbit torque (SOT) strength by current induced effective in-plane magnetic fields and spin Hall angle (SHA) using AC harmonic Hall voltage measurements techniques on Ta/Pt/Co/Pt/Co/Ta thin film structures. The proposed Co/Pt thin film double stack gives property enhancement on thermal stability and perpendicular magnetization anisotropy strength over the single stack Pt/Co/Ta. In the proposed Co/Pt double stack we observed that increasing the Ta capping thickness to three times enhances the SHA in similar order, consistent with larger spin injection efficiency. Doubling the Pt spacer layer thickness reduces the SHA by nearly 1.4 times, due to partial cancellation of SOT by bottom layer Pt, negating the increase from the top Co/Pt interface. The in-plane current threshold for magnetization switching is lower with the increase of the SHA.

  8. Human Aspects of Library Automation: Helping Staff and Patrons Cope. Papers presented at the Annual Clinic on Library Applications of Data Processing (22nd, Urbana, Illinois, April 14-16, 1985).

    Science.gov (United States)

    Shaw, Debora, Ed.

    This collection explores the human aspect of the automation and reautomation of library functions as both library staff and library users are expected to adapt to and use computers. A brief introduction by Debora Shaw sets the stage for the following papers: (1) "Terminal Paralysis, or Showdown at the Interface" (Sara Fine); (2)…

  9. Comparative genomics of citric-acid producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, Mikael R.; Salazar, Margarita; Schaap, Peter; van de Vondervoort, Peter; Culley, David E.; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristian F.; Albang, Richard; Albermann, Kaj; Berka, Randy; Braus, Gerhard; Braus-Stromeyer, Susanna A.; Corrochano, Luis; Dai, Ziyu; van Dijck, Piet; Hofmann, Gerald; Lasure, Linda L.; Magnuson, Jon K.; Menke, Hildegard; Meijer, Martin; Meijer, Susan; Nielsen, Jakob B.; Nielsen, Michael L.; van Ooyen, Albert; Pel, Herman J.; Poulsen, Lars; Samson, Rob; Stam, Hein; Tsang, Adrian; van den Brink, Johannes M.; ATkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Grigoriev, Igor V.; Kubicek, Christian P.; Martinez, Diego; van Peij, Noel; Roubos, Johannes A.; Nielsen, Jens B.; Baker, Scott E.

    2011-06-01

    The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compels additional exploration. We therefore undertook whole genome sequencing of the acidogenic A. niger wild type strain (ATCC 1015), and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was utilized to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 megabase of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis revealed up-regulation of the electron transport chain, specifically the alternative oxidative pathway in ATCC 1015, while CBS 513.88 showed significant up regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases and protein transporters.

  10. Report on CLEO'88, (2)

    International Nuclear Information System (INIS)

    Nakai, Sadao; Yamada, Toshitaka; Ishikawa, Ken.

    1988-01-01

    High power laser technology achieves spectacular development with the advance of nuclear fusion research and the development of the lasers for nuclear fusion. This technology heightens the level of advanced technologies and expands the frontier while deeply related with the industrial technology applying lasers. As to the report on laser nuclear fusion in CLEO '88, the lectures by the persons from Lawrence Livermore National Laboratory, Osaka University and Rochester University showed the recent advance and results regarding implosion, that is, direct irradiation implosion, indirect irradiation implosion and so on. The move on laser nuclear fusion has grown tense, and the situation to powerfully promote nuclear fusion ignition, break-even plan and the plan of realizing high gain has arisen dur to the results of ataining high density compression and stable high rate of contraction, high neutron yield and pellet gain. The new technology of solid lasers achieved remarkable development. As to laser processing, alloying, hardening, cutting and so on were reported. With a Nd-YAG laser, Toshiba Corp. obtained 1.56 kW, which was its maximum. (Kako, I.)

  11. Microwave Palaeointensity Experiments On Terrestrial and Martian Material

    Science.gov (United States)

    Shaw, J.; Hill, M.; Gratton, M.

    The microwave palaeointensity technique was developed in Liverpool University (Walton et al 1996) and has successfully been applied to archaeological ceramics and recent lavas (Shaw et al 1996, 1999.; Hill et al 1999,2000). These published results show that microwave analysis provides accurate palaeointensity determinations com- bined with a very high success rate. Most recently the technique has been successfully applied to Martian material (Shaw et al, 2001) to look for the existence of an internal Martian dynamo early in Martian history. New experiments have been carried out us- ing microwaves to demagnetise synthetic muti-component TRM's and new palaeoin- tensity experiments providing a comparison between microwave analysis of laboratory TRM's and conventional thermal Thellier analysis of microwave generated mTRM's. These experiments demonstrate the equivalence of microwave and thermally gener- ated TRM's. D. Walton, S Snape, T.C. Rolph, J. Shaw and J.A. Share, Application of ferromagnetic resonance heating to palaeointensity determinations.1996, Phys Earth Planet Int,94, 183-186. J. Shaw, D. Walton, S Yang, T.C.Rolph, and J.A. Share. Microwave Archaeointensities from Peruvian Ceramics. 1996, Geophys. J. Int,124,241-244 J. Shaw, S. Yang, T. C. Rolph, and F. Y. Sun. A comparison of archaeointensity results from Chinese ceramics using Microwave and conventional ThellierSs and ShawSs methods.,1999, G J Int.136, 714-718 M. Hill, and J. Shaw, 1999, Palaeointensity results for Historic Lavas from Mt. Etna using microwave demagnetisation/remagnetisation in a modified Thellier type exper- iment. G. J. Int, 139, 583-590 M. J. Hill, and J. Shaw, 2000. Magnetic field intensity study of the 1960 Kilauea lava flow, Hawaii, using the microwave palaeointensity technique, Geophys. J. Int., 142, 487-504. J. Shaw, M. Hill, and S. J. Openshaw, 2001, Investigating the ancient Martian magnetic field using microwaves, Earth and Planetary Science Letters 190 (2001) 103-109

  12. Earthquake Hazard Assessment: an Independent Review

    Science.gov (United States)

    Kossobokov, Vladimir

    2016-04-01

    Seismic hazard assessment (SHA), from term-less (probabilistic PSHA or deterministic DSHA) to time-dependent (t-DASH) including short-term earthquake forecast/prediction (StEF), is not an easy task that implies a delicate application of statistics to data of limited size and different accuracy. Regretfully, in many cases of SHA, t-DASH, and StEF, the claims of a high potential and efficiency of the methodology are based on a flawed application of statistics and hardly suitable for communication to decision makers. The necessity and possibility of applying the modified tools of Earthquake Prediction Strategies, in particular, the Error Diagram, introduced by G.M. Molchan in early 1990ies for evaluation of SHA, and the Seismic Roulette null-hypothesis as a measure of the alerted space, is evident, and such a testing must be done in advance claiming hazardous areas and/or times. The set of errors, i.e. the rates of failure and of the alerted space-time volume, compared to those obtained in the same number of random guess trials permits evaluating the SHA method effectiveness and determining the optimal choice of the parameters in regard to specified cost-benefit functions. These and other information obtained in such a testing may supply us with a realistic estimate of confidence in SHA results and related recommendations on the level of risks for decision making in regard to engineering design, insurance, and emergency management. These basics of SHA evaluation are exemplified with a few cases of misleading "seismic hazard maps", "precursors", and "forecast/prediction methods".

  13. Disproportionately severe calcinosis cutis in an 88-year-old patient with CREST syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Buchowski, J.M.; Ahn, N.U.; Ahn, U.M. [Dept. of Orthopaedic Surgery, Johns Hopkins Univ. School of Medicine, Baltimore, MD (United States); McCarthy, E.F. [Dept. of Orthopaedic Surgery, Johns Hopkins Univ. School of Medicine, Baltimore, MD (United States); Dept. of Pathology, Johns Hopkins University School of Medicine, Baltimore, MD (United States); Mehta, M.B. [Clinical Associates, Good Samaritan Hospital, Baltimore, MD (United States)

    2001-08-01

    An 88-year-old woman with CREST syndrome (calcinosis, Raynaud's phenomenon, esophageal dysmotility, sclerodactyly, and telangiectasias) presented with hyperglycemia, intravascular depletion, and atrial fibrillation. The patient was found to have unusually severe calcinosis cutis in both legs extending from the knees to the ankles bilaterally, as well as Raynaud's phenomenon, sclerodactyly, and telangiectasias. The patient was normocalcemic and normophosphatemic. Although subcutaneous calcification is often seen with CREST syndrome, this case is unusual in that the area of involvement was much larger than previously described. Furthermore, the amount of calcinosis was disproportionately severe and was the major cause of symptoms and disability compared with the other components of the syndrome. (orig.)

  14. Annual report 1987-88

    International Nuclear Information System (INIS)

    1988-01-01

    The annual report of the Department of Atomic Energy (India) for the financial year 1987-88 describes: (1) Research and Development (R and D) activities of its research establishments, namely, the Bhabha Atomic Research Centre, Bombay; the Indira Gandhi Centre for Atomic Research, Kalpakkam and the Centre for Advanced Technology, Indore; and of almost fully funded research institutions, namely, the Tata Institute of Fundamental Research, Bombay; Tata Memorial Centre, Bombay; Saha Institute of Nuclear Physics, Calcutta; and Institute of Physics, Bhubaneshwar; (2) performance of nuclear power stations at Tarapur, Rawatbhata and Kalpakkam, various heavy water plants around the country, the Nuclear Fuel Complex, Hyderabad, fuel reprocessing plants, (3) exploration work for atomic minerals, (4) regulatory and safety functions, (5) performance of public sector undertakings, namely, Indian Rare Earths Ltd., Electronics Corporation of India Ltd., and Uranium Corporation of India Ltd., (6) other activities including international relations, financial assistance to research schemes in science and engineering etc. During the year, the Nuclear Power Board was converted into Nuclear Power Corporation (NPC) of India Ltd. with the objectives of managing the nuclear power stations on commercial lines and raising finance from the public for its projects. The Board of Radiation and Isotope Technology (BRIT) was set up to promote radiation technology on a commercial basis in the country. (M.G.B.). Coloured pictures

  15. Superconducting fluctuation effect in CaFe0.88Co0.12AsF

    Science.gov (United States)

    Xiao, H.; Gao, B.; Ma, Y. H.; Li, X. J.; Mu, G.; Hu, T.

    2016-11-01

    Out-of-plane angular dependent torque measurements were performed on CaFe0.88Co0.12AsF single crystals. Superconducting fluctuations, featured by magnetic field enhanced and exponential temperature dependent diamagnetism, are observed above the superconducting transition temperature T c, which is similar to that of cuprate superconductors, but less pronounced. In addition, the ratio of T c versus superfluid density follows well the Uemura line of high-T c cuprates, which suggests the exotic nature of the superconductivity in CaFe0.88Co0.12AsF.

  16. Moral Responsibility and Legal Liability, or, Ethics Drives the Law

    Science.gov (United States)

    McGowan, Richard J.; Buttrick, Hilary G.

    2015-01-01

    As William Shaw's (2008) textbook states, by way of observation, "To a significant extent, law codifies a society's customs, ideals, norms, and moral values" (pp. 10-11). Shaw adds that "changes in the law tend to reflect changes in what a society takes to be right and wrong…" (p. 11). We think Shaw is correct, and we work to…

  17. IL-1R and MyD88 signalling in CD4+ T cells promote Th17 immunity and atherosclerosis.

    Science.gov (United States)

    Engelbertsen, Daniel; Rattik, Sara; Wigren, Maria; Vallejo, Jenifer; Marinkovic, Goran; Schiopu, Alexandru; Björkbacka, Harry; Nilsson, Jan; Bengtsson, Eva

    2018-01-01

    The role of CD4+ T cells in atherosclerosis has been shown to be dependent on cytokine cues that regulate lineage commitment into mature T helper sub-sets. In this study, we tested the roles of IL-1R1 and MyD88 signalling in CD4+ T cells in atherosclerosis. We transferred apoe-/-myd88+/+ or apoe-/-myd88-/- CD4+ T cells to T- and B-cell-deficient rag1-/-apoe-/- mice fed high fat diet. Mice given apoe-/-myd88-/- CD4+ T cells exhibited reduced atherosclerosis compared with mice given apoe-/-myd88+/+ CD4+ T cells. CD4+ T cells from apoe-/-myd88-/- produced less IL-17 but similar levels of IFN-γ. Treatment of human CD4+ T cells with a MyD88 inhibitor inhibited IL-17 secretion in vitro. Transfer of il1r1-/- CD4+ T cells recapitulated the phenotype seen by transfer of myd88-/- CD4+ T cells with reduced lesion development and a reduction in Th17 and IL-17 production compared with wild type CD4+ T cell recipients. Relative collagen content of lesions was reduced in mice receiving il1r1-/- CD4+ T cells. We demonstrate that both IL1R and MyD88 signalling in CD4+ T cells promote Th17 immunity, plaque growth and may regulate plaque collagen levels. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2017. For permissions please email: journals.permissions@oup.com.

  18. Sandwich hybridization probes for the detection of Pseudo-nitzschia (Bacillariophyceae) species: An update to existing probes and a description of new probes.

    Science.gov (United States)

    Bowers, Holly A; Marin, Roman; Birch, James M; Scholin, Christopher A

    2017-12-01

    New sandwich hybridization assay (SHA) probes for detecting Pseudo-nitzschia species (P. arenysensis, P. fraudulenta, P. hasleana, P. pungens) are presented, along with updated cross-reactivity information on historical probes (SHA and FISH; fluorescence in situ hybridization) targeting P. australis and P. multiseries. Pseudo-nitzschia species are a cosmopolitan group of diatoms that produce varying levels of domoic acid (DA), a neurotoxin that can accumulate in finfish and shellfish and transfer throughout the food web. Consumption of infected food sources can lead to illness in humans (amnesic shellfish poisoning; ASP) and marine wildlife (domoic acid poisoning; DAP). The threat of human illness, along with economic loss from fishery closures has resulted in the implementation of monitoring protocols and intensive ecological studies. SHA probes have been instrumental in some of these efforts, as the technique performs well in complex heterogeneous sample matrices and has been adapted to benchtop and deployable (Environmental Sample Processor) platforms. The expanded probe set will enhance future efforts towards understanding spatial, temporal and successional patterns in species during bloom and non-bloom periods. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Precise determination of δ88Sr in rocks, minerals, and waters by double-spike TIMS: A powerful tool in the study of chemical, geologic, hydrologic and biologic processes

    Science.gov (United States)

    Neymark, Leonid A.; Premo, Wayne R.; Mel'nikov, Nikolay N.; Emsbo, Poul

    2014-01-01

    We present strontium isotopic (88Sr/86Sr and 87Sr/86Sr) results obtained by 87Sr–84Sr double spike thermal ionization mass-spectrometry (DS-TIMS) for several standards as well as natural water samples and mineral samples of abiogenic and biogenic origin. The detailed data reduction algorithm and a user-friendly Sr-specific stand-alone computer program used for the spike calibration and the data reduction are also presented. Accuracy and precision of our δ88Sr measurements, calculated as permil (‰) deviations from the NIST SRM-987 standard, were evaluated by analyzing the NASS-6 seawater standard, which yielded δ88Sr = 0.378 ± 0.009‰. The first DS-TIMS data for the NIST SRM-607 potassium feldspar standard and for several US Geological Survey carbonate, phosphate, and silicate standards (EN-1, MAPS-4, MAPS-5, G-3, BCR-2, and BHVO-2) are also reported. Data obtained during this work for Sr-bearing solids and natural waters show a range of δ88Sr values of about 2.4‰, the widest observed so far in terrestrial materials. This range is easily resolvable analytically because the demonstrated external error (±SD, standard deviation) for measured δ88Sr values is typically ≤0.02‰. It is shown that the “true” 87Sr/86Sr value obtained by the DS-TIMS or any other external normalization method combines radiogenic and mass-dependent mass-fractionation effects, which cannot be separated. Therefore, the “true” 87Sr/86Sr and the δ87Sr parameter derived from it are not useful isotope tracers. Data presented in this paper for a wide range of naturally occurring sample types demonstrate the potential of the δ88Sr isotope tracer in combination with the traditional radiogenic 87Sr/86Sr tracer for studying a variety of biological, hydrological, and geological processes.

  20. Hydroxyapatite from fish scale for potential use as bone scaffold or regenerative material

    Energy Technology Data Exchange (ETDEWEB)

    Pon-On, Weeraphat, E-mail: fsciwpp@ku.ac.th [Department of Physics, Faculty of Science, Kasetsart University, Bangkok (Thailand); Suntornsaratoon, Panan [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Charoenphandhu, Narattaphol [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Department of Physiology, Faculty of Science, Mahidol University, Bangkok (Thailand); Thongbunchoo, Jirawan [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Krishnamra, Nateetip [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Department of Physiology, Faculty of Science, Mahidol University, Bangkok (Thailand); Tang, I. Ming [Department of Materials Science, Faculty of Science, Kasetsart University, Bangkok 10900 (Thailand)

    2016-05-01

    The present paper studies the physico-chemical, bioactivity and biological properties of hydroxyapatite (HA) which is derived from fish scale (FS) (FSHA) and compares them with those of synthesized HA (sHA) obtained by co-precipitation from chemical solution as a standard. The analysis shows that the FSHA is composed of flat-plate nanocrystal with a narrow width size of about 15–20 nm and having a range of 100 nm in length and that the calcium phosphate ratio (Ca/P) is 2.01 (Ca-rich CaP). Whereas, synthesized HA consists of sub-micron HA particle having a Ca/P ratio of 1.65. Bioactivity test shows that the FSHA forms more new apatite than does the sHA after being incubated in simulated body fluid (SBF) for 7 days. Moreover, the biocompatibility study shows a higher osteoblast like cell adhesion on the FSHA surface than on the sHA substrate after 3 days of culturing. Our results also show the shape of the osteoblast cells on the FSHA changes from being a rounded shape to being a flattened shape reflecting its spreading behavior on this surface. MTT assay and ALP analysis show significant increases in the proliferation and activity of osteoblasts over the FSHA scaffold after 5 days of culturing as compared to those covering the sHA substrates. These results confirm that the bio-materials derived from fish scale (FSHA) are biologically better than the chemically synthesized HA and have the potential for use as a bone scaffold or as regenerative materials. - Highlights: • Preparation of hydroxyapatite (HA) which is derived from fish scale (FS) (FSHA) and their bioactivities • The FSHA is composed of flat-plate nanocrystal with a narrow size of 15–20 nm. • Bioactivity test shows that the FSHA forms more new apatite than does the sHA after being incubated SBF. • In vitro cell availability tests show a higher cell adhesion on the FSHA surface.

  1. Desarrollo de una interfaz gráfica mediante Galaxy para Qiime

    OpenAIRE

    Navas Molina, Jose Antonio

    2012-01-01

    En aquest projecte s'ha desenvolupat un paquet Python que permet la integració del pipeline QIIME a la plataforma Galaxy de forma automàtica. També s'ha replicat la pàgina web FastUniFrac utilitzant scripts de QIIME integrats en Galaxy.

  2. Desert dust induces TLR signaling to trigger Th2-dominant lung allergic inflammation via a MyD88-dependent signaling pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Miao, E-mail: hemiao@mail.cmu.edu.cn [Environment and Non-communicable Disease Research Center, School of Public Health, China Medical University, Shenyang 110122 (China); Ichinose, Takamichi, E-mail: ichinose@oita-nhs.ac.jp [Department of Health Sciences, Oita University of Nursing and Health Sciences, Oita 870-1201 (Japan); Song, Yuan; Yoshida, Yasuhiro [Department of Immunology and Parasitology, School of Medicine, University of Occupational and Environmental Health, Fukuoka 807-8555 (Japan); Bekki, Kanae [Department of Environmental Health, National Institute of Public Health, Saitama 351-0197 (Japan); Arashidani, Keiichi [Department of Immunology and Parasitology, School of Medicine, University of Occupational and Environmental Health, Fukuoka 807-8555 (Japan); Yoshida, Seiichi [Department of Health Sciences, Oita University of Nursing and Health Sciences, Oita 870-1201 (Japan); Nishikawa, Masataka [Environmental Chemistry Division, National Institute for Environmental Studies, Ibaraki 305-8506 (Japan); Takano, Hirohisa [Environmental Health Division, Department of Environmental Engineering, Graduate School of Engineering, Kyoto University, Kyoto 615-8530 (Japan); Shibamoto, Takayuki [Department of Environmental Toxicology, University of California, Davis, CA 95616, USA. (United States); Sun, Guifan [Environment and Non-communicable Disease Research Center, School of Public Health, China Medical University, Shenyang 110122 (China)

    2016-04-01

    Asian sand dust (ASD) is known to exacerbate asthma, although its mechanism is not yet well understood. In this study, when the effects on inflammatory response by LPS present in ASD was investigated by measuring the gene expression of cytokines and chemokines in RAW264.7 cells treated with ASD and/or polymyxin B (PMB), the ASD effects were attenuated by PMB, but not completely. When an in vitro study was performed using bone marrow-derived macrophages (BMDMs) from WT, TLR2{sup −/−}, TLR4{sup −/−}, and MyD88{sup −/−} BALB/c mice and BMDMs from WT, TLR2{sup −/−}, TLR4{sup −/−}, TLR2/4{sup −/−}, TLR7/9{sup −/−}, and MyD88{sup −/−} C57BL/6J mice, cytokine (IL-6, IL-12) production in BMDMs was higher in ASD-stimulated TLR2{sup −/−} cells than in TLR4{sup −/−} cells, whereas it was lower or undetectable in TLR2/4{sup −/−} and MyD88{sup −/−} cells. These results suggest that ASD causes cytokine production predominantly in a TLR4/MyD88-dependent pathway. When WT and TLRs 2{sup −/−}, 4{sup −/−}, and MyD88{sup −/−} BALB/c mice were intratracheally challenged with OVA and/or ASD, ASD caused exacerbation of lung eosinophilia along with Th2 cytokine and eosinophil-relevant chemokine production. Serum OVA-specific IgE and IgG1 similar to WT was observed in TLRs 2{sup −/−}, 4{sup −/−} mice, but not in MyD88{sup −/−} mice. The Th2 responses in TLR2{sup −/−} mice were attenuated remarkably by PMB. These results indicate that ASD exacerbates lung eosinophilia in a MyD88-dependent pathway. TLRs 2 and 4 signaling may be important in the increase in lung eosinophilia. Also, the TLR4 ligand LPS and TLR2 ligand like β-glucan may be strong candidates for exacerbation of lung eosinophilia. - Highlights: • ASD enhanced Th2 response in TLR2{sup −/−}, TLR4{sup −/−} and WT mice, but not in MyD88{sup −/−}. • Th2 responses in TLR2{sup −/−} mice were attenuated by LPS inhibitor polymyxin B. • TLR2

  3. Sepsis Induces Hematopoietic Stem Cell Exhaustion and Myelosuppression through Distinct Contributions of TRIF and MYD88

    Directory of Open Access Journals (Sweden)

    Huajia Zhang

    2016-06-01

    Full Text Available Toll-like receptor 4 (TLR4 plays a central role in host responses to bacterial infection, but the precise mechanism(s by which its downstream signaling components coordinate the bone marrow response to sepsis is poorly understood. Using mice deficient in TLR4 downstream adapters MYD88 or TRIF, we demonstrate that both cell-autonomous and non-cell-autonomous MYD88 activation are major causes of myelosuppression during sepsis, while having a modest impact on hematopoietic stem cell (HSC functions. In contrast, cell-intrinsic TRIF activation severely compromises HSC self-renewal without directly affecting myeloid cells. Lipopolysaccharide-induced activation of MYD88 or TRIF contributes to cell-cycle activation of HSC and induces rapid and permanent changes in transcriptional programs, as indicated by persistent downregulation of Spi1 and CebpA expression after transplantation. Thus, distinct mechanisms downstream of TLR4 signaling mediate myelosuppression and HSC exhaustion during sepsis through unique effects of MyD88 and TRIF.

  4. Phytochemical screening, total phenolics and antioxidant activities of bark and leaf extracts of Goniothalamus velutinus (Airy Shaw from Brunei Darussalam

    Directory of Open Access Journals (Sweden)

    Erum Iqbal

    2015-07-01

    Full Text Available Goniothalamus velutinus Airy Shaw belongs to the family Annonaceae which is known to have anticancer, antitumor and many other bioactivities. Natives of Sabah and Sarawak use root decoction of G. velutinus for the treatment of headache and food poisoning while the bark was used as a mosquito repellent. Bark and leaf extracts of this plant, obtained from Brunei Darussalam, were tested for phytochemical and antioxidant activities. Phytochemical screening of plant extracts revealed the presence of alkaloids, steroids, terpenoids and cardiac glycosides. Quantitative determination of total phenolics, total flavonoids, and various in vitro antioxidant activities (DPPH, ABTS and FRAP of methanolic extract was carried out using colorimetric methods. The total phenolic content, expressed as mg of gallic acid equivalent (GAE per gram of extract, was found to be 68 mg GAE/g and 78 mg GAE/g for bark and leaves respectively. The radical scavenging activity measurement, expressed in terms of EC50 (effective concentration of extract in μg/mL that reduces DPPH absorbance to 50% as compared to negative control, for leaf and bark extracts was found to be 155 μg/mL and 204 μg/mL respectively. Standards trolox and ascorbic acid show EC50 value of 5 μg/mL and 4 μg/mL respectively. Trolox equivalent antioxidant capacity (TEAC was measured using the ABTS and FRAP method. Result for bark and leaf extracts was 79 mg and 106 mg trolox equivalent (TE/g respectively for the ABTS method. For FRAP assay, results for bark and leaf extracts were 80 and 89 mg TE/g respectively.

  5. Hyaluronan signaling during ozone-induced lung injury requires TLR4, MyD88, and TIRAP.

    Directory of Open Access Journals (Sweden)

    Zhuowei Li

    Full Text Available Ozone exposure is associated with exacerbation of reactive airways disease. We have previously reported that the damage-associated molecular pattern, hyaluronan, is required for the complete biological response to ambient ozone and that hyaluronan fragments signal through toll-like receptor 4 (TLR4. In this study, we further investigated the role of TLR4 adaptors in ozone-induced airway hyperresponsiveness (AHR and the direct response to hyaluronan fragments (HA. Using a murine model of AHR, C57BL/6J, TLR4-/-, MyD88-/-, and TIRAP-/- mice were characterized for AHR after exposure to either ozone (1 ppm × 3 h or HA fragments. Animals were characterized for AHR with methacholine challenge, cellular inflammation, lung injury, and production of pro-inflammatory cytokines. Ozone-exposed C57BL/6J mice developed cellular inflammation, lung injury, pro-inflammatory cytokines, and AHR, while mice deficient in TLR4, MyD88 or TIRAP demonstrated both reduced AHR and reduced levels of pro-inflammatory cytokines including TNFα, IL-1β, MCP-1, IL-6 and KC. The level of hyaluronan was increased after inhalation of ozone in each strain of mice. Direct challenge of mice to hyaluronan resulted in AHR in C57BL/6J mice, but not in TLR4-/-, MyD88-/-, or TIRAP-/- mice. HA-induced cytokine production in wild-type mice was significantly reduced in TLR4-/-, MyD88-/-, or TIRAP-/- mice. In conclusion, our findings support that ozone-induced airway hyperresponsiveness is dependent on the HA-TLR4-MyD88-TIRAP signaling pathway.

  6. Journal of East African Natural History - Vol 88, No 1 (1999)

    African Journals Online (AJOL)

    Canthariphilous insects in east Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C Hemp, A Hemp, K Dettner, 1-15. http://dx.doi.org/10.2982/0012-8317(1999)88[1:CIIEA]2.0.CO;2 ...

  7. Comparative genomics of citric-acid-producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88

    Science.gov (United States)

    Andersen, Mikael R.; Salazar, Margarita P.; Schaap, Peter J.; van de Vondervoort, Peter J.I.; Culley, David; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristian F.; Albang, Richard; Albermann, Kaj; Berka, Randy M.; Braus, Gerhard H.; Braus-Stromeyer, Susanna A.; Corrochano, Luis M.; Dai, Ziyu; van Dijck, Piet W.M.; Hofmann, Gerald; Lasure, Linda L.; Magnuson, Jon K.; Menke, Hildegard; Meijer, Martin; Meijer, Susan L.; Nielsen, Jakob B.; Nielsen, Michael L.; van Ooyen, Albert J.J.; Pel, Herman J.; Poulsen, Lars; Samson, Rob A.; Stam, Hein; Tsang, Adrian; van den Brink, Johannes M.; Atkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Grigoriev, Igor V.; Kubicek, Christian P.; Martinez, Diego; van Peij, Noël N.M.E.; Roubos, Johannes A.; Nielsen, Jens; Baker, Scott E.

    2011-01-01

    The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compel additional exploration. We therefore undertook whole-genome sequencing of the acidogenic A. niger wild-type strain (ATCC 1015) and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence, and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was used to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 Mb of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis supported up-regulation of genes associated with biosynthesis of amino acids that are abundant in glucoamylase A, tRNA-synthases, and protein transporters in the protein producing CBS 513.88 strain. Our results and data sets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi. PMID:21543515

  8. Theoretical interpretation of the nuclear structure of 88Se within the ACM and the QPM models.

    Science.gov (United States)

    Gratchev, I. N.; Thiamova, G.; Alexa, P.; Simpson, G. S.; Ramdhane, M.

    2018-02-01

    The four-parameter algebraic collective model (ACM) Hamiltonian is used to describe the nuclear structure of 88Se. It is shown that the ACM is capable of providing a reasonable description of the excitation energies and relative positions of the ground-state band and γ band. The most probable interpretation of the nuclear structure of 88Se is that of a transitional nucleus. The Quasiparticle-plus-Phonon Model (QPM) was also applied to describe the nuclear motion in 88Se. Preliminarily calculations show that the collectivity of second excited state {2}2+ is weak and that this state contains a strong two-quasiparticle component.

  9. Green synthesis and evaluation of an iron-based metal-organic framework MIL-88B for efficient decontamination of arsenate from water.

    Science.gov (United States)

    Hou, Shuliang; Wu, Yi-Nan; Feng, Lingyu; Chen, Wei; Wang, Ying; Morlay, Catherine; Li, Fengting

    2018-02-13

    Iron-containing metal-organic frameworks (MOFs) have gradually emerged as environmentally benign alternatives for reducing the levels of environmental contamination because of their advantages, such as readily obtained raw materials with low cost, nontoxic metal source with good biocompatibility, and distinguished physicochemical features e.g., high porosity, framework flexibility, and semiconductor properties. In this study, we reported an innovative strategy for synthesizing an iron-based MOF, MIL-88B, at room temperature. The novelty of this strategy was the use of ethanol as solvent and the pretreatment of dry milling with neither the bulk use of a toxic organic solvent nor the addition of extremely dangerous hydrofluoric acid or strong alkali. The synthesized MIL-88B(Fe) was evaluated as a sorbent for removing arsenate in water and it exhibited high adsorption capacity (156.7 mg g -1 ) at a low dosage. The removal capacity of trace arsenate on MIL-88B(Fe) was 32.3 mg g -1 at a low equilibrium concentration (6.4 μg L -1 ), which satisfied the arsenic threshold for drinking water. The results of Fourier transform infrared and X-ray photoelectron spectroscopy indicated that the As(v) molecules bonded with the oxygen molecules, which were coordinated with FeO clusters in the framework. This work presented the potential use of the up-scaled MIL-88B as an excellent sorbent for purifying arsenate-contaminated water.

  10. STS-88 Day 10 Highlights

    Science.gov (United States)

    1998-01-01

    On this tenth day of the STS-88 mission, the flight crew, Commander Robert D. Cabana, Pilot Frederick W. Sturckow, and Mission Specialists Nancy J. Currie, James H. Newman, Jerry L. Ross, and Sergei Krikalev are awakened by the sounds of Elvis Presley's "Hound Dog". Today's activities are devoted mostly to tasks that ready the station for future assembly work. The crew's first job is to release some cable ties on four cables connected on an earlier space walk, three located on Unity's upper mating adapter and one on its lower adapter, to relieve tension on the lines. The space walkers also will check an insulation cover on one cable connection on the lower Pressurized Mating Adapter (PMA 2) to make sure it is fully installed. Near the end of the space walk, the astronauts conduct a detailed photographic survey of the space station from top to bottom. Finally, each astronaut test fires the Simplified Aid for Extravehicular Activity Rescue (SAFER) jet backpacks they are wearing, a type of space "lifejacket," that would allow an astronaut to fly back to the station if they should ever become untethered.

  11. MyD88 Adaptor Protein Is Required for Appropriate Hepcidin Induction in Response to Dietary Iron Overload in Mice

    Directory of Open Access Journals (Sweden)

    Antonio Layoun

    2018-03-01

    Full Text Available Iron homeostasis is tightly regulated to provide virtually all cells in the body, particularly red blood cells, with this essential element while defending against its toxicity. The peptide hormone hepcidin is central to the control of the amount of iron absorbed from the diet and iron recycling from macrophages. Previously, we have shown that hepcidin induction in macrophages following Toll-like receptor (TLR stimulation depends on the presence of myeloid differentiation primary response gene 88 (MyD88. In this study, we analyzed the regulation of iron metabolism in MyD88−/− mice to further investigate MyD88 involvement in iron sensing and hepcidin induction. We show that mice lacking MyD88 accumulate significantly more iron in their livers than wild-type counterparts in response to dietary iron loading as they are unable to appropriately control hepcidin levels. The defect was associated with inappropriately low levels of Smad4 protein and Smad1/5/8 phosphorylation in liver samples found in the MyD88−/− mice compared to wild-type mice. In conclusion, our results reveal a previously unknown link between MyD88 and iron homeostasis, and provide new insights into the regulation of hepcidin through the iron-sensing pathway.

  12. Bacteroides gingivalis-Actinomyces viscosus cohesive interactions as measured by a quantitative binding assay

    International Nuclear Information System (INIS)

    Schwarz, S.; Ellen, R.P.; Grove, D.A.

    1987-01-01

    There is limited evidence, mostly indirect, to suggest that the adherence of Bacteroides gingivalis to teeth may be enhanced by the presence of gram-positive dental plaque bacteria like Actinomyces viscosus. The purpose of this study was to carry out direct quantitative assessments of the cohesion of B gingivalis and A. viscosus by using an in vitro assay modeled on the natural sequence in which these two species colonize the teeth. The assay allowed comparisons to be made of the adherence of 3 H-labeled B. gingivalis 2561 and 381 to saliva-coated hydroxyapatite beads (S-HA) and A. viscosus WVU627- or T14V-coated S-HA (actinobeads) in equilibrium and kinetics binding studies. A series of preliminary binding studies with 3H-labeled A. viscosus and parallel studies by scanning electron microscopy with unlabeled A. viscosus were conducted to establish a protocol by which actinobeads suitable for subsequent Bacteroides adherence experiments could be prepared. By scanning electron microscopy, the actinobeads had only small gaps of exposed S-HA between essentially irreversibly bound A. viscosus cells. Furthermore, B. gingivalis cells appeared to bind preferentially to the Actinomyces cells instead of the exposed S-HA. B. gingivalis binding to both S-HA and actinobeads was saturable with at least 2 X 10(9) to 3 X 10(9) cells per ml, and equilibrium with saturating concentrations was reached within 10 to 20 min. B. gingivalis always bound in greater numbers to the actinobeads than to S-HA. These findings provide direct measurements supporting the concept that cohesion with dental plaque bacteria like A. viscosus may foster the establishment of B. gingivalis on teeth by enhancing its adherence

  13. Characteristics of Total Electron Content (TEC) observed from a chain of stations near the northern crest of the Equatorial Ionization Anomaly (EIA) along 88.5°E meridian in India

    Science.gov (United States)

    Paul, K. S.; Das, A.; Ray, S.; Paul, A.

    2016-01-01

    The equatorial ionosphere presents some of the highest TEC values in the world coupled with observations of periodic structures. Total Electron Content (TEC) and scintillation data were analyzed from a chain of stations Calcutta (22.58°N, 88.38°E geographic; 32°N magnetic dip), Baharampore (24.09°N, 88.25°E geographic; 35°N magnetic dip) and Farakka (24.79°N, 87.89°E geographic; 36.04°N magnetic dip) situated almost same meridian (88.5°E) during September 2011 and March-April 2012 for elevation greater than 20° so that the ionosphere can be tracked from the 15.50°N south of Calcutta to 31.80°N north of Farakka. Periodic variation of TEC was noticed before TEC bite out, predominantly within a particular latitudinal swath (19°N ‒26°N) along 88.5°E meridian. No periodic structures were observed over the magnetic equator during the observation period on ionosonde records from the magnetic equator station Trivandrum and COSMIC, GRACE and C/NOFS electron density measurements. The present paper reports, perhaps for the first time from the Indian longitude sector, confinement of such periodic structures in TEC primarily within a latitude swath of 19.00-26.00 °N almost along the same longitude of 88.5 °E.

  14. Small circuits for cryptography.

    Energy Technology Data Exchange (ETDEWEB)

    Torgerson, Mark Dolan; Draelos, Timothy John; Schroeppel, Richard Crabtree; Miller, Russell D.; Anderson, William Erik

    2005-10-01

    This report examines a number of hardware circuit design issues associated with implementing certain functions in FPGA and ASIC technologies. Here we show circuit designs for AES and SHA-1 that have an extremely small hardware footprint, yet show reasonably good performance characteristics as compared to the state of the art designs found in the literature. Our AES performance numbers are fueled by an optimized composite field S-box design for the Stratix chipset. Our SHA-1 designs use register packing and feedback functionalities of the Stratix LE, which reduce the logic element usage by as much as 72% as compared to other SHA-1 designs.

  15. National Radiological Protection Board accounts 1987-88

    International Nuclear Information System (INIS)

    1988-01-01

    The financial objectives for 1987-88 were to fund the technical programme and to increase the working balance to a realistic level in the region of Pound 400K as at 31 March 1988. To achieve these objectives profiled budgets were established and monitored throughout the year for a revenue expenditure programme of Pound 7313K and a capital programme of Pound 749K. To fund the difference between planned expenditure and total grants of Pound 4613K receipts of Pound 3600K were needed after allowing for non-recoverable VAT. In the event all objectives were attained with minor variances on the anticipated planned budget profiles with the net result that Pound 106K was added to the working balance. (author)

  16. The Development of Biomimetic Spherical Hydroxyapatite/Polyamide 66 Biocomposites as Bone Repair Materials

    Directory of Open Access Journals (Sweden)

    Xuesong Zhang

    2014-01-01

    Full Text Available A novel biomedical material composed of spherical hydroxyapatite (s-HA and polyamide 66 (PA biocomposite (s-HA/PA was prepared, and its composition, mechanical properties, and cytocompatibility were characterized and evaluated. The results showed that HA distributed uniformly in the s-HA/PA matrix. Strong molecule interactions and chemical bonds were presented between the s-HA and PA in the composites confirmed by IR and XRD. The composite had excellent compressive strength in the range between 95 and 132 MPa, close to that of natural bone. In vitro experiments showed the s-HA/PA composite could improve cell growth, proliferation, and differentiation. Therefore, the developed s-HA/PA composites in this study might be used for tissue engineering and bone repair.

  17. Demarcation of secondary hyperalgesia zones

    DEFF Research Database (Denmark)

    Ringsted, Thomas K; Enghuus, Casper; Petersen, Morten A

    2015-01-01

    of analgesic drug effects in humans. However, since the methods applied in demarcating the secondary hyperalgesia zone seem inconsistent across studies, we examined the effect of a standardized approach upon the measurement of SHA following a first degree burn injury (BI). NEW METHOD: The study was a two.......0001). No day-to-day or observer-to-observer differences in SHAs were observed. Intraclass correlation coefficients, in the range of 0.51 to 0.84, indicated a moderate to almost perfect reliability between observers. COMPARISON WITH EXISTING METHODS: No standardized approach in SHA-assessment has hitherto been...... presented. CONCLUSIONS: This is the first study to demonstrate that demarcation of secondary hyperalgesia zones depends on the developed pressure of the punctate stimulator used....

  18. The extended (G/G)-expansion method and travelling wave ...

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 6. The extended (′/)-expansion method and travelling wave solutions for the perturbed nonlinear Schrödinger's equation with Kerr law nonlinearity. Zaiyun Zhang Jianhua Huang Juan Zhong Sha-Sha Dou Jiao Liu Dan Peng Ting Gao. Research Articles ...

  19. Rereading "The Jack-Roller:" Hidden Histories in Sociology and Social Work

    Science.gov (United States)

    Shaw, Ian

    2009-01-01

    I revisit one of the iconic Chicago School studies, Clifford Shaw's "The Jack-Roller". A naive reading of Shaw's book leaves the reader with a sense of having been inducted into a melange of what we now know as "sociology" and "social work," but which to Shaw seems a coherent stance. I suggest that this is close to the heart of how things were,…

  20. A novel missense mutation in CCDC88C activates the JNK pathway and causes a dominant form of spinocerebellar ataxia.

    Science.gov (United States)

    Tsoi, Ho; Yu, Allen C S; Chen, Zhefan S; Ng, Nelson K N; Chan, Anne Y Y; Yuen, Liz Y P; Abrigo, Jill M; Tsang, Suk Ying; Tsui, Stephen K W; Tong, Tony M F; Lo, Ivan F M; Lam, Stephen T S; Mok, Vincent C T; Wong, Lawrence K S; Ngo, Jacky C K; Lau, Kwok-Fai; Chan, Ting-Fung; Chan, H Y Edwin

    2014-09-01

    Spinocerebellar ataxias (SCAs) are a group of clinically and genetically diverse and autosomal-dominant disorders characterised by neurological deficits in the cerebellum. At present, there is no cure for SCAs. Of the different distinct subtypes of autosomal-dominant SCAs identified to date, causative genes for only a fraction of them are currently known. In this study, we investigated the cause of an autosomal-dominant SCA phenotype in a family that exhibits cerebellar ataxia and pontocerebellar atrophy along with a global reduction in brain volume. Whole-exome analysis revealed a missense mutation c.G1391A (p.R464H) in the coding region of the coiled-coil domain containing 88C (CCDC88C) gene in all affected individuals. Functional studies showed that the mutant form of CCDC88C activates the c-Jun N-terminal kinase (JNK) pathway, induces caspase 3 cleavage and triggers apoptosis. This study expands our understanding of the cause of autosomal-dominant SCAs, a group of heterogeneous congenital neurological conditions in humans, and unveils a link between the JNK stress pathway and cerebellar atrophy. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  1. Adoption of the Hash algorithm in a conceptual model for the civil registry of Ecuador

    Science.gov (United States)

    Toapanta, Moisés; Mafla, Enrique; Orizaga, Antonio

    2018-04-01

    The Hash security algorithm was analyzed in order to mitigate information security in a distributed architecture. The objective of this research is to develop a prototype for the Adoption of the algorithm Hash in a conceptual model for the Civil Registry of Ecuador. The deductive method was used in order to analyze the published articles that have a direct relation with the research project "Algorithms and Security Protocols for the Civil Registry of Ecuador" and articles related to the Hash security algorithm. It resulted from this research: That the SHA-1 security algorithm is appropriate for use in Ecuador's civil registry; we adopted the SHA-1 algorithm used in the flowchart technique and finally we obtained the adoption of the hash algorithm in a conceptual model. It is concluded that from the comparison of the DM5 and SHA-1 algorithm, it is suggested that in the case of an implementation, the SHA-1 algorithm is taken due to the amount of information and data available from the Civil Registry of Ecuador; It is determined that the SHA-1 algorithm that was defined using the flowchart technique can be modified according to the requirements of each institution; the model for adopting the hash algorithm in a conceptual model is a prototype that can be modified according to all the actors that make up each organization.

  2. MyD88 is crucial for the development of a protective CNS immune response to Toxoplasma gondii infection

    Directory of Open Access Journals (Sweden)

    Torres Marbel

    2013-02-01

    Full Text Available Abstract Background Toxoplasmosis is one of the most common parasitic infections in humans. It can establish chronic infection and is characterized by the formation of tissue cysts in the brain. The cysts remain largely quiescent for the life of the host, but can reactivate and cause life-threatening toxoplasmic encephalitis in immunocompromised patients, such as those with AIDS, neoplastic diseases and organ transplants. Toll-like receptor (TLR adaptor MyD88 activation is required for the innate sensing of Toxoplasma gondii. Mice deficient in MyD88 have defective IL-12 and Th1 effector responses, and are highly susceptible to the acute phase of T. gondii infection. However, the role of this signaling pathway during cerebral infection is poorly understood and requires examination. Method MyD88-deficient mice and control mice were orally infected with T. gondii cysts. Cellular and parasite infiltration in the peripheral organs and in the brain were determined by histology and immunohistochemistry. Cytokine levels were determined by ELISA and chemokine mRNA levels were quantified by real-time PCR (qPCR. Results Thirteen days after infection, a higher parasite burden was observed but there was no histological change in the liver, heart, lungs and small intestine of MyD88−/− and MyD88+/+ mice. However, MyD88−/− mice compared to MyD88+/+ mice were highly susceptible to cerebral infection, displayed high parasite migration to the brain, severe neuropathological signs of encephalitis and succumbed within 2 weeks of oral infection. Susceptibility was primarily associated with lower expression of Th1 cytokines, especially IL-12, IFN-γ and TNF-α, significant decrease in the expression of CCL3, CCL5, CCL7 and CCL19 chemokines, marked defect of CD8+ T cells, and infiltration of CD11b+ and F4/80+ cells in the brain. Conclusion MyD88 is essential for the protection of mice during the cerebral installation of T. gondii infection. These results

  3. A TIR domain variant of MyD88 adapter-like (Mal)/TIRAP results in loss of MyD88 binding and reduced TLR2/TLR4 signaling.

    NARCIS (Netherlands)

    Nagpal, K.; Plantinga, T.S.; Wong, J.; Monks, B.G.; Gay, N.J.; Netea, M.G.; Fitzgerald, K.A.; Golenbock, D.

    2009-01-01

    The adapter protein MyD88 adapter-like (Mal), encoded by TIR-domain containing adapter protein (Tirap) (MIM 606252), is the most polymorphic of the five adapter proteins involved in Toll-like receptor signaling, harboring eight non-synonymous single nucleotide polymorphisms in its coding region. We

  4. Lutzomyia wellcomei Fraiha, Shaw & Lainson (Diptera, Psychodidae, Phlebotominae em Fragmento de Mata Atlântica do Rio Grande do Norte, Nordeste do Brasil

    Directory of Open Access Journals (Sweden)

    Marcos Paulo Gomes Pinheiro

    2013-12-01

    Resumo. As leishmanioses podem afetar seres humanos e animais nas formas visceral e tegumentar. A forma tegumentar tem sido associada, entre outras espécies, a Lutzomyia wellcomei Fraiha, Shaw & Lainson, inicialmente encontrado na região amazônica. O estudo se baseou em coletas mensais de janeiro a dezembro em um fragmento de Mata Atlântica e em um ambiente peridomiciliar, com armadilhas luminosas CDC. Esse é o primeiro estudo sistematizado sobre essa espécie no Rio Grande do Norte. Os insetos foram identificados e analisados em relação às chuvas no local. Alguns espécimes de L. wellcomei foram metalizados sob fita de carbono, visualizados e fotografados em microscópio eletrônico de varredura. A espécie mais abundante na área de mata foi Lutzomyia walkeri Newstead seguida por L. wellcomei. Do total capturado no ambiente de mata e no peridomicílio, cerca de 8% corresponde a L. wellcomei, sendo esta a espécie predominante no ambiente de mata no período chuvoso. Flebotomíneos L. wellcomei não foram capturados em ambiente peridomiciliar. Na mata essa espécie foi encontrada juntamente às espécies Lutzomyia whitmani Antunes & Coutinho e Lutzomyia intermedia Lutz & Neiva. Machos e fêmeas Lutzomyia longipalpis Lutz & Neiva foram predominantes no ambiente peridomiciliar. A análise microscópica da morfologia externa de L. wellcomei revela detalhes da cabeça de machos e fêmeas.

  5. The FOUR LIPS and MYB88 transcription factor genes are widely expressed in Arabidopsis thaliana during development.

    Science.gov (United States)

    Lei, Qin; Lee, EunKyoung; Keerthisinghe, Sandra; Lai, Lien; Li, Meng; Lucas, Jessica R; Wen, Xiaohong; Ren, Xiaolin; Sack, Fred D

    2015-09-01

    The FOUR LIPS (FLP) and MYB88 transcription factors, which are closely related in structure and function, control the development of stomata, as well as entry into megasporogenesis in Arabidopsis thaliana. However, other locations where these transcription factors are expressed are poorly described. Documenting additional locations where these genes are expressed might define new functions for these genes. Expression patterns were examined throughout vegetative and reproductive development. The expression from two transcriptional-reporter fusions were visualized with either β-glucuronidase (GUS) or green fluorescence protein (GFP). Both flp and myb88 genes were expressed in many, previously unreported locations, consistent with the possibility of additional functions for FLP and MYB88. Moreover, expression domains especially of FLP display sharp cutoffs or boundaries. In addition to stomatal and reproductive development, FLP and MYB88, which are R2R3 MYB transcription factor genes, are expressed in many locations in cells, tissues, and organs. © 2015 Botanical Society of America.

  6. Coulomb Excitation of a Neutron-Rich $^{88}$Kr Beam Search for Mixed Symmetry States

    CERN Multimedia

    Andreoiu, C; Napiorkowski, P J; Iwanicki, J S

    2002-01-01

    We propose to use the ISOLDE/REX/MINIBALL/CD set-up to perform a Coulomb Excitation experiment with a $^{88}$Kr radioactive beam. The motivation includes a search for $Mixed$ $Symmetry$ states predicted by the IBM-2 model, gathering more spectroscopy data about the $^{88}$Kr nucleus and extending shape coexistence studies (performed previously by the proposers for neutron-deficient Kr isotopes) to the neutron-rich side. The proposed experiment will provide data complementary to the Coulomb Excitation of a relativistic $^{88}$Kr beam proposed by D. Tonev et al. for a RISING experiment. A total of 12 days of beam time is necessary for the experiment, equally divided into two runs. One run with a 2.2 MeV/A beam energy on a $^{48}$Ti target and a second run with the maximum available REX energy of 3.1 MeV/A on a $^{208}$Pb target are requested. Using either a UC$_{x}$ or ThC$_{x}$ fissioning primary target coupled with a plasma source by a cooled transfer line seems to be the best choice for the proposed experime...

  7. ACHEMA yearbook '88. Vol. 3

    International Nuclear Information System (INIS)

    Behrens, D.

    1987-01-01

    Volume 3 entitled 'Chemical Engineering and Biotechnology from A ... Z' lists all companies, institutes and organizations which participate as exhibitors in ACHEMA 88 (index of exhibitors). The section 'Who can give information?' is composed of 8,000 keywords which provide information on which special products are manufactured by which company and where more detailed data on the functions and applications of the products can be obtained. Finally an index of picture marks and trade marks completes the contents of Volume 3. The keywords contained in the section 'Who can give information?' are also listed in English, French, Spanish and Russian translation, so that Volume 3 can also be used as an alphabetical directory. The keyword index which refers to the hall and stand numbers of the exhibitors has been prepared by means of electronic data processing and this database represents the basis for the ACHEMA Information System COMPASS. COMPASS guides the visitor to the stands where he will find the products which are of interest to him. Visitors receive a printout of the name, hall and stand of the corresponding manufacturers. The information contained in Volume 2 and 3 is also stored in the DECHEMA databank DEQUIP (Dechema Equipment Suppliers Data Bank), which is accessible online throughout the world. (orig./HK) [de

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. O P Sha. Articles written in Sadhana. Volume 31 Issue 5 October 2006 pp 645-659. An investigation into design of fair surfaces over irregular domains using data-dependent triangulation · R Sharma O P Sha · More Details Abstract Fulltext PDF. Design of fair surfaces over irregular domains is a ...

  9. The study of radiochemical separation methods on gaseous Fission product krypton-88

    International Nuclear Information System (INIS)

    Yang Zhihong; Zhang Shengdong; Yang Lei; Ding Youqian; Sun Hongqing; Ma Peng

    2012-01-01

    Half-life of krypton-88 is 2.84 hours, high fission yields and a relatively large gamma branching ratio is had. The gas is short-lived fission products in burnup measurements. Only New fission products can extract from extraction in gas of fissile irradiation target. But krypton-88 with krypton-85, krypton-87, xenon -135, and xenon-138 is coexisted together, thus radiochemical separation must quickly taken. selected the irradiation time is 1-2 hours and cooling time is best 2 hours for sample preparation, krypton and xenon were separated using activated carbon adsorption, the ratio of krypton and xenon were measured by gamma spectroscopy. Then according to the ratio of krypton-85 and xenon-125 count rate coefficient around separation were calculated yield of krypton and decontamination factor of xenon and the final the yield of krypton-85 is calculated. (authors)

  10. Cryptanalysis of Vortex

    DEFF Research Database (Denmark)

    Aumasson, Jean-Philippe; Dunkelman, Orr; Mendel, Florian

    2009-01-01

    Vortex is a hash function that was first presented at ISC'2008, then submitted to the NIST SHA-3 competition after some modifications. This paper describes several attacks on both versions of Vortex, including collisions, second preimages, preimages, and distinguishers. Our attacks exploit flaws...

  11. Gallbladder Volvulus Presenting as Acute Appendicitis

    Directory of Open Access Journals (Sweden)

    Zachary Bauman

    2015-01-01

    Full Text Available We encountered a case of gallbladder volvulus in an 88-year-old thin female in which the initial presentation was more consistent with that of acute appendicitis. After complete work-up, including physical exam, lab work, and computed tomography, the definite diagnosis of gallbladder volvulus was not made until intraoperative visualization was obtained. Gallbladder volvulus is a rare but serious condition, which requires a high clinical suspicion so prompt surgical intervention can be undertaken.

  12. Human monoclonal antibody 99mTc-88BV59: detection of colorectal cancer, recurrent or metastatic disease and immunogenicity assessment.

    Science.gov (United States)

    Krause, B J; Baum, R P; Staib-Sebler, E; Lorenz, M; Niesen, A; Hör, G

    1997-01-01

    This study presents immunoscintigraphic results in 24 patients suffering from primary colorectal cancer, recurrent or metastatic disease after the injection of 1197-1351 MBq technetium-99m labelled totally human monoclonal antibody 88BV59. Labelling efficacy of 99mTc-88BV59 ranged from 97% to 99%. Immunoscintigraphy was performed 18-20 h after injection. Scintigraphic findings were compared with those of computed tomography (CT). Patients underwent surgery in order to evaluate immunoscintigraphic findings histologically. Sera of the patients (before injection and 1 and 3 months post infusion) were analysed for the presence of human anti-human antibodies (HAHA). None of the patients showed a HAHA response as assessed by a solid-phase ELISA assay. The antibody scan detected about 25% more lesions than CT. In the detection of extrahepatic disease, the sensitivity of the antibody scan proved to be 68%, whereas the sensitivity of CT was 41%.

  13. Agrocon '88

    International Nuclear Information System (INIS)

    1988-01-01

    The proceedings of the Ninth Agricultural Outlook Conference are presented. The aim of the conference was to examine the position of agricultural price policy, the costs of inputs and the mutal relationships between the various branches of agriculture. A separate abstract was prepared for one of the papers presented. The rest were considered to be outside the subject scope of INIS

  14. Simulating the Transfer of Strontium-90 from Soil to Leafy Vegetables by Using Strontium-88

    OpenAIRE

    Kuke, Ding; Shujuan, Liu; Yingxue, He; Dong, Yan; Fengshou, Zhang; Shuifeng, Wang; Jinghua, Guo; Wei, Zhang; Xin, Wang; Xiaoyan, Jiang

    2016-01-01

    The transfer, from soil to Chinese cabbage and spinach, of radioactive strontium-90 released as a result of accidents in nuclear power stations was studied using a stable isotope of strontium, namely nuclide strontium-88 (88Sr). The study led to an experimental model for assessing the hazard of radionuclide strontium-90 (90Sr) entering the food chain and for predicting the risk to food safety. Chinese cabbage and spinach were grown in pots in a greenhouse and irrigated with deionized water co...

  15. Hormonal-Pheromonal Interrelationships in Ticks and Parasitic Mites.

    Science.gov (United States)

    1986-12-01

    II. Maturation and pherumone activity. 15 J. * V IBID 20: 424-439. Gaber , S.H.A., G.M. Khalil, D.E. Sonenshine, and M.A. Moez. Precocene-2 effects on...the camel tick, Hyalomma dromedarii. I. Adult responses. IBID 20: 534-540. Khalil, G.M., S.H.A. Gaber , D.E. Sonenshine, and S.M. Gad. IBID. 2. Larval

  16. Status of the revision of the 88/609 directive on the reduction of air pollutant emissions from large burning plants; Le point sur la revision de la Directive 88/609 relative a la reduction des emissions polluantes dans l`atmosphere, en provenance des grandes installations de combustion (GIC)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-31

    The present European 88/609 directive, which applies to burning plants with a capacity of more than 50 MW (i.e. mainly power plant boilers and industrial energy production plants), is presented; different emission level limits are fixed for new and old plants, for the three main air pollutants (sulfur dioxide, nitrogen oxides and dust). Results on emission pollution levels in 1990, following the 1988 directive are presented. Several revisions drafts have been studied, which included gas turbines, and the end of the separation between old and new plants

  17. Punctuated 88% Phenol Peeling for the Treatment of Facial Photoaging: A Clinical and Histopathological Study.

    Science.gov (United States)

    de Mendonça, Maria Cristina C; Segheto, Natália N; Aarestrup, Fernando M; Aarestrup, Beatriz J V

    2018-02-01

    Phenol peeling is considered an important agent in the treatment of facial rejuvenation; however, its use has limitations due to its high potential for side effects. This article proposes a new peeling application technique for the treatment of photoaging, aiming to evaluate, clinically and histopathologically, the efficacy of a new way of applying 88% phenol, using a punctuated pattern. The procedure was performed in an outpatient setting, with female patients, on static wrinkles and high flaccidity areas of the face. Accompanying photographs and skin samples were taken for histopathological analysis before and after treatment. It was shown that 88% phenol applied topically using a punctuated technique is effective in skin rejuvenation. The authors thus suggest, based on this new proposal, that further studies be conducted with a larger group of patients to better elucidate the action mechanisms of 88% phenol. This new form of application considerably reduced patients' withdrawal from their regular activities, besides reducing the cost, compared with the conventional procedure.

  18. Radiogenic lead-208 abundance 88.34 %

    International Nuclear Information System (INIS)

    Seneda, Jose A.; Abrao, Alcidio; Dias, Mauro S.; Kakazu, Mauricio H.; Salvador, Vera L.R.; Queiroz, Carlos A.S.; Rocha, Soraya M.R. da; Sato, Key

    2009-01-01

    Brazil has a long tradition in thorium technology, from the monazite ores mining until the production of the nuclear grade thorium compounds. Early in 1969 the Institute of Energy and Nuclear Research (IPEN) designed a project for a pilot plant installation to purify the thorium compounds, based on the solvent extraction technique. Thorium compounds used came from monazite's industrialization. During the course of the operation of this plant, a crude sludge were formed containing thorium not extracted and the whole rare earths, plus minor impurities like sodium, titanium, zirconium, hafnium, iron, silicon, phosphate and the thorium daughters were accumulated. Included is the radiogenic lead-208. This sludge, hereafter named 'RETOTER', was treated with hydrochloric acid and the lead was separated and recovered by anion exchange technology. The lead-208 was analyzed by mass spectrometry (HR-ICPMS) technique. The lead-208 abundance measure was 88.34%, this allowed the calculation of the thermal neutron capture cross section of σ 0 γ = 14,6 +/- 0.7 mb, considerably lower than the σ 0 γ = 174.2 +/- 0.7 mb value of the natural lead. (author)

  19. Comparative genomics of citric-acid producing Aspergillus niger ATCC 1015 versus enzyme-producing CBS 513.88

    Energy Technology Data Exchange (ETDEWEB)

    Grigoriev, Igor V.; Baker, Scott E.; Andersen, Mikael R.; Salazar, Margarita P.; Schaap, Peter J.; Vondervoot, Peter J.I. van de; Culley, David; Thykaer, Jette; Frisvad, Jens C.; Nielsen, Kristen F.; Albang, Richard; Albermann, Kaj; Berka, Randy M.; Braus, Gerhard H.; Braus-Stromeyer, Susanna A.; Corrochano, Luis M.; Dai, Ziyu; Dijck, Piet W.M. van; Hofmann, Gerald; Lasure, Linda L.; Magnusson, Jon K.; Meijer, Susan L.; Nielsen, Jakob B.; Nielsen, Michael L.; Ooyen, Albert J.J. van; Panther, Kathyrn S.; Pel, Herman J.; Poulsen, Lars; Samson, Rob A.; Stam, Hen; Tsang, Adrian; Brink, Johannes M. van den; Atkins, Alex; Aerts, Andrea; Shapiro, Harris; Pangilinan, Jasmyn; Salamov, Asaf; Lou, Yigong; Lindquist, Erika; Lucas, Susan; Grimwood, Jane; Kubicek, Christian P.; Martinez, Diego; Peij, Noel N.M.E. van; Roubos, Johannes A.; Nielsen, Jens

    2011-04-28

    The filamentous fungus Aspergillus niger exhibits great diversity in its phenotype. It is found globally, both as marine and terrestrial strains, produces both organic acids and hydrolytic enzymes in high amounts, and some isolates exhibit pathogenicity. Although the genome of an industrial enzyme-producing A. niger strain (CBS 513.88) has already been sequenced, the versatility and diversity of this species compels additional exploration. We therefore undertook whole genome sequencing of the acidogenic A. niger wild type strain (ATCC 1015), and produced a genome sequence of very high quality. Only 15 gaps are present in the sequence and half the telomeric regions have been elucidated. Moreover, sequence information from ATCC 1015 was utilized to improve the genome sequence of CBS 513.88. Chromosome-level comparisons uncovered several genome rearrangements, deletions, a clear case of strain-specific horizontal gene transfer, and identification of 0.8 megabase of novel sequence. Single nucleotide polymorphisms per kilobase (SNPs/kb) between the two strains were found to be exceptionally high (average: 7.8, maximum: 160 SNPs/kb). High variation within the species was confirmed with exo-metabolite profiling and phylogenetics. Detailed lists of alleles were generated, and genotypic differences were observed to accumulate in metabolic pathways essential to acid production and protein synthesis. A transcriptome analysis revealed up-regulation of the electron transport chain, specifically the alternative oxidative pathway in ATCC 1015, while CBS 513.88 showed significant up-regulation of genes relevant to glucoamylase A production, such as tRNA-synthases and protein transporters. Our results and datasets from this integrative systems biology analysis resulted in a snapshot of fungal evolution and will support further optimization of cell factories based on filamentous fungi.[Supplemental materials (10 figures, three text documents and 16 tables) have been made available

  20. Removal of acid red 88 from wastewater by adsorption on agrobased waste material. A case study of Iranian golden Sesamum indicum hull

    Directory of Open Access Journals (Sweden)

    Mahmoud Zarei

    2017-08-01

    Full Text Available Background: Colors are very useful in different industries such as textile and leather but when they enter water, can cause many biological and environmental problems. In the present research, a waste agricultural material which is freely available is employed to analyze its efficiency for removing acid dye from contaminated wastewaters. Methods: In this study, batch adsorption experiments were performed in the treatment process of acid red 88 (AR88 by Iranian golden Sesamum indicum (IGSI seeds hull which is produced abundantly in some countries and especially in Iran up to 1100 kg/ha. Also, the effect of operational parameters like adsorption time, pH, dye concentration and adsorbent dosage was studied on pollutant removing efficiency. The experimental data of AR88 adsorption was fitted to Langmuir, Freundlich and Temkin isotherm models. The scanning electron microscopy (SEM images for the IGSI were taken before and after adsorption process. Results: The efficiency of dye adsorption on adsorbent was found to be 98.2%. The optimum pH for treatment was 4.5 which is in the acidic range. Enhancing the adsorbent dosage from 0.5 to 2.5 g caused increasing in removal efficiency from 73.85% to 95.85%. Decreasing in dye concentration from 70 to 30 mg/L caused increasing in removal efficiency from 79.73% to 95.83%. The process of adsorption was best fitted to Langmuir model and the amount of dye adsorbed on adsorbent, qe, was found to be 25 mg/g. Comparison between SEM images before and after dye adsorption, showed the significant difference that was due to the dye loading on adsorbent. Conclusion: The results of present study demonstrated higher dye removal efficiency for AR88 in acidic pHs. Employing the IGSI material in this study proves to be a potential alternative to expensive adsorbents, utilized for the treatment of contaminated industrial waste waters.

  1. Secondary laser cooling of strontium-88 atoms

    Energy Technology Data Exchange (ETDEWEB)

    Strelkin, S. A.; Khabarova, K. Yu., E-mail: kseniakhabarova@gmail.com; Galyshev, A. A.; Berdasov, O. I.; Gribov, A. Yu.; Kolachevsky, N. N.; Slyusarev, S. N. [Federal State Unitary Enterprise “All-Russia Research Institute for Physicotechnical and Radio Engineering Measurements” (VNIIFTRI) (Russian Federation)

    2015-07-15

    The secondary laser cooling of a cloud of strontium-88 atoms on the {sup 1}S{sub 0}–{sup 3}P{sub 1} (689 nm) intercombination transition captured into a magneto-optical trap has been demonstrated. We describe in detail the recapture of atoms from the primary trap operating on the strong {sup 1}S{sub 0}–{sup 1}P{sub 1} (461 nm) transition and determine the recapture coefficient κ, the number of atoms, and their temperature in the secondary trap as a function of experimental parameters. A temperature of 2 µK has been reached in the secondary trap at the recapture coefficient κ = 6%, which confirms the secondary cooling efficiency and is sufficient to perform metrological measurements of the {sup 1}S{sub 0}–{sup 3}P{sub 1} (698 nm) clock transition in an optical lattice.

  2. Kaasaegseid maailmavaateid kohtulaua ees / Ants Oras

    Index Scriptorium Estoniae

    Oras, Ants

    2003-01-01

    Montgomery Belgioni raamatust "Our present philosophy of life", mis tutvustab Bernard Shaw', André Gide'i, Sigmund Freudi ja Bertrand Russelli filosoofilisi teooriaid. Varem ilmunud: "Looming", 1931, nr. 6, lk. 646-651

  3. English presentation of each data element of articles in serial publications in Japan

    International Nuclear Information System (INIS)

    Narui, Shigeko; Izawa, Michiyo; Naramoto, Miyoko; Kajiro, Tadashi

    1981-01-01

    Texts and several data elements were surveyed by extracting 1,000 articles from inputs to the INIS. Rates of English presentation in journals were as the following: texts 38%, abstracts 72%, keywords 27%, titles 88%, personal authors 90% and affiliations 79%. Also, articles describing all data elements in English were 25% and articles without keywords in English 68%. As a result of the survey, private organizations and publishers give priority of access data elements to body of the works, universities and public agencies priority of the works, and associations both phases, comparing with the rates of English presentation between texts and the access data elements. The English presentation in technical reports were as follows: texts 46%, abstracts 83%, keywords 53%, titles 88%, personal authors 86%, corporate authors 97%, and affiliations 85%. (author)

  4. Multichannel Seismic Reflection - SCAR- Antarctic Penn. 1987-88 SDLS CD-ROM vol 27

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data are stacked multichannel marine seismic reflection data recorded during 1987-88 in the Antarctica Peninsula region, by Petrobras, Brazil. The following...

  5. Multichannel Seismic Reflection - SCAR- Antarctic Penn. 1987-88 SDLS CD-ROM vol 26

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data are stacked multichannel marine seismic reflection data recorded during 1987-88 in the Antarctica Peninsula region, by Petrobras, Brazil. The following...

  6. Expression of myeloid differentiation factor 88 in neurons is not requisite for the induction of sickness behavior by interleukin-1β

    Directory of Open Access Journals (Sweden)

    Braun Theodore P

    2012-10-01

    Full Text Available Abstract Background Animals respond to inflammation by suppressing normal high-energy activities, including feeding and locomotion, in favor of diverting resources to the immune response. The cytokine interleukin-1 beta (IL-1β inhibits normal feeding and locomotor activity (LMA via its actions in the central nervous system (CNS. Behavioral changes in response to IL-1β are mediated by myeloid differentiation factor 88 (MyD88 in non-hematopoietic cells. It is unknown whether IL-1β acts directly on neurons or requires transduction by non-neuronal cells. Methods The Nestin-cre mouse was crossed with MyD88lox mice to delete MyD88 from neurons and glia in the CNS (MyD88ΔCNS. These mice were compared to total body MyD88KO and wild type (WT mice. Mice had cannulae stereotactically placed in the lateral ventricle and telemetry transponders implanted into the peritoneum. Mice were treated with either intracerebroventricular (i.c.v. IL-1β (10 ng or vehicle. Food intake, body weight and LMA were continuously monitored for 24 h after treatment. I.c.v. tumor necrosis factor (TNF, a MyD88-independent cytokine, was used to control for normal immune development. Peripheral inflammation was modeled using intraperitoneal lipopolysaccharide (LPS. Groups were compared using two-way ANOVA with Bonferroni post-test. Efficacy of recombination was evaluated using tdTomato reporter mice crossed with the Nestin-cre mouse. MyD88 deletion was confirmed by Western blot. Results I.c.v. IL-1β treatment caused a significant reduction in feeding, body weight and LMA in WT mice. MyD88KO mice were protected from these changes in response to i.c.v. IL-1β despite having intact behavioral responses to TNF. Cre-mediated recombination was observed in neurons and astrocytes, but not microglia or endothelial cells. In contrast to MyD88KO mice, the behavioral responses of MyD88ΔCNS mice to i.c.v. IL-1β or intraperitoneal (i.p. LPS were indistinguishable from those of WT mice

  7. 共表达ETEC K99、K88菌毛蛋白重组干酪乳杆菌的构建%The Surface Display of ETEC K99,K88 Protein in Lactobacillus casei

    Institute of Scientific and Technical Information of China (English)

    温丽娟; 王桂华; 侯喜林; 余丽芸; 王萌

    2011-01-01

    将PCR扩增的K99和K88-LTB基因片段串联插入到干酪乳杆菌细胞表面表达载体pLA中,构建了重组表达载体pLA-K99-K88-LTB,将其电转化干酪乳杆菌CICC 6 105,获得了表达融合蛋白pLA-K99-K88-LTB的重组干酪乳杆菌表达系统.重组干酪乳杆菌在MRS培养基中表达后,经SDS-PAGE检测,约有90 KDa的融合蛋白得到表达,蛋白大小与理论值相符合.Western-blot分析表明表达的蛋白可被鼠源K99,K88抗血清所识别.间接免疫荧光技术和流式细胞术的结果表明,融合蛋白成功地利用多聚谷氨酸跨膜蛋白pgsA基因展示在干酪乳杆菌菌体表面.

  8. Human monoclonal antibody 99mTc-88BV59: detection of colorectal cancer, recurrent or metastatic disease and immunogenicity assessment

    International Nuclear Information System (INIS)

    Krause, B.J.; Baum, R.P.; Staib-Sebler, E.; Lorenz, M.; Niesen, A.; Hoer, G.

    1997-01-01

    This study presents immunoscintigraphic results in 24 patients suffering from primary colorectal cancer, recurrent or metastatic disease after the injection of 1197-1351 MBq technetium-99m labelled totally human monoclonal antibody 88BV59. Labelling efficacy of 99m Tc-88BV59 ranged from 97% to 99%. Immunoscintigraphy was performed 18-20 h after injection. Scintigraphic findings were compared with those of computed tomography (CT). Patients underwent surgery in order to evaluate immunoscintigraphic findings histologically. Sera of the patients (before injection and 1 and 3 months post infusion) were analysed for the presence of human anti-human antibodies (HAHA). None of the patients showed a HAHA response as assessed by a solid-phase ELISA assay. The antibody scan detected about 25% more lesions than CT. In the detection of extrahepatic disease, the sensitivity of the antibody scan proved to be 68%, whereas the sensitivity of CT was 41%. (orig.). With 3 figs., 1 tab

  9. Increased Circulating Level of the Survival Factor GP88 (Progranulin in the Serum of Breast Cancer Patients When Compared to Healthy Subjects

    Directory of Open Access Journals (Sweden)

    Katherine Rak Tkaczuk

    2011-01-01

    Full Text Available Introduction GP88 (PC-Cell Derived Growth Factor, progranulin is a glycoprotein overexpressed in breast tumors and involved in their proliferation and survival. Since GP88 is secreted, an exploratory study was established to compare serum GP88 level between breast cancer patients (BC and healthy volunteers (HV. Methods An IRB approved prospective study enrolled 189 stage 1–4 BC patients and 18 HV. GP88 serum concentration was determined by immunoassay. Results Serum GP88 level was 28.7+ 5.8 ng/ml in HV and increased to 40.7+ 16.0 ng/ml ( P = 0.007 for stage 1-3 and 45.3 +23.3 ng/ml ( P = 0.0007 for stage 4 BC patients. There was no correlation between the GP88 level and BC characteristics such as age, race, tumor grade, ER, PR and HER-2 expression. Conclusion These data suggest that serial testing of serum GP88 levels may have value as a circulating biomarker for detection, monitoring and follow up of BC.

  10. U.S. Army Reserve 88th Readiness Division Finds Big Savings

    Energy Technology Data Exchange (ETDEWEB)

    None

    2018-02-20

    Fact sheet features lighting work done for the U.S. Army Reserve 88th Readiness Division, which was recognized in two 2017 Interior Lighting Campaign exemplary recognition categories. The troffer lighting upgrade projects at the two recognized sites are expected to save more than 246,000 kWh annually or roughly enough electricity to run 23 homes for a year.

  11. Differential outcome of infection with attenuated Salmonella in MyD88-deficient mice is dependent on the route of administration.

    Science.gov (United States)

    Issac, Jincy M; Sarawathiamma, Dhanya; Al-Ketbi, Mai I; Azimullah, Sheikh; Al-Ojali, Samia M; Mohamed, Yassir A; Flavell, Richard A; Fernandez-Cabezudo, Maria J; al-Ramadi, Basel K

    2013-01-01

    Activation of the innate immune system is a prerequisite for the induction of adaptive immunity to both infectious and non-infectious agents. TLRs are key components of the innate immune recognition system and detect pathogen-associated molecular patterns. Most TLRs utilize the MyD88 adaptor for their signaling pathways. In the current study, we investigated innate and adaptive immune responses to primary as well as secondary Salmonella infections in MyD88-deficient (MyD88(-/-)) mice. Using i.p. or oral route of inoculation, we demonstrate that MyD88(-/-) mice are hypersusceptible to infection by an attenuated, double auxotrophic, mutant of Salmonella enterica serovar Typhimurium (S. typhimurium). This is manifested by 2-3 logs higher bacterial loads in target organs, delayed recruitment of phagocytic cells, and defective production of proinflammatory cytokines in MyD88(-/-) mice. Despite these deficiencies, MyD88(-/-) mice developed Salmonella-specific memory Th1 responses and produced elevated serum levels of anti-Salmonella Abs, not only of Th1-driven (IgG2c, IgG3) but also IgG1 and IgG2b isotypes. Curiously, these adaptive responses were insufficient to afford full protection against a secondary challenge with a virulent strain of S. typhimurium. In comparison with the high degree of mortality seen in MyD88(-/-) mice following i.p. inoculation, oral infections led to the establishment of a state of long-term persistence, characterized by continuous bacterial shedding in animal feces that lasted for more than 6 months, but absence from systemic organs. These findings suggest that the absent expression of MyD88 affects primarily the innate effector arm of the immune system and highlights its critical role in anti-bacterial defense. Copyright © 2012 Elsevier GmbH. All rights reserved.

  12. PENGARUH KUALITAS PRODUK TERHADAP KEPUASAN PELANGGAN DI RUMAH MAKAN “LESEHAN 88” MADIUN

    Directory of Open Access Journals (Sweden)

    Dian kristiana

    2014-01-01

    The samples in this study using a quota sample of 100 people, based on the characteristics of customers who have made a purchase at least once. Data collection using questionnaires and documentation. In analyzing the data used statistical method to test the product moment correlation is valid whether or not the instruments used and the method of regression tests for testing the hypothesis put forward in this study.The results showed that the quality of products have an influence a positive relationship to customer satisfaction in the eating "Lesehan 88" Madiun. It is derived from the value of 0.752 while the value rhitung rtabel 0.195 (0.752 ≥ 0.195. On the other hand Sighit value of 0.000 and the value Sigprob at 00:05 (0.000 ≤ 0.05 with the Ha acceptable means quality products have a relationship with customer satisfaction in restaurants "Lesehan 88" Madiun. It also obtained the F test value, while the value Fcount Ftable 3.938 127.623 (127.623 ≥ 3.938. On the other hand Sigprob Sighit of 0.000 and 0.05 (0.05 ≤ 0.000. It means that there is rejection of H0 which indicates that there are significant between product quality to customer satisfaction in the eating "Lesehan 88" Madiun. Also obtained regression coefficients (t test with tcount 11.297 1.660 while the value ttable (≥ 11.297 1.660. On the other hand sighit value of 0.000 and Sigprob value of 0.05 (0.05 ≤ 0.000. By this means Ha received no difference between the effect of product quality on customer satisfaction in the restaurant "Lesehan 88" Madiun. R2 of 0,566, results showed that 56.6% of customer satisfaction variables quality of the product, while the remaining 43.4% is influenced by other factors not examined.

  13. [Analysis of the intensity of professional collaboration among nurses in a critical care area].

    Science.gov (United States)

    Bengoechea Calpe, L; Marín Fernández, B; Regaira Martínez, E

    2016-01-01

    To analyse the intensity of professional collaboration (IPC) between the nurses in a multidisciplinary critical area (CA) and the relationship with the workplace "intensive care unit (ICU) and special hospitalisation area (SHA)", educational level, age, and years of professional activity in CA. A cross-sectional descriptive study was conducted with 57 nurses from CA, recording socio-demographic data: age, educational level, speciality titles, years of professional activity and workday type, years of professional activity in the CA, and involvement in scientific works. Tool: Intensity of Inter-professional Collaboration Questionnaire. SPSS 20.0. The study included a total of 47 nurses (ICU/SHA), with a mean age of 35.91 (9.59) years. Almost three-quarters (74.46%) were nursing graduates with a posgraduate in ICU. Median and interquartile range of professional experience was 14 and 14.50 years, respectively, and years working in CA was 8.50 and 16 years, respectively. Just over half of them (51.10%) worked part-time, and 61.70% participated in scientific works. The mean IPC score was 61.68 (6.84), with 57.40% providing values of high IPC. The relationship between the workplace (ICU/SHA) and educational level with IPC was not statistically significant (p>.05). There are statistical significant differences between IPC with age and years of professional activity in CA (p<.05). The present study demonstrates the existence of good IPC in the CA. Younger nurses obtain a better IPC score, as well as nurses who have been working for less time in CA. Nurses with a Degree or Masters have a higher level of IPC than the rest, as well as nurses who perform professional activity combining ICU and SHA. Copyright © 2015 Elsevier España, S.L.U. y SEEIUC. All rights reserved.

  14. Governing how we care: contesting community and defining difference in U.S. public health programs

    National Research Council Canada - National Science Library

    Shaw, Susan J., Dr

    2012-01-01

    ... the meanings of cultural difference, ethnicity, and inequality in health care. Drawing on ethnographic research conducted over six years in a small New England city, Shaw presents critical perspectives on public health intervention efforts...

  15. Temporal Role for MyD88 in a Model of Brucella-Induced Arthritis and Musculoskeletal Inflammation.

    Science.gov (United States)

    Lacey, Carolyn A; Mitchell, William J; Brown, Charles R; Skyberg, Jerod A

    2017-03-01

    Brucella spp. are facultative intracellular Gram-negative bacteria that cause the zoonotic disease brucellosis, one of the most common global zoonoses. Osteomyelitis, arthritis, and musculoskeletal inflammation are common focal complications of brucellosis in humans; however, wild-type (WT) mice infected systemically with conventional doses of Brucella do not develop these complications. Here we report C57BL/6 WT mice infected via the footpad with 10 3 to 10 6 CFU of Brucella spp. display neutrophil and monocyte infiltration of the joint space and surrounding musculoskeletal tissue. Joint inflammation is detectable as early as 1 day postinfection and peaks 1 to 2 weeks later, after which WT mice are able to slowly resolve inflammation. B and T cells were dispensable for the onset of swelling but required for resolution of joint inflammation and infection. At early time points, MyD88 -/- mice display decreased joint inflammation, swelling, and proinflammatory cytokine levels relative to WT mice. Subsequently, swelling of MyD88 -/- joints surpassed WT joint swelling, and resolution of joint inflammation was prolonged. Joint bacterial loads in MyD88 -/- mice were significantly greater than those in WT mice by day 3 postinfection and at all time points thereafter. In addition, MyD88 -/- joint inflammatory cytokine levels on day 3 and beyond were similar to WT levels. Collectively these data demonstrate MyD88 signaling mediates early inflammatory responses in the joint but also contributes to subsequent clearance of Brucella and resolution of inflammation. This work also establishes a mouse model for studying Brucella -induced arthritis, musculoskeletal complications, and systemic responses, which will lead to a better understanding of focal complications of brucellosis. Copyright © 2017 American Society for Microbiology.

  16. In Vivo Role of TLR2 and MyD88 Signaling in Eliciting Innate Immune Responses in Staphylococcal Endophthalmitis

    Science.gov (United States)

    Talreja, Deepa; Singh, Pawan Kumar; Kumar, Ashok

    2015-01-01

    Purpose. The purpose of this study was to investigate the protective mechanisms evoked by TLR2 and MyD88 signaling in bacterial endophthalmitis in vivo. Methods. Endophthalmitis was induced in wild-type (WT), TLR2−/−, MyD88−/−, and Cnlp−/− mice by intravitreal injections of a laboratory strain (RN6390) and two endophthalmitis isolates of Staphylococcus aureus. Disease progression was monitored by assessing corneal and vitreous haze, bacterial burden, and retinal tissue damage. Levels of inflammatory cytokines/chemokines were determined using quantitative RT-PCR (qRT-PCR) and ELISA. Flow cytometry was used to assess neutrophil infiltration. Cathelicidin-related antimicrobial peptide (CRAMP) expression was determined by immunostaining and dot blot. Results. Eyes infected with either laboratory or clinical isolates exhibited higher levels of inflammatory mediators at the early stages of infection (≤24 hours) in WT mice than in TLR2−/− or MyD88−/− mice. However, their levels surpassed that of WT mice at the later stages of infection (>48 hours), coinciding with increased bacterial burden and retinal damage. Both TLR2−/− and MyD88−/− retinas produced reduced levels of CRAMP, and its deficiency (Cnlp−/−) rendered the mice susceptible to increased bacterial burden and retinal tissue damage as early as 1 day post infection. Analyses of inflammatory mediators and neutrophil levels in WT versus Cnlp−/− mice showed a trend similar to that observed in TLR2 and MyD88 KO mice. Furthermore, we observed that even a 10-fold lower infective dose of S. aureus was sufficient to cause endophthalmitis in TLR2−/− and MyD88−/− mice. Conclusions. TLR2 and MyD88 signaling plays an important role in protecting the retina from staphylococcal endophthalmitis by production of the antimicrobial peptide CRAMP. PMID:25678692

  17. Assessment of radionuclide databases in CAP88 mainframe version 1.0 and Windows-based version 3.0.

    Science.gov (United States)

    LaBone, Elizabeth D; Farfán, Eduardo B; Lee, Patricia L; Jannik, G Timothy; Donnelly, Elizabeth H; Foley, Trevor Q

    2009-09-01

    In this study the radionuclide databases for two versions of the Clean Air Act Assessment Package-1988 (CAP88) computer model were assessed in detail. CAP88 estimates radiation dose and the risk of health effects to human populations from radionuclide emissions to air. This program is used by several U.S. Department of Energy (DOE) facilities to comply with National Emission Standards for Hazardous Air Pollutants regulations. CAP88 Mainframe, referred to as version 1.0 on the U.S. Environmental Protection Agency Web site (http://www.epa.gov/radiation/assessment/CAP88/), was the very first CAP88 version released in 1988. Some DOE facilities including the Savannah River Site still employ this version (1.0) while others use the more user-friendly personal computer Windows-based version 3.0 released in December 2007. Version 1.0 uses the program RADRISK based on International Commission on Radiological Protection Publication 30 as its radionuclide database. Version 3.0 uses half-life, dose, and risk factor values based on Federal Guidance Report 13. Differences in these values could cause different results for the same input exposure data (same scenario), depending on which version of CAP88 is used. Consequently, the differences between the two versions are being assessed in detail at Savannah River National Laboratory. The version 1.0 and 3.0 database files contain 496 and 838 radionuclides, respectively, and though one would expect the newer version to include all the 496 radionuclides, 35 radionuclides are listed in version 1.0 that are not included in version 3.0. The majority of these has either extremely short or long half-lives or is no longer in production; however, some of the short-lived radionuclides might produce progeny of great interest at DOE sites. In addition, 122 radionuclides were found to have different half-lives in the two versions, with 21 over 3 percent different and 12 over 10 percent different.

  18. Evocatin of the Spirit: A-capella-Werke von Gorecki, Pärt, Martin, Barber und Schönberg / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1995-01-01

    Uuest heliplaadist "Evocatin of the Spirit: A-capella-Werke von Gorecki, Pärt, Martin, Barber und Schönberg. Robert Shaw Festival Singers. Robert Shaw (AD: 1994). Telarc/in-akustik CD 80406 (WD: 72'15")

  19. Tiit Kask, Aldur Vunk (Hrsg.): Reis (nõukogude) läände / Journey to the [Soviet] west. Kuurortlinn Pärnu 1940-88. Artiklite kogumik / Resort town of Pärnu 1940-88. Collection of articles, Pärnu: Pärnu Linnavalitsus 2009, 121 S., 97 Abb. / Andr

    Index Scriptorium Estoniae

    Fülberth, Andreas

    2011-01-01

    Raamatuarvustus: Reis (nõukogude) läände : kuurortlinn Pärnu 1940-88 : artiklite kogumik = Journey to the [Soviet] West : resort town of Pärnu during 1940-88 : collection of articles. Pärnu, 2009

  20. Thoracic trauma: presentation and management outcome

    International Nuclear Information System (INIS)

    Saaiq, M.; Shah, S. A.

    2008-01-01

    To determine the presentation and management outcome of thoracic trauma in a tertiary care setting. A total of 143 patients, who presented with chest trauma, were included in the study. All the patients were assessed by the history, physical examination and ancillary investigations. Appropriate managements were instituted as required. Data was described in percentages. out of 143 patients, 119 (83)% were males and 24 (17)% were females. Most of the patients belonged to the age group of 21-50 years. Ninety seven (66)% patients were admitted for indoor management. Blunt injury was found in 125 (87.4%) patients, while penetrating injuries in only 18 (12.6%) patients. Road Traffic Accidents (RTAs) were the commonest cause of trauma (n=103, 72%). Rib fracture was the commonest chest injury (74% patients). Head injury was the most frequently associated injury (18% of the patients). Tube thoracostomy was the commonest intervention undertaken in 65 (45%) patients. Seventeen (11.88%) patients were managed with mechanical ventilation. there were 17 deaths with a mortality rate of 11.88%. Thoracic trauma is an important cause of hospitalization, morbidity and mortality in the younger population. RTAs constitute the leading cause of thoracic trauma in our setup. Tube thoracostomy is the most frequent and at times the only invasive procedure required as a definitive measure in thoracic trauma patients. A policy of selective hospitalization helps to avoid unnecessary hospital admissions. (author)

  1. Examining seismicity patterns in the 2010 M 8.8 Maule rupture zone.

    Science.gov (United States)

    Diniakos, R. S.; Bilek, S. L.; Rowe, C. A.; Draganov, D.

    2016-12-01

    The subduction of the Nazca Plate beneath the South American Plate along Chile has produced some of the largest earthquakes recorded on modern seismic instrumentation. These include the 1960 M 9.5 Valdivia, 2010 M 8.8 Maule, 2014 M 8.1 Iquique, and more recently the 2015 M 8.3 Illapel earthquakes. Slip heterogeneity in the 2010 Maule earthquake has been noted in various studies, with bilateral slip and peak slip of 15 m north of the epicenter. For other great subduction zone earthquakes, such as the 2004 M 9.1 Sumatra, 2010 M 8.8 Maule, and 2011 M 9.0 Tohoku, there was an increase in normal-faulting earthquakes in regions of high slip. In order to understand aftershock behavior of the 2010 Maule event, we are expanding the catalog of small magnitude earthquakes using a template-matching algorithm to find other small earthquakes in the rupture area. We use a starting earthquake catalog (magnitudes between 2.5-4.0) developed from regional and local array seismic data; these comprise our template catalog from Jan. - Dec. 2012 that we use to search through seismic waveforms recorded by a 2012 temporary seismic array in Malargüe, Argentina located 300 km east of the Maule rupture area. We use waveform cross correlation techniques in order to detect new events, and then we use HYPOINVERSE2000 (Klein, 2002) and a velocity model designed for the south-central Chilean region (Haberland et al., 2006) to locate new detections. We also determine focal mechanisms to further analyze aftershock behavior for the region. To date, over 2400 unique detections have been found, of which we have located 133 events with an RMS <1. Many of these events are located in the region of greatest coseismic slip, north of the 2010 epicenter, whereas catalog events are located north and south of the epicenter, along the regions of bilateral slip. Focal mechanisms for the new locations will also be presented.

  2. Recent developments in high charge state heavy ion beams at the LBL 88-inch Cyclotron

    International Nuclear Information System (INIS)

    Gough, R.A.; Clark, D.J.; Glasgow, L.R.

    1978-01-01

    Recent advances in design and operation of the internal PIG sources at the LBL 88-Inch Cyclotron have led to the development of high charge state (0.4 16 O 8+ . Total external intensities of these beams range from 10 12 particles/s for 6 Li 3+ to 0.1 particles/s for 16 O 8+ . Techniques have been developed for routine tune-out of the low intensity beams. These include use of model beams and reliance on the large systematic data base of cyclotron parameters which has been developed over many years of operation. Techniques for delivery of these weak beams to the experimental target areas are presented. Source design and operation, including special problems associated with Li, Be, and B beams are discussed

  3. Fabrication of metal-organic framework MIL-88B films on stainless steel fibers for solid-phase microextraction of polychlorinated biphenyls.

    Science.gov (United States)

    Wu, Ye-Yu; Yang, Cheng-Xiong; Yan, Xiu-Ping

    2014-03-21

    Metal-organic frameworks (MOFs) have received considerable attention as novel sorbents for sample preparation due to their fascinating structures and functionalities such as large surface area, good thermal stability, and uniform structured nanoscale cavities. Here, we report the application of a thermal and solvent stable MOF MIL-88B with nanosized bipyramidal cages and large surface area for solid-phase microextraction (SPME) of polychlorinated biphenyls (PCBs). Novel MIL-88B coated fiber was fabricated via an in situ hydrothermal growth of MIL-88B film on etched stainless steel fiber. The MIL-88B coated fiber gave large enhancement factors (757-2243), low detection limits (0.45-1.32ngL(-1)), and good linearity (5-200ngL(-1)) for PCBs. The relative standard deviation (RSD) for six replicate extractions of PCBs at 100ngL(-1) on MIL-88B coated fiber ranged from 4.2% to 8.7%. The recoveries for spiked PCBs (10ngL(-1)) in water and soil samples were in the range of 79.7-103.2%. Besides, the MIL-88B coated fiber was stable enough for 150 extraction cycles without significant loss of extraction efficiency. The developed method was successfully applied to the determination of PCBs in water samples and soil samples. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. J-SHIS - an integrated system for knowing seismic hazard information in Japan

    Science.gov (United States)

    Azuma, H.; Fujiwara, H.; Kawai, S.; Hao, K. X.; Morikawa, N.

    2015-12-01

    An integrated system of Japan seismic hazard information station (J-SHIS) was established in 2005 for issuing and exchanging information of the National Seismic Hazard Maps for Japan that are based on seismic hazard assessment (SHA). A simplified app, also named J-SHIS, for smartphones is popularly used in Japan based on the integrated system of http://www.j-shis.bosai.go.jp/map/?lang=en. "Smartphone tells hazard" is realized on a cellphone, a tablet and/or a PC. At a given spot, the comprehensive information of SHA map can be easily obtained as below: 1) A SHA probability at given intensity (JMA=5-, 5+, 6-, 6+) within 30 years. 2) A site amplification factor varies within 0.5 ~ 3.0 and expectation is 1 based on surface geology map information. 3) A depth of seismic basement down to ~3,000m based on deeper borehole and geological structure. 4) Scenario earthquake maps: By choosing an active fault, one got the average case for different parameters of the modeling. Then choose a case, you got the shaking map of intensity with color scale. "Seismic Hazard Karte tells more hazard" is another app based on website of http://www.j-shis.bosai.go.jp/labs/karte/. (1) For every mesh of 250m x 250m, professional service SHA information is provided over national-world. (2) With five ranks for eight items, comprehensive SHA information could be delivered. (3) Site amplification factor with an average index is given. (4) Deeper geologic structure modeling is provided with borehole profiling. (5) A SHA probability is assessed within 30 and/or 50 years for the given site. (6) Seismic Hazard curves are given for earthquake sources from inland active fault, subduction zone, undetermined and their summarization. (7) The JMA seismic intensities are assessed in long-term averaged periods of 500-years to ~100,000 years. The app of J-SHIS can be downloaded freely from http://www.j-shis.bosai.go.jp/app-jshis.

  5. Effects of casein glycomacropeptide supplementation on growth performance, intestinal morphology, intestinal barrier permeability and inflammatory responses in Escherichia coli K88 challenged piglets

    Directory of Open Access Journals (Sweden)

    Yili Rong

    2015-06-01

    Full Text Available Casein glycomacropeptide (CGMP is a bioactive peptide derived from milk with multiple functions. This study was aimed at evaluating the effects of CGMP as a potential feed additive on growth performance, intestinal morphology, intestinal barrier permeability and inflammatory responses of Escherichia coli K88 (E. coli K88 challenged piglets. Eighteen weaning piglets were randomly assigned to three groups. Control group and K88 challenged group received a basal diet, and CGMP treated group received the basal diet supplemented with 1% of CGMP powder. The trail lasted for 12 days, K88 was orally administered to the piglets of K88 challenged group and CGMP treated group on days 8–10. The results showed that the diet containing 1% CGMP significantly alleviated the decrease in average daily gain (P  0.05 and barrier permeability damage (P < 0.05, and acute inflammatory response (P < 0.05 induced by E. coli K88 infection. In conclusion, CGMP supplementation in the diet protected the weaning piglets against E. coli K88 infection.

  6. Human monoclonal antibody {sup 99m}Tc-88BV59: detection of colorectal cancer, recurrent or metastatic disease and immunogenicity assessment

    Energy Technology Data Exchange (ETDEWEB)

    Krause, B.J. [Department of Nuclear Medicine, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany); Baum, R.P. [Department of Nuclear Medicine, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany); Staib-Sebler, E. [Department of General and Abdominal Surgery, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany); Lorenz, M. [Department of General and Abdominal Surgery, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany); Niesen, A. [Department of Nuclear Medicine, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany); Hoer, G. [Department of Nuclear Medicine, Johann Wolfgang Goethe University Medical Center, Frankfurt/Main (Germany)

    1997-01-01

    This study presents immunoscintigraphic results in 24 patients suffering from primary colorectal cancer, recurrent or metastatic disease after the injection of 1197-1351 MBq technetium-99m labelled totally human monoclonal antibody 88BV59. Labelling efficacy of {sup 99m}Tc-88BV59 ranged from 97% to 99%. Immunoscintigraphy was performed 18-20 h after injection. Scintigraphic findings were compared with those of computed tomography (CT). Patients underwent surgery in order to evaluate immunoscintigraphic findings histologically. Sera of the patients (before injection and 1 and 3 months post infusion) were analysed for the presence of human anti-human antibodies (HAHA). None of the patients showed a HAHA response as assessed by a solid-phase ELISA assay. The antibody scan detected about 25% more lesions than CT. In the detection of extrahepatic disease, the sensitivity of the antibody scan proved to be 68%, whereas the sensitivity of CT was 41%. (orig.). With 3 figs., 1 tab.

  7. 12 CFR 225.88 - How to request the Board to determine that an activity is financial in nature or incidental to a...

    Science.gov (United States)

    2010-01-01

    ... activity is financial in nature or incidental to a financial activity? 225.88 Section 225.88 Banks and... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Financial Holding Companies § 225.88 How to request the Board to determine that an activity is financial in nature or incidental to a financial...

  8. Cryogenic vacuum pumping at the LBL 88-inch cyclotron

    International Nuclear Information System (INIS)

    Elo, D.; Morris, D.; Clark, D.J.; Gough, R.A.

    1978-09-01

    A cryogenic vacuum pumping panel has been in operation at the 88-inch cyclotron since 1974. The nude pumping panel is located in the acceleration chamber. The pumping surface consists of tubing cooled to 20 0 K by a closed loop helium refrigeration system. The pumping surfaces are shielded from radiation heat loads and water vapors by liquid nitrogen cooled baffles. The panel was designed for an average pumping speed of 14,000 liters/sec. for air. This approximately tripled the total effective pumping on the acceleration chamber from the existing diffusion pumped system, significantly reducing charge exchange losses of heavy ions during acceleration. Design, installation and performance characteristics are described

  9. Working Group on Ionising Radiations. Report 1987-88

    International Nuclear Information System (INIS)

    1989-01-01

    The programme of work for 1987/88 by the Working Group on Ionising Radiation, Health and Safety Commision in February 1988, included the main topics of continuing interest and concern in relation to ionising radiations in general and the Ionising Radiations Regulations 1985 (IRR 85) (Ref 1) in particular. These were: emergency dose limitation, occupational dose limitation, practical experience of the principle of keeping doses as low as reasonably practicable, experience of the regulatory requirements in respect of internal dosimetry and the need for a standing advisory committee on ionising radiations. Calibration of radiotherapy equipment was also considered as a matter of principle following a specific incident involving cancer patients. This report of progress during the first year summarises the Group's opinions on each topic and gives recommendations. (author)

  10. Influence on grip of knife handle surface characteristics and wearing protective gloves.

    Science.gov (United States)

    Claudon, Laurent

    2006-11-01

    Ten subjects were asked to apply maximum torques on knife handles with either their bare hand or their hand wearing a Kevlar fibre protective glove. Four knife handles (2 roughnesses, 2 hardnesses) were tested. Surface electromyograms of 6 upper limb and shoulder muscles were recorded and subject opinions on both knife handle hardness and friction in the hand were also assessed. The results revealed the significant influence of wearing gloves (pgloves greatly increased the torque independently of the other two parameters. Under the bare hand condition, a 90 degrees ShA slightly rough handle provided the greatest torque. Subject opinion agreed with the observed effects on recorded torque values except for the hardness factor, for which a preference for the 70 degrees ShA value over the 90 degrees ShA value emerged.

  11. The SCEC Community Modeling Environment(SCEC/CME): A Collaboratory for Seismic Hazard Analysis

    Science.gov (United States)

    Maechling, P. J.; Jordan, T. H.; Minster, J. B.; Moore, R.; Kesselman, C.

    2005-12-01

    The SCEC Community Modeling Environment (SCEC/CME) Project is an NSF-supported Geosciences/IT partnership that is actively developing an advanced information infrastructure for system-level earthquake science in Southern California. This partnership includes SCEC, USC's Information Sciences Institute (ISI), the San Diego Supercomputer Center (SDSC), the Incorporated Institutions for Research in Seismology (IRIS), and the U.S. Geological Survey. The goal of the SCEC/CME is to develop seismological applications and information technology (IT) infrastructure to support the development of Seismic Hazard Analysis (SHA) programs and other geophysical simulations. The SHA application programs developed on the Project include a Probabilistic Seismic Hazard Analysis system called OpenSHA. OpenSHA computational elements that are currently available include a collection of attenuation relationships, and several Earthquake Rupture Forecasts (ERFs). Geophysicists in the collaboration have also developed Anelastic Wave Models (AWMs) using both finite-difference and finite-element approaches. Earthquake simulations using these codes have been run for a variety of earthquake sources. Rupture Dynamic Model (RDM) codes have also been developed that simulate friction-based fault slip. The SCEC/CME collaboration has also developed IT software and hardware infrastructure to support the development, execution, and analysis of these SHA programs. To support computationally expensive simulations, we have constructed a grid-based scientific workflow system. Using the SCEC grid, project collaborators can submit computations from the SCEC/CME servers to High Performance Computers at USC and TeraGrid High Performance Computing Centers. Data generated and archived by the SCEC/CME is stored in a digital library system, the Storage Resource Broker (SRB). This system provides a robust and secure system for maintaining the association between the data seta and their metadata. To provide an easy

  12. Analysis of 88 nephrectomies in a rural tertiary care center of India

    Directory of Open Access Journals (Sweden)

    Biswajit Datta

    2012-01-01

    Full Text Available Nephrectomy is not an uncommon surgery in day-to-day practice of urology. Trauma is the most common cause of emergency nephrectomy. On the other hand, elective nephrectomy is done for both benign and malignant diseases of the kidney. This study has been performed to know the different causes of nephrectomy in a rural, tertiary care center of India. In our series, we have studied all the elective nephrectomies done in our hospital during a period of eight years. We have analyzed 88 cases of nephrectomies regarding their age, sex, laterality of disease, and histopathologic report of the nephrectomy specimens. Out of 88 cases, 61 were males and 27 were females. In our series, 62.5% cases of nephrectomies were done for benign causes and 37.5% cases for malignant causes. Among the benign causes, neglected pelviureteric junction obstruction was the leading cause, followed by calculus disease resulting in obstruction. On the other hand, renal cell carcinoma was the most common malignant pathology requiring nephrectomy.

  13. Multichannel Seismic Reflection Data - SCAR - Antarctic Peninsula 1987-88, SDLS CD-ROM vol 24

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These data are stacked multichannel marine seismic reflection data recorded during 1987-88 in the Antarctic Peninsula, Antarctica, by the Japan National Oil...

  14. Archeointensity study on baked clay samples taken from the reconstructed ancient kiln: implication for validity of the Tsunakawa-Shaw paleointensity method

    Science.gov (United States)

    Yamamoto, Yuhji; Torii, Masayuki; Natsuhara, Nobuyoshi

    2015-05-01

    In 1972, a reconstruction experiment of a kiln had been done to reproduce an excavated kiln of the seventh century in Japan. Baked clay samples were taken from the floor surface and -20 cm level, and they have been stored after determinations of the paleomagnetic directions by partial alternating field demagnetizations. We recently applied the Tsunakawa-Shaw method to the samples to assess how reliable archeointensity results are obtained from the samples. A suite of the rock magnetic experiments and the scanning electron microscope observations elucidate that dominant magnetic carriers of the floor surface samples are Ti-poor titanomagnetite grains in approximately 10 nm size with single-domain and/or super-paramagnetic states, whereas contributions of multi-domain grains seem to be relatively large for the -20-cm level samples. From the floor surface samples, six out of the eight successful results were obtained and they give an average of 47.3 μT with a standard deviation of 2.2 μT. This is fairly consistent with the in situ geomagnetic field of 46.4 μT at the time of the reconstruction. They are obtained with a built-in anisotropy correction using anhysteretic remanent magnetization and without any cooling rate corrections. In contrast, only one out of four was successful from the -20-cm level samples. It yields an archeointensity of 31.6 μT, which is inconsistent with the in situ geomagnetic field. Considering from the in situ temperature record during the firing of the kiln and the unblocking temperature spectra of the samples, the floor surface samples acquired full thermoremanent magnetizations (TRMs) as their natural remanent magnetizations whereas the -20-cm level samples only acquired partial TRMs, and these differences probably cause the difference in the archeointensity results between the two sample groups. For archeointensity researches, baked clay samples from a kiln floor are considered to be ideal materials.

  15. Lack of MyD88 protects the immunodeficient host against fatal lung inflammation triggered by the opportunistic bacteria Burkholderia cenocepacia.

    Science.gov (United States)

    Ventura, Grasiella M de C; Balloy, Viviane; Ramphal, Reuben; Khun, Huot; Huerre, Michel; Ryffel, Bernhard; Plotkowski, Maria-Cristina M; Chignard, Michel; Si-Tahar, Mustapha

    2009-07-01

    Burkholderia cenocepacia is an opportunistic pathogen of major concern for cystic fibrosis patients as well as immunocompromised cancer patients and transplant recipients. The mechanisms by which B. cenocepacia triggers a rapid health deterioration of the susceptible host have yet to be characterized. TLR and their key signaling intermediate MyD88 play a central role in the detection of microbial molecular patterns and in the initiation of an effective immune response. We performed a study to better understand the role of TLR-MyD88 signaling in B. cenocepacia-induced pathogenesis in the immunocompromised host, using an experimental murine model. The time-course of several dynamic parameters, including animal survival, bacterial load, and secretion of critical inflammatory mediators, was compared in infected and immunosuppressed wild-type and MyD88(-/-) mice. Notably, when compared with wild-type mice, infected MyD88(-/-) animals displayed significantly reduced levels of inflammatory mediators (including KC, TNF-alpha, IL-6, MIP-2, and G-CSF) in blood and lung airspaces. Moreover, despite a higher transient bacterial load in the lungs, immunosuppressed mice deficient in MyD88 had an unexpected survival advantage. Finally, we showed that this B. cenocepacia-induced life-threatening infection of wild-type mice involved the proinflammatory cytokine TNF-alpha and could be prevented by corticosteroids. Altogether, our findings demonstrate that a MyD88-dependent pathway can critically contribute to a detrimental host inflammatory response that leads to fatal pneumonia.

  16. Highly efficient Fenton and enzyme-mimetic activities of NH2-MIL-88B(Fe) metal organic framework for methylene blue degradation.

    Science.gov (United States)

    He, Jianchuan; Zhang, Yao; Zhang, Xiaodan; Huang, Yuming

    2018-03-26

    Here, we show that NH 2 -MIL-88B(Fe) can be used as a peroxidase-like catalyst for Fenton-like degradation of methylene blue (MB) in water. The iron-based NH 2 -MIL-88B(Fe) metal organic framework (MOF) was synthesized by a facile and rapid microwave heating method. It was characterized by scanning electron microscopy, Fourier transform infrared spectroscopy, powder X-ray diffraction, and the Brunauer-Emmett-Teller method. The NH 2 -MIL-88B(Fe) MOF possesses intrinsic oxidase-like and peroxidase-like activities. The reaction parameters that affect MB degradation were investigated, including the solution pH, NH 2 -MIL-88B(Fe) MOF and H 2 O 2 concentrations, and temperature. The results show that the NH 2 -MIL-88B(Fe) MOF exhibits a wide working pH range (pH 3.0-11.0), temperature tolerance, and good recyclability for MB removal. Under the optimal conditions, complete removal of MB was achieved within 45 min. In addition, removal of MB was above 80% after five cycles, showing the good recyclability of NH 2 -MIL-88B(Fe). The NH 2 -MIL-88B(Fe) MOF has the features of easy preparation, high efficiency, and good recyclability for MB removal in a wide pH range. Electron spin resonance and fluorescence probe results suggest the involvement of hydroxyl radicals in MB degradation. These findings provide new insight into the application of high-efficient MOF-based Fenton-like catalysts for water purification.

  17. Improved security analysis of Fugue-256 (poster)

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Knudsen, Lars Ramkilde; Bagheri, Nasoor

    2011-01-01

    We present some improved analytical results as part of the ongoing work on the analysis of Fugue-256 hash function, a second round candidate in the NIST's SHA3 competition. First we improve Aumasson and Phans' integral distinguisher on the 5.5 rounds of the final transformation of Fugue-256 to 16...

  18. African Journal for Physical Activity and Health Sciences - Vol 17 ...

    African Journals Online (AJOL)

    Prevalence of risk factors for sudden cardiac death in competitive South African student athletes · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Bakkum, C Bresler, L Nortie, I Shaw, BS Shaw, 581-590 ...

  19. 27-Oxygenated cholesterol induces expression of CXCL8 in macrophages via NF-κB and CD88

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sun-Mi, E-mail: lala1647@hanmail.net [Department of Pharmacology, Pusan National University, School of Medicine, Yangsan, Gyeongnam 626-870 (Korea, Republic of); Lee, Chung Won, E-mail: vasculardoctorlee@gmail.com [Department of Thoracic and Cardiovascular Surgery, Pusan National University Hospital, Pusan 602-739 (Korea, Republic of); Kim, Bo-Young, E-mail: kimboyoung@pusan.ac.kr [Department of Pharmacology, Pusan National University, School of Medicine, Yangsan, Gyeongnam 626-870 (Korea, Republic of); Jung, Young-Suk, E-mail: youngjung@pusan.ac.kr [College of Pharmacy, Pusan National University, Busan 609-735 (Korea, Republic of); Eo, Seong-Kug, E-mail: vetvirus@chonbuk.ac.kr [College of Veterinary Medicine and Bio-Safety Research Institute, Chonbuk National University, Iksan, Jeonbuk 570-752 (Korea, Republic of); Park, Young Chul, E-mail: ycpark@pusan.ac.kr [Department of Microbiology & Immunology, Pusan National University, School of Medicine, Yangsan, Gyeongnam 626-870 (Korea, Republic of); Kim, Koanhoi, E-mail: koanhoi@pusan.ac.kr [Department of Pharmacology, Pusan National University, School of Medicine, Yangsan, Gyeongnam 626-870 (Korea, Republic of)

    2015-08-07

    We attempted to determine the effects of a milieu rich in cholesterol molecules on expression of chemokine CXCL8. A high-cholesterol diet led to an increased transcription of the IL-8 gene in the arteries and elevated levels of CXCL8 in sera of ApoE{sup −/−} mice, compared with those of wild-type C57BL/6 mice. Treatment of THP-1 monocyte/macrophage cells with 27-hydroxycholesterol (27OHChol) resulted in transcription of the IL-8 gene and increased secretion of its corresponding gene product whereas cholesterol did not induce expression of CXCL8 in THP-1 cells. 27OHChol-induced transcription of the IL-8 gene was blocked by cycloheximide, but not by polymyxin B. Treatment of THP-1 cells with 27OHChol caused translocation of p65 NF-κB subunit into the nucleus and up-regulation of CD88. Inhibition of NF-κB and CD88 using SN50 and W-54011, respectively, resulted in reduced transcription of the IL-8 gene and attenuated secretion of CXCL8 induced by 27OHChol. We propose that oxidatively modified cholesterol like 27OHChol, rather than cholesterol, is responsible for sustained expression of CXCL8 in monocytes/macrophages in atherosclerotic arteries. - Highlights: • Consumption of a high-cholesterol diet leads to increased CXCL8 expression in ApoE{sup −/−} mice. • 27OHChol, but not cholesterol, up-regulates expression of CXCL8 in macrophages. • 27OHChol enhances nuclear translocation of NF-κB and expression of CD88 in macrophages. • Inhibition of NF-κB or CD88 results in decreased CXCL8 expression induced by 27OHChol. • 27OHChol up-regulates CXCL8 expression via NF-κB and CD88 in macrophages.

  20. Subscales correlations between MSSS-88 and PRISM scales in evaluation of spasticity for patients with multiple sclerosis

    Directory of Open Access Journals (Sweden)

    Knežević Tatjana

    2017-01-01

    Full Text Available Introduction/Objective. Patient-reported outcomes have been recognized as an important way of assessing health and well-being of patients with multiple sclerosis (MS. The aim of the study is to determine the correlation between different subscales of Patient-Reported Impact of Spasticity Measure (PRISM and Multiple Sclerosis Spasticity Scale (MSSS-88 scales in the estimation of spasticity influence on different domains Methods. The study is a cross-sectional observational study. MSSS-88 and PRISM scales were analyzed in five domains (body-function domain, activity domain, participation domain, personal factors/wellbeing domain, and hypothesis. For statistical interpretation of the correlation we performed the Spearman’s ρ-test, concurrent validity, divergent validity, and the linear regression model. Results. We found a significant correlation between subscales of evaluated MSSS-88 and PRISM scales for body domains; the highest correlation was between the need for assistance/positioning (NA/P and walking (W. Spasticity has the weakest correlation with the need for intervention (NI. The presence of pain has a negative impact and significant positive correlation between pain discomfort and NI. In the domain of body function for males, there was a non-significant correlation between muscle spasms and NI. The same applies for social functioning and social embarrassment domains, as well as for emotional health and psychological agitation for personal factors / wellbeing domain. The differences between genders of MS patients persist in different domains; muscle spasms are strong predictors for NI, and body movement is a strong predictor versus W for NA/P. Conclusion. MSSS-88 and PRISM scales can be considered reliable in measuring different domains of disability for MS patients with spasticity. Because it is shorter, quicker, and simple to use, it is concluded that the PRISM scale can successfully compete with and replace the MSSS-88 scale in

  1. The TLR13-MyD88-NF-κB signalling pathway of Cyclina sinensis plays vital roles in innate immune responses.

    Science.gov (United States)

    Ren, Yipeng; Ding, Dan; Pan, Baoping; Bu, Wenjun

    2017-11-01

    Toll-like receptors, the best known pattern recognition receptors, play important roles in recognizing non-self molecules and binding pathogen-associated molecular patterns in the innate immune system. In the present research, the cDNA and protein characterization of the TLR signalling pathway genes including IRAK4, TRAK6 and IKKα (named CsIRAK4, CsTRAF6 and CsIKKα, respectively) with the typical motifs from Cyclina sinensis showed significant similarity with their homologues from other shellfish. Furthermore, the mRNA transcripts of these three genes are ubiquitously expressed in all tissues tested and are dominantly expressed in C. sinensis haemocytes (P sinensis by RNA interference and immune challenges. The results suggested the mRNA expression patterns of CsMyD88, CsIRAK4, CsTRAF6, CsIKKα, CsIκB, CsNF-κB, CsC-LYZ and CsAMP were all down-regulated (P sinensis haemocytes, revealing the involvement of the TLR13-MyD88-NF-κB signalling pathway in innate immunity by positively adjusting internal signalling factors and immune-related genes. In summary, a TLR13-MyD88-NF-κB signalling pathway exists and plays vital roles in innate immune responses in C. sinensis. These findings collectively lay the foundation for studying the functional characterization of internal signalling factors and establishing a regulatory network for the TLR signalling pathway in molluscs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Environmental Assessment for Building 88 Interior Demolition, Pearl Harbor Naval Complex, O'ahu, Hawaii

    National Research Council Canada - National Science Library

    2005-01-01

    ...) and ancillary equipment from the interior of Building 88, a former lubricating oil storage facility, and the related exposed piping underneath Mike wharves M3 and M4 at Merry Point, Pearl Harbor Naval Complex...

  3. Inflammation- and tumor-induced anorexia and weight loss require MyD88 in hematopoietic/myeloid cells but not in brain endothelial or neural cells.

    Science.gov (United States)

    Ruud, Johan; Wilhelms, Daniel Björk; Nilsson, Anna; Eskilsson, Anna; Tang, Yan-Juan; Ströhle, Peter; Caesar, Robert; Schwaninger, Markus; Wunderlich, Thomas; Bäckhed, Fredrik; Engblom, David; Blomqvist, Anders

    2013-05-01

    Loss of appetite is a hallmark of inflammatory diseases. The underlying mechanisms remain undefined, but it is known that myeloid differentiation primary response gene 88 (MyD88), an adaptor protein critical for Toll-like and IL-1 receptor family signaling, is involved. Here we addressed the question of determining in which cells the MyD88 signaling that results in anorexia development occurs by using chimeric mice and animals with cell-specific deletions. We found that MyD88-knockout mice, which are resistant to bacterial lipopolysaccharide (LPS)-induced anorexia, displayed anorexia when transplanted with wild-type bone marrow cells. Furthermore, mice with a targeted deletion of MyD88 in hematopoietic or myeloid cells were largely protected against LPS-induced anorexia and displayed attenuated weight loss, whereas mice with MyD88 deletion in hepatocytes or in neural cells or the cerebrovascular endothelium developed anorexia and weight loss of similar magnitude as wild-type mice. Furthermore, in a model for cancer-induced anorexia-cachexia, deletion of MyD88 in hematopoietic cells attenuated the anorexia and protected against body weight loss. These findings demonstrate that MyD88-dependent signaling within the brain is not required for eliciting inflammation-induced anorexia. Instead, we identify MyD88 signaling in hematopoietic/myeloid cells as a critical component for acute inflammatory-driven anorexia, as well as for chronic anorexia and weight loss associated with malignant disease.

  4. Shavian / Pent Nurmekund

    Index Scriptorium Estoniae

    Nurmekund, Pent, 1906-1996

    1997-01-01

    G. B. Shaw' näidendi "Androkles ja lõvi" ilmus erilises foneetilises tähestikus, mille lõid Kingsley Read ja Peter MacCarthy, täites G. B. Shaw' testamendi ühte punkti. Varem ilm. ajal. Edasi, 1962, 18. dets.

  5. RAS1, a quantitative trait locus for salt tolerance and ABA sensitivity in Arabidopsis

    KAUST Repository

    Ren, Zhonghai

    2010-03-08

    Soil salinity limits agricultural production and is a major obstacle for feeding the growing world population. We used natural genetic variation in salt tolerance among different Arabidopsis accessions to map a major quantitative trait locus (QTL) for salt tolerance and abscisic acid (ABA) sensitivity during seed germination and early seedling growth. A recombinant inbred population derived from Landsberg erecta (Ler; salt and ABA sensitive) x Shakdara (Sha; salt and ABA resistant) was used for QTL mapping. High-resolution mapping and cloning of this QTL, Response to ABA and Salt 1 (RAS1), revealed that it is an ABA- and salt stress-inducible gene and encodes a previously undescribed plant-specific protein. A premature stop codon results in a truncated RAS1 protein in Sha. Reducing the expression of RAS1 by transfer-DNA insertion in Col or RNA interference in Ler leads to decreased salt and ABA sensitivity, whereas overexpression of the Ler allele but not the Sha allele causes increased salt and ABA sensitivity. Our results suggest that RAS1 functions as a negative regulator of salt tolerance during seed germination and early seedling growth by enhancing ABA sensitivity and that its loss of function contributes to the increased salt tolerance of Sha.

  6. Status and trends of native birds in the Keauhou and Kilauea forest, Hawai`i Island.

    Science.gov (United States)

    Camp, Richard J.; Jacobi, James D.; Pratt, Thane K.; Gorresen, P. Marcos; Rubenstein, Tanya

    2010-01-01

    A Safe Harbor Agreement (SHA) is a voluntary arrangement between the U.S. Fish and Wildlife Service and non-Federal landowners to promote the protection, conservation, and recovery of listed species without imposing further land use restrictions on the landowners. Kamehameha Schools is considering entering into a SHA for their Keauhou and Kīlauea Forest lands on the island of Hawai′i. Bird surveys were conducted in 2008 to determine the current occurrence and density of listed species for the Keauhou and Kīlauea Forest, a prerequisite for establishing an agreement. Because of different management practices in the proposed SHA area we stratified the survey data into intact and altered forest strata. The listed passerines—′Akiapōlā′au (Hemignathus munroi), Hawai′i Creeper (Oreomystis mana), and Hawai′i ′Ākepa (Loxops coccineus)—occur in both strata but at low densities. The endangered ′Io (Hawaiian Hawk; Buteo solitarius) also occurs within both strata at low densities. This report was prepared for the U.S. Fish and Wildlife Service and Kamehameha Schools to provide information they can use to establish baseline levels for the SHA. In addition, we describe the status and trends of the non-listed native birds.

  7. Boxb mediate BALB/c mice corneal inflammation through a TLR4/MyD88-dependent signaling pathway in Aspergillus fumigatus keratitis

    Directory of Open Access Journals (Sweden)

    Min Liu

    2018-04-01

    Full Text Available AIM: To investigate whether high-mobility group box 1 (HMGB1 Boxb exacerbates BALB/c mice corneal immune responses and inflammatory through the Toll-like receptor 4 (TLR4/myeloid differentiation primary response 88 (MyD88-dependent signaling pathway in Aspergillus fumigatus (A. fumigatus keratitis. METHODS: The mice corneas were pretreated with phosphate buffer saline (PBS, Boxb before A. fumigatus infection. The abdominal cavity extracted macrophages were pretreated with PBS, Boxb, TLR4 inhibitor (CLI-095, Dimethyl sulfoxide (DMSO separately before A. fumigatus hyphae stimulation. HMGB1 was detected in normal and infected mice corneas and macrophages by real-time reverse transcriptase polymerase chain reaction (RT-PCR, the TLR4, MyD88, interleukin-1β (IL-1β, tumor necrosis factor-α (TNF-α were detected by Western blot and PCR. RESULTS: In BALB/c mice corneas, the expressions of TLR4, HMGB1, IL-1β, TNF-α were increased after A. fumigatus infection. While pretreatment with Boxb significantly increased the expressions of TLR4, HMGB1, MyD88, IL-1β, TNF-α compared with PBS control after infection. In BALB/c mice abdominal cavity extracted macrophages, pretreatment with Boxb increased the expressions of TLR4, HMGB1, MyD88, IL-1β, TNF-α, while pretreatment with CLI-095 and Boxb significantly decreased the expressions of TLR4, HMGB1, MyD88, IL-1β, TNF-α. CONCLUSION: In A. fumigatus keratitis, Boxb play a pro-inflammatory role in corneal anti-fungi immune response through the HMGB1-TLR4-MyD88 signal pathway.

  8. The absence of MyD88 has no effect on the induction of alternatively activated macrophage during Fasciola hepatica infection

    Directory of Open Access Journals (Sweden)

    Luo HongLin

    2011-11-01

    Full Text Available Abstract Background Alternatively activated macrophages (AAMϕ play important roles in allergies and responses to parasitic infections. However, whether signaling through toll-like receptors (TLRs plays any role in AAMϕ induction when young Fasciola hepatica penetrates the liver capsule and migrates through the liver tissue is still unclear. Results The data show that the lack of myeloid differentiation factor 88 (MyD88 has no effect on the AAMϕ derived from the bone marrow (BMMϕ in vitro and does not impair the mRNA expression of arginase-1, resistin-like molecule (RELMα, and Ym1 in BMMϕs. The Th2 cytokine production bias in splenocytes was not significantly altered in F. hepatica-infected mice in the absence of MyD88 in vitro and in the pleural cavity lavage in vivo. In addition, MyD88-deficiency has no effect on the arginase production of the F. hepatica elicited macrophages (Fe Mϕs, production of RELMα and Ym1 proteins and mRNA expression of Ym1 and RELMα of macrophages in the peritoneal cavity 6 weeks post F. hepatica infection. Conclusions The absence of MyD88 has no effect on presence of AAMϕ 6 weeks post F. hepatica infection.

  9. “If it is a tear let it be a tear, not a laceration”: Form J88 as evidence ...

    African Journals Online (AJOL)

    The availability of the J88 form in court is believed to convey the precise clinical description of the woman's injuries as it is seen as prima facie evidence. This article reports how the J88 form is used in prosecution of violence against women (VAW). A four-phased sensory ethnographic design that used courtscapes, ...

  10. Com traduir i modificar un dels formats bibliogràfics de RefWorks al castellà

    OpenAIRE

    Feliu, M. Àngels

    2010-01-01

    L'ús de gestors de referències com RefWorks agilitza el treball dels autors però el seu ús en castellà presenta dificultats a causa de la seva construcció original en anglès. Per això, un dels formats de RefWorks s'ha adaptat a les normes gramaticals i ortogràfiques del castellà i s'ha posat a disposició de la comunitat científica.

  11. Bacterial lipoprotein-induced self-tolerance and cross-tolerance to LPS are associated with reduced IRAK-1 expression and MyD88-IRAK complex formation.

    LENUS (Irish Health Repository)

    Li, Chong Hui

    2012-02-03

    Tolerance to bacterial cell-wall components may represent an essential regulatory mechanism during bacterial infection. We have demonstrated previously that the inhibition of nuclear factor (NF)-kappaB and mitogen-activated protein kinase activation was present in bacterial lipoprotein (BLP) self-tolerance and its cross-tolerance to lipopolysaccharide (LPS). In this study, the effect of BLP-induced tolerance on the myeloid differentiation factor 88 (MyD88)-dependent upstream signaling pathway for NF-kappaB activation in vitro was examined further. When compared with nontolerant human monocytic THP-1 cells, BLP-tolerant cells had a significant reduction in tumor necrosis factor alpha (TNF-alpha) production in response to a high-dose BLP (86+\\/-12 vs. 6042+\\/-245 ng\\/ml, P < 0.01) or LPS (341+\\/-36 vs. 7882+\\/-318 ng\\/ml, P < 0.01) stimulation. The expression of Toll-like receptor 2 (TLR2) protein was down-regulated in BLP-tolerant cells, whereas no significant differences in TLR4, MyD88, interleukin-1 receptor-associated kinase 4 (IRAK-4), and TNF receptor-associated factor 6 expression were observed between nontolerant and BLP-tolerant cells, as confirmed by Western blot analysis. The IRAK-1 protein was reduced markedly in BLP-tolerant cells, although IRAK-1 mRNA expression remained unchanged as revealed by real-time reverse transcriptase-polymerase chain reaction analysis. Furthermore, decreased MyD88-IRAK immunocomplex formation, as demonstrated by immunoprecipitation, was observed in BLP-tolerant cells following a second BLP or LPS stimulation. BLP pretreatment also resulted in a marked inhibition in total and phosphorylated inhibitor of kappaB-alpha (IkappaB-alpha) expression, which was not up-regulated by subsequent BLP or LPS stimulation. These results demonstrate that in addition to the down-regulation of TLR2 expression, BLP tolerance is associated with a reduction in IRAK-1 expression, MyD88-IRAK association, and IkappaB-alpha phosphorylation. These

  12. FY 1988 scientific and technical reports, articles, papers and presentations

    Science.gov (United States)

    Turner, Joyce E. (Compiler)

    1988-01-01

    This document presents formal NASA technical reports, papers published in technical journals, and presentations by MSFC personnel in FY 88. It also includes papers of MSFC contractors. After being announced in STAR, all of the NASA series reports may be obtained from the NationaL Technical Information Service, 5285 Port Royal Road, Springfield, VA 22161. The information in this report may be of value to the scientific and engineering community in determining what information has been published and what is available.

  13. 75 FR 57532 - In the Matter of: Stone & Webster Construction, Inc.; Confirmatory Order (Effective Immediately)

    Science.gov (United States)

    2010-09-21

    ... Any person adversely affected by this Confirmatory Order, other than Shaw, may request a hearing... Safety Conscious Work Environment (SCWE) and Safety Culture: At the parent company, The Shaw Group Inc... performance evaluations; Periodic independent culture surveys. For nuclear maintenance sites: A SCWE Procedure...

  14. Structural complementarity of Toll/interleukin-1 receptor domains in Toll-like receptors and the adaptors Mal and MyD88.

    Science.gov (United States)

    Dunne, Aisling; Ejdeback, Mikael; Ludidi, Phumzile L; O'Neill, Luke A J; Gay, Nicholas J

    2003-10-17

    The Toll/interleukin 1 receptor (TIR) domain is a region found in the cytoplasmic tails of members of the Toll-like receptor/interleukin-1 receptor superfamily. The domain is essential for signaling and is also found in the adaptor proteins Mal (MyD88 adaptor-like) and MyD88, which function to couple activation of the receptor to downstream signaling components. Experimental structures of two Toll/interleukin 1 receptor domains reveal a alpha-beta-fold similar to that of the bacterial chemotaxis protein CheY, and other evidence suggests that the adaptors can make heterotypic interactions with both the receptors and themselves. Here we show that the purified TIR domains of Mal and MyD88 can form stable heterodimers and also that Mal homodimers and oligomers are dissociated in the presence of ATP. To identify structural features that may contribute to the formation of signaling complexes, we produced models of the TIR domains from human Toll-like receptor 4 (TLR4), Mal, and MyD88. We found that although the overall fold is conserved the electrostatic surface potentials are quite distinct. Docking studies of the models suggest that Mal and MyD88 bind to different regions in TLRs 2 and 4, a finding consistent with a cooperative role of the two adaptors in signaling. Mal and MyD88 are predicted to interact at a third non-overlapping site, suggesting that the receptor and adaptors may form heterotetrameric complexes. The theoretical model of the interactions is supported by experimental data from glutathione S-transferase pull-downs and co-immunoprecipitations. Neither theoretical nor experimental data suggest a direct role for the conserved proline in the BB-loop in the association of TLR4, Mal, and MyD88. Finally we show a sequence relationship between the Drosophila protein Tube and Mal that may indicate a functional equivalence of these two adaptors in the Drosophila and vertebrate Toll pathways.

  15. Permanent magnets prepared from Sm10.5Fe88.5Zr1.0Ny without homogenization

    International Nuclear Information System (INIS)

    Gebel, B.; Kubis, M.; Mueller, K.-H.

    1997-01-01

    In as-cast Sm 2 Fe 17 the high amount of α-Fe caused by a peritectic reaction can be considerably reduced by a small addition of about 1 at% Zr. X-ray diffraction showed that as-cast Sm 10.5 Fe 88.5 Zr 1.0 mainly consists of a phase with the Th 2 Zn 17 -type structure and SmFe 3 . Non-homogenized Sm 10.5 Fe 88.5 Zr 1.0 was milled and (i) annealed in vacuum or (ii) treated with a hydrogenation-disproportionation-desorp tion-recombination (HDDR) process. The annealed and subsequently nitrogenated powder is magnetically anisotropic and has a coercivity μ 0J H C up to 2.0 T and an energy product (BH) max up to 136 kJ/m 3 . HDDR-treated and nitrogenated powder is isotropic and exhibits values of μ 0J H C = 3.1 T and (BH) max 103 kJ/m 3 . Consequently, Sm 10.5 Fe 88.5 Zr 1.0 N y (y ∼ 16) permanent magnets with very good properties can be prepared without the time-consuming homogenization procedure. (orig.)

  16. Contrasting Inducible Knockdown of the Auxiliary PTEX Component PTEX88 in P. falciparum and P. berghei Unmasks a Role in Parasite Virulence.

    Directory of Open Access Journals (Sweden)

    Scott A Chisholm

    Full Text Available Pathogenesis of malaria infections is linked to remodeling of erythrocytes, a process dependent on the trafficking of hundreds of parasite-derived proteins into the host erythrocyte. Recent studies have demonstrated that the Plasmodium translocon of exported proteins (PTEX serves as the central gateway for trafficking of these proteins, as inducible knockdown of the core PTEX constituents blocked the trafficking of all classes of cargo into the erythrocyte. However, the role of the auxiliary component PTEX88 in protein export remains less clear. Here we have used inducible knockdown technologies in P. falciparum and P. berghei to assess the role of PTEX88 in parasite development and protein export, which reveal that the in vivo growth of PTEX88-deficient parasites is hindered. Interestingly, we were unable to link this observation to a general defect in export of a variety of known parasite proteins, suggesting that PTEX88 functions in a different fashion to the core PTEX components. Strikingly, PTEX88-deficient P. berghei were incapable of causing cerebral malaria despite a robust pro-inflammatory response from the host. These parasites also exhibited a reduced ability to sequester in peripheral tissues and were removed more readily from the circulation by the spleen. In keeping with these findings, PTEX88-deficient P. falciparum-infected erythrocytes displayed reduced binding to the endothelial cell receptor, CD36. This suggests that PTEX88 likely plays a specific direct or indirect role in mediating parasite sequestration rather than making a universal contribution to the trafficking of all exported proteins.

  17. Heme activates TLR4-mediated inflammatory injury via MyD88/TRIF signaling pathway in intracerebral hemorrhage

    Directory of Open Access Journals (Sweden)

    Lin Sen

    2012-03-01

    Full Text Available Abstract Background Inflammatory injury plays a critical role in intracerebral hemorrhage (ICH-induced neurological deficits; however, the signaling pathways are not apparent by which the upstream cellular events trigger innate immune and inflammatory responses that contribute to neurological impairments. Toll-like receptor 4 (TLR4 plays a role in inflammatory damage caused by brain disorders. Methods In this study, we investigate the role of TLR4 signaling in ICH-induced inflammation. In the ICH model, a significant upregulation of TLR4 expression in reactive microglia has been demonstrated using real-time RT-PCR. Activation of microglia was detected by immunohistochemistry, cytokines were measured by ELISA, MyD88, TRIF and NF-κB were measured by Western blot and EMSA, animal behavior was evaluated by animal behavioristics. Results Compared to WT mice, TLR4−/− mice had restrained ICH-induced brain damage showing in reduced cerebral edema and lower neurological deficit scores. Quantification of cytokines including IL-6, TNF-α and IL-1β and assessment of macrophage infiltration in perihematoma tissues from TLR4−/−, MyD88−/− and TRIF−/− mice showed attenuated inflammatory damage after ICH. TLR4−/− mice also exhibited reduced MyD88 and TRIF expression which was accompanied by decreased NF-κB activity. This suggests that after ICH both MyD88 and TRIF pathways might be involved in TLR4-mediated inflammatory injury possibly via NF-κB activation. Exogenous hemin administration significantly increased TLR4 expression and microglial activation in cultures and also exacerbated brain injury in WT mice but not in TLR4−/− mice. Anti-TLR4 antibody administration suppressed hemin-induced microglial activation in cultures and in the mice model of ICH. Conclusions Our findings suggest that heme potentiates microglial activation via TLR4, in turn inducing NF-κB activation via the MyD88/TRIF signaling pathway, and ultimately

  18. Cryptanalysis of the 10-Round Hash and Full Compression Function of SHAvite-3-512

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Leurent, Gaëtan; Mendel, Florian

    2010-01-01

    In this paper, we analyze SHAvite-3-512 hash function, as proposed for round 2 of the SHA-3 competition. We present cryptanalytic results on 10 out of 14 rounds of the hash function SHAvite-3-512, and on the full 14 round compression function of SHAvite-3-512. We show a second preimage attack on ...

  19. The double Laplacian growth

    International Nuclear Information System (INIS)

    Loutsenko, I.; Yermolayeva, O.

    2008-06-01

    The dynamics of the idealized Laplacian growth (or the Hele-Shaw problem) can be approximated by the Poiselle flow which in appropriate units takes the form of the Darcy law. In this paper we account for the liquid inertia in the Hele-Shaw problem at zero surface tension limit. The Laplace dynamics for the pressure is extended here with one more for the velocity potential for which we call this growth process the Double Laplacian. The application of the conformal mappings technique leads to doubled dynamics for both the conformal map and the complex potential, which is presented in the paper for the radial and the planar growth. We apply the stability analysis and discuss the integrability for the stated problem. (author)

  20. Inhibition of IL-1R1/MyD88 signalling promotes mesenchymal stem cell-driven tissue regeneration.

    Science.gov (United States)

    Martino, Mikaël M; Maruyama, Kenta; Kuhn, Gisela A; Satoh, Takashi; Takeuchi, Osamu; Müller, Ralph; Akira, Shizuo

    2016-03-22

    Tissue injury and the healing response lead to the release of endogenous danger signals including Toll-like receptor (TLR) and interleukin-1 receptor, type 1 (IL-1R1) ligands, which modulate the immune microenvironment. Because TLRs and IL-1R1 have been shown to influence the repair process of various tissues, we explored their role during bone regeneration, seeking to design regenerative strategies integrating a control of their signalling. Here we show that IL-1R1/MyD88 signalling negatively regulates bone regeneration, in the mouse. Furthermore, IL-1β which is released at the bone injury site, inhibits the regenerative capacities of mesenchymal stem cells (MSCs). Mechanistically, IL-1R1/MyD88 signalling impairs MSC proliferation, migration and differentiation by inhibiting the Akt/GSK-3β/β-catenin pathway. Lastly, as a proof of concept, we engineer a MSC delivery system integrating inhibitors of IL-1R1/MyD88 signalling. Using this strategy, we considerably improve MSC-based bone regeneration in the mouse, demonstrating that this approach may be useful in regenerative medicine applications.

  1. Critical role of macrophages and their activation via MyD88-NFκB signaling in lung innate immunity to Mycoplasma pneumoniae.

    Directory of Open Access Journals (Sweden)

    Jen-Feng Lai

    2010-12-01

    Full Text Available Mycoplasma pneumoniae (Mp, a common cause of pneumonia, is associated with asthma; however, the mechanisms underlying this association remain unclear. We investigated the cellular immune response to Mp in mice. Intranasal inoculation with Mp elicited infiltration of the lungs with neutrophils, monocytes and macrophages. Systemic depletion of macrophages, but not neutrophils, resulted in impaired clearance of Mp from the lungs. Accumulation and activation of macrophages were decreased in the lungs of MyD88(-/- mice and clearance of Mp was impaired, indicating that MyD88 is a key signaling protein in the anti-Mp response. MyD88-dependent signaling was also required for the Mp-induced activation of NFκB, which was essential for macrophages to eliminate the microbe in vitro. Thus, MyD88-NFκB signaling in macrophages is essential for clearance of Mp from the lungs.

  2. Water-resources activities in New York, 1987-88

    Science.gov (United States)

    Marshall, Mary P.; Finch, Anne J.

    1988-01-01

    The U.S. Geological Survey conducted more than 35 water resources projects in New York in 1987-88. These studies, done largely through cooperative joint-funding programs with the state, County, and local agencies, encompass statewide networks of measurement stations that provide continuous records of streamflow, groundwater levels, and water quality; they also address regional and local problems as well as critical problems of national scope. Some of the questions addressed by these studies are the effect of sewers on groundwater levels and streamflow on Long Island; the occurrence and transport of PCB residues within the upper Hudson River basin; the effect of acid rain on streams in the Catskill Mountains; the frequency and magnitude of floods statewide; the role of wetlands in improving the chemical quality of landfill leachate; the direction of groundwater movement from waste disposal sites near the Niagara River; and the location and potential well yields of stratified-drift aquifers in upstate New York. (USGS)

  3. Root growth of Cynodon dactylon and Eleusine indica collected from motorways at different concentrations of lead.

    Science.gov (United States)

    Wong, M H; Lau, W M

    1985-04-01

    An ecological survey was conducted on the roadside vegetation at three different sites: Tai Po, a commercial and residential area (average annual daily traffic (AADT) = 23730; and Shek O and Wu Kai Sha, recreational areas (AADT = 1590 and 20, respectively). Cynodon dactylon and Eleusine indica were the two most dominant species recorded. The Tai Po site had higher Pb contents in both soil and plant, followed by Shek O, and then Wu Kai Sha. Tillers of C. dactylon and E. indica from the three sites were subjected to a series concentrations of Pb(NO3)2. By comparing their indexes of tolerance and values of 14-day EC50 (effective concentration reducing the normal root growth by 50%), roadside populations of the two grasses collected from Tai Po and Shek O, especially the former one, were more tolerant to elevated levels of Pb compared with those collected from Wu Kai Sha.

  4. Comparing the Age-Friendliness of Different Neighbourhoods Using District Surveys: An Example from Hong Kong.

    Science.gov (United States)

    Wong, Moses; Chau, Pui Hing; Cheung, Francis; Phillips, David R; Woo, Jean

    2015-01-01

    To address the age-friendliness of living environment in cities, the World Health Organization (WHO) launched the "Age-friendly cities" (AFC) initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed. Two quantitative studies on AFC conducted in two Hong Kong districts-Sha Tin and Tuen Mun-were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO's AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores. Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores. District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and infrastructure and higher socio-economic status, but lower

  5. Computed tomography (CT) findings in 88 neurofibromatosis 1 (NF1) patients: Prevalence rates and correlations of thoracic findings

    International Nuclear Information System (INIS)

    Ueda, Ken; Honda, Osamu; Satoh, Yukihisa; Kawai, Misa; Gyobu, Tomoko; Kanazawa, Toru; Hidaka, Shojiro; Yanagawa, Masahiro; Sumikawa, Hiromitsu; Tomiyama, Noriyuki

    2015-01-01

    Highlights: • Various thoracic CT findings, including cysts, mediastinal masses, etc. were found. • Cysts show upper and peripheral dominant distribution. • The number, size, and distribution of the pulmonary cysts in NF-1 revealed significant correlation. • It is suspected that thoracic CT findings in NF-1 occur independently. - Abstract: Purpose: To evaluate the prevalence rates and the correlations of thoracic computed tomography (CT) findings of neurofibromatosis 1 (NF1) in 88 patients. Materials and methods: Chest CT images of 88 NF1 patients were independently reviewed by three observers, and the CT findings were evaluated. If abnormal findings were present, their number, size, and distribution were recorded. The prevalence rate of each CT finding was calculated, and the correlations between CT findings were analyzed. Results: Of the 88 cases, 13 were positive for cysts, 16 for emphysema, 8 for nodules, 8 for GGNs (ground glass nodules), 13 for mediastinal masses, 20 for scoliosis, 44 for subcutaneous nodules, and 34 for skin nodules. Cysts showed upper and peripheral dominant distributions. Regarding 13 mediastinal masses, 2 were diagnosed as malignant peripheral nerve sheath tumors (MPNSTs), 1 was diagnosed as primary lung cancer, 2 were diagnosed as lateral meningocele, 3 were diagnosed as neurofibromas, and the remaining 7 were considered neurofibromas. There was a significant correlation between the prevalence of subcutaneous nodules and that of skin nodules. Significant positive correlations were also seen between size and number, size and rate of central distribution, and number and rate of central distribution of cysts. Conclusion: Various CT findings were found in NF-1 patients, and the prevalence rates of subcutaneous and skin nodules were higher than other findings. Though the prevalence rates of subcutaneous nodules and skin nodules were significantly correlated, the other CT findings in NF-1 occurred independently. The number, size, and

  6. Computed tomography (CT) findings in 88 neurofibromatosis 1 (NF1) patients: Prevalence rates and correlations of thoracic findings

    Energy Technology Data Exchange (ETDEWEB)

    Ueda, Ken, E-mail: k-ueda@radiol.med.osaka-u.ac.jp [Department of Radiology, Osaka University Graduate School of Medicine (Japan); Honda, Osamu [Department of Radiology, Osaka University Graduate School of Medicine (Japan); Satoh, Yukihisa [Department of Diagnostic Radiology, Osaka Medical Center for Cancer and Cardiovascular Diseases (Japan); Kawai, Misa; Gyobu, Tomoko; Kanazawa, Toru; Hidaka, Shojiro; Yanagawa, Masahiro [Department of Radiology, Osaka University Graduate School of Medicine (Japan); Sumikawa, Hiromitsu [Department of Diagnostic Radiology, Osaka Rosai Hospital (Japan); Tomiyama, Noriyuki [Department of Radiology, Osaka University Graduate School of Medicine (Japan)

    2015-06-15

    Highlights: • Various thoracic CT findings, including cysts, mediastinal masses, etc. were found. • Cysts show upper and peripheral dominant distribution. • The number, size, and distribution of the pulmonary cysts in NF-1 revealed significant correlation. • It is suspected that thoracic CT findings in NF-1 occur independently. - Abstract: Purpose: To evaluate the prevalence rates and the correlations of thoracic computed tomography (CT) findings of neurofibromatosis 1 (NF1) in 88 patients. Materials and methods: Chest CT images of 88 NF1 patients were independently reviewed by three observers, and the CT findings were evaluated. If abnormal findings were present, their number, size, and distribution were recorded. The prevalence rate of each CT finding was calculated, and the correlations between CT findings were analyzed. Results: Of the 88 cases, 13 were positive for cysts, 16 for emphysema, 8 for nodules, 8 for GGNs (ground glass nodules), 13 for mediastinal masses, 20 for scoliosis, 44 for subcutaneous nodules, and 34 for skin nodules. Cysts showed upper and peripheral dominant distributions. Regarding 13 mediastinal masses, 2 were diagnosed as malignant peripheral nerve sheath tumors (MPNSTs), 1 was diagnosed as primary lung cancer, 2 were diagnosed as lateral meningocele, 3 were diagnosed as neurofibromas, and the remaining 7 were considered neurofibromas. There was a significant correlation between the prevalence of subcutaneous nodules and that of skin nodules. Significant positive correlations were also seen between size and number, size and rate of central distribution, and number and rate of central distribution of cysts. Conclusion: Various CT findings were found in NF-1 patients, and the prevalence rates of subcutaneous and skin nodules were higher than other findings. Though the prevalence rates of subcutaneous nodules and skin nodules were significantly correlated, the other CT findings in NF-1 occurred independently. The number, size, and

  7. Challenging issues in the study of fiscally-induced migration.

    Science.gov (United States)

    Winer, S L

    1986-01-01

    This paper reviews Shaw's book, INTERMETROPOLITAN MIGRATION IN CANADA, which provides new evidence concerning the link between fiscal structure and internal migration. Shaw bases his work on a valuable new migration series he has put together from census data: intermetropolitan flows from 1956-1981. The existence of censua data at 5-year intervals permits Shaw enough data to estimate migration equations separately for the periods before and after 1971. A comparison of the role of fiscal variables before and after 1971 is interesting because unemployment insurance, equalization payments, and provincial natural resource revenues probably became more important in determining regional differences in incomes after 1971 than in the 20 years prior to that. Shaw suspects that migration behavior has become less sensitive to traditional market variables such as wage differentials and more sensitive to other factors, including quality of life indicators since 1950. The author thinks that Shaw's conclusion cannot rest comfortably on estimating equations that omit fiscal variables. The overall role of wage differentials in determining observed migration patterns is the product of the coefficient on wage variables and the actual evolution of wages over the estimation period. Another problem with the methodology used to contrast pre- and post-1971 migration equations is the apparent neglect of statistical testing for shifts in coefficients on the traditional economic variables and for shifts in the coefficients on the fiscal variables. The strongest of the useful results from the study concern the role of unemployment insurance. The evidence that these have an influence on internal migration is now compelling. Shaw's book adds substantial weight to the view that variation in fiscal structure plays a significant role in determining internal migration patterns.

  8. Band calculation of lithium cold compression up to 8.8 Gbar

    International Nuclear Information System (INIS)

    Chernov, S.V.

    1988-01-01

    Quantum-mechanical calculation of pressure ''cold'' component at lithium compression from zero pressure up to 8.8 Gbar is carried out by Coring-Kohm-Rostoker method for bcc and fcc lattices. Changing of pressure curve slope at ≅ 5.4 compression degree, which is connected with 2 1/2 order elctron phase transition, is pointed out. Insiguificant oscillation is observed near the curve of Thomas-Fermi-quantum corrections model, connected with deep level displacement into the band. Three regions, where the existance of rarefaction shoch waves is possible, are pointed out

  9. Contributions for the international conference on carbon and graphite CARBON '88

    International Nuclear Information System (INIS)

    Delle, W.

    1988-08-01

    This report is the compilation of three papers prepared by the Kernforschungsanlage Juelich GmbH (KFA) in collaboration with other partners for the International Conference CARBON '88. The topics were as follows: 1.) Fracture toughness of fast neutron irradiated graphite (W. Delle, H. Derz, G. Kleist, H. Nickel, W. Thiele); 2.) The irradiation creep characteristics of graphite to high fluences (C.R. Kennedy, M. Cundy, G. Kleist); and 3.) New silicon carbide materials starting with the Coat-Mix procedure (H.K. Luhleich, K. Bach, F.J. Dias, M. Kampel, F. Koch, H. Nickel). (orig./MM)

  10. Clinical presentation of nasopharyngeal carcinoma in Sarawak Malaysia.

    Science.gov (United States)

    Tiong, T S; Selva, K S

    2005-12-01

    Nasopharyngeal carcinoma (NPC) is a common cancer in Malaysia. The clinical presentation in Sarawak has not been well documented. A retrospective review of 213 selected NPC cases was undertaken on the clinical records in Sarawak General Hospital, Sarawak, from June 1999 to June 2003. There were 116 patients in Kuching and 97 in Serian. There were twice as many males as females. The youngest patient was 16 and the oldest 88 years old with a mean age of 51 years. The four most common symptoms in order of frequencies were cervical lymphadenopathy, epistaxis, hearing loss and diplopia. 80.8% of the patients presented with cervical lymphadenopathy and about 85% of the patients presented in the advanced stages. Very small percentages of the patients were found to have single presenting symptoms of epistaxis (2.4%) and hearing loss (0.5%).

  11. Rare variants in MYD88, IRAK4 and IKBKG and susceptibility to invasive pneumococcal disease: a population-based case-control study.

    Directory of Open Access Journals (Sweden)

    Magda K Ellis

    Full Text Available Although rare variants within the Toll-like receptor signalling pathway genes have been found to underlie human primary immunodeficiencies associated with selective predisposition to invasive pneumococcal disease (IPD, the contribution of variants in these genes to IPD susceptibility at the population level remains unknown. Complete re-sequencing of IRAK4, MYD88 and IKBKG genes was undertaken in 164 IPD cases from the UK and 164 geographically-matched population-based controls. 233 single-nucleotide variants (SNVs were identified, of which ten were in coding regions. Four rare coding variants were predicted to be deleterious, two variants in MYD88 and two in IRAK4. The predicted deleterious variants in MYD88 were observed as two heterozygote cases but not seen in controls. Frequencies of predicted deleterious IRAK4 SNVs were the same in cases and controls. Our findings suggest that rare, functional variants in MYD88, IRAK4 or IKBKG do not significantly contribute to IPD susceptibility in adults at the population level.

  12. Duodenal Tumor Presenting as Acquired Hemophilia in an 88-Year-Old Woman: A Clinical Case and Review of the Literature

    Directory of Open Access Journals (Sweden)

    Nigel P. Murray

    2012-01-01

    Full Text Available Acquired hemophilia is a rare disease, presenting with severe hemorrhage, we present a case caused by a duodenal tumor, the clinical management, ethical implications, treatment recommendations, and a review of the literature.

  13. Engaging Students with Gaps: The Whale and the Cigar.

    Science.gov (United States)

    Fowler, Lois Josephs; Pesante, Linda Hutz

    1989-01-01

    Shows how to help students fill in textual "gaps" to interact more fully with contemporary texts, classics, and myths. Presents examples of this approach for studying (1) Shakespeare's "Hamlet" with Tom Stoppard's "Rosencrantz and Guildenstern Are Dead"; and (2) George Bernard Shaw's "Pygmalion" with the…

  14. Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88

    NARCIS (Netherlands)

    Pel, Herman J.; de Winde, Johannes H.; Archer, David B.; Dyer, Paul S.; Hofmann, Gerald; Schaap, Peter J.; Turner, Geoffrey; Albang, Richard; Albermann, Kaj; Andersen, Mikael R.; Bendtsen, Jannick D.; Benen, Jacques A. E.; van den Berg, Marco; Breestraat, Stefaan; Caddick, Mark X.; Contreras, Roland; Cornell, Michael; Coutinho, Pedro M.; Danchin, Etienne G. J.; Debets, Alfons J. M.; Dekker, Peter; van Dijck, Piet W. M.; van Dijk, Alard; Dijkhuizen, Lubbert; Driessen, Arnold J. M.; d'Enfert, Christophe; Geysens, Steven; Groot, Gert S. P.; de Groot, Piet W. J.; Guillemette, Thomas; Henrissat, Bernard; Herweijer, Marga; van den Hombergh, Johannes P. T. W.; van den Hondel, Cees A. M. J. J.; van der Heijden, Rene T. J. M.; van der Kaaij, Rachel M.; Klis, Frans M.; Kools, Harrie J.; Kubicek, Christian P.; van Kuyk, Patricia A.; Lauber, Juergen; Lu, Xin; van der Maarel, Marc J. E. C.; Meulenberg, Rogier; Menke, Hildegard; Mortimer, Martin A.; Nielsen, Jens; Oliver, Stephen G.; Olsthoorn, Maurien; Pal, Karoly; van Peij, Noel N. M. E.; Ram, Arthur F. J.; Rinas, Ursula; Roubos, Johannes A.; Sagt, Cees M. J.; Schmoll, Monika; Sun, Jibin; Ussery, David; Varga, Janos; Vervecken, Wouter; de Vondervoort, Peter J. J. van; Wedler, Holger; Wosten, Han A. B.; Zeng, An-Ping; van Ooyen, Albert J. J.; Visser, Jaap; Stam, Hein; Enfert, Christophe d’; Lauber, Jürgen; Goosen, Coenie; de Vries, Ronald P.

    The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level of

  15. The use of droplet digital PCR in liquid biopsies: A highly sensitive technique for MYD88 p.(L265P) detection in cerebrospinal fluid.

    Science.gov (United States)

    Hiemcke-Jiwa, Laura S; Minnema, Monique C; Radersma-van Loon, Joyce H; Jiwa, N Mehdi; de Boer, Mirthe; Leguit, Roos J; de Weger, Roel A; Huibers, Manon M H

    2018-04-01

    The gold standard for diagnosis of central nervous system lymphomas still regards a stereotactic brain biopsy, with the risk of major complications for the patient. As tumor cells can be detected in cerebrospinal fluid (CSF), CSF analysis can be used as an alternative. In this respect, mutation analysis in CSF can be of added value to other diagnostic parameters such a cytomorphology and clonality analysis. A well-known example of targeted mutation analysis entails MYD88 p.(L265P) detection, which is present in the majority of Bing Neel syndrome and primary central nervous system lymphoma (PCNSL) patients. Unfortunately, tumor yield in CSF can be very low. Therefore, use of the highly sensitive droplet digital PCR (ddPCR) might be a suitable analysis strategy for targeted mutation detection. We analyzed 26 formalin fixed paraffin embedded (FFPE) samples (8 positive and 18 negative for MYD88 p.(L265P) mutation) by ddPCR, of which the results were compared with next generation sequencing (NGS). Subsequently, 32 CSF samples were analyzed by ddPCR. ddPCR and NGS results on FFPE material showed 100% concordance. Among the 32 CSF samples, 9 belonged to patients with lymphoplasmacytic lymphoma (LPL) and clinical suspicion of Bing Neel syndrome, and 3 belonged to patients with PCNSL. Nine of these samples tested positive for MYD88 p.(L265P) (8 LPL and 1 PCNSL). This study shows that sensitive MYD88 mutation analysis by ddPCR in CSF is highly reliable and can be applied even when DNA input is low. Therefore, ddPCR is of added value to current diagnostic parameters, especially when the available amount of DNA is limited. Copyright © 2017 John Wiley & Sons, Ltd.

  16. Effectiveness of a presentation on infant oral health care for parents.

    Science.gov (United States)

    Rothe, Vincent; Kebriaei, Amy; Pitner, Sheryl; Balluff, Mary; Salama, Fouad

    2010-01-01

    The aim of this study was to evaluate an infant oral health education programme, using a pre-post test design, for parents attending a paediatric clinic. The subjects were parents attending the well baby appointments at 3, 6, and 9 months of age. The study participants were men and women, all with an infant between 3 and 12 months of age. A 16 question assessment in the form of a questionnaire was completed immediately before and after the introduction of a 30 min educational intervention in the form of a PowerPoint presentation and a video of infant oral hygiene for parents. The parents completed the questionnaire twice (pre-post test design) in the same visit. Recruited parents attended only one presentation. The presentation educated parents about infant oral health and provided anticipatory guidance. Forty-seven parents or caretakers participated in the study. On the pre-test 28% had a score of 70% or less, and on the post-test 87% got a score of 88% or better. On the pre-test, 72% had a score of 70% or higher, and on the post-test 87% got a score of 88% or higher. Most parents (80%) reported that the presentation was helpful and indicated that the information would change the way they care for their baby's teeth at home. This study demonstrated the effectiveness of a 30 min PowerPoint and Video presentation in improving the oral health knowledge of parents caring for an infant.

  17. Investigation on the porosity of zeolite NU-88 by means of positron annihilation lifetime spectroscopy

    International Nuclear Information System (INIS)

    Consolati, G.; Mariani, M.; Millini, R.; Quasso, F.

    2009-01-01

    Seven well characterized zeolites were investigated by positron annihilation lifetime spectroscopy. The lifetime spectra were analysed in four discrete components. The third one was associated with ortho-positronium annihilation in the channels, framed in terms of infinite cylinders. Differences between the radii determined from the positron annihilation technique and X-ray diffraction data were found and explained in terms of the physical structure of the channel. An analogous study on a high-silica NU-88 zeolite gave a value of 0.33 nm for the corresponding radius, in agreement with Ar and N 2 adsorption data as well as with the catalytic behaviour of this zeolite in several acid catalyzed reactions. The longest lifetime component in NU-88 reveals the existence of mesopores, with average radius of about 1.8 nm, which could explain the importance of hydrogen transfer reactions in this zeolite.

  18. The Decision to Produce Altcoins: Miners' Arbitrage in Cryptocurrency Markets

    OpenAIRE

    Adam Hayes

    2015-01-01

    Bitcoin has become the de facto 'gold' standard among cryptocurrencies as it is the most widely accepted in commerce, has the largest mining network, and greatest volume of transactions. Because of this, miners of other SHA-256 cryptocurrencies will tend to convert those altcoins into bitcoin in order to transact in a meaningful way with the real economy. The result is that bitcoin mining regulates that of all other SHA-256 blockchains. Specifically, what matters is the expected number of bit...

  19. Magnetocaloric effect, thermal conductivity, and magnetostriction of epoxy-bonded La(Fe0.88Si0.12)13 hydrides

    Science.gov (United States)

    Matsumoto, K.; Murayama, D.; Takeshita, M.; Ura, Y.; Abe, S.; Numazawa, T.; Takata, H.; Matsumoto, Y.; Kuriiwa, T.

    2017-09-01

    Magnetic materials with large magnetocaloric effect are significantly important for magnetic refrigeration. La(Fe0.88Si0.12)13 compounds are one of the promising magnetocaloric materials that have a first order magnetic phase transition. Transition temperature of hydrogenated La(Fe0.88Si0.12)13 increased up to room temperature region while keeping metamagnetic transition properties. From view point of practical usage, bonded composite are very attractive and their properties are important. We made epoxy bonded La(Fe0.88Si0.12)13 hydrides. Magnetocaloric effect was studied by measuring specific heat, magnetization, and temperature change in adiabatic demagnetization. The composite had about 20% smaller entropy change from the hydrogenated La(Fe0.88Si0.12)13 powder in 2 T. Thermal conductivity of the composite was several times smaller than La(Fe,Si)13. The small thermal conductivity was explained due to the small thermal conductivity of epoxy. Thermal conductivity was observed to be insensitive to magnetic field in 2 T. Thermal expansion and magnetostriction of the composite material were measured. The composite expanded about 0.25% when it entered into ferromagnetic phase. Magnetostriction of the composite in ferromagnetic phase was about 0.2% in 5 T and much larger than that in paramagnetic phase. The composite didn’t break after about 100 times magnetic field changes in adiabatic demagnetization experiment even though it has magnetostriction.

  20. Continuous intravenous infusion of ampicillin and gentamicin during parenteral nutrition in 88 newborn infants

    DEFF Research Database (Denmark)

    Colding, H; Møller, S; Andersen, G E

    1982-01-01

    Ampicillin and gentamicin were dissolved once a day in an L-amino acid solution especially prepared for parenteral nutrition of newborn infants and infused continuously to 88 infants in whom septicaemia was suspected or had been proved. The mean dosages were 162 and 5.3 mg/kg per 24 hours...

  1. Recurrent candidiasis and early-onset gastric cancer in a patient with a genetically defined partial MYD88 defect.

    Science.gov (United States)

    Vogelaar, Ingrid P; Ligtenberg, Marjolijn J L; van der Post, Rachel S; de Voer, Richarda M; Kets, C Marleen; Jansen, Trees J G; Jacobs, Liesbeth; Schreibelt, Gerty; de Vries, I Jolanda M; Netea, Mihai G; Hoogerbrugge, Nicoline

    2016-04-01

    Gastric cancer is caused by both genetic and environmental factors. A woman who suffered from recurrent candidiasis throughout her life developed diffuse-type gastric cancer at the age of 23 years. Using whole-exome sequencing we identified a germline homozygous missense variant in MYD88. Immunological assays on peripheral blood mononuclear cells revealed an impaired immune response upon stimulation with Candida albicans, characterized by a defective production of the cytokine interleukin-17. Our data suggest that a genetic defect in MYD88 results in an impaired immune response and may increase gastric cancer risk.

  2. Myeloid differentiation factor 88-deficient bone marrow cells improve Alzheimer's disease-related symptoms and pathology

    NARCIS (Netherlands)

    Hao, W.; Liu, Y.; Liu, S.; Walter, S.; Grimm, M.O.; Kiliaan, A.J.; Penke, B.; Hartmann, T.; Rube, C.E.; Menger, M.D.; Fassbender, K.

    2011-01-01

    Alzheimer's disease is characterized by extracellular deposits of amyloid beta peptide in the brain. Increasing evidence suggests that amyloid beta peptide injures neurons both directly and indirectly by triggering neurotoxic innate immune responses. Myeloid differentiation factor 88 is the key

  3. The UNG2 Arg88Cys variant abrogates RPA-mediated recruitment of UNG2 to single-stranded DNA.

    Science.gov (United States)

    Torseth, Kathrin; Doseth, Berit; Hagen, Lars; Olaisen, Camilla; Liabakk, Nina-Beate; Græsmann, Heidi; Durandy, Anne; Otterlei, Marit; Krokan, Hans E; Kavli, Bodil; Slupphaug, Geir

    2012-06-01

    In human cell nuclei, UNG2 is the major uracil-DNA glycosylase initiating DNA base excision repair of uracil. In activated B cells it has an additional role in facilitating mutagenic processing of AID-induced uracil at Ig loci and UNG-deficient patients develop hyper-IgM syndrome characterized by impaired class-switch recombination and disturbed somatic hypermutation. How UNG2 is recruited to either error-free or mutagenic uracil processing remains obscure, but likely involves regulated interactions with other proteins. The UNG2 N-terminal domain contains binding motifs for both proliferating cell nuclear antigen (PCNA) and replication protein A (RPA), but the relative contribution of these interactions to genomic uracil processing is not understood. Interestingly, a heterozygous germline single-nucleotide variant leading to Arg88Cys (R88C) substitution in the RPA-interaction motif of UNG2 has been observed in humans, but with unknown functional relevance. Here we demonstrate that UNG2-R88C protein is expressed from the variant allele in a lymphoblastoid cell line derived from a heterozygous germ line carrier. Enzyme activity as well as localization in replication foci of UNG2-R88C was similar to that of WT. However, binding to RPA was essentially abolished by the R88C substitution, whereas binding to PCNA was unaffected. Moreover, we show that disruption of the PCNA-binding motif impaired recruitment of UNG2 to S-phase replication foci, demonstrating that PCNA is a major factor for recruitment of UNG2 to unperturbed replication forks. Conversely, in cells treated with hydroxyurea, RPA mediated recruitment of UNG2 to stalled replication forks independently of functional PCNA binding. Modulation of PCNA- versus RPA-binding may thus constitute a functional switch for UNG2 in cells subsequent to genotoxic stress and potentially also during the processing of uracil at the immunoglobulin locus in antigen-stimulated B cells. Copyright © 2012 Elsevier B.V. All rights

  4. Hyaluronan preserves the proliferation and differentiation potentials of long-term cultured murine adipose-derived stromal cells

    International Nuclear Information System (INIS)

    Chen, P.-Y.; Huang, Lynn L.H.; Hsieh, H.-J.

    2007-01-01

    For long-term culture, murine adipose-derived stromal cells (mADSCs) at latter passages demonstrated a marked decline in proliferative activity, exhibited senescent morphology and reduced differentiation potentials, particularly osteogenesis. To extend the lifespan of mADSCs, two culture conditions containing hyaluronan (HA) was compared in our study, one as a culture medium supplement (SHA), and the other where HA was pre-coated on culture surface (CHA). mADSCs cultivated with SHA exhibited a prolonged lifespan, reduced cellular senescence, and enhanced osteogenic potential compared to regular culture condition (control). Upon CHA treatment, mADSCs tended to form cell aggregates with gradual growth profiles, while their differentiation activities remained similar to SHA groups. After transferring mADSCs from CHA to control surface, they were shown to have an extended lifespan and an increase of osteogenic potential. Our results suggested that HA can be useful for preserving the proliferation and differentiation potentials of long-term cultured mADSCs

  5. Antioxidative activity, moisture retention, film formation, and viscosity stability of Auricularia fuscosuccinea, white strain water extract.

    Science.gov (United States)

    Liao, Wayne C; Hsueh, Chiu-Yen; Chan, Chin-Feng

    2014-01-01

    This study showed that both water extracts (WAF-W) and ethanol extracts (EAF-W) of Auricularia fuscosuccinea (Montagne) Farlow, white strain (AF-W) demonstrated significantly stronger antioxidative effects than did commercially available Tremella fuciformis sporocarp extracts (WSK; with the exception of EAF-W in terms of superoxide radical scavenging activity levels). The moisture retention capacity of WAF-W is as potent as that of sodium hyaluronate (SHA), but less than that of WSK. No corrugation or fissures were observed in WAF-W film; only the SHA and WSK films demonstrated such effects in low-moisture conditions. The WAF-W solution also exhibited stable viscosity at high temperatures, indicating that the WAF-W film was more stable compared with the SHA and WSK films. WAF-W induced no adverse effects when a hen's egg test was performed on the chorioallantoic membrane (CAM). This study demonstrated that WAF-W exhibits excellent potential as a topical material for skin moisturizing and anti-aging effects.

  6. MyD88 mediates in vivo effector functions of alveolar macrophages in acute lung inflammatory responses to carbon nanotube exposure

    Energy Technology Data Exchange (ETDEWEB)

    Frank, Evan A. [Division of Environmental Genetics and Molecular Toxicology, Department of Environmental Health, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Birch, M. Eileen [National Institute for Occupational Safety and Health, Cincinnati, OH 45213 (United States); Yadav, Jagjit S., E-mail: Jagjit.Yadav@uc.edu [Division of Environmental Genetics and Molecular Toxicology, Department of Environmental Health, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States)

    2015-11-01

    Carbon nanotubes (CNTs) are rapidly emerging as high-priority occupational toxicants. CNT powders contain fibrous particles that aerosolize readily in places of manufacture and handling, posing an inhalation risk for workers. Studies using animal models indicate that lung exposure to CNTs causes prolonged inflammatory responses and diffuse alveolar injury. The mechanisms governing CNT-induced lung inflammation are not fully understood but have been suggested to involve alveolar macrophages (AMs). In the current study, we sought to systematically assess the effector role of AMs in vivo in the induction of lung inflammatory responses to CNT exposures and investigate their cell type-specific mechanisms. Multi-wall CNTs characterized for various physicochemical attributes were used as the CNT type. Using an AM-specific depletion and repopulation approach in a mouse model, we unambiguously demonstrated that AMs are major effector cells necessary for the in vivo elaboration of CNT-induced lung inflammation. We further investigated in vitro AM responses and identified molecular targets which proved critical to pro-inflammatory responses in this model, namely MyD88 as well as MAPKs and Ca{sup 2} {sup +}/CamKII. We further demonstrated that MyD88 inhibition in donor AMs abrogated their capacity to reconstitute CNT-induced inflammation when adoptively transferred into AM-depleted mice. Taken together, this is the first in vivo demonstration that AMs act as critical effector cell types in CNT-induced lung inflammation and that MyD88 is required for this in vivo effector function. AMs and their cell type-specific mechanisms may therefore represent potential targets for future therapeutic intervention of CNT-related lung injury. - Highlights: • Demonstrated in vivo effector role of alveolar macrophages (AMs) in CNT toxicity • MyD88, MAPKs, and Ca{sup 2} {sup +}/CamKII are required for AM inflammatory responses in vitro. • MyD88 signaling is required for in vivo effector

  7. TLR2, TLR4 and the MYD88 signaling pathway are crucial for neutrophil migration in acute kidney injury induced by sepsis.

    Directory of Open Access Journals (Sweden)

    Angela Castoldi

    Full Text Available The aim of this study was to investigate the role of TLR2, TLR4 and MyD88 in sepsis-induced AKI. C57BL/6 TLR2(-/-, TLR4(-/- and MyD88(-/- male mice were subjected to sepsis by cecal ligation and puncture (CLP. Twenty four hours later, kidney tissue and blood samples were collected for analysis. The TLR2(-/-, TLR4(-/- and MyD88(-/- mice that were subjected to CLP had preserved renal morphology, and fewer areas of hypoxia and apoptosis compared with the wild-type C57BL/6 mice (WT. MyD88(-/- mice were completely protected compared with the WT mice. We also observed reduced expression of proinflammatory cytokines in the kidneys of the knockout mice compared with those of the WT mice and subsequent inhibition of increased vascular permeability in the kidneys of the knockout mice. The WT mice had increased GR1(+low cells migration compared with the knockout mice and decreased in GR1(+high cells migration into the peritoneal cavity. The TLR2(-/-, TLR4(-/-, and MyD88(-/- mice had lower neutrophil infiltration in the kidneys. Depletion of neutrophils in the WT mice led to protection of renal function and less inflammation in the kidneys of these mice. Innate immunity participates in polymicrobial sepsis-induced AKI, mainly through the MyD88 pathway, by leading to an increased migration of neutrophils to the kidney, increased production of proinflammatory cytokines, vascular permeability, hypoxia and apoptosis of tubular cells.

  8. Analysis of gut microbial regulation of host gene expression along the length of the gut and regulation of gut microbial ecology through MyD88.

    Science.gov (United States)

    Larsson, Erik; Tremaroli, Valentina; Lee, Ying Shiuan; Koren, Omry; Nookaew, Intawat; Fricker, Ashwana; Nielsen, Jens; Ley, Ruth E; Bäckhed, Fredrik

    2012-08-01

    The gut microbiota has profound effects on host physiology but local host-microbial interactions in the gut are only poorly characterised and are likely to vary from the sparsely colonised duodenum to the densely colonised colon. Microorganisms are recognised by pattern recognition receptors such as Toll-like receptors, which signal through the adaptor molecule MyD88. To identify host responses induced by gut microbiota along the length of the gut and whether these required MyD88, transcriptional profiles of duodenum, jejunum, ileum and colon were compared from germ-free and conventionally raised wild-type and Myd88-/- mice. The gut microbial ecology was assessed by 454-based pyrosequencing and viruses were analysed by PCR. The gut microbiota modulated the expression of a large set of genes in the small intestine and fewer genes in the colon but surprisingly few microbiota-regulated genes required MyD88 signalling. However, MyD88 was essential for microbiota-induced colonic expression of the antimicrobial genes Reg3β and Reg3γ in the epithelium, and Myd88 deficiency was associated with both a shift in bacterial diversity and a greater proportion of segmented filamentous bacteria in the small intestine. In addition, conventionally raised Myd88-/- mice had increased expression of antiviral genes in the colon, which correlated with norovirus infection in the colonic epithelium. This study provides a detailed description of tissue-specific host transcriptional responses to the normal gut microbiota along the length of the gut and demonstrates that the absence of MyD88 alters gut microbial ecology.

  9. The magnetic field of the equatorial magnetotail - AMPTE/CCE observations at R less than 8.8 earth radii

    Science.gov (United States)

    Fairfield, D. H.; Acuna, M. H.; Zanetti, L. J.; Potemra, T. A.

    1987-01-01

    The MPTE/CCE magnetic field experiment has been used to obtain a quantitative evaluation of the frequency and extent of magnetic field distortion in the near-tail region at less than 8.8 earth radii. The variation of this distortion with Kp, radial distance, longitude, and near-equatorial latitude is reported. It has been found that taillike distortions from the dipole field direction may reach 80 deg near the MPTE/CE apogee of 8.8 earth radii. The Bz field component in dipole coordinates was always positive within 0.5 earth radii of the equatorial current sheet, indicating the neutral lines were never seen inside of 8.8 earth radii. Fields were most taillike near midnight and during times of high Kp. At 8.5 earth radii the equatorial field magnitude depressions were roughly half the dipole field strength of 51 nT. These depressions are larger at lesser distances, reaching -40 nT at 3.4 earth radii for Kp of 2- or less and -80 nT and Kp of 3+ and greater.

  10. C5a Receptor (CD88) Blockade Protects against MPO-ANCA GN

    OpenAIRE

    Xiao, Hong; Dairaghi, Daniel J.; Powers, Jay P.; Ertl, Linda S.; Baumgart, Trageen; Wang, Yu; Seitz, Lisa C.; Penfold, Mark E.T.; Gan, Lin; Hu, Peiqi; Lu, Bao; Gerard, Norma P.; Gerard, Craig; Schall, Thomas J.; Jaen, Juan C.

    2013-01-01

    Necrotizing and crescentic GN (NCGN) with a paucity of glomerular immunoglobulin deposits is associated with ANCA. The most common ANCA target antigens are myeloperoxidase (MPO) and proteinase 3. In a manner that requires activation of the alternative complement pathway, passive transfer of antibodies to mouse MPO (anti-MPO) induces a mouse model of ANCA NCGN that closely mimics human disease. Here, we confirm the importance of C5aR/CD88 in the mediation of anti-MPO–induced NCGN and report th...

  11. Ferrofluid spiral formations and continuous-to-discrete phase transitions under simultaneously applied DC axial and AC in-plane rotating magnetic fields

    International Nuclear Information System (INIS)

    Rhodes, Scott; Perez, Juan; Elborai, Shihab; Lee, Se-Hee; Zahn, Markus

    2005-01-01

    New flows and instabilities are presented for a ferrofluid drop contained in glass Hele-Shaw cells with simultaneously applied in-plane clockwise rotating and DC axial uniform magnetic fields. When a ferrofluid drop is stressed by a uniform DC axial magnetic field, up to ∼250 G in 0.9-1.4 mm gap Hele-Shaw cells, the drop forms a labyrinth pattern. With subsequent application of an in-plane uniform rotating magnetic field, up to ∼100 G rms at frequency 20-40 Hz, smooth spirals form from viscous shear due to ferrofluid flow. If the rotating magnetic field is applied first, the drop is held together without a labyrinth. Gradual increase of the DC axial magnetic field, to a critical magnetic field value, results in an abrupt phase transformation from a large drop to many small discrete droplets. A preliminary minimum magnetization and surface energy analysis is presented to model the phase transformation

  12. Genome sequencing and analysis of the versatile cell factory Aspergillus niger CBS 513.88

    DEFF Research Database (Denmark)

    Pel, Herman J.; de Winde, Johannes H.; Archer, David B.

    2007-01-01

    The filamentous fungus Aspergillus niger is widely exploited by the fermentation industry for the production of enzymes and organic acids, particularly citric acid. We sequenced the 33.9-megabase genome of A. niger CBS 513.88, the ancestor of currently used enzyme production strains. A high level...... clusters for fumonisin and ochratoxin A synthesis....

  13. Trends in Public and Private School Principal Demographics and Qualifications: 1987-88 to 2011-12. Stats in Brief. NCES 2016-189

    Science.gov (United States)

    Hill, Jason; Ottem, Randolph; DeRoche, John

    2016-01-01

    Using data from seven administrations of the Schools and Staffing Survey (SASS), this Statistics in Brief examines trends in public and private school principal demographics, experience, and compensation over 25 years, from 1987-88 through 2011-12. Data are drawn from the 1987-88, 1990-91, 1993-94, 1999-2000, 2003-04, 2007-08, and 2011-12 survey…

  14. Sistema predictiu per a evolució de pacients. Aplicació al cas d'asma infantil

    OpenAIRE

    Rubia Galera, Ivan de La

    2015-01-01

    [CATALÀ] S'ha dissenyat una aplicació que permet treballar amb dades de pacients i episodis, preprocessar-les i entrenar models amb algorismes d'aprenentatge automàtic que ofereixen bons resultats. S'ha experimentat amb dades de pacients d'asma infantil de l'hospital de Sant Joan de Déu. [ANGLÈS] We've developed an application that can deal with patient data, preprocess it and train models with machine learning algorithms that have given good results. We've experimented with data from Hosp...

  15. Nitrogen capillary plasma as a source of intense monochromatic radiation at 2.88 nm

    Energy Technology Data Exchange (ETDEWEB)

    Vrba, P., E-mail: vrbovmir@fbmi.cvut.cz [Institute of Plasma Physics, Academy of Sciences, Za Slovankou 3, Prague 8 (Czech Republic); Vrbova, M. [Faculty of Biomedical Engineering, CTU in Prague, Sitna 3105, Kladno 2 (Czech Republic); Zakharov, S.V. [EPPRA sas, Villebon/Yvette (France); Zakharov, V.S. [EPPRA sas, Villebon/Yvette (France); KIAM RAS, Moscow (Russian Federation); Jancarek, A.; Nevrkla, M. [Faculty of Nuclear Science and Physical Engineering, CTU in Prague, Brehova 7, Prague 1 (Czech Republic)

    2014-10-15

    Highlights: • Pinching capillary discharge is studied as a source of monochromatic SXR. • Modeling of the laboratory device was performed by RMHD Z* code. • Results of computer and laboratory experiments are presented. - Abstract: Capillary discharge plasma related to our laboratory device is modeled and the results are compared with experimental data. Time dependences of selected plasma quantities (e.g. plasma mass density, electron temperature and density and emission intensities) evaluated by 2D Radiation-Magneto-Hydro-Dynamic code Z* describe plasma evolution. The highest output pulse energy at 2.88 nm wavelength is achieved for nitrogen filling pressure ∼100 Pa. The estimated output energy of monochromatic radiation 5.5 mJ sr{sup −1} (∼10{sup 14} photons sr{sup −1}) corresponds properly to observe experimental value ∼3 × 10{sup 13} photons sr{sup −1}. Ray tracing inspection along the capillary axis proves an influence of radiation self-absorption for the investigated wavelength. The spectra, evaluated using the FLY code, agree to the measured ones.

  16. British Nuclear Fuels plc: report and accounts 1987-88

    International Nuclear Information System (INIS)

    1989-01-01

    The Energy Committee has considered the report and accounts of BNFL (British Nuclear Fuels PLC) for the year 1987-88. The report looks at BNFL as a government owned PLC - its activities and financial performance. Various questions are raised about the underlying financial position justifying the optimism portrayed in the report and accounts. The impact of cost-plus contracts on UK customers is examined. The economics of THORP (Thermal Oxide Reprocessing Plant) are also examined especially as the escalation in the cost of constructing THORP means that a substantial loss will be made in the reprocessing of waste for which contracts were signed in the late 1960s or early 1970s. The main conclusions of the report are summarized. One of these is that the UK must be cautious about becoming a repository of foreign nuclear waste. Other specific recommendations are made - some about the decommissioning of BNFL plant. (UK)

  17. Women Out of View. An Analysis of Female Characters on 1987-88 TV Programs.

    Science.gov (United States)

    Steenland, Sally; Whittemore, Lauren

    This study of the images of women as portrayed on new television programs in 1987-88 not only compared them with the images of the last season, but examined the similarities and differences between these characters and real life women. Each continuing female character on every new show was coded for race, age, occupation, marital and socioeconomic…

  18. First Person Past: American Autobiographies, Volume 2

    DEFF Research Database (Denmark)

    American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic......American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic...

  19. Colagenopatía y meningitis aséptica recurrente en una paciente de 88 años Colagenopathy and recurrent aseptic meningitis in an 88 year old patient

    Directory of Open Access Journals (Sweden)

    Fernando J. VAzquez

    2004-02-01

    Full Text Available La meningitis aséptica recurrente (MAR en ancianos es rara y generalmente es secundaria a drogas. Su asociación a colagenopatías en ancianos ha sido raramente informada. El Síndrome de Sjögren (SS en ocasiones afecta el sistema nervioso central, pero la MAR asociada a SS es rara en este grupo etario. Se presenta una paciente de 88 años, autoválida, con antecedentes de xerostomía, xeroftalmos, Raynaud, disfagia y agrandamiento parotídeo recurrente autolimitado. En el año 2001 cursó una meningitis linfocítica y evolucionó con recuperación completa. Un año después volvió a presentar una meningitis linfocítica aséptica. Se descartaron causas infecciosas. Se demostró FAN 1/160 con patrón nucleolar moteado, Ac anti Ro y anti RNP positivos y anticoagulante lúpico positivo. Se confirmó sequedad ocular y la biopsia de labio fue compatible con SS. Evolucionó con resolución completa en 10 días sin tratamiento. Se interpretó como una enfermedad mixta del tejido conectivo (EMTC con síntomas predominantemente de SS, que cursó una MAR en su forma pura. La EMTC y el SS deberían ser considerados entre los diagnósticos diferenciales de la MAR, inclusive en ancianos.Recurrent aseptic meningitis (RAM infrequent in elderly patients and generally secondary to drugs. Its association with rheumatologic diseases is also seldom reported in the elderly. Sjögren Syndrome (SS sometimes affects the central nevous system, but the association between recurrent meningitis and SS is rare, specially in this age-group. We present an 88 year-old autovalid patient, with a history of xerostomia, xerophthalmia, Raynaud, dysphagia, and recurrent parotid enlargement. In 2001 she developed a lymphocytic meningitis with a complete remission. A year later, she developed again an aseptic lymphocytic meningitis. We ruled out infeccious causes. We found a FAN titer 1/160 with a nucleolar-mottled pattern, positive anti Ro and anti RNP antibodies and a positive

  20. Primary Type3 (Non-ABC, Non-GCB Subtype of Extranodal Diffuse Large B-Cell Lymphoma of the Thyroid Bearing No MYD88 Mutation by Padlock Probe Hybridization

    Directory of Open Access Journals (Sweden)

    Yukiko Nishi

    2017-06-01

    Full Text Available Primary extranodal malignant lymphoma of the thyroid is a rare entity composed of mostly neoplastic transformation of germinal center-like B cells (GCB or memory B cells. Other B-cell-type malignancies arising primarily in the thyroid have rarely been described. Immunohistochemical examination of autopsied primary malignant lymphoma of the thyroid in an 83-year-old Japanese female revealed the presence of a non-GCB subtype of diffuse large B-cell lymphoma (DLBCL without the typical codon 206 or 265 missense mutation of MYD88. The lack of the highly oncogenic MYD88 gene mutation, frequently observed in DLBCL of the activated B-cell (ABC subtype, and the detection of an extremely aggressive yet local clinical phenotype demonstrated that the present case was an exceptional entity of the type3 (non-GCB and non-ABC subtype.

  1. Inclusive dielectron cross sections in p+p and p+d interactions at beam energies from 1.04 to 4.88 GeV

    International Nuclear Information System (INIS)

    Wilson, W.K.; Beedoe, S.; Carroll, J.; Igo, G.; Seidl, P.; Toy, M.; Bossingham, R.; Gong, W.G.; Heilbronn, L.; Huang, H.Z.; Krebs, G.; Letessier-Selvon, A.; Magestro, D.; Matis, H.S.; Miller, J.; Naudet, C.; Porter, R.J.; Roche, G.; Schroeder, L.S.; Yegneswaran, A.; Bougteb, M.; Manso, F.; Prunet, M.; Roche, G.; Hallman, T.; Madansky, L.; Welsh, R.C.; Kirk, P.; Wang, Z.F.

    1998-01-01

    Measurements of dielectron production in p+p and p+d collisions with beam kinetic energies from 1.04 to 4.88 GeV are presented. The differential cross section is presented as a function of invariant pair mass, transverse momentum, and rapidity. The shapes of the mass spectra and their evolution with beam energy provide information about the relative importance of the various dielectron production mechanisms in this energy regime. The p+d to p+p ratio of the dielectron yield is also presented as a function of invariant pair mass, transverse momentum, and rapidity. The shapes of the transverse momentum and rapidity spectra from the p+d and p+p systems are found to be similar to one another for each of the beam energies studied. The beam energy dependence of the integrated cross sections is also presented. copyright 1998 The American Physical Society

  2. Presentation of electric motor and motor control technology for electric vehicles and hybrid vehicles; Denki jidosha hybrid sha yo motor oyobi motor seigyo gijutsu no shokai

    Energy Technology Data Exchange (ETDEWEB)

    Matsudaira, N.; Masakik, R.; Tajima, F. [Hitachi, Ltd., Tokyo (Japan)

    1999-02-01

    The authors have developed a motor drive system for electric vehicles and hybrid vehicles. This system consists of a permanent magnet type synchronous motor, an inverter using insulated gate bipolar transistors (IGBTs) and a controller based on a single-chip microcomputer. To achieve a compact and light weight synchronous motor, an internal permanent magnet type rotor structure was designed. This paper presents motor control technology for electric vehicles, such as an optimization method of field weakening control and a new current control method. (author)

  3. Lifetime measurements of nuclear states in 92,91,90Mo, 89,88Nb

    International Nuclear Information System (INIS)

    Chakrawarthy, R.S.; Singh, Pragya; Pillay, R.G.; Devare, H.G.

    1993-01-01

    In order to test the correctness of the wave functions calculated by the shell-model calculations, the knowledge of transition probabilities is important. This, in turn, requires the determination of half lives of these states. We have performed two different experiments, based on Recoil Distance Method (RDM), to measure the lifetime in picosecond range, of states belonging to 92,91,90 Mo and 89,88 Nb nuclei. (author). 3 refs., 1 tab., 1 fig

  4. Rotational Rebound Attacks on Reduced Skein

    DEFF Research Database (Denmark)

    Khovratovich, Dmitry; Nikolić, Ivica; Rechberger, Christian

    2014-01-01

    ciphers, including the new standard SHA-3 (Keccak). The rebound attack is a start-from-the-middle approach for finding differential paths and conforming pairs in byte-oriented designs like Substitution-Permutation networks and AES. We apply our new compositional attack to the reduced version of the hash...... number of rounds. We also use neutral bits and message modification methods from the practice of collision search in MD5 and SHA-1 hash functions. These methods push the rotational property through more rounds than previous analysis suggested, and eventually establish a distinguishing property...

  5. 7 CFR 160.88 - Permitted use of words “turpentine” and “rosin.”

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Permitted use of words âturpentineâ and ârosin.â 160... STORES REGULATIONS AND STANDARDS FOR NAVAL STORES Sales and Shipments § 160.88 Permitted use of words “turpentine” and “rosin.” The use of the word “turpentine” or the word “rosin” is not prohibited in the name...

  6. Utilization of ''RASO'' for a historical survey of Angra-1 power from 26.10.88 for updating the inventory calculation

    International Nuclear Information System (INIS)

    Guimaraes, A.C.F.; Goes, A.G.

    1988-12-01

    The ''RASO'', an activity and operational situation report for Angra 1, is transmitted daily by phone to CNEN by inspectors living at Angra 1 site, anal shows the parameters about the operational status of the nuclear power plant. In the period of 26.10.88 to 04.12.88 a discretized power serie was determined for greater time intervals than the original serie, and then new concentrations were calculated using origem 2 computer code. (author) [pt

  7. Case report 373: Diametaphyseal chrondroblastoma of the upper portion of the left femur

    Energy Technology Data Exchange (ETDEWEB)

    Sotelo-Avila, C.; Sundaram, M.; Graviss, E.R.; Kyriakos, M.; Tayob, A.A.

    1986-06-01

    In summary, a case has been presented of a chondroblastoma of the diametaphysis of the upper end of the left femur in an 11-year-old girl. Despite its atypical location, the tumor proved to be a characteristic chondroblastoma on microscopic examination. The literature was reviewed comprehensively and it was noted that 12 examples of chondroblastoma arising outside an epiphysis (or apophysis) were noted. (orig./SHA).

  8. ECR heavy-ion source for the LBL 88-inch cyclotron

    International Nuclear Information System (INIS)

    Clark, D.J.; Kalnins, J.G.; Lyneis, C.M.

    1983-03-01

    An Electron Cyclotron Resonance (ECR) heavy-ion source is under construction at the LBL 88-Inch Cyclotron. This source will produce very-high-charge-state heavy ions, such as 0 8 + and Ar 12 + , which will increase cyclotron energies by a factor of 2-4, up to A = 80. It is a two-stage source using room-temperature coils, a permanent-magnet sextupole, and a 6-9 GHz microwave system. Design features include adjustable first-to-second-stage plasma coupling, a variable second-stage mirror ratio, high-conductance radial pumping of the second stage, and a beam-diagnostic system. A remotely movable extraction electrode will optimize extraction efficiency. The project includes construction of a transport line and improvements to the cyclotron axial-injection system. The construction period is expected to be two years

  9. 43 CFR 2.88 - What criteria will the Department consider in responding to my Touhy Request?

    Science.gov (United States)

    2010-10-01

    ... of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Legal Process: Testimony by Employees and Production of Records Responsibility of the Department § 2.88 What criteria will the...; and (7) Avoid undue burden on us. Responsibilities of Employees ...

  10. Comparing the Age-Friendliness of Different Neighbourhoods Using District Surveys: An Example from Hong Kong

    Science.gov (United States)

    Wong, Moses; Chau, Pui Hing; Cheung, Francis; Phillips, David R.; Woo, Jean

    2015-01-01

    Background To address the age-friendliness of living environment in cities, the World Health Organization (WHO) launched the “Age-friendly cities” (AFC) initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed. Methodology Two quantitative studies on AFC conducted in two Hong Kong districts—Sha Tin and Tuen Mun—were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO’s AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores. Results Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores. Conclusions District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and

  11. Comparing the Age-Friendliness of Different Neighbourhoods Using District Surveys: An Example from Hong Kong.

    Directory of Open Access Journals (Sweden)

    Moses Wong

    Full Text Available To address the age-friendliness of living environment in cities, the World Health Organization (WHO launched the "Age-friendly cities" (AFC initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed.Two quantitative studies on AFC conducted in two Hong Kong districts-Sha Tin and Tuen Mun-were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO's AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores.Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores.District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and infrastructure and higher socio

  12. Case report 473: Tuberculosis of the distal metaphysis of the femur

    Energy Technology Data Exchange (ETDEWEB)

    Abdelwahab, I.F.; Gould, E.; Present, D.A.; Klein, M.J.; Nelson, J.

    1988-04-01

    In summary, a case of tuberculous osteomyelitis of the femur in a 16-month-old male child has been presented. The parents illegally immigrated to the United States from Central America before the birth of their child. Both parents had active pulmonary tuberculosis and the child presented with calcified granulomas in his lungs in addition to the lesion in the femur. This presentation is uncommon among the white population in the United States and Europe and is usually limited to non-white immigrants. (orig./SHA).

  13. Case report 473: Tuberculosis of the distal metaphysis of the femur

    International Nuclear Information System (INIS)

    Abdelwahab, I.F.; Gould, E.; Present, D.A.; Klein, M.J.; Nelson, J.

    1988-01-01

    In summary, a case of tuberculous osteomyelitis of the femur in a 16-month-old male child has been presented. The parents illegally immigrated to the United States from Central America before the birth of their child. Both parents had active pulmonary tuberculosis and the child presented with calcified granulomas in his lungs in addition to the lesion in the femur. This presentation is uncommon among the white population in the United States and Europe and is usually limited to non-white immigrants. (orig./SHA)

  14. Production of exotic beams at the LBL 88-Inch Cyclotron by the ISOL method

    International Nuclear Information System (INIS)

    1990-04-01

    The Users of the LBL 88-Inch Cyclotron are preparing a proposal to produce exotic, i.e., radioactive beams. The facility will consist of a high-current 30 MeV cyclotron to generate the radioactive nuclei, an ECR source that can be coupled to different production targets, and the 88-Inch Cyclotron to accelerate the radioactive ions. Thus, the basic concept is that of the double cyclotron system pioneered at Louvain-la-Neuve, although the initial emphasis will be on producing a variety of light proton-rich beams at energies up to 10 MeV/A. At this workshop we wish to outline what is being planned, to invite comments and suggestions, and, especially, to encourage participation. We believe that this facility will be an important step toward establishing the scientific and technical basis for a National High Intensity Facility. This can be achieved through active participation by members of the radioactive beam (RB) community in (1) experiments with high quality radioactive beams of moderate intensity and, (2) R ampersand D on high beam-power targets and highly efficient ion sources. 5 refs., 4 figs

  15. Role of a transductional-transcriptional processor complex involving MyD88 and IRF-7 in Toll-like receptor signaling

    Science.gov (United States)

    Honda, Kenya; Yanai, Hideyuki; Mizutani, Tatsuaki; Negishi, Hideo; Shimada, Naoya; Suzuki, Nobutaka; Ohba, Yusuke; Takaoka, Akinori; Yeh, Wen-Chen; Taniguchi, Tadatsugu

    2004-01-01

    Toll-like receptor (TLR) activation is central to immunity, wherein the activation of the TLR9 subfamily members TLR9 and TLR7 results in the robust induction of type I IFNs (IFN-α/β) by means of the MyD88 adaptor protein. However, it remains unknown how the TLR signal “input” can be processed through MyD88 to “output” the induction of the IFN genes. Here, we demonstrate that the transcription factor IRF-7 interacts with MyD88 to form a complex in the cytoplasm. We provide evidence that this complex also involves IRAK4 and TRAF6 and provides the foundation for the TLR9-dependent activation of the IFN genes. The complex defined in this study represents an example of how the coupling of the signaling adaptor and effector kinase molecules together with the transcription factor regulate the processing of an extracellular signal to evoke its versatile downstream transcriptional events in a cell. Thus, we propose that this molecular complex may function as a cytoplasmic transductional-transcriptional processor. PMID:15492225

  16. Clone-specific MYD88 L265P and CXCR4 mutation status can provide clinical utility in suspected Waldenström macroglobulinemia/lymphoplasmacytic lymphoma.

    Science.gov (United States)

    Burnworth, Bettina; Wang, Zhixing; Singleton, Timothy P; Bennington, Angela; Fritschle, Wayne; Bennington, Richard; Brodersen, Lisa Eidenschink; Wells, Denise A; Loken, Michael R; Zehentner, Barbara K

    2016-12-01

    MYD88 L265P, a diagnostic marker for lymphoplasmacytic lymphoma (LPL)/Waldenström macroglobulinemia (WM) can also be detected in other hematopoietic malignancies. We demonstrate a novel approach to increase the specificity of this marker for WM/LPL diagnosis by combining flow cytometric cell sorting with molecular analysis. Clonal B-lymphocyte and co-occurring clonal plasma cell populations of low-grade B-cell lymphomas were sorted by flow cytometry and analyzed for immunoglobulin gene rearrangements (PCR), and for MYD88 and CXCR4 mutations. Identical clonal origin was confirmed by PCR for 21 LPL/WM cases and MYD88 L265P was detected in both B-cell and plasma cell fractions. 9/20 other B-cell lymphomas with identical light chain restriction on B-cells and plasma cells were genotypically identical by PCR and MYD88 L265P was detected in both cell fractions in 7/9 whereas in 11/20 specimens with different clonal origin, MYD88 L265P was absent (5/11), or only found in B-lymphocytes (4/11), or plasma cells (2/11). CXCR4 mutations were detected in 17/39 cases, but missed in 63% of these without cell sorting. Confirming MYD88L265P in both B-cells and plasma cell fractions can provide a novel and powerful discriminator to distinguish LPL/WM from phenotypically similar disorders. Furthermore, this approach significantly increases CXCR4 detection sensitivity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Cloning and functional characterization of IRAK4 in large yellow croaker (Larimichthys crocea) that associates with MyD88 but impairs NF-κB activation.

    Science.gov (United States)

    Zou, Peng Fei; Huang, Xue Na; Yao, Cui Luan; Sun, Qing Xue; Li, Ying; Zhu, Qian; Yu, Zhen Xing; Fan, Ze Jun

    2017-04-01

    As crucial signaling transducer in Toll-like receptor (TLR) and interleukin (IL)-1 receptor (IL-1R) signaling pathway, IL-1R-associated kinase 4 (IRAK4) mediates downstream signaling cascades and plays important roles in innate and adaptive immune responses. In the present study, an IRAK4 orthologue was characterized from large yellow croaker (Larimichthys crocea), named Lc-IRAK4, with a conservative N-terminal death domain and a C-terminal protein kinase domain. The genome of Lc-IRAK4 is structured into eleven exons and ten introns. Expression analysis indicated that Lc-IRAK4 was widely expressed in tested tissues, with the highest level in liver and weakest in muscle. Additionally, in the spleen, liver tissues and blood, it could be induced by poly I:C and LPS stimulation, but not be induced by Vibrio parahemolyticus infection. Fluorescence microscopy assays revealed that Lc-IRAK4 localized in the cytoplasm in HEK 293T cells. It was also determined that Lc-IRAK4 could interact with MyD88, whereas MyD88-mediated NF-κB activation was significantly impaired when co-transfected the two in HEK 293T cells. These findings collectively indicated that although Lc-IRAK4 was evolutionarily conserved in vertebrates, the exact function especially the signaling transduction mediated by IRAK4 in fish immune response was different from that in mammals, which impaired MyD88-mediated NF-κB activation. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Energy Law'88 Proceedings

    International Nuclear Information System (INIS)

    1988-01-01

    This Seminar, divided into 10 topics, covered the legal, economic and trading aspects of oil, coal, natural gas and minerals, nuclear energy was examined from the viewpoint of present government policies, the future of this source of energy and of other sources. The papers presented at the Seminar are reproduced in the Proceedings. (NEA) [fr

  19. Retinal dendritic cell recruitment, but not function, was inhibited in MyD88 and TRIF deficient mice.

    Science.gov (United States)

    Heuss, Neal D; Pierson, Mark J; Montaniel, Kim Ramil C; McPherson, Scott W; Lehmann, Ute; Hussong, Stacy A; Ferrington, Deborah A; Low, Walter C; Gregerson, Dale S

    2014-08-13

    Immune system cells are known to affect loss of neurons due to injury or disease. Recruitment of immune cells following retinal/CNS injury has been shown to affect the health and survival of neurons in several models. We detected close, physical contact between dendritic cells and retinal ganglion cells following an optic nerve crush, and sought to understand the underlying mechanisms. CD11c-DTR/GFP mice producing a chimeric protein of diphtheria toxin receptor (DTR) and GFP from a transgenic CD11c promoter were used in conjunction with mice deficient in MyD88 and/or TRIF. Retinal ganglion cell injury was induced by an optic nerve crush, and the resulting interactions of the GFPhi cells and retinal ganglion cells were examined. Recruitment of GFPhi dendritic cells to the retina was significantly compromised in MyD88 and TRIF knockout mice. GFPhi dendritic cells played a significant role in clearing fluorescent-labeled retinal ganglion cells post-injury in the CD11c-DTR/GFP mice. In the TRIF and MyD88 deficient mice, the resting level of GFPhi dendritic cells was lower, and their influx was reduced following the optic nerve crush injury. The reduction in GFPhi dendritic cell numbers led to their replacement in the uptake of fluorescent-labeled debris by GFPlo microglia/macrophages. Depletion of GFPhi dendritic cells by treatment with diphtheria toxin also led to their displacement by GFPlo microglia/macrophages, which then assumed close contact with the injured neurons. The contribution of recruited cells to the injury response was substantial, and regulated by MyD88 and TRIF. However, the presence of these adaptor proteins was not required for interaction with neurons, or the phagocytosis of debris. The data suggested a two-niche model in which resident microglia were maintained at a constant level post-optic nerve crush, while the injury-stimulated recruitment of dendritic cells and macrophages led to their transient appearance in numbers equivalent to or greater

  20. Opposite roles for neuropeptide S in the nucleus accumbens and bed nucleus of the stria terminalis in learned helplessness rats.

    Science.gov (United States)

    Shirayama, Yukihiko; Ishima, Tamaki; Oda, Yasunori; Okamura, Naoe; Iyo, Masaomi; Hashimoto, Kenji

    2015-09-15

    The role of neuropeptide S (NPS) in depression remains unclear. We examined the antidepressant-like effects of NPS infusions into the shell or core regions of the nucleus accumbens (NAc) and into the bed nucleus of the stria terminalis (BNST) of learned helplessness (LH) rats (an animal model of depression). Infusions of NPS (10 pmol/side) into the NAc shell, but not the NAc core and BNST, exerted antidepressant-like effects in the LH paradigm. Implying that behavioral deficits could be improved in the conditioned avoidance test. Coinfusion of SHA68 (an NPS receptor antagonist, 100 pmol/side) with NPS into the NAc shell blocked these effects. In contrast, NPS receptor antagonism by SHA68 in the BNST induced antidepressant-like effects. Infusions of NPS into the NAc shell or SHA68 into the BNST did not produce memory deficits or locomotor activation in the passive avoidance and open field tests. These results suggest that excitatory and inhibitory actions by the NPS system are integral to the depression in LH animals. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Soil and applied sulphur utilization by sunflower grown on vertisol under rainfed conditions

    International Nuclear Information System (INIS)

    Sreemannarayana, B.; Sreenivasa Raju, A.

    1993-01-01

    In a field experiment, conducted with sunflower genotypes viz., Morden, APSH-11, and EC 68414 grown on a local black clay loam soil, fertilizer sulphur (labelled with 35 S) was applied at the rate of 0, 20, 40 and 60 kg S/ha through gypsum and ammonium sulphate. Among the sunflower genotypes, EC 68414 utilized maximum sulphur from the sources at any given growth stage i.e., star, bud, flowering and maturity. Sulphur applied through ammonium sulphate resulted in highest S utilization by all the genotypes at all the stages of growth. Though, sulphur uptake showed an increase, the S utilization decreased with increase in levels of S. The S uptake was highest at 60 kg S/ha level applied through any of the sources. The soil S uptake was higher than fertilizer S uptake at any given stage of crop. Maximum yields were recorded at 40 kg S/ha level signifying that this dose is optimum for sunflower grown on black clay loam soils. (author). 17 refs., 3 tabs

  2. DNA variation in the phenotypically-diverse brown alga Saccharina japonica

    Directory of Open Access Journals (Sweden)

    Balakirev Evgeniy S

    2012-07-01

    Full Text Available Abstract Background Saccharina japonica (Areschoug Lane, Mayes, Druehl et Saunders is an economically important and highly morphologically variable brown alga inhabiting the northwest Pacific marine waters. On the basis of nuclear (ITS, plastid (rbcLS and mitochondrial (COI DNA sequence data, we have analyzed the genetic composition of typical Saccharina japonica (TYP and its two common morphological varieties, known as the “longipes” (LON and “shallow-water” (SHA forms seeking to clarify their taxonomical status and to evaluate the possibility of cryptic species within S. japonica. Results The data show that the TYP and LON forms are very similar genetically in spite of drastic differences in morphology, life history traits, and ecological preferences. Both, however, are genetically quite different from the SHA form. The two Saccharina lineages are distinguished by 109 fixed single nucleotide differences as well as by seven fixed length polymorphisms (based on a 4,286 bp concatenated dataset that includes three gene regions. The GenBank database reveals a close affinity of the TYP and LON forms to S. japonica and the SHA form to S. cichorioides. The three gene markers used in the present work have different sensitivity for the algal species identification. COI gene was the most discriminant gene marker. However, we have detected instances of interspecific COI recombination reflecting putative historical hybridization events between distantly related algal lineages. The recombinant sequences show highly contrasted level of divergence in the 5’- and 3’- regions of the gene, leading to significantly different tree topologies depending on the gene segment (5’- or 3’- used for tree reconstruction. Consequently, the 5’-COI “barcoding” region (~ 650 bp can be misleading for identification purposes, at least in the case of algal species that might have experienced historical hybridization events. Conclusion Taking into account

  3. TRANSMUTED EXPONENTIATED EXPONENTIAL DISTRIBUTION

    OpenAIRE

    MEROVCI, FATON

    2013-01-01

    In this article, we generalize the exponentiated exponential distribution using the quadratic rank transmutation map studied by Shaw etal. [6] to develop a transmuted exponentiated exponential distribution. Theproperties of this distribution are derived and the estimation of the model parameters is discussed. An application to real data set are finally presented forillustration

  4. Phenomenological and microscopic optical potentials for 88 MeV 7Li scattering

    International Nuclear Information System (INIS)

    Steeden, M.F.; Coopersmith, J.; Cartwright, S.J.; Cohler, M.D.; Clarke, N.M.; Griffiths, R.J.

    1980-01-01

    The elastic scattering cross sections for 88 MeV 7 Li ions have been measured for targets of 24 26 Mg and 40 48 Ca. Analyses using both phenomenological and microscopic optical potentials provide information on the energy dependence of optical parameters, and the extent to which the potentials are determined for these light ions. The use of a double-folding microscopic model demonstrates the need for normalisation of the real potential by a factor of 0.5 in contrast to measurements at lower energies. The contribution of exchange effects, density dependence and break-up are discussed. (author)

  5. Treatment of Active Acne Vulgaris by Chemical Peeling Using 88% Lactic Acid

    Directory of Open Access Journals (Sweden)

    Khalifa E. Sharquie

    2014-10-01

    Full Text Available Introduction: The etiopathogenesis of acne vulgaris is multifactorial, and its therapy is prolonged course that might be not accepted by many patients. Most recently TCA 35% one session peeling gave complete clearance and full remission for active acne vulgaris. Lactic acid has been used effectively as therapeutic topical agents for many skin diseases. Aim: To evaluate the efficacy and safety of chemical peeling using 88% lactic acid solution in the treatment of active acne vulgaris. Material and Methods: This clinical, interventional, therapeutic study was done at the Department of Dermatology, Baghdad Teaching Hospital, during the period from October 2012 to October 2013. Twenty five patients with active acne vulgaris were included, 15 (60% females and 10 (40% males and their ages ranged from 16-36 (21.5000± 5.46279 years. Fifteen patients were associated with acne scars. Three chemical peels using 88% lactic acid solution was carried out two weeks apart for patients with active acne vulgaris with or without scarring. Scoring for active acne vulgaris and acne scar was done for each case before and after operation to evaluate the severity of acne and the degree of scar before and after treatment. All patients were with Fitzpatrick’s skin types III and IV. Patients were followed up every two weeks during period of therapy and monthly for 3 months after stopping the treatment. Results: Twenty five patients with active acne vulgaris were treated with 3 sessions of lactic acid, fifteen patients had associated acne scar. Scoring for active acne vulgaris including papules and pustules showed highly statistically significant reduction after 2 weeks of therapy (p=0.0001, after 4 weeks (p=0.0001and after 6 weeks (p=0.0001, with percent reduction 87.2% for papules and 94% for pustules after end of sessions while after 3 months follow up the reduction rate for papules 93.8% and p-value (p=0.001 and for pustules 97.6% and (p=0.0001. While the scarring

  6. Ailelerin Eğitim Sürecine Katılımına İlişkin Öğretmen ve Yönetici Görüşleri

    OpenAIRE

    Erdoğan, Çetin; Demirkasımoğlu, Nihan

    2014-01-01

    Background. Research has shown that there is a correlation between student academic achievement and the qualities of parents and social surroundings (Shaw, 2008). A study by Epstein and Sheldon (2002b) suggested that parent involvement decreases student absenteeism. Number of other studies concluded that parent involvement positively affects student academic achievement (Jeynes, 2007; Shaw, 2008; Sheldon, 2003). Epstein (1995) categorized parent involvement in education process as relation ...

  7. Preliminary X-ray analysis of twinned crystals of the Q88Y25-Lacpl esterase from Lactobacillus plantarum WCFS1

    International Nuclear Information System (INIS)

    Álvarez, Yanaisis; Esteban-Torres, María; Acebrón, Iván; Rivas, Blanca de las; Muñoz, Rosario; Martínez-Ripoll, Martín; Mancheño, José M.

    2011-01-01

    The Q88Y25-Lacpl esterase from L. plantarum WCFS1 has been recombinantly expressed, purified and crystallized. A native diffraction data set has been collected to 2.24 Å resolution. Q88Y25-Lacpl is an esterase produced by the lactic acid bacterium Lactobacillus plantarum WCFS1 that shows amino-acid sequence similarity to carboxylesterases from the hormone-sensitive lipase family, in particular the AFEST esterase from the archaeon Archaeoglobus fulgidus and the hyperthermophilic esterase EstEI isolated from a metagenomic library. N-terminally His 6 -tagged Q88Y25-Lacpl has been overexpressed in Escherichia coli BL21 (DE3) cells, purified and crystallized at 291 K using the hanging-drop vapour-diffusion method. Mass spectrometry was used to determine the purity and homogeneity of the enzyme. Crystals of His 6 -tagged Q88Y25-Lacpl were prepared in a solution containing 2.8 M sodium acetate trihydrate pH 7.0. X-ray diffraction data were collected to 2.24 Å resolution on beamline ID29 at the ESRF. The apparent crystal point group was 422; however, initial global analysis of the intensity statistics (data processed with high symmetry in space group I422) and subsequent tests on data processed with low symmetry (space group I4) showed that the crystals were almost perfectly merohedrally twinned. Most probably, the true space group is I4, with unit-cell parameters a = 169.05, b = 169.05, c = 183.62 Å

  8. Generating unique IDs from patient identification data using security models

    Directory of Open Access Journals (Sweden)

    Emad A Mohammed

    2016-01-01

    Full Text Available Background: The use of electronic health records (EHRs has continued to increase within healthcare systems in the developed and developing nations. EHRs allow for increased patient safety, grant patients easier access to their medical records, and offer a wealth of data to researchers. However, various bioethical, financial, logistical, and information security considerations must be addressed while transitioning to an EHR system. The need to encrypt private patient information for data sharing is one of the foremost challenges faced by health information technology. Method: We describe the usage of the message digest-5 (MD5 and secure hashing algorithm (SHA as methods for encrypting electronic medical data. In particular, we present an application of the MD5 and SHA-1 algorithms in encrypting a composite message from private patient information. Results: The results show that the composite message can be used to create a unique one-way encrypted ID per patient record that can be used for data sharing. Conclusion: The described software tool can be used to share patient EMRs between practitioners without revealing patients identifiable data.

  9. Generating unique IDs from patient identification data using security models.

    Science.gov (United States)

    Mohammed, Emad A; Slack, Jonathan C; Naugler, Christopher T

    2016-01-01

    The use of electronic health records (EHRs) has continued to increase within healthcare systems in the developed and developing nations. EHRs allow for increased patient safety, grant patients easier access to their medical records, and offer a wealth of data to researchers. However, various bioethical, financial, logistical, and information security considerations must be addressed while transitioning to an EHR system. The need to encrypt private patient information for data sharing is one of the foremost challenges faced by health information technology. We describe the usage of the message digest-5 (MD5) and secure hashing algorithm (SHA) as methods for encrypting electronic medical data. In particular, we present an application of the MD5 and SHA-1 algorithms in encrypting a composite message from private patient information. The results show that the composite message can be used to create a unique one-way encrypted ID per patient record that can be used for data sharing. The described software tool can be used to share patient EMRs between practitioners without revealing patients identifiable data.

  10. Case report 432: Granulocytic sarcoma (GS), with hypereosinophilic syndrome (HES)

    Energy Technology Data Exchange (ETDEWEB)

    Xipell, J M; Beamish, M R; Clark, D

    1987-07-01

    A case is presented of a 28-year-old man with a history of the hypereosinophilic syndrome, who subsequently developed granulocytic sarcoma of the tibia which proved resistant to aggressive therapy. He ultimately developed acute myeloid leukemia which also was resistant to therapy. The disease process was characterized by localised skeletal pain, the development of lytic lesions in several areas of the skeleton and progression to frank myeloid leukemia. (orig./SHA).

  11. Case report 429: Adult T-cell leukemia (ATL)

    International Nuclear Information System (INIS)

    Aoki, Jun; Yamamoto, Itsuo; Hino, Megumu; Torizuka, Kanji; Kyoto Univ.; Uchiyama, Takahashi; Uchino, Haruto

    1987-01-01

    The radiological and pathological skeletal manifestations in a case of adult T-cell leukemia are presented. The authors have emphasized the presence of multiple areas of localized subperiosteal resorption as a helpful finding in the differential diagnosis between adult T-cell leukemia and multiple myeloma and hyperparathyroidism. A possible mechanism for these radiological features and its similarity to those of other T-cell malignancies are discussed briefly. (orig./SHA)

  12. Annual Report 88

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    The 1988 progress report of the Institut Laue-Langevin (ILL) is presented. The ILL is a service institute created so that chemistry, solid state physics, fundamental and nuclear physics, biology and metallurgy specialists can use the unique power of neutron techniques on their investigations. The report includes the reactor operation, the research programs and the obtained results and international cooperation. The activities of the ILL departments and the communications are given

  13. [Status of ethical awareness based on 88 medical journals in China and combined evaluation].

    Science.gov (United States)

    Chen, Liwen; Wang, Yiren; Li, Lingjiang

    2015-09-01

    To evaluate the status of ethical awareness of medical journals in China.
 We surveyed editorial awareness based on 88 medical journals by using self-made questionnaire. Five aspects were selected by literature and systematic analysis: Instruction for authors, the first review stage, the peer-review stage, the editing stage, as well as education and training, which covered 11 indexes in the system. Weight values of indexes were gained by scoring of senior editors, and analytic hierarchy process, TOPSIS method, and weight rank-sun ratio were used to evaluate the status of editorial awareness.
 Of the 88 biomedical journals, 56 (63.6%) had no ethical requirement in the instruction for authors in 2010, 14 (15.9%) were at high level of ethical awareness, 45 (51.1%) were at medium level, and 29(33.0%) were at low level. There were significant differences in the scores of instruction for authors and peer-review stage among the journals administrated by different authorities (H(C)=10.175, H=7.305, Pjournals covered by different databases (H(C)=11.951, 7.661, 6.146, or 8.085, Pjournals (H(C)=6.109, Pjournals in China should be improved. Comprehensive approach is more reliable and practical than that of single approach.

  14. Dramatic Response with Single-Agent Ibrutinib in Multiply Relapsed Marginal Zone Lymphoma with MYD88L265P Mutation

    Directory of Open Access Journals (Sweden)

    Ryan C. Lynch

    2017-09-01

    Full Text Available The B-cell receptor signaling pathway is important in the lymphomagenesis of many lymphomas, including marginal zone lymphoma (MZL. Herein we describe a case of extranodal MZL refractory to multiple lines of therapy. The presence of an IgM paraprotein prompted further evaluation, and the patient was found to have an MYD88L265P mutation. Treatment with ibrutinib led to a dramatic response with prompt resolution of symptoms and significant improvement in measurable sites of disease. The excellent response to ibrutinib in our patient with MYD88L265P-mutated refractory MZL supports a biological rationale for its use.

  15. Reparació de l'espina bífida fetal amb tècniques no agressives

    OpenAIRE

    García Fontecha, César Galo

    2010-01-01

    La malformació congènita que suposa l'espina bífida comporta trastorns i lesions irreversibles que dificultaran el desenvolupament d'una vida normal en l'afectat, podent fins i tot morir en els seus primers anys de vida. Per als casos d'espina bífida, s'ha considerat la interrupció legal de l'embaràs o la intervenció quirúrgica en el moment del naixement, encara que en les últimes dècades s'ha optat per la reparació intrauterina. Aquest treball suposa un avenç en aquest aspecte, ja que propos...

  16. The hash function BLAKE

    CERN Document Server

    Aumasson, Jean-Philippe; Phan, Raphael; Henzen, Luca

    2014-01-01

    This is a comprehensive description of the cryptographic hash function BLAKE, one of the five final contenders in the NIST SHA3 competition, and of BLAKE2, an improved version popular among developers. It describes how BLAKE was designed and why BLAKE2 was developed, and it offers guidelines on implementing and using BLAKE, with a focus on software implementation.   In the first two chapters, the authors offer a short introduction to cryptographic hashing, the SHA3 competition, and BLAKE. They review applications of cryptographic hashing, they describe some basic notions such as security de

  17. Newlook : desenvolupament d'un comerç online

    OpenAIRE

    Balasch Pérez, David; Universitat Autònoma de Barcelona. Escola d'Enginyeria

    2015-01-01

    El comerç online suposa un gran avanç per les empreses que es dediquen a aquest sector, ja que, Internet ha suposat un increment important dins d'aquesta industria i tot el sector que és dedica a la venda de productes, per tant, tots ells han de disposar d'un sistema adaptable a qualsevol dispositiu mòbil, ja que no podem oblidar que la venda d'aquests dispositius s'ha incrementat notablement en els últims anys. Aquest projecte s'ha desenvolupament amb la motivació de crear una pàgina web ada...

  18. Concurso NIST. Análisis del concurso (2007-2012)

    OpenAIRE

    Martín Sierra, Marían

    2014-01-01

    El objetivo de este proyecto es dar a conocer el concurso SHA-3, concurso que ha transcurrido durante los últimos años y que ha promovido el Instituto Nacional de Estándares y Tecnología, también conocido como NIST, con el objetivo de encontrar el nuevo algoritmo criptográfico de función resumen SHA-3 que se utilizará de estándar de aquí en adelante. Con este fin se ha realizado un estudio sobre criptografía en general y sobre algunos de los algoritmos criptográficos de func...

  19. Comportamiento mecánico de las juntas tipo T-bolt en materiales compuestos gruesos

    OpenAIRE

    Martínez Moll, Víctor

    2003-01-01

    En aquest treball s'ha realitzat una anàlisi de la junta T-bolt aplicada a la unió de laminats gruixuts amb elements metàl·lics. Més concretament, l'estudi es centra en el tipus de juntes T-bolt emprades en la unió entre les pales i la boixa de grans aerogeneradors, que constitueix una de les principals aplicacions d'aquest tipus de junta.En primer lloc, s'ha realitzat una anàlisi simplificada dels factors que influeixen al comportament de la junta, a partir del qual es justifica la necessit...

  20. Fisetin-treatment alleviates airway inflammation through inhbition of MyD88/NF-κB signaling pathway.

    Science.gov (United States)

    Huang, Wei; Li, Ming-Li; Xia, Ming-Yue; Shao, Jian-Ying

    2018-07-01

    Asthma is a common chronic airway inflammation disease and is considered as a major public health problem. Fisetin (3,3',4',7-tetrahydroxyflavone) is a naturally occurring flavonoid abundantly found in different vegetables and fruits. Fisetin has been reported to exhibit various positive biological effects, including anti-proliferative, anticancer, anti-oxidative and neuroprotective effects. We evaluated the effects of fisetin on allergic asthma regulation in mice. Mice were first sensitized, then airway-challenged with ovalbumin (OVA). Whether fisetin treatment attenuated OVA-induced airway inflammation was examined via inflammation inhibition through MyD88-related NF-κB (p65) signaling pathway. Mice were divided into the control (Con), OVA-induced asthma (Mod), 40 (FL) and 50 (FH) mg/kg fisetin-treated OVA-induced asthma groups. Our results found that OVA-induced airway inflammation in mice caused a significant inflammatory response via the activation of MyD88 and NF-κB signaling pathways, leading to release of pro-inflammatory cytokines. In contrast, fisetin-treated mice after OVA induction inhibited activation of MyD88 and NF-κB signaling pathways, resulting in downregulation of pro-inflammatory cytokine secretion. Further, fisetin significantly ameliorated the airway hyperresponsiveness (AHR) towards methacholine (Mch). In addition, fisetin reduced the number of eosinophil, monocyte, neutrophil and total white blood cell in the bronchoalveolar lavage fluid (BALF) of OVA-induced mice. The serum and BALF samples obtained from the OVA-induced mice with fisetin showed lower levels of pro-inflammatory cytokines. The results of our study illustrated that fisetin may be a new promising candidate to inhibit airway inflammation response induced by OVA.

  1. Investigation of creep deformation mechanisms at intermediate temperatures in Rene 88 DT

    International Nuclear Information System (INIS)

    Viswanathan, G.B.; Sarosi, P.M.; Henry, M.F.; Whitis, D.D.; Milligan, W.W.; Mills, M.J.

    2005-01-01

    Creep deformation substructures in the superalloy Rene 88 DT have been investigated after small-strain (0.2-0.5%) creep at 650 deg C using conventional and high resolution transmission electron microscopy. Clear differences in creep strength and deformation mechanisms have been observed as a function of applied stress and precipitate microstructure. Both coarse and fine bimodal precipitate microstructures have been tested, produced by relatively slow and fast cooling from the supersolvus solutionizing temperature. The finer γ' microstructure exhibited significantly lower creep rates. It has been established that microtwinning caused by the passage of Shockley partial dislocations on successive {1 1 1} planes is the dominant deformation process at low applied stress, and changes to shearing by 1/2[1 1 0] dislocations and Orowan looping around the larger secondary precipitates at higher applied stress. In the coarser microstructure, the dominant deformation mode is isolated faulting where 1/2[1 1 0] dislocations shear the matrix while superlattice extrinsic stacking faults are created in the secondary γ' particles. The detailed mechanisms by which these deformation modes proceed are discussed, leading to the proposition that the thermally activated process for both microtwinning and isolated faulting is similar, involving diffusion-mediated re-ordering within the γ' particles in the wake of shearing 1/6 Shockley partials. Based on the present evidence, it is proposed that the tertiary γ' volume fraction is crucial in dictating the transition in mechanism and the creep strength of these alloys

  2. Law No. 109/88, 26 September 1988.

    Science.gov (United States)

    1988-01-01

    This Law establishes agrarian reform policy in Portugal. Its main goals are the improvement of the conditions of exploitation of the land; the economic, social, and cultural promotion of farmers and agricultural workers; the protection of their rights; the use of resources to increase agricultural production and productivity; and the protection of the environment, including the fertility of land. Special emphasis is given to consideration of regional ecological characteristics in efforts to maximize agricultural productivity. The Law also has as a goal the promotion of associational agricultural practices. To attain these goals, the Law provides for the expropriation and redistribution of land and introduces incentives designed to provide wide-ranging material support of agricultural activity and integrative measures, which deal with infrastructural development. Expropriation and redistribution of land are to be carried out according to procedures set forth in the Code of Expropriation. The Law, however, introduces the landowner's "right of reserve." Under this right, landowners may apply for the devolution of expropriated land, subject to the limit of 60 hectares per "right of reserve" or, alternately, to the limit of 91,000 productivity points, measured according to criteria of a land productivity schedule, regardless of the physical size of the area subject to expropriation. The "right of reserve" shall be apportioned among co-owners and legal successors of expropriated land. Procedures to be followed in determining the "right of reserve" are set forth in Regulating Decree No. 44/88, 14 December 1988 (Diario da Republica, Series I, No. 287, 14 December 1988, pp. 4915-6). full text

  3. First indirect x-ray imaging tests with an 88-mm diameter single crystal

    Energy Technology Data Exchange (ETDEWEB)

    Lumpkin, A. H. [Fermilab; Macrander, A. T. [Argonne

    2017-02-01

    Using the 1-BM-C beamline at the Advanced Photon Source (APS), we have performed the initial indirect x - ray imaging point-spread-function (PSF) test of a unique 88-mm diameter YAG:Ce single crystal of only 100 - micron thickness. The crystal was bonded to a fiber optic plat e (FOP) for mechanical support and to allow the option for FO coupling to a large format camera. This configuration resolution was compared to that of self - supported 25-mm diameter crystals, with and without an Al reflective coating. An upstream monochromator was used to select 17-keV x-rays from the broadband APS bending magnet source of synchrotron radiation. The upstream , adjustable Mo collimators were then used to provide a series of x-ray source transverse sizes from 200 microns down to about 15-20 microns (FWHM) at the crystal surface. The emitted scintillator radiation was in this case lens coupled to the ANDOR Neo sCMOS camera, and the indirect x-ray images were processed offline by a MATLAB - based image processing program. Based on single Gaussian peak fits to the x-ray image projected profiles, we observed a 10.5 micron PSF. This sample thus exhibited superior spatial resolution to standard P43 polycrystalline phosphors of the same thickness which would have about a 100-micron PSF. Lastly, this single crystal resolution combined with the 88-mm diameter makes it a candidate to support future x-ray diffraction or wafer topography experiments.

  4. Correlation of Radiological and Endoscopic Findings in Patients Presenting with Dysphagia.

    Science.gov (United States)

    Sachdeva, Kavita; Kaul, Vineet

    2017-03-01

    Dysphagia is a common symptom with diverse etiology in otolaryngology. In the present study clinicopathological, radiological and endoscopic evaluation of patients was done in a tertiary care hospital in patients presenting with dysphagia. A prospective nonrandomized observational study was carried out on total of 80 cases having dysphagia during March 2015 to August 2016. In the present study, out of 80 patients, youngest case was a three years old child while oldest case was an 85 years old female. The mean age was 48.3 ± 20.3 years. The majority of cases were in age group 41-59 years (35%). Male to female ratio was 2.33:1. The mean duration of illness was 15.44 weeks. 15% of patients had absolute dysphagia. For detecting the lesion, Barium swallow study (BSS) showed a total sensitivity of 49.05% (n = 53), Computerised Tomography (CT) showed a total sensitivity of 85.70% (n = 49), plain skiagram neck & chest showed a total sensitivity of 88.88% (n = 9) and endoscopy was the most sensitive test overall as it showed a total sensitivity of 98.75% (n = 80). No complications were reported with either rigid or flexible endoscopy. Dysphagia is a common presenting complaint in otolaryngology with cases coming directly or being referred from other specialities. Males are more commonly affected than females and incidence of malignancy increases with age. Endoscopy can become the first screening test in dysphagia due to its high sensitivity and low risk of complications, with radiological tests being done in an adjunct manner.

  5. The detection of K88, K99 fimbrial antigen and enterotoxin genes of Escherichia coli isolated from piglets and calves with diarrhoea in Indonesia

    Directory of Open Access Journals (Sweden)

    Supar

    1996-03-01

    Full Text Available Enterotoxigenic Escherichia coli (ETEC strains cause diarrhoeal disease in piglets and calves in Indonesia. These strains possess two virulence factors namely attachment and enterotoxin antigens . These factors could be detected phenotypically and genetically. Haemolytic Escherichia coli (E coli isolates possessing K88 fimbrial antigen associated with 0-group 108 and 149. They were positive for K88 gene and demonstrated their ability to produce heat labile enterotoxin (LT and genetically were all positive for LT gene . Seventeen isolates ofE coli K88 which associated with 0-group 149 were positive forSTb gene, other O-serotypes were negative . Ten isolates of Ecoli K88 which associated with 0-group 108 possessed K88, K99, LT and STa genes, but negative for STb gene . However, phenotypically the K99 antigen and STa toxin were not expressed under laboratory conditions, the reason was not well understood . E. coli K99 strains isolated from calves wit h diarrhoea were all associated with 0-group 9 and produced STa toxin when tested by suckling mousse bioassay. The E. coli K99 calf isolates were all hybridized with K99 and STa gene only . It is likely that K99 gene is associated with STa gene . The DNA hybridization technique is more convenience to be used for confirmation diagnosis of colibacillosis, however, not all veterinary laboratories could perform these tests .

  6. Thermomechanical Processing of Fe-6.9Al-2Cr-0.88C Steel: Intercritical Annealing Followed by Quench Tempering

    Science.gov (United States)

    Farahat, Ahmed Ismail Zaky; Mohamed, Masoud Ibrahim

    2015-01-01

    A hot forged Fe-0.88 pct C-6.9 pct Al steel was intercritically annealed at temperatures in the range of 1173 K to 1283 K (900 °C to 1010 °C), and subsequently tempered at 623 K (350 °C) to enhance the mechanical properties by microstructure modification. Room temperature compression tests were carried out to evaluate the influence of the intercritical annealing temperature on the mechanical properties. A substructure was present in the microstructure after each intercritical annealing treatment. The substructure was absent after annealing at 1263 K (990 °C) and higher temperatures. Over-aging occurred when the annealing temperature was increased to 1283 K (1010 °C). A remarkable increase in strength and ductility was achieved after annealing at 1263 K (990 °C).

  7. Chemical residues in Dolphins from the US Atlantic coast including atlantic bottlenose obtained during the 1987/88 mass mortality

    Energy Technology Data Exchange (ETDEWEB)

    Kuehl, D.W.; Haebler, R.; Potter, C.

    1991-01-01

    Bottlenose dolphins (Tursiops truncatus) collected during the 1987/88 mass mortality event along the Atlantic coast of the United States have been analyzed for anthropogenic chemical contaminants. Average contaminant concentrations in adult males were higher than the average concentrations measured in adult females. Females could be divided into two groups by contaminant concentrations, one with low concentrations, and another with concentrations 4.4 times (PCBs) to 8.9 times (p,p'-DDE) greater. Contaminant concentrations in bottlenose were generally greater than the concentrations measured in either common (Delphinus delphis) or white-sided (Lagernorhynchus acutus) dolphins from the western North Atlantic Ocean. A subset of animals screened for unusual chemical contaminants showed that numerous polybrominated chemicals were present, including polybrominated biphenyls and diphenyl ethers not previously found in marine mammals from U.S. coastal waters.

  8. Suppression of aqueous corrosion of La(Fe0.88Si0.12)13 by reducing dissolved oxygen concentration for high-performance magnetic refrigeration

    International Nuclear Information System (INIS)

    Fujieda, S.; Fukamichi, K.; Suzuki, S.

    2014-01-01

    Highlights: • The aqueous corrosion of La(Fe 0.88 Si 0.12 ) 13 and its suppression were investigated. • The lattice expansion after immersion was caused by the hydrogen absorption. • The itinerant-electron metamagnetic transition became indistinct after immersion. • The aqueous corrosion was suppressed by reducing the dissolved oxygen concentration. - Abstract: The itinerant-electron metamagnetic transition of La(Fe 0.88 Si 0.12 ) 13 becomes indistinct after immersion in distilled-water containing about 8 ppm of the dissolved oxygen (DO) concentration because of aqueous corrosion. However, the aqueous corrosion of La(Fe 0.88 Si 0.12 ) 13 is significantly suppressed by reducing the DO concentration. Thus, isothermal magnetic entropy change after immersion for 30 days in deaerated distilled-water with a DO concentration less than 0.1 ppm is larger than that after immersion for 5 days in distilled-water containing about 8 ppm of the DO concentration. Consequently, the reduction of the DO concentration is effective for preservation of the excellent magnetocaloric effects of La(Fe 0.88 Si 0.12 ) 13 in an aqueous solution, which is a promising heat transfer fluid of room-temperature magnetic refrigeration

  9. Case report 363

    International Nuclear Information System (INIS)

    Langer, R.; Kaufmann, H.J.

    1986-01-01

    In summary, the case is presented of a 10-year-old girl with a fibrosarcoma of the femoral shaft, which showed the radiological and histological features of a malignant bone tumor, but with no findings radiologically pathognomonic of fibrosarcoma. Malignant fibrous histiocytoma, fibrogenic osteosarcoma and even Ewing tumor could present with the same radiological features. Although permeative infiltration of bone (described in this case) is observed in primary fibrosarcoma, it is much more commonly associated with another malignant bone tumor of childhood - Ewing tumor. (orig./SHA)

  10. New neutron capture and total cross section measurements on 88Sr and their impact on s-process nucleosynthesis

    International Nuclear Information System (INIS)

    Koehler, P.E.; Spencer, R.R.; Guber, K.H.

    1998-01-01

    The authors have made new and improved measurements of the neutron capture and total cross sections of 88 Sr at the Oak Ridge Electron Linear Accelerator (ORELA). Improvements over previous measurements include a wider incident neutron energy range, the use of metallic rather than carbonate samples, better background subtraction, reduced sensitivity to sample-dependent backgrounds, and better pulse-height weighting functions. Because of its small cross section, the 88 Sr(n,γ) reaction is an important bottleneck during the s-process nucleosynthesis. Hence, an accurate determination of this rate is needed to better constrain the neutron exposure in s-process models and to more fully exploit the recently discovered isotopic anomalies in certain meteorites. They describe the experimental procedures, compare the results to previous data, and discuss their astrophysical impact

  11. BARC highlights '88

    International Nuclear Information System (INIS)

    1989-01-01

    Highlights of research and development activities of the Bhabha Atomic Research Centre (BARC), Bombay during 1988 are presented in chapters entitled: Physical Sciences, Chemical Sciences, Materials and Materials Sciences, Radioisotopes, Reactors, Fuel Cycle, Radiological Safety and Protection, Electronics and Instrumentation, Engineering Services, and Life Sciences. Main thrust of the R and D activities of BARC is on nuclear power reactor technology and all stages of nuclear fuel cycle. Some activities are also in the frontier areas such as high temperature superconductivity and inertial confinement fusion. (M.G.B.). figs., tabs., coloured ills

  12. Tako-tsubo cardiomyopathy after a quarrel.

    African Journals Online (AJOL)

    Tako-tsubo cardiomyopathy after a quarrel. Dong-Mei Jiang1,a, Ze-Wei Sunc2,a, Jie Han2. 1. Department of Cardiology, Biomedical research (therapy) center, Sir Run Run Shaw Hospital,. College of ... acterized by (1) sudden onset of chest pain or shortness of breath; (2) ... In the present report, we de- scribe a case of ...

  13. Simulating the Transfer of Strontium-90 from Soil to Leafy Vegetables by Using Strontium-88.

    Science.gov (United States)

    Kuke, Ding; Shujuan, Liu; Yingxue, He; Dong, Yan; Fengshou, Zhang; Shuifeng, Wang; Jinghua, Guo; Wei, Zhang; Xin, Wang; Xiaoyan, Jiang

    The transfer, from soil to Chinese cabbage and spinach, of radioactive strontium-90 released as a result of accidents in nuclear power stations was studied using a stable isotope of strontium, namely nuclide strontium-88 ( 88 Sr). The study led to an experimental model for assessing the hazard of radionuclide strontium-90 ( 90 Sr) entering the food chain and for predicting the risk to food safety. Chinese cabbage and spinach were grown in pots in a greenhouse and irrigated with deionized water containing known quantities of strontium. Based on the strontium content of that water, the plants were divided into five groups (treatments) and strontium content of the soil, and 30-day-old plants were determined by inductively coupled plasma atomic emission spectroscopy instrument (ICP-AES). Data on the strontium content of soil and plants enabled the development of a model using MATLAB, a mathematical software package, which included curve fitting and problem solving using regression equations and differential equations. Although strontium curves for leaves, stems, and roots of Chinese cabbage were not exactly the same, all showed a non-linear increase when compared with the increase in the content of strontium in soil. Strontium curves for leaves, stems, and roots of spinach were very similar and showed an initial increase followed by a decrease. Strontium concentrations in both Chinese cabbage and spinach were initially related to the concentrations of sodium and sulfur, the next two relevant nuclides being calcium and magnesium. The relationship between calcium and strontium in Chinese cabbage was different from that in spinach. By using 88 Sr to simulate the transfer of radionuclide 90 Sr from soil to a crop, the relevant data required to deal with accidental release of strontium can be obtained using a fitting curve and regression equations, thereby providing some experimental basis for evaluating the potential hazards posed by such accidents to the food chain.

  14. Radiation effects testing at the 88-Inch Cyclotron at LBNL

    International Nuclear Information System (INIS)

    McMahan, Margaret A.; Koga, Rokotura

    2002-01-01

    The effects of ionizing particles on sensitive microelectronics is an important component of the design of systems as diverse as satellites and space probes, detectors for high energy physics experiments and even internet server farms. Understanding the effects of radiation on human cells is an equally important endeavor directed towards future manned missions in space and towards cancer therapy. At the 88-Inch Cyclotron at the Berkeley Laboratory, facilities are available for radiation effects testing (RET) with heavy ions and with protons. The techniques for doing these measurements and the advantages of using a cyclotron will be discussed, and the Cyclotron facilities will be compared with other facilities worldwide. RET of the same part at several facilities of varying beam energy can provide tests of the simple models used in this field and elucidate the relative importance of atomic and nuclear effects. The results and implications of such measurements will be discussed

  15. Search for associated production of massive states decaying into two photons in $e^{+}e^{-}$ annihilations at $\\sqrt{s}$ = 88 - 209 GeV

    CERN Document Server

    Abbiendi, G.; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Boeriu, O.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Cammin, J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Cohen, I.; Csilling, A.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Elfgren, E.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hauschildt, J.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Homer, R.J.; Horvath, D.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kormos, Laura L.; Kowalewski, Robert V.; Kramer, T.; Kress, T.; Krieger, P.; von Krogh, J.; Krop, D.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Rick, H.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trefzger, T.; Tricoli, A.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vachon, B.; Vollmer, C.F.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.; Zivkovic, Lidija

    2002-01-01

    A search is performed for production of short-lived particles in e+e- -> XY, with X -> gamma gamma and Y -> ffbar, for scalar X and scalar or vector Y. Model-independent limits in the range of 25-60 femtobarns are presented on sigma (e+e- -> XY) x B(X -> ffbar) for centre-of-mass energies in the range 205-207 GeV. The data from all LEP centre-of-mass energies 88-209 GeV are also interpreted in the context of fermiophobic Higgs boson models, for which a lower mass limit of 105.5 GeV is obtained for a "benchmark" fermiophobic Higgs boson.

  16. Patients with primary breast and primary female genital tract diffuse large B cell lymphoma have a high frequency of MYD88 and CD79B mutations.

    Science.gov (United States)

    Cao, Xin-Xin; Li, Jian; Cai, Hao; Zhang, Wei; Duan, Ming-Hui; Zhou, Dao-Bin

    2017-11-01

    This study is to retrospectively evaluate the prevalence of MYD88 and CD79B mutations and the clinicopathologic characteristics of patients with primary diffuse large B cell lymphoma (DLBCL) of the female genital tract and breast. The characteristics, treatments, and outcomes of 19 patients diagnosed with primary DLBCL of the female genital tract and breast, who had formalin-fixed and paraffin-embedded tissues obtained from diagnostic samples diagnosed between January 2004 and June 2016, were analyzed retrospectively. Nineteen female patients (7 with primary breast and 12 with primary female genital tract DLBCL) were included in this retrospective study. Eleven patients (57.9%) carried a MYD88 mutation, including 10 with MYD8 L265P and 1 with the MYD88 L265S mutation. Seven patients (36.8%) harbored a CD79B mutation, which included two cases with CD79B Y196H, two cases with CD79B Y196N, one case with CD79B Y196D, one case with CD79B Y196F, and one case with CD79B Y196X. Four cases had both MYD88 and CD79B mutations. The clinicopathologic parameters, progression-free survival (PFS), and overall survival (OS) of the MYD88 mutation-carrying group were not significantly different from those of the MYD88 wild-type group except for higher LDH levels. Six patients received cyclophosphamide, doxorubicin, vincristine, and prednisolone (CHOP), while 13 patients received rituximab plus CHOP, and 13 patients received central nervous system prophylaxis. The median OS and PFS were 73 and 56 months, respectively. Patients with primary breast and primary female genital tract DLBCL have a high frequency of MYD88 and CD79B mutations. The presence of these mutations does not affect survival but may offer additional therapeutic options.

  17. Search for anomalons produced in nuclear emulsion by 1.88A GeV 40Ar ions

    International Nuclear Information System (INIS)

    El-Nadi, M.; Badawy, O.E.; El-Nagdy, M.S.; Sadek, N.M.; El-Sourogy, A.A.; Mosaad, M.M.; El-Bakry, M.N.; El-Hamalawy, A.

    1987-01-01

    The interaction mean free paths of relativistic projectile fragments produced from a 40 Ar beam at 1.88A GeV in nuclear emulsion are measured. No statistically significant anomalously short mean free path is observed for projectile fragments of charges ranging from Ζ = 2 up to Ζ ≥ 10 at such energy. (author)

  18. NESHAP Dose-Release Factor Isopleths for Five Source-to-Receptor Distances from the Center of Site and H-Area for all Compass Sectors at SRS using CAP88-PC Version 4.0

    Energy Technology Data Exchange (ETDEWEB)

    Trimor, P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-08-09

    The Environmental Protection Agency (EPA) requires the use of the computer model CAP88-PC to estimate the total effective doses (TED) for demonstrating compliance with 40 CFR 61, Subpart H (EPA 2006), the National Emission Standards for Hazardous Air Pollutants (NESHAP) regulations. As such, CAP88 Version 4.0 was used to calculate the receptor dose due to routine atmospheric releases at the Savannah River Site (SRS). For estimation, NESHAP dose-release factors (DRFs) have been supplied to Environmental Compliance and Area Closure Projects (EC&ACP) for many years. DRFs represent the dose to a maximum receptor exposed to 1 Ci of a specified radionuclide being released into the atmosphere. They are periodically updated to include changes in the CAP88 version, input parameter values, site meteorology, and location of the maximally exposed individual (MEI). This report presents the DRFs of tritium oxide released at two onsite locations, center-of-site (COS) and H-Area, at 0 ft. elevation to maximally exposed individuals (MEIs) located 1000, 3000, 6000, 9000, and 12000 meters from the release areas for 16 compass sectors. The analysis makes use of area-specific meteorological data (Viner 2014).

  19. Two-dimensional gravitactic bioconvection in a protozoan (tetrahymena pyriformis) culture

    OpenAIRE

    Nguyen-Quang, Tri; Nguyen, The Hung; Guichard, Frederic; Nicolau, Ana; Szatmari, George; LePalec, Georges; Dusser, Martine; Lafossee, Josee; Bonnet, Jean Louis; Bohatier, Jacques

    2009-01-01

    Gravitactic bioconvective patterns created by Tetrahymena pyriformis in a Hele-Shaw apparatus were realized and compared with theoretical results. There were found to be two thresholds for bioconvection development: the first indicates the transition from the diffusion to the steady convection state; the second corresponds to the transition from the steady to the unsteady convection state. The results showed that the Hele-Shaw apparatus may be used as a physical analogy of poro...

  20. Narrow Line Cooling of 88Sr Atoms in the Magneto-optical Trap for Precision Frequency Standard

    Science.gov (United States)

    Strelkin, S. A.; Galyshev, A. A.; Berdasov, O. I.; Gribov, A. Yu.; Sutyrin, D. V.; Khabarova, K. Yu.; Kolachevsky, N. N.; Slyusarev, S. N.

    We report on our progress toward the realization of a Strontium optical lattice clock, which is under development at VNIIFTRI as a part of GLONASS program. We've prepared the narrow line width laser system for secondary cooling of 88Sr atoms which allows us to reach atom cloud temperature below 3 μK after second cooling stage.