Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. ZHANG XIURONG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 48. Structures and electronic properties of W m Cu n ( n + m ≤ 7 ) clusters · YU ZHICHENG ZHANG XIURONG HUO PEIYING GAO KUN · More Details Abstract Fulltext PDF.
Künnap, Ago, 1941-
2010-01-01
Arvustus: Gao Jingyi. Han yu yu bei Ou yu yan : Han yu yu Wula'er yu yan ji Yin Ou yu yan tong yuan tan jiu = Chinese language and languages of northern Europe. Beijing : Zhongguo she hui ke xue chu ban she, 2008
Jing Tong Yu Shu, a traditional Chinese medicine, suppresses IL-1β ...
African Journals Online (AJOL)
Zhang et al. 2953. Tropical ... Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a ..... Flower A, Liu JP, Chen S, Lewith G, Little P. Chinese ... Mol Hum Reprod 2000; 6: 269-275. 18.
Preimages for Step-Reduced SHA-2
DEFF Research Database (Denmark)
Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian
2009-01-01
In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT
Xie, Linguo; Sun, Yan; Chen, Tao; Tian, Dawei; Li, Yujuan; Zhang, Yu; Ding, Na; Shen, Zhonghua; Xu, Hao; Nian, Xuewu; Sha, Nan; Han, Ruifa; Hu, Hailong; Wu, Changli
2015-01-01
Linguo Xie,1,2,* Yan Sun,2,* Tao Chen,1,2,* Dawei Tian,1,2 Yujuan Li,3 Yu Zhang,1,2 Na Ding,2 Zhonghua Shen,1,2 Hao Xu,1,2 Xuewu Nian,4 Nan Sha,1,2 Ruifa Han,1,2 Hailong Hu,1,2 Changli Wu1,2 Objective: Human murine double minute 2 protein (MDM2) is mainly a negative regulator of p53 tumor suppressor pathway. We aimed to investigate the association between MDM2 SNP309 polymorphism and bladder cancer risk. Methods: A total of 535 bladder cancer patients and 649 health controls were recruited f...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. W ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. P ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...
The first collision for full SHA-1
M.M.J. Stevens (Marc); E. Bursztein (Elie); P. Karpman (Pierre); A. Albertini (Ange); Y. Markov (Yarik)
2017-01-01
textabstractSHA-1 is a widely used 1995 NIST cryptographic hash function standard that was officially deprecated by NIST in 2011 due to fundamental security weaknesses demonstrated in various analyses and theoretical attacks. Despite its deprecation, SHA-1 remains widely used in 2017 for document
76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256
2011-03-02
... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict
[Diagnosis and treatment characteristics of head-wind sha in She medicine].
Zou, Guangyi; Xu, Xiangdong; Zheng, Songming; Yan, Lianhe; Lei, Houxing; Zhang, Qiao-ling; Xiang, Yingmei; Ye, Yiping; Song, Liwei
2015-03-01
The diagnosis and treatment characteristics of head-wind sha in She medicine were analyzed and summarized. By visiting She-nationality villages and towns in Zhejiang province and Fujian province and interviewing hundreds of doctors of She medicine, the sha diagnosis, sha differentiation, experience and theory of treatment were arranged, and a comprehensive summary on theory and application of head-wind sha in She medicine such as pathogeny, name of disease, mechanism, diagnosis, differential diagnosis and treatment was made. It is believed that the methods of diagnosis and treatment in She medicine for head-wind sha could effectively enhance curative effect, safety and patients' quality of life, and the further research should be carried out.
LDPC and SHA based iris recognition for image authentication
Directory of Open Access Journals (Sweden)
K. Seetharaman
2012-11-01
Full Text Available We introduce a novel way to authenticate an image using Low Density Parity Check (LDPC and Secure Hash Algorithm (SHA based iris recognition method with reversible watermarking scheme, which is based on Integer Wavelet Transform (IWT and threshold embedding technique. The parity checks and parity matrix of LDPC encoding and cancellable biometrics i.e., hash string of unique iris code from SHA-512 are embedded into an image for authentication purpose using reversible watermarking scheme based on IWT and threshold embedding technique. Simply by reversing the embedding process, the original image, parity checks, parity matrix and SHA-512 hash are extracted back from watermarked-image. For authentication, the new hash string produced by employing SHA-512 on error corrected iris code from live person is compared with hash string extracted from watermarked-image. The LDPC code reduces the hamming distance for genuine comparisons by a larger amount than for the impostor comparisons. This results in better separation between genuine and impostor users which improves the authentication performance. Security of this scheme is very high due to the security complexity of SHA-512, which is 2256 under birthday attack. Experimental results show that this approach can assure more accurate authentication with a low false rejection or false acceptance rate and outperforms the prior arts in terms of PSNR.
"Pipa Fairy Maiden" Zhang Hongyan
Institute of Scientific and Technical Information of China (English)
1995-01-01
WHEN Zhang Hongyan plays the completely traditional Chinese musical instrument, the pipa, she is called a "pipa fairy maiden" by her audiences, "the pipa queen with outstanding talent and appearance" by the Hong Kong press and "a national flower of the Women Philharmonic Orchestra" in Singapore. Having completed her master’s degree program at the folk music department of the Central Conservatory of Music. Zhang is continuing there as a teacher. On the unforgettable night of June 9, 1992, Zhang Hongyan presented her first solo concerto concert at the Beijing Concert Hall, in cooperation with the celebrated Central Philharmonic Orchestra based in Beijing and its famous conductor Hu Yongyan. This concert made her the first folk musical instrument player to present a special concerto concert in cooperation with a Western style orchestra. It is the result of many years of effort. Zhang was born in Shengxian County, Zhejiang Province, famous as the home of Yue Opera. Her father is a musician with a Yue Opera
CSIR Research Space (South Africa)
Motara, YM
2017-09-01
Full Text Available the intersection between the SHA-1 preimage problem, the encoding of that problem for SAT-solving, and SAT-solving. The results demonstrate that SAT-solving is not yet a viable approach to take to solve the preimage problem, and also indicate that some...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. DUJUAN ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 59. In vitro bioactivity evaluation of α -calcium sulphate hemihydrate and bioactive glass composites for their potential use in bone regeneration · YANYAN ZHENG CHENGDONG ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. PING ZHANG. Articles written in Bulletin of Materials Science. Volume 36 Issue 6 November 2013 pp 1073-1077. Intrinsic structure and friction properties of graphene and graphene oxide nanosheets studied by scanning probe microscopy · Yan-Huai Ding Hu-Ming Ren Fei-Hu ...
Second-Preimage Analysis of Reduced SHA-1
DEFF Research Database (Denmark)
Rechberger, Christian
2010-01-01
Many applications using cryptographic hash functions do not require collision resistance, but some kind of preimage resistance. That's also the reason why the widely used SHA-1 continues to be recommended in all applications except digital signatures after 2010. Recent work on preimage and second...
Directory of Open Access Journals (Sweden)
Zahid Raja
Full Text Available Antimicrobial peptides (AMPs are promising drugs to kill resistant pathogens. In contrast to bacteria, protozoan parasites, such as Leishmania, were little studied. Therefore, the antiparasitic mechanism of AMPs is still unclear. In this study, we sought to get further insight into this mechanism by focusing our attention on temporin-SHa (SHa, a small broad-spectrum AMP previously shown to be active against Leishmania infantum. To improve activity, we designed analogs of SHa and compared the antibacterial and antiparasitic mechanisms. [K3]SHa emerged as a highly potent compound active against a wide range of bacteria, yeasts/fungi, and trypanosomatids (Leishmania and Trypanosoma, with leishmanicidal intramacrophagic activity and efficiency toward antibiotic-resistant strains of S. aureus and antimony-resistant L. infantum. Multipassage resistance selection demonstrated that temporins-SH, particularly [K3]SHa, are not prone to induce resistance in Escherichia coli. Analysis of the mode of action revealed that bacterial and parasite killing occur through a similar membranolytic mechanism involving rapid membrane permeabilization and depolarization. This was confirmed by high-resolution imaging (atomic force microscopy and field emission gun-scanning electron microscopy. Multiple combined techniques (nuclear magnetic resonance, surface plasmon resonance, differential scanning calorimetry allowed us to detail peptide-membrane interactions. [K3]SHa was shown to interact selectively with anionic model membranes with a 4-fold higher affinity (KD = 3 x 10-8 M than SHa. The amphipathic α-helical peptide inserts in-plane in the hydrophobic lipid bilayer and disrupts the acyl chain packing via a detergent-like effect. Interestingly, cellular events, such as mitochondrial membrane depolarization or DNA fragmentation, were observed in L. infantum promastigotes after exposure to SHa and [K3]SHa at concentrations above IC50. Our results indicate that these
Mapping PetaSHA Applications to TeraGrid Architectures
Cui, Y.; Moore, R.; Olsen, K.; Zhu, J.; Dalguer, L. A.; Day, S.; Cruz-Atienza, V.; Maechling, P.; Jordan, T.
2007-12-01
The Southern California Earthquake Center (SCEC) has a science program in developing an integrated cyberfacility - PetaSHA - for executing physics-based seismic hazard analysis (SHA) computations. The NSF has awarded PetaSHA 15 million allocation service units this year on the fastest supercomputers available within the NSF TeraGrid. However, one size does not fit all, a range of systems are needed to support this effort at different stages of the simulations. Enabling PetaSHA simulations on those TeraGrid architectures to solve both dynamic rupture and seismic wave propagation have been a challenge from both hardware and software levels. This is an adaptation procedure to meet specific requirements of each architecture. It is important to determine how fundamental system attributes affect application performance. We present an adaptive approach in our PetaSHA application that enables the simultaneous optimization of both computation and communication at run-time using flexible settings. These techniques optimize initialization, source/media partition and MPI-IO output in different ways to achieve optimal performance on the target machines. The resulting code is a factor of four faster than the orignial version. New MPI-I/O capabilities have been added for the accurate Staggered-Grid Split-Node (SGSN) method for dynamic rupture propagation in the velocity-stress staggered-grid finite difference scheme (Dalguer and Day, JGR, 2007), We use execution workflow across TeraGrid sites for managing the resulting data volumes. Our lessons learned indicate that minimizing time to solution is most critical, in particular when scheduling large scale simulations across supercomputer sites. The TeraShake platform has been ported to multiple architectures including TACC Dell lonestar and Abe, Cray XT3 Bigben and Blue Gene/L. Parallel efficiency of 96% with the PetaSHA application Olsen-AWM has been demonstrated on 40,960 Blue Gene/L processors at IBM TJ Watson Center. Notable
Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun
2011-09-01
Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.
Zhang functions and various models
Zhang, Yunong
2015-01-01
This book focuses on solving different types of time-varying problems. It presents various Zhang dynamics (ZD) models by defining various Zhang functions (ZFs) in real and complex domains. It then provides theoretical analyses of such ZD models and illustrates their results. It also uses simulations to substantiate their efficacy and show the feasibility of the presented ZD approach (i.e., different ZFs leading to different ZD models), which is further applied to the repetitive motion planning (RMP) of redundant robots, showing its application potential.
Zhang Qing and His Meticulous Chinese Paintings
Institute of Scientific and Technical Information of China (English)
JULIE; M.SEGRAVES
2002-01-01
ZHANG Qing was initially drawn to the bird and flower paint-ings of the Tang and Song dynasties (7th-12th centuries). Later,Qing Dynasty (1644-1911) artist Ren Bonian, famous for hispaintings of figures, also became an important influence.Although Zhang Qing considers his style to be firmly rooted in tradi-
The extended (G/G)-expansion method and travelling wave ...
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 6. The extended (′/)-expansion method and travelling wave solutions for the perturbed nonlinear Schrödinger's equation with Kerr law nonlinearity. Zaiyun Zhang Jianhua Huang Juan Zhong Sha-Sha Dou Jiao Liu Dan Peng Ting Gao. Research Articles ...
Effects of Gua-Sha therapy on breast engorgement: a randomized controlled trial.
Chiu, Jin-Yu; Gau, Meei-Ling; Kuo, Shu-Yu; Chang, Yung-Hsien; Kuo, Su-Chen; Tu, Hui-Chuan
2010-03-01
Breast engorgement is a common problem that affects the initiation and duration of breastfeeding. Limited solutions are available to relieve the discomfort associated with breast engorgement. Thus, further investigation of methods to achieve effective relief of symptoms is critical to promote breastfeeding success. : The purpose of this study was to determine the effects of two breast care methods, that is, scraping (Gua-Sha) therapy (administered to the experimental group) and traditional breast care (i.e., massage and heating; administered to the control group). A randomized controlled trial was conducted on 54 postpartum women at a Level III medical teaching hospital. Participant inclusion criteria included postpartum breastfeeding women (a) who had an uncomplicated delivery and (b) who were experiencing breast engorgement problems. The Gua-Sha protocol selected appropriate acupoint positions, which included ST16, ST18, SP17, and CV17. Each position was lightly scraped seven times in two cycles. For the control group, we used hot packs and massage for 20 min in accordance with recommendations given in an obstetrical technique textbook. Results showed no statistical differences between the two groups at baseline. Body temperature, breast temperature, breast engorgement, pain levels, and discomforting levels were statistically different between the two groups at 5 and 30 min after intervention (p account. Our findings provided empirical evidence supporting that Gua-Sha therapy may be used as an effective technique in the management of breast engorgement. By using Gua-Sha therapy, nurses can handle breast engorgement problems more effectively in primary care and hence help patients both physically and psychologically.
O'Brien, E C; Farkas, E; Gil, M J; Fitzgerald, D; Castineras, A; Nolan, K B
2000-04-01
Stability constants of iron(III), copper(II), nickel(II) and zinc(II) complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid (HAha) and benzohydroxamic acid (HBha) have been determined at 25.0 degrees C, I=0.2 mol dm(-3) KCl in aqueous solution. The complex stability order, iron(III) > copper(II) > nickel(II) approximately = zinc(II) was observed whilst complexes of H2Sha were found to be more stable than those of the other two ligands. In the preparation of ternary metal ion complexes of these ligands and 1,10-phenanthroline (phen) the crystalline complex [Cu(phen)2(Cl)]Cl x H2Sha was obtained and its crystal structure determined. This complex is a model for hydroxamate-peroxidase inhibitor interactions.
D.SYM.4 SHA-3 Design and Cryptanalysis Report
DEFF Research Database (Denmark)
Gauravaram, Praveen; Thomsen, Søren Steffen
2011-01-01
The competition to select a new secure hash function standard SHA-3 was initiated in response to surprising progress in the cryptanalysis of existing hash function constructions that started in 2004. In this report we survey design and cryptanalytic results of those 14 candidates that remain in t...
On security arguments of the second round SHA-3 candidates
DEFF Research Database (Denmark)
Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart
2012-01-01
of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...... and review arguments and bounds against classes of differential attacks.We discuss all the SHA-3 candidates at a high functional level, analyze, and summarize the security reduction results and bounds against differential attacks. Additionally, we generalize the well-known proof of collision resistance...
A one-time pad color image cryptosystem based on SHA-3 and multiple chaotic systems
Wang, Xingyuan; Wang, Siwei; Zhang, Yingqian; Luo, Chao
2018-04-01
A novel image encryption algorithm is proposed that combines the SHA-3 hash function and two chaotic systems: the hyper-chaotic Lorenz and Chen systems. First, 384 bit keystream hash values are obtained by applying SHA-3 to plaintext. The sensitivity of the SHA-3 algorithm and chaotic systems ensures the effect of a one-time pad. Second, the color image is expanded into three-dimensional space. During permutation, it undergoes plane-plane displacements in the x, y and z dimensions. During diffusion, we use the adjacent pixel dataset and corresponding chaotic value to encrypt each pixel. Finally, the structure of alternating between permutation and diffusion is applied to enhance the level of security. Furthermore, we design techniques to improve the algorithm's encryption speed. Our experimental simulations show that the proposed cryptosystem achieves excellent encryption performance and can resist brute-force, statistical, and chosen-plaintext attacks.
Li, Mingyang; Zheng, Ang; Duan, Wenjuan; Mu, Xin; Liu, Chunli; Yang, Yang; Wang, Xin
2018-06-01
System of Health Accounts 2011 (SHA 2011) is a new health care accounts system, revised from SHA 1.0 by the Organisation for Economic Co-operation and Development (OECD), the World Health Organization (WHO) and Eurostat. It keeps the former tri-axial relationship and develops three analytical interfaces, in order to fix the existing shortcomings and make it more convenient for analysis and comparison across countries. SHA 2011 was introduced in China in 2014, and little about its application in China has been reported. This study takes children as an example to study how to apply SHA 2011 at the subnational level in the practical situation of China's health system. Multistage random sampling method was applied and 3 532 517 samples from 252 institutions were included in the study. Official yearbooks and account reports helped the estimation of provincial data. The formula to calculate Current Health Expenditure (CHE) was introduced step-by-step. STATA 10.0 was used for statistics. Under the frame of SHA 2011, the CHE for children in Liaoning was calculated as US$ 0.74 billion in 2014; 98.56% of the expenditure was spent in hospital and the allocation to primary health care institutions was insufficient. Infection, maternal and prenatal diseases cost the most in terms of Global Burden of Disease (GBD), and respiratory system diseases took the leading place in terms of International Classification of Disease Tenth Revision (ICD-10). In addition, medical income contributed most to the health financing. The method to apply SHA 2011 at the subnational level is feasible in China. It makes health accounts more adaptable to rapidly developing health systems and makes the financing data more readily available for analytical use. SHA 2011 is a better health expenditure accounts system to reveal the actual burden on residents and deserves further promotion in China as well as around the world.
A comparative study of Message Digest 5(MD5) and SHA256 algorithm
Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.
2018-03-01
The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.
Mortal Ancestors, Immortal Images: Zhang Dai’s Biographical Portraits
Directory of Open Access Journals (Sweden)
Duncan M. Campbell
2012-11-01
Full Text Available Towards the end of his long life, the prolific late-Ming historian and essayist Zhang Dai 張岱 (1597-?1684 completed a book that he had been working on for many years. Entitled Portraits of the Eminent and Worthy Immortals of Zhejiang During the Ming Dynasty (You Ming yuyue san bu xiu tuzan 有明於越三不朽名賢圖贊 the book included the short biographies (with poetic panegyrics and portraits of 109 men and women of Zhang Dai’s hometown of Shaoxing, one of the epicentres of China’s élite cultural life. The book was organised according to the “Three Immortalities of Life”: moral force, meritorious service, and wise words. Zhang also included a number of his own friends and family members in this collection. This paper discusses aspects the relationship between text and image in this late-imperial Chinese work, both in the context of Zhang Dai’s practice as a biographer who had a strong visual sense and in regard to his particular historical plight as someone who had survived the collapse of one dynasty and who had lived on under its successor regime.
Dr. Yu Wang, Director, Natural Science Division, National Science Council, Taiwan
Patrice Loïez
2001-01-01
Photo 01: L. to r.: Dr. Philippe Bloch, CERN CMS ECAL Deputy Project Manager, Dr. Yu Wang, Dr. Etiennette Auffray, CERN, responsible of the CERN ECAL Regional Centre. Photo 02: L. to r.: Dr. Yu Wang, Dr. Philippe Bloch, Dr. Apollo GO, National Central University, Taiwan, Dr. Etiennette Auffray.
[Autobiography of modern acupuncturist Yu Shu-zhuang].
Li, Jia-jian' i; Guo, Jing; Yu, Zhen-zhong; Wang, Lin-peng
2014-11-01
Professor YU Shu-zhuang is a distinguished acupuncturist in China. He has practiced the TCM acupuncture-moxibustion clinical, educational and scientific research for 60 years in his life. In clinic, he summarized the experiences "five-ming first"; in treatment, he insisted "dredging" and "regulating", protecting the function of spleen and stomach, and needles should be less but specific. In the meanwhile, he made a deep study on the function and clinical effects of specific acupoints, and used the research results of propagated sensation along channel to guide clinical treatment, forming his special academic points. Professor YU has educated a great number of acupuncture-moxibustion talents in China and foreign countries, making great contribution to the popularization of acupuncture-moxibustion in the worldwide.
Reference: 356 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 006 Mar Plant molecular biology Deng Xingwang|Dong Li|Wang Lei|Xue Yongbiao|Zhang Yansheng|Zhang Yu'e ...ein CEGENDUO negatively regulates auxin-mediated lateral root formation in Arabidopsis. 4 599-615 16525894 2
Zhang Ke
2006-01-01
Intervjuu Hiina arhitektuuribüroo Standardarchitecture arhitektide Zhang Ke ja Zhang Hongiga ning arhitektuuribüroo Urbanus arhitekti Xiaodu Liuga Hollandis Hiina tänapäeva tutvustaval näitusel. Hiina arhitektide haridusest, oma arhitektuuribüroode töödest, tänapäeva hiina arhitektuurist, põhiprobleemidest
Twist of Magnetic Fields in Solar Active Regions Hongqi Zhang ...
Indian Academy of Sciences (India)
tribpo
in active regions also shows the butterfly pattern through the solar cycle. And, less than 30% of the active regions do not follow the general trend (Zhang & Bao 1998). The longitudinal distribution of current helicity parameter h|| of active regions in both the hemispheres in the last decade was presented by Zhang & Bao ...
Aesthetic Function Realized in the Selected Modern Chinese Essays by Zhang Peiji
Institute of Scientific and Technical Information of China (English)
罗丹
2014-01-01
The selected modern Chinese essays translated by Zhang Peiji is a masterpiece for Chinese scholars to do translation research. Prof. Zhang not only excels at translating the Chinese works accurately but also conveys the aesthetic value in the translated version. This paper wil analyse the aesthetic function used in Zhang Peiji’s selected modern Chinese essays from five aspects, music value, rhythm value, ful-grownness value, conciseness value and artistic conception value.
African Journal of Biotechnology - Vol 10, No 73 (2011)
African Journals Online (AJOL)
Morphological diversity of wild medicinal Paris L. from China and Vietnam · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JY Zhang, J Zhang, WZ Yang, YZ Wang, H Yu, H Jin, 16421-16428 ...
African Journal of Biotechnology - Vol 10, No 65 (2011)
African Journals Online (AJOL)
HQ Lou, Y Hu, L Zhang, YJ Zhang, PG Tu, XT Yu, YJ Jin, L Wang, 14286-14292 ... The effect of osmopriming on germination, seedling growth and phosphatase activities of lettuce under saline ... S Han, TH Zhu, SJ Li, FL Li, 14404-14409.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Yu-Song Guo Zhong-Duo Wang Cheng-Zhong Yan Yu-Lan Zhang Jin-Nan Zheng Yuan-Min Xu Tao Du Chu-Wu Liu · More Details Fulltext PDF ... Aifu Yang Dapeng Sun Shikai Liu Ying Dong Zhong Chen Zunchun Zhou · More Details Fulltext ...
Casein kinase 1-Like 3 is required for abscisic acid regulation of ...
African Journals Online (AJOL)
Casein kinase 1-Like 3 is required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis. M Wang, D Yu, X Guo, X Li, J Zhang, L Zhao, H Chang, S Hu, C Zhang, J Shi, X Liu ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 128; Issue 6. Triflic Anhydride-Mediated Beckmann Rearrangement Reaction of Β-Oximyl Amides: Access to 5-Iminooxazolines. MANGFEI YU QIAN ZHANG JIA WANG PENG HUANG PENGFEI YAN RUI ZHANG DEWEN DONG. Regular Article Volume 128 Issue 6 ...
Preparation and characterization of water-absorbing composite ...
African Journals Online (AJOL)
ABCO
2012-08-16
Aug 16, 2012 ... 2007; Doorkosh et al., 2000), and natural polymers (Yu et al., 2009; Doorkosh et al., ... Zhang et al., 2007; Lee and Chen, 2005; Neaman et al.,. 2004; Lin et al., 2001). ..... Li A, Zhang JP, Wang AQ (2007). Utilization of starch ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 122; Issue 6. Theoretical study of nucleophilic halogenalkylation of propylene oxide with halogenmethane and dihalogenmethane anion. Tao Liu Xiang-Chen Yin Guo-Dong Liu Zhang-Yu Yu. Full Papers Volume 122 Issue 6 November 2010 pp 901-909 ...
Broad-Band Spectral Indices Variability of BL Lacertae by Wavelet ...
Indian Academy of Sciences (India)
by Wavelet Method. Hao-Jing Zhang1,2,∗, Jing-Ming Bai1, Yu-Ying Bao3 & Xiong Zhang2. 1Yunnan Astronomical Observatory, National Astronomical Observatory, ... 3Department of Physics, Yuxi Teachers' College, Yuxi, Yunnan 653100, China. ∗ ... broad-band spectral indices—periodic variation—methods: numerical:.
BioShaDock: a community driven bioinformatics shared Docker-based tools registry.
Moreews, François; Sallou, Olivier; Ménager, Hervé; Le Bras, Yvan; Monjeaud, Cyril; Blanchet, Christophe; Collin, Olivier
2015-01-01
Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.
Comments on Yu N Parkhomenko's paper 'Role of aberration effects in dispersive cavities'
International Nuclear Information System (INIS)
Anokhov, S P
1999-01-01
The legitimacy of the approach, proposed by Yu N Parkhomenko for dealing with the operation of solid-state lasers with dispersive cavities, is discussed. Additional information is provided on the neodymium glass laser, used in the present author's experiment. Comment on A Yu N Parkhomenko 1998 Quantum Electron. 28 1102. (discussion)
Mortal Ancestors, Immortal Images: Zhang Dai’s Biographical Portraits
Duncan M. Campbell
2012-01-01
Towards the end of his long life, the prolific late-Ming historian and essayist Zhang Dai 張岱 (1597-?1684) completed a book that he had been working on for many years. Entitled Portraits of the Eminent and Worthy Immortals of Zhejiang During the Ming Dynasty (You Ming yuyue san bu xiu tuzan 有明於越三不朽名賢圖贊) the book included the short biographies (with poetic panegyrics) and portraits of 109 men and women of Zhang Dai’s hometown of Shaoxing, one of the epicentres of China’s élite cultural life. Th...
Directory of Open Access Journals (Sweden)
Du Ruiting
2008-11-01
Full Text Available Abstract Background There is increasing evidence to suggest an immunomodulation function both within the intestines and systemically upon consuming probiotic species. We recently isolated a novel LAB, Lactobacillus caseiZhang (LcZhang from koumiss. LcZhang exhibited favorable probiotic properties, such as acid resistance, bile resistance, gastrointestinal (GI colonization ability, etc. In order to examine the immunomodulatory qualities of LcZhang, we administered LcZhang to healthy mice with varying doses of either live or heat-killed LcZhang and measured various parameters of the host immune response. Results The study was performed in four separate experiments via oral administration of live and heat-killed LcZhang to BALB/c mice for several consecutive days. We investigated the immunomodulating capacity of LcZhang in vivo by analyzing the profile of cytokines, T cell subpopulations, and immunoglobulin concentrations induced in blood serum and intestinal fluid in BALB/c mice. Only live bacteria elicited a wide range of immune responses, which include the increased production of interferon-γ (IFN-γ, and depression of tumor necrosis factor-α (TNF-α levels. In addition, interleukin-2 (IL-2 and IL-2 receptor gene transcription increased significantly, but the proportion of T cell subsets appeared to be unaffected. We also observed that LcZhang was capable of inducing gut mucosal responses by enhancing the production of secretory Immunoglobulin A (sIgA as well influencing the systemic immunity via the cytokines released to the circulating blood. Conclusion The present work shows that the dose-dependent administration of LcZhang is capable of influencing immune responses, implying that it may be a valuable strain for probiotic use in humans.
Data harmonization and federated analysis of population-based studies : the BioSHaRE project
Doiron, Dany; Burton, Paul; Marcon, Yannick; Gaye, Amadou; Wolffenbuttel, Bruce H R; Perola, Markus; Stolk, Ronald P; Foco, Luisa; Minelli, Cosetta; Waldenberger, Melanie; Holle, Rolf; Kvaløy, Kirsti; Hillege, Hans L; Tassé, Anne-Marie; Ferretti, Vincent; Fortier, Isabel
2013-01-01
ABSTRACTS BACKGROUND: Individual-level data pooling of large population-based studies across research centres in international research projects faces many hurdles. The BioSHaRE (Biobank Standardisation and Harmonisation for Research Excellence in the European Union) project aims to address these
Dr.Zhang Ren's Experience in Acupuncture Treatment of Obstinate Eye Diseases
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
@@ Dr.Zhang Ren (張仁), the board chairman of Shanghai Acupuncture Association, has been engaging in acupuncture treatment for more than 30years, during which he has kept on exploring the acupuncture therapies for obstinate diseases,especially for the obstinate eye diseases, ant summed up rich experience in this aspect. The following is a summary of what the author has learned from Dr. Zhang Ren.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
... Refresher Courses · Symposia · Live Streaming. Home; Journals; Journal of Genetics; Volume 95; Issue 1. Novel NPHS1 gene mutations in a Chinese family with congenital nephrotic syndrome. Fengjie Yang Yaxian Chen Yu Zhang Liru Qiu Yu Chen Jianhua Zhou. Research Note Volume 95 Issue 1 March 2016 pp 161- ...
Wang, J; Guo, Z; Zhang, Q; Yan, L; Chen, W; Liu, X-M; Zhang, H-P
2009-06-01
Lactobacillus casei Zhang is a novel strain that was screened out of koumiss collected in Inner Mongolia, and our previous research showed that L. casei Zhang has health benefits such as cholesterol-reducing and immunomodulating effects. The fermentation characteristics of L. casei Zhang in soymilk and bovine milk and the transit tolerance of L. casei Zhang in fermented milk products during refrigerated storage for 28 d were assessed. A faster decrease in pH and faster growth of L. casei Zhang during fermentation were observed in soymilk compared with bovine milk at various inoculation rates, probably because of the low pH buffering capacity of soymilk. The fermented bovine milk samples had much higher final titratable acidity (TA) values (between 0.80 and 0.93%) than the soymilk samples (between 0.40 and 0.46%). Dramatic increases in TA values in the fermented soymilk samples during storage were observed, and the TA values of the fermented soymilk samples changed from survival rates of freshly prepared cultures of L. casei Zhang in simulated gastric juice at pH 2.0 and 2.5 were 31 and 69%, respectively, and the delivery of L. casei Zhang through fermented soymilk and bovine milk significantly improved the viability of L. casei Zhang in simulated gastric transit. Lactobacillus casei Zhang showed good tolerance to simulated gastric juice and intestinal juice in the fermented soymilk and bovine milk samples, and maintained high viability (>10(8) cfu/g) during storage at 4 degrees C for 28 d. Our results indicated that both soymilk and bovine milk could serve as vehicles for delivery of probiotic L. casei Zhang, and further research is needed to elucidate the mechanism of the change in pH and TA of L. casei Zhang in fermented milk samples during fermentation and storage and to understand the difference between soy- and milk-based systems.
Tropical Journal of Pharmaceutical Research - Vol 14, No 7 (2015)
African Journals Online (AJOL)
Evaluation of Therapeutic Effects of Radiotherapy during Treatment of Lung Adenocarcinoma in Mice with Positron Emission Tomography Imaging ofF-FLT andF-FDG · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Qu, H Wang, W Yu, J Zhang, H Zhang, J Tian ...
Side channel analysis of some hash based MACs: A response to SHA-3 requirements
DEFF Research Database (Denmark)
Gauravaram, Praveen; Okeya, Katsuyuki
2008-01-01
The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...
Triyono, Joko; Rizha, Yushak; Triyono, Teguh
2018-04-01
The use of biomaterials in orthopedics is increasing. This led to the growth of innovations in the field of medicine, one of them is the development of biomaterials. Study of Sheep Hydroxyapatite (SHA)/shellac/sugar biocomposite characterization was to determine the phase of the material, porosity, hardness and compressive strength of them. This research was conducted to develop new types of biomaterials that can be used as bone filler material. The analysis that used in this research was dry methods. The results showed that observation of XRD (X-Ray Diffraction) shows the pattern of diffraction 2θ: 31.6472°, 32.7753°, 32.0723°, The highest hardness of SHA/shellac/sugar ratio was 70:30% (7.38±0.1395 VHN) and the lowest at 50:50% (4.91±0.37 VHN). The highest Diametral Tensile Strength (DTS) test was 70:30% (5.43±1.395 MPa) and the lowest at 50:50% (3.10±0.26 MPa). SEM observations are performed to see the material porosity.
On soliton solutions of the Wu-Zhang system
Directory of Open Access Journals (Sweden)
Inc Mustafa
2016-01-01
Full Text Available In this paper, the extended tanh and hirota methods are used to construct soliton solutions for the WuZhang (WZ system. Singular solitary wave, periodic and multi soliton solutions of the WZ system are obtained.
The Role of SIRT1 In Breast Cancer Stem Cells
2016-09-01
2009;9:123-8. 56. Ma W, Xiao GG, Mao J, Lu Y, Song B, Wang L, Fan S, Fan P, Hou Z, Li J, Yu X, 20 Wang B, Wang H, Wang H, Xu F, Li Y, Liu Q, Li L...Int J Biol Sci. 2010;6:599-612. 63. Zhang Y, Zhang M, Dong H, Yong S, Li X, Olashaw N, Kruk PA, Cheng JQ, Bai W, Chen J, Nicosia SV, Zhang X
DNA pattern recognition using canonical correlation algorithm
Indian Academy of Sciences (India)
2015-09-28
Sep 28, 2015 ... were considered as the two views, and statistically significant relationships were established between these two ... Canonical correlation analysis is to find two sets of basis ..... Jing XY, Li S, Lan C, Zhang D, Yang JY and Liu Q 2011 Color ... Yu S, Yu K, Tresp V and Kriegel HP 2006 Multi-output regularized.
Gordely, Valentin; Kuklin, Alexander; Balasoiu, Maria
2012-03-01
The Second International Workshop 'SANS-YuMO User Meeting at the Start-up of Scientific Experiments on the IBR-2M Reactor', devoted to the 75th anniversary of the birth of Professor Yu M Ostanevich (1936-1992), an outstanding neutron physicist and the founder of small-angle neutron scattering (field, group, and instrument) at JINR FLNPh, was held on 27-30 May at the Frank Laboratory of Neutron Physics. The first Workshop was held in October 2006. Research groups from different neutron centers, universities and research institutes across Europe presented more than 35 oral and poster presentations describing scientific and methodological results. Most of them were obtained with the help of the YuMO instrument before the IBR-2 shutdown in 2006. For the last four years the IBR-2 reactor has been shut down for refurbishment. At the end of 2010 the physical launch of the IBR-2M reactor was finally realized. Nowadays the small-angle neutron scattering (SANS) technique is applied to a wide range of scientific problems in condensed matter, soft condensed matter, biology and nanotechnology, and despite the fact that there are currently over 30 SANS instruments in operation worldwide at both reactor and spallation sources, the demand for beam-time is considerably higher than the time available. It must be remembered, however, that as the first SANS machine on a steady-state reactor was constructed at the Institute Laue Langevin, Grenoble, the first SANS instrument on a 'white' neutron pulsed beam was accomplished at the Joint Institute for Nuclear Research at the IBR-30 reactor, beamline N5. During the meeting Yu M Ostanevich's determinative and crucial contribution to the construction of spectrometers at the IBR-2 high-pulsed reactor was presented, as well as his contribution to the development of the time-of-flight (TOF) small-angle scattering technique, and a selection of other scientific areas. His leadership and outstanding scientific achievements in applications of the
Yu Kilchun’s Concept of Reform of the Tax System in the Korean Empire
Directory of Open Access Journals (Sweden)
Jinah Yang
2016-08-01
Full Text Available Yu Kilchun in “Semubu (Tax Department” criticizes the trend of the tax system, in which the authority to impose and collect taxes had been taken away from the local magistrates and the isŏ class (composed of hyangni, local functionaries, and sŏri, petty clerks during the Kabo Reform was once again returned to them. Yu Kilchun devised a concept of tax system reform on the premise of the reorganization of the administrative districts into the chu-kun-hyang-ri (state-county-district-village system. Yu’s idea was to make myŏn (hyang, district a governing administrative unit, placed under direct government control. To fund the operation of local governments, Yu proposed to create local taxes, chu taxes and hyang. Tax amounts were to be determined by local assemblies, chuhoe and hyanghoe, which were given the authority to deliberate on budget. The authority to review tax sources, levy and collect taxes was given to hyang, a small unit of administrative division. By imbuing this authority to hyang, Yu Kilchun planned to exclude local magistrates and the isŏ class in the tax collection process. Since “Semubu” discusses the reorganization of administrative divisions and local tax administration, as well as local tax system reform, the discovery of this text is significant, as it expands the range of the reform ideas proposed by Yu Kilchun, and furthermore the Enlightenment Party.
YU Ren-cun(郁仁存)——A Famous Oncologist in Integrative Medicine
Institute of Scientific and Technical Information of China (English)
2008-01-01
@@ YU Ren-cun was born on August 1,1934.After graduating from Jiangxi Medical College in 1955,he took part in the very first Western Doctors' Class for Learning Traditional Chinese Medicine (TCM) held in Beijing from March 1959 to December 1961.Prof.YU systematically learned TCM while taking this class.Since 1962,he has been working in the Beijing Hospital of Traditional Chinese Medicine,eventually being promoted to a Chief Physician by the Beijing Municipal Government in May of 1981.In 1997,Prof.YU was selected as a well-known veteran for the National TCM Doctor Inheritance Work by the State Administration of Traditional Chinese Medicine (SATCM).The State Council of China has awarded him a special subsidy every month for his excellent work.
Directory of Open Access Journals (Sweden)
Monika GÄNßBAUER
2014-05-01
Full Text Available This article introduces the work of the academician Zhang Xianglong (b. 1949, focussing on his idea of establishing a “special zone for Confucianism” in China. Zhang argues that special protection is needed for Confucian traditions which he perceives as the leading culture of China. Confucian culture should find its way out of the museum, says Zhang. He also refers to the political concept of “one country, two systems” that was implemented when Hongkong was restored to Chinese rule. Zhang applies this to his idea of a “special zone for Confucianism”, suggesting that this political concept could be extended to “one country, three systems”. In my view Zhang is developing new, creative ideas for possible experimental fields dealing with Confucianism in the context of the People’s Republic of China. In the end it is my argument that it would be helpful to conduct in-depth research on the possible role of Confucianism in today’s China.
Energy Technology Data Exchange (ETDEWEB)
Lung Shih-Chun Candice [Research Center for Environmental Changes, Academia Sinica, Taipei (Taiwan); Guo Yu-Liang Leon; Chang Ho-Yuan [Dept. of Environmental and Occupational Health, Coll. of Medicine, National Cheng Kung Univ., Tainan (Taiwan)
2004-09-15
In 1979, about two thousand people in central Taiwan were intoxicated by consumption of the rice oil that was contaminated with polychlorinated biphenyls (PCBs). This ''Yu-cheng'' incident was one of the two human tragedies which people ingested substantial amounts of PCBs within a short period of time. Some of the follow-up epidemiological studies focused on the children born to the exposed mothers, the Yu-cheng children, since they could be exposed to PCBs via breast-feeding or transplacental transfer. This report presents the results of the serum PCB levels of the 21 Yu-cheng children with a congener-specific analysis. On the other hand, fish consumption is thought to be the single most important exposure route to PCBs to the general public; thus, it is crucial to understand PCB exposure from fish consumption. In a separated study to assess PCB contamination in fish, PCB congener concentrations in tilapia (Oreochromis hybrids), the most popular fish in Taiwan, were evaluated. The consumption quantity of tilapia is the highest throughout the Island. It is mostly farmed in fresh water but can also be bred in saltwater. This report presents the concentrations and profiles in the serums of the Yu-cheng children. The congener profile is compared with PCB profile in the serum of Yu-cheng women reported previously and that in one of the potentially significant exposure source, tilapia, conducted in a separated work. Remarkable similarity between the profile of Yu-cheng children and that of the tilapia is revealed and discussed.
Further investigations on a question of Zhang and Lü
Directory of Open Access Journals (Sweden)
Abhijit Banerjee
2015-09-01
Full Text Available In the paper taking the question of Zhang and Lü [15] into background, wepresent one theorem which will improve and extend results of Banerjee-Majumdar [2] and arecent result of Li-Huang [9].
Impact of Obesity on Tamoxifen Chemoprevention in a Model of Ductal Carcinoma in Situ
2012-10-01
Sarah M. Smith. McDonald JM*, Dunlap SM*, Cogdell D, Dunmire V, Wei Q, Starzinski-Powitz A, Sawaya R, Bruner J, Fuller GN, Aldape K, and Zhang W...Sciences 104(28):11736-41, July 2007. Moore LM, Holmes KM, Smith SM, Wu Y, Tchougounova E, Uhrbom L, Sawaya R, Bruner JM, Fuller GN, and Zhang W... Bruner JM Kuang J, Yu H, Fuller GN and Zhang W. Inhibition of gliomagenesis and attenuation of mitotic transition by MIIP. Oncogene 29(24):3501-8, June
Relational demography in coach-athlete dyads | Zhang | African ...
African Journals Online (AJOL)
This study used an adapted version of Zhang's (2004) trust questionnaire to examine perceived characteristic and trust differences between coach and athlete dyads that differ in gender or ethnicity as well as in dyads that were similar. The four different gender dyad groups were male athlete with male coach (MAMC), ...
[Learning experience of acupuncture technique from professor ZHANG Jin].
Xue, Hongsheng; Zhang, Jin
2017-08-12
As a famous acupuncturist in the world, professor ZHANG Jin believes the key of acupuncture technique is the use of force, and the understanding of the "concentrating the force into needle body" is essential to understand the essence of acupuncture technique. With deep study of Huangdi Neijing ( The Inner Canon of Huangdi ) and Zhenjiu Dacheng ( Compendium of Acupuncture and Moxibustion ), the author further learned professor ZHANG Jin 's theory and operation specification of "concentrating force into needle body, so the force arriving before and together with needle". The whole-body force should be subtly focused on the tip of needle, and gentle force at tip of needle could get significant reinforcing and reducing effect. In addition, proper timing at tip of needle could start reinforcing and reducing effect, lead qi to disease location, and achieve superior clinical efficacy.
Yu, Jie; Hui, Wenyan; Cao, Chenxia; Pan, Lin; Zhang, Heping; Zhang, Wenyi
2018-03-02
Nutrient starvation is an important survival challenge for bacteria during industrial production of functional foods. As next-generation sequencing technology has greatly advanced, we performed proteomic and genomic analysis to investigate the response of Lactobacillus casei Zhang to a glucose-restricted environment. L. casei Zhang strains were permitted to evolve in glucose-restricted or normal medium from a common ancestor over a 3 year period, and they were sampled at 1000, 2000, 3000, 4000, 5000, 6000, 7000, and 8000 generations and subjected to proteomic and genomic analyses. Genomic resequencing data revealed different point mutations and other mutational events in each selected generation of L. casei Zhang under glucose restriction stress. The differentially expressed proteins induced by glucose restriction were mostly related to fructose and mannose metabolism, carbohydrate metabolic processes, lyase activity, and amino-acid-transporting ATPase activity. Integrative proteomic and genomic analysis revealed that the mutations protected L. casei Zhang against glucose starvation by regulating other cellular carbohydrate, fatty acid, and amino acid catabolism; phosphoenolpyruvate system pathway activation; glycogen synthesis; ATP consumption; pyruvate metabolism; and general stress-response protein expression. The results help reveal the mechanisms of adapting to glucose starvation and provide new strategies for enhancing the industrial utility of L. casei Zhang.
Effect of LongZhang Gargle on Biofilm Formation and Acidogenicity of Streptococcus mutans In Vitro
Directory of Open Access Journals (Sweden)
Yutao Yang
2016-01-01
Full Text Available Streptococcus mutans, with the ability of high-rate acid production and strong biofilm formation, is considered the predominant bacterial species in the pathogenesis of human dental caries. Natural products which may be bioactive against S. mutans have become a hot spot to researches to control dental caries. LongZhang Gargle, completely made from Chinese herbs, was investigated for its effects on acid production and biofilm formation by S. mutans in this study. The results showed an antimicrobial activity of LongZhang Gargle against S. mutans planktonic growth at the minimum inhibitory concentration (MIC of 16% and minimum bactericidal concentration (MBC of 32%. Acid production was significantly inhibited at sub-MIC concentrations. Biofilm formation was also significantly disrupted, and 8% was the minimum concentration that resulted in at least 50% inhibition of biofilm formation (MBIC50. A scanning electron microscopy (SEM showed an effective disruption of LongZhang Gargle on S. mutans biofilm integrity. In addition, a confocal laser scanning microscopy (CLSM suggested that the extracellular polysaccharides (EPS synthesis could be inhibited by LongZhang Gargle at a relatively low concentration. These findings suggest that LongZhang Gargle may be a promising natural anticariogenic agent in that it suppresses planktonic growth, acid production, and biofilm formation against S. mutans.
African Journals Online (AJOL)
pc
2017-11-10
Nov 10, 2017 ... ts of alkyl chain length on particles morphology were primarily studied ..... [3] Li Z, Yu L, Zheng L, Li N, Han S, Li G. Characterization studies on the ionic ... [4] Chiang YD, Lian HY, Leo SY, Wang SG, Yamauchi Y, Wu KC. ... [20] Yu YJ, Xing JL, Pang JL, Jiang SH, Lam KF, Yang TQ, Xue QS, Zhang K, Wu P.
Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei
2014-05-01
Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.
A bandwidth correction to the Allegri-Zhang solution for accelerated random vibration testing
Directory of Open Access Journals (Sweden)
Benasciutti Denis
2018-01-01
Full Text Available In 2008, Allegri and Zhang published a study [Int. J. Fatigue. 2008, 30(6:967-977] in which they provided an exact analytical solution to the inverse scaling law for accelerated vibration tests of linear systems submitted to stationary Gaussian excitations By combining finite element analysis with multiaxial spectral methods defined in the frequency-domain, their solution generalised the simple inverse power law model suggested in some standards. The solution adopted the “equivalent von Mises stress” multiaxial criterion combined with the narrow-band damage expression. This work aims to propose a bandwidth correction to the original Allegri-Zhang solution to account for the actual spectral banwidth of the local multiaxial stress. The corrected Allegri-Zhang solution is also extended to another multiaxial spectral method, namely the “Projection-by-Projection” criterion. A numerical example is finally discussed, in which the corrected solution is applied to an L-shaped beam submitted to random accelerations.
The genome and structural proteome of YuA, a new Pseudomonas aeruginosa phage resembling M6.
Ceyssens, Pieter-Jan; Mesyanzhinov, Vadim; Sykilinda, Nina; Briers, Yves; Roucourt, Bart; Lavigne, Rob; Robben, Johan; Domashin, Artem; Miroshnikov, Konstantin; Volckaert, Guido; Hertveldt, Kirsten
2008-02-01
Pseudomonas aeruginosa phage YuA (Siphoviridae) was isolated from a pond near Moscow, Russia. It has an elongated head, encapsulating a circularly permuted genome of 58,663 bp, and a flexible, noncontractile tail, which is terminally and subterminally decorated with short fibers. The YuA genome is neither Mu- nor lambda-like and encodes 78 gene products that cluster in three major regions involved in (i) DNA metabolism and replication, (ii) host interaction, and (iii) phage particle formation and host lysis. At the protein level, YuA displays significant homology with phages M6, phiJL001, 73, B3, DMS3, and D3112. Eighteen YuA proteins were identified as part of the phage particle by mass spectrometry analysis. Five different bacterial promoters were experimentally identified using a promoter trap assay, three of which have a sigma54-specific binding site and regulate transcription in the genome region involved in phage particle formation and host lysis. The dependency of these promoters on the host sigma54 factor was confirmed by analysis of an rpoN mutant strain of P. aeruginosa PAO1. At the DNA level, YuA is 91% identical to the recently (July 2007) annotated phage M6 of the Lindberg typing set. Despite this level of DNA homology throughout the genome, both phages combined have 15 unique genes that do not occur in the other phage. The genome organization of both phages differs substantially from those of the other known Pseudomonas-infecting Siphoviridae, delineating them as a distinct genus within this family.
Synthesis and photoluminescence study of narrow-band UVB ...
Indian Academy of Sciences (India)
[7] Guo C, Ding X, Seo H J, Ren Z and Bai J 2011 J. Alloys. Compd. 509 4871. [8] Zhang X, Lang H and Seo H 2011 J. Fluoresc. 21 1111. [9] Zhang Z W 2013 Ceram. Int. 39 1723. [10] Yu H 2012 J. Lumin. 132 2553. [11] Wang Q 2012 J. Lumin. 132 434. [12] Palan C, Bajaj N and Omanwar S 2016 Mater. Res. Bull. 76 216.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
This project is based on the (agreement of the joint exploitation project for Yu Xian block in Yu Xian coal mine, Province of Hepei by Japan's NEDO and China's Coal Geological Bureau), signed on October 4, 1996. The joint project mainly comprises seismic exploitation and test drilling, Japan being mainly responsible for the former and China for the latter. The final report will be drawn jointly for the geological survey results necessary for designing coal mines. The Yu Xian block contains the Jurassic coal seams, which are covered by the Quaternary bed and not exposed to the surface. The Quaternary bed base is 50 to 400 m deep from the surface, and coal seams are 300 to 700 m deep also from the surface. A total of 11 coal seams are located in the Xiahuayuan strata as the coal-bearing strata. The first and fifth seams are most promising ones. In particular, the fifth seam is thick (0.2 to 6.91 m thick) and distributed throughout the block. It is estimated that 8 coal seams have a total coal quantity of approximately 346 million tons. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
Lung, S.-C. Candice [Research Center for Environmental Changes, Academia Sinica, Nankang, Taipei, Taiwan 115 (China); Guo, Y.-L.L. [Department of Environmental and Occupational Health, College of Medicine, National Cheng Kung University, 138 Sheng-Li Rd., Tainan, Taiwan 70428 (China); Chang, H.-Y.[Department of Environmental and Occupational Health, College of Medicine, National Cheng Kung University, 138 Sheng-Li Rd., Tainan, Taiwan 70428 (China)]. E-mail: h7154@mail.ncku.edu.tw
2005-07-15
In 1979, about 2000 people in central Taiwan were intoxicated via rice oil consumption that was contaminated with polychlorinated biphenyls (PCBs). This 'Yu-cheng' incident was one of the two known major human PCB intoxication episodes. Twenty years after the intoxication, serum samples of 435 Yu-cheng victims, 414 adults and 21 children, were collected. Sixteen PCB congeners were analyzed with a gas chromatograph-electron capture detector. We found the median concentration of total PCBs in the adult serum was 1500 ng/g lipid, still substantially higher than that of the general population in Taiwan (3.7-fold) and most seafood consumers in the world. Most of analyzed PCB congeners in children were below or around the detection limits. Congener no. 138, however, had the highest concentrations, approximately accounting for 55% and 29% in the child and adult groups, respectively. Given that PCBs are persistent organic pollutants and endocrine disruptors, the concentrations and congener-specific profiles regarding the Yu-cheng victims provide valuable information for the investigation of such chemicals in humans. - Total serum PCBs in the Yu-cheng adult victims twenty years after the incident were still higher than that of the general population in Taiwan.
Directory of Open Access Journals (Sweden)
Hai Kuan Wang
2010-01-01
Full Text Available Cheddar cheese has been manufactured with Lactobacillus casei Zhang as the dairy starter adjunct. L. casei Zhang had previously been isolated from koumiss collected from Xilin Guole in Inner Mongolia and characterized in detail with regard to their probiotic potential. The addition of L. casei Zhang to Cheddar cheese had no adverse effects on sensory criteria. The cheese made with 0.1, 1 and 2 % of the probiotic strain L. casei Zhang adjuncts contained high levels of the Lactobacillus after 6 months of ripening with final counts of 9.6·10^7, 7.7·10^7 and 1.02·10^8 CFU/g, respectively. In the ripe control cheese, without the addition of probiotic strain L. casei Zhang, the number of Lactobacillus reached 5.7·107 CFU/g. Enterobacterial repetitive intergenic consensus PCR (ERIC-PCR analysis was used to distinguish the added L. casei Zhang from the natural flora of the cheese and to determine whether L. casei Zhang grew in the cheese. ACE-inhibitory activity and γ-aminobutyric acid (GABA concentrations in the cheese were measured. Compared with control cheese, experimental cheese with 0.1, 1 and 2 % of probiotic strain L. casei Zhang revealed some increase in ACE-inhibitory activity and GABA mass fraction. In the present study, the production of both ACE-inhibitory activity and GABA in the probiotic cheese with the L. casei Zhang adjunct isolated from koumiss has been found for the first time. The results suggest that cheese with the probiotic strain L. casei Zhang showed good potential for application in the management of hypertension.
Hydrothermal growth of ZnO nanoflowers and their photocatalyst ...
Indian Academy of Sciences (India)
JINCHENG FAN1,∗, TENGFEI LI1 and HANG HENG2,3. 1School of Materials ... In this paper, the fabrication of ZnO nanoflowers on Si substrate by the ..... [21] Bae J, Han J B, Zhang X-M, Wei M, Duan X, Zhang Y and. Wang Z L 2009 J. ... 142 570. [31] Sun Y J, Wang L, Yu X G and Chen K Z 2012 CrystEngComm. 14 3199.
Yuánmíng Yuán en el siglo XVIII: Arte entre la diplomacia y la filosofía; entre Europa y Pekín
Directory of Open Access Journals (Sweden)
Pedro Luengo
2016-01-01
Full Text Available Este estudio pretende probar que el Yuánmíng Yuán fue diseñado como una representación del macrocosmos imperial a partir de la filosofía de la China de Qianlong. Para ello se valorará la función simbólica de los palacios de estilo europeo a partir de las descripciones de embajadas orientales y occidentales. Esta información se pondrá en relación con las diferentes representaciones pictóricas del jardín, conservadas tanto en grabados o acuarelas como en pinturas murales. A partir de toda esta información se pretende valorar su utilización en las visitas de diferentes legados diplomáticos extranjeros. En concreto, se intenta comprobar que los palacios europeos se utilizaron eminentemente para impresionar a las misiones orientales, y no tanto a las occidentales.
Jing Tong Yu Shu , a traditional Chinese medicine, suppresses IL ...
African Journals Online (AJOL)
Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a rat surgical model. Methods: Endometriosis was induced in 40 female rats. The rats were randomly divided into 4 groups: three JTYS groups given different doses of the drug, and a saline group. After four ...
Genes involved in sex determination process and the influence of ...
African Journals Online (AJOL)
DR. & MRS. TONY A. NLEWADIM
2015-02-04
Feb 4, 2015 ... Key words: Next-generation sequencing, simple sequence repeats, Rhamdia sp. .... individual genotypes were defined according to the standards of the bands. ..... Wang J, Yu X, Zhao K, Zhang Y, Tong J, Peng Z (2012).
Directory of Open Access Journals (Sweden)
François Moreews
2015-12-01
Full Text Available Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.
False become true: Christie's catalogue of Zhang Hongtu
Directory of Open Access Journals (Sweden)
Sandra Valenzuela Arellano
2013-06-01
Full Text Available By analyzing the series Christie’s Catalogue Project by the artist Zhang Hongtu, this essay traces relationships between: Cultural heritance, national identity, fakeness, popular culture and legitimacy of power structures, within contemporary China. Contemporary art creates assemblies of meanings related to its time, sometimes relating the present with history, high with vernacular culture, soft power with the construction of collective memory. This essay aims to reconstruct with words, through textual and visual analysis, those visual assemblies.
Orbital Mechanics near a Rotating Asteroid Yu Jiang1,2,∗ & Hexi ...
Indian Academy of Sciences (India)
The Hamilton function can then be written as (Yu & Baoyin 2012a). H = 1. 2 .... The symplectic structure is a differential exterior 2-form defined on a ..... The disadvantage of Poisson-bracket, Poisson and cohomology forms is unavailable for ...
Adaptation of Lactobacillus casei Zhang to Gentamycin Involves an Alkaline Shock Protein
Directory of Open Access Journals (Sweden)
Wenyi Zhang
2017-11-01
Full Text Available Lactobacillus (L. casei Zhang is a koumiss-originated probiotic strain, which was used as a model in a long-term antibiotics-driven evolution experiment to reveal bacterial evolutionary dynamics; and we isolated gentamycin-resistant L. casei Zhang descendents. To decipher the gentamycin resistance mechanism, here we cultivated the parental L. casei Zhang and its descendent cells in an antibiotics-containing environment to compare their global protein expression profiles using the iTRAQ-based proteomic approach. A total of 72 proteins were significantly up-regulated (>2.0-fold, P < 0.05, whilst 32 proteins were significantly down-regulated <−2.0-fold, P < 0.05 in the descendent line. The gentamycin-resistant descendent line showed elevated expression in some carbohydrates, amino acids, and purine metabolic pathways. Several stress-related proteins were also differentially expressed. Among them, one alkaline shock protein, asp23, was up-regulated most in the gentamycin-resistant strain (21.9-fold increase compared with the parental strain. The asp23 gene disruption mutant was significantly more sensitive to gentamycin compared with the wild type, suggesting an important role of this gene in developing the gentamycin-resistant phenotype in L. casei. Our report has described the adaptation of a probiotic strain that has acquired antibiotics resistance through long-term antibiotics exposure at the proteome level, and we revealed a novel mechanism of gentamycin resistance.
A potential explanation for the effect of carbon source on the ...
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... structure, mixed liquor suspended solids (MLSS), sludge volume index (SVI) .... Fine air bubbles for aeration were supplied through an air sparger at the ..... Ren TT, Liu L, Sheng GP, Liu XW, Yu HQ, Zhang MC, Zhu JR (2008).
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
This is a detailed geological survey report on Yu Hsien coalfield for the period beginning in 1987 and ending in March, 2001. The survey elucidated the structures, beds, coal seams, coal property, hydro-geological features, and other mining technological conditions in Beiyang Zhuang mining area. In addition, as a result of coal reserves calculation, the total of A, B and C class coal reserves was 328.34 million tons, of which No.1 and No.5 coal seams were 259.79 million tons, taking 79.1% of the entire reserves. The average coal seam thickness of the No.1 and No.5 coal seams, which are the principal minable coal seams, are each 3.10 m and 2.66 m, with the existing depth usually 300-711 m; the coal properties are classified into low-medium ash, low sulfur, low phosphorus, and medium heating value. The coal category is long flame coal, with the use applicable to cement, electric power, gasification, etc. As the infrastructure, Beiyang Zhuang mining area is one of the three mines for which development has been decided in Yu Hsien coalfield. with the planned coal output scheduled for 1.8 million tons, and with a road or a dedicated railroad for coal maintained leading to large and medium cities such as Changkiakow, Suanhwa and Beijing. Further, railway construction is in progress, so that transportation conditions are extremely favorable. Preliminary investigation of industries and construction of coal pits should be considered. (NEDO)
4 gene expression in hepatocellular carcinoma (HCC)
African Journals Online (AJOL)
Gamalat El Gedawy
2016-06-06
Jun 6, 2016 ... Subjects and methods: This study was conducted on 30 HCC patients, 20 chronic liver disease ...... [26] Huang CS, Yu W, Cui H, Wang YJ, Zhang L, Han F, et al. ... Y. Involvement of programmed cell death 4 in transforming.
Electric Vehicle Sharing Planning and Operations
2018-02-01
Dongfang Zhao (ORCID ID 0000-0002-5424-9915); Xiaopeng (Shaw) Li (ORCID ID 0000-0002-5264-3775); Yu Zhang (ORCID ID 0000-0003-1202-626X) This project includes literature review and proposing a model for EV planning and operations. We first conducted ...
Valensise, Gianluca; Barba, Salvatore; Basili, Roberto; Bonini, Lorenzo; Burrato, Pierfrancesco; Carafa, Michele; Kastelic, Vanja; Fracassi, Umberto; Maesano, Francesco Emanuele; Tarabusi, Gabriele; Tiberti, Mara Monica; Vannoli, Paola
2016-04-01
The vast majority of active faulting studies are performed at the scale of individual, presumably seismogenic faults or fault strands. Most SHA approaches and models, however, require homogeneus information on potential earthquake sources over the entire tectonic domain encompassing the site(s) of interest. Although it is out of question that accurate SHA must rely on robust investigations of individual potential earthquake sources, it is only by gathering this information in regionally extensive databases that one can address some of the most outstanding issues in the use of #Fault2SHA. We will briefly recall three issues that are particularly relevant in the investigation of seismogenic faulting in southern Europe. A fundamental challenge is the completeness of the geologic record of active faulting. In most tectonic environments many potential seismogenic faults are blind or hidden, or deform the lower crust without leaving a discernible signal at the surface, or occur offshore, or slip so slowly that nontectonic erosional-depositional processes easily outpace their surface effects. Investigating only well-expressed faults is scientifically rewarding but also potentially misleading as it draws attention on the least insidious faults, leading to a potential underestimation of the regional earthquake potential. A further issue concerns the hierarchy of fault systems. Most active faults do not comprise seismogenic sources per se but are part of larger systems, and slip only in conjunction with the master fault of each system. In the most insidious cases, only secondary faults are expressed at the surface while the master fault lies hidden beneath them. This may result in an overestimation of the true number of seismogenic sources that occur in each region and in a biased identification of the characteristics of the main player in each system. Recent investigations of geologic and geodetic vs earthquake release budgets have shown that the "seismic coupling", which
Morphology and anatomical structure of the larval salt gland of ...
African Journals Online (AJOL)
Ezedom Theresa
2013-10-09
Oct 9, 2013 ... the morphology and fine structure of the ion transporting epithelium ... The general structure of the salt gland of nauplii cultured at 180 g/L disappeared. ...... Wu G, Zhang H, Sun J, Liu F, Ge X, Chen WH, Yu, J, Wang W (2011).
van Heugten, L.
2013-01-01
In 2001, a music theatre production exploring Islam’s early history from a female perspective was shut down before it reached the stage. The cancellation of Aïsha and the Women of Madina by Rotterdam’s Independent Theatre (O.T.) generated a media storm as speculations about censorship mounted. To
Zhao,JiHui; Zhang,Qi-Bo; Liu,Bao; Piao,Xiang-Hua; Yan,Yu-Lu; Hu,Xiao-Ge; Zhou,Kuan; Zhang,Yong-Tai; Feng,Nian-Ping
2017-01-01
Ji-Hui Zhao,1,* Qi-Bo Zhang,1,* Bao Liu,2 Xiang-Hua Piao,1 Yu-Lu Yan,1 Xiao-Ge Hu,1 Kuan Zhou,1 Yong-Tai Zhang,1 Nian-Ping Feng1 1School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People’s Republic of China; 2Anethesiology Department, Augusta University, Augusta, GA, USA *These authors contributed equally to this work Purpose: To enhance the immunogenicity of the model subunit vaccine, ovalbumin (OVA) was combined with platycodin (PD), a ...
Robustness analysis of the Zhang neural network for online time-varying quadratic optimization
International Nuclear Information System (INIS)
Zhang Yunong; Ruan Gongqin; Li Kene; Yang Yiwen
2010-01-01
A general type of recurrent neural network (termed as Zhang neural network, ZNN) has recently been proposed by Zhang et al for the online solution of time-varying quadratic-minimization (QM) and quadratic-programming (QP) problems. Global exponential convergence of the ZNN could be achieved theoretically in an ideal error-free situation. In this paper, with the normal differentiation and dynamics-implementation errors considered, the robustness properties of the ZNN model are investigated for solving these time-varying problems. In addition, linear activation functions and power-sigmoid activation functions could be applied to such a perturbed ZNN model. Both theoretical-analysis and computer-simulation results demonstrate the good ZNN robustness and superior performance for online time-varying QM and QP problem solving, especially when using power-sigmoid activation functions.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
... YU1 JUAN QIN2 JIAQI ZHANG1 FULIN CHENG1 WENLIANG WU1. College of Chemical Engineering, Nanjing Tech University, Nanjing 210009, People's Republic of China; Technology and Finance Service Center of Jiangsu Province, Productivity Center of Jiangsu Province, Nanjing 210042, People's Republic of China ...
2018-01-31
Aritra Pal (ORCID ID 0000-0002-2256-2464) Yu Zhang (ORCID ID 0000-0003-1202-626X) Changhyun Kwon (ORCID ID 0000-0001-8455-6396) Bike Sharing is a sustainable mode of urban mobility, not only for regular commuters but also for casual users and tourist...
SYNTHESIS AND CHARACTERISATION OF Ni0.25Co0.75Fe2O4 ...
African Journals Online (AJOL)
characterised for their size and structure using X-ray diffraction (XRD), high .... the sample shows broad peaks, indicating the fine crystalline nature of the particles. ... Zhao, L.J.; Zhang, H.J.; Xing,Y.; Song, S.Y.; Yu, S.Y.; Shi, W.D.; Guo, X.M.; ...
Indian Academy of Sciences (India)
965–971. Quantum Mechanics, Field Theories and Special Relativity ... Li Zhang, Shutang Liu and Chenglong Yu ... Probing of complete and incomplete fusion dynamics in heavy-ion collision ... Summary of the National Conference on Nuclear Physics 2013 ... High-power Yb-doped continuous-wave and pulsed fibre lasers.
Supplementary data: A complete mitochondrial genome of wheat ...
Indian Academy of Sciences (India)
Supplementary data: A complete mitochondrial genome of wheat (Triticum aestivum cv. Chinese Yumai), and fast evolving mitochondrial genes in higher plants. Peng Cui, Huitao Liu, Qiang Lin, Feng Ding, Guoyin Zhuo, Songnian Hu, Dongcheng Liu, Wenlong Yang, Kehui Zhan,. Aimin Zhang and Jun Yu. J. Genet.
Dynamics analysis of fractional order Yu-Wang system
Bhalekar, Sachin
2013-10-01
Fractional order version of a dynamical system introduced by Yu and Wang (Engineering, Technology & Applied Science Research, 2, (2012) 209-215) is discussed in this article. The basic dynamical properties of the system are studied. Minimum effective dimension 0.942329 for the existence of chaos in the proposed system is obtained using the analytical result. For chaos detection, we have calculated maximum Lyapunov exponents for various values of fractional order. Feedback control method is then used to control chaos in the system. Further, the system is synchronized with itself and with fractional order financial system using active control technique. Modified Adams-Bashforth-Moulton algorithm is used for numerical simulations.
Zhang, Juan; Liu, Qian; Chen, Wei; Du, Guocheng; Chen, Jian
2016-03-01
Lyophilization is considered an effective way to preserve the activity of milk starters, such as lactic acid bacteria, in which proper protective agents play key roles. In this study, Lactobacillus casei Zhang, a probiotic bacterium applied as a milk starter in China, was used to investigate the effects of various cryoprotectants according to cell survival rate and physiological characteristics. The result showed a significant survival improvement to 86.6% when glutathione (GSH) was added as an ideal cryoprotectant. Further study revealed that GSH plays a key role on maintaining higher unsaturation ratio of cell membrane and shorter chain length of saturated fatty acids. In this case, the intact cell structure can be obtained. These findings will contribute not only to deepen the understanding of cells during lyophilization but also to improve the industrial performance of certain milk starters such as L. casei Zhang by application of GSH as cryoprotectant. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Space and Intermediality in Jia Zhang-ke’s Still Life
Directory of Open Access Journals (Sweden)
Cecília Mello
2014-07-01
Full Text Available This article is dedicated to an analysis of Chinese director Jia Zhang-ke’s film Still Life (San Xia Hao Ren 三峡好人, 2006 from the point of view of its intermedial relationship with Chinese landscape painting. As I will suggest, Jia’s discovery of a real landscape and a vanishing cityscape in this film, shot on location in the region of the Three Gorges of the Yangtze River, springs from a realist impulse and from an original aesthetic response to a new historical and social conjuncture. But while it seems firmly located in the landscape of contemporary China, the film also shares aesthetic qualities with the tradition of Chinese landscape painting, mounted on hanging or hand scrolls. A focus on this particular instance of intermediality leads to a reflection on cinema’s spatial organization in light of current revisions in film and audiovisual theory, which suggest that filmic space and its spectatorial experience should be considered above all from the point of view of touch and movement. It also allows for a broader understanding of the political implications of intermediality in Jia Zhang-ke’s oeuvre, fruit of an organic link between form and content that brings a historical resonance to a contemporary perspective.
Zhang, Yong; Ma, Chen; Zhao, Jie; Xu, Haiyan; Hou, Qiangchuan; Zhang, Heping
2017-04-11
The incidence of colon cancer has increased considerably and the intestinal microbiota participate in the development of colon cancer. We showed that the L. casei Zhang or vitamin K2 (Menaquinone-7) intervention significantly alleviated intestinal tumor burden in mice. This was associated with increased serum adiponectin levels in both treatments. But osteocalcin level was only increased by L. casei Zhang. Furthermore, the anti-carcinogenic actions of L. casei Zhang were mediated by hepatic Chloride channel-3(CLCN3)/Nuclear Factor Kappa B(NF-κB) and intestinal Claudin15/Chloride intracellular channel 4(CLIC4)/Transforming Growth Factor Beta(TGF-β) signaling, while the vitamin K2 effect involved a hepatic Vitamin D Receptor(VDR)-phosphorylated AMPK signaling pathway. Fecal DNA sequencing by the Pacbio RSII method revealed there was significantly lower Helicobacter apodemus, Helicobacter mesocricetorum, Allobaculum stercoricanis and Adlercreutzia equolifaciens following both interventions compared to the model group. Moreover, different caecum acetic acid and butyric acid levels and enrichment of other specific microbes also determined the activity of the different regulatory pathways. Together these data show that L. casei Zhang and Vitamin K2 can suppress gut risk microbes and promote beneficial microbial metabolites to reduce colonic tumor development in mice.
Yu.S. Osipov's work in mathematical control theory
International Nuclear Information System (INIS)
Kryazhimskiy, Arkady A
2006-01-01
This paper gives an overview of Yu.S. Osipov's work in mathematical control theory, including development of the theory of positional differential games for control systems with time delay; analysis of the phenomenon of infinite dimensionality of the state space of a dynamical system in the context of differential games; development of the theory of dynamical inversion (dynamical regularization) for finite- and infinite-dimensional control systems; applications of methods of the theory of positional differential games beyond the scope of the theory itself; work on new differential-game methods and on methods of control under incomplete information. The author of this overview is the first student of Osipov, and also his longstanding colleague.
Igavese armastuse sõdalane : mitte just klassika, aga ajaloo verstapost küll / Ilmar Raag
Raag, Ilmar, 1968-
2006-01-01
Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi, Eesti ühistöö) : stsenarist Iiro Küttner, režissöör Antti-Jussi Annila, võitluskunstide koreograaf Yu Yan Kai, osades - Tommi Eronen, Zhang Jingchu, Markku Peltola, Elle Kull
Fassaadikunstist ja teesklusest / Margit Tõnson
Tõnson, Margit, 1978-
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola
African Journals Online (AJOL)
cadewumi
24. Yu, S., Zhang, Xen., Chen, G, and W. Liu. (2012). Compromised cellular responses to DNA damage accelerate chronological aging by incurring cell wall fragility in Saccharomyces cerevisiae. Mol Biol Rep. 39: 3573–3583. 25. Zoreky, N.S.A. (2009). Antimicrobial activity of pomegranate (Punica granatum L.) fruit peels.
The Near-Earth Encounter of Asteroid 308635 (2005 YU55): Thermal IR Observations
Lim, Lucy F.; Emery, J. P.; Moskovitz, N. A.; Busch, M. W.; Yang, B.; Granvik, M.
2012-10-01
The near-Earth approach (0.00217 AU, or 0.845 lunar distances) of the C-type asteroid 308635 (2005 YU55) in November 2011 presented a rare opportunity for detailed observations of a low-albedo NEA in this size range. As part of a multi-telescope campaign to measure visible and infrared spectra and photometry, we obtained mid-infrared ( 8 to 22 micron) photometry and spectroscopy of 2005 YU55 using Michelle [1] on the Gemini North telescope on UT November 9 and 10, 2011. An extensive radar campaign [2] together with optical lightcurves [3,4] established the rotation state of YU55. In addition, the radar imaging resulted in a shape model for the asteroid, detection of numerous boulders on its surface, and a preliminary estimate of its equatorial diameter at 380 +/- 20 m. In a preliminary analysis, applying the radar and lightcurve-derived parameters to a rough-surface thermophysical model fit to the Gemini/Michelle thermal emission photometry results in a thermal inertia range of approximately 500 to 1500 J m-2 s-1/2 K-1, with the low-thermal-inertia solution corresponding to the small end of the radar size range and vice versa. Updates to these results will be presented and modeling of the thermal contribution to the measured near-infrared spectra from Palomar/Triplespec and IRTF/SpeX will also be discussed. The authors gratefully acknowledge the assistance of observatory staff and the support of the NASA NEOO program (LFL and JPE), the Carnegie fellowship (NAM), and NASA AES, NSF, and the NRAO Jansky Fellowship (MWB). [1] De Buizer, J. and R. Fisher, Proc. Hris (2005), pp. 84-87. [2] Busch, M.W. et al., ACM (2012), abstract #6179. [3] Warner, B., MPBull 39 (2), 84 [4] Pravec, P.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 95; Issue 1. Distribution and linkage disequilibrium analysis of polymorphisms of GH1 gene in different populations of pigs associated with body size. Yunyun Cheng Songcai Liu Dan Su Chao Lu Xin Zhang Qingyan Wu Siming Li Haoyu Fu Hao Yu Linlin Hao. Research Article ...
Üllatav seiklusfantaasia Soomest / Alar Niineväli
Niineväli, Alar
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Elle Kull. Lisa "Soome film sai Hiinas hea lepingu
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. Yuanming Zhang. Articles written in Journal of Chemical Sciences. Volume 118 Issue 3 May 2006 pp 281-285. Temperature effects on surface activity and application in oxidation of toluene derivatives of CTAB-SDS with KMnO4 · Yu Tang Biying Du Jun Yang Yuanming ...
A novel missense mutation in collagenous domain of EDA gene in a ...
Indian Academy of Sciences (India)
Supplementary data: A novel missense mutation in collagenous domain of EDA gene in a. Chinese family with X-linked hypohidrotic ectodermal dysplasia. Daxu Li, Ran Xu, Fumeng Huang, Biyuan Wang, Yu Tao, Zijian Jiang, Hairui Li, Jianfeng Yao,. Peng Xu, Xiaokang Wu, Le Ren, Rui Zhang, John R. Kelsoe and Jie Ma.
Imprecise intron losses are less frequent than precise intron losses but are not rare in plants.
Ma, Ming-Yue; Zhu, Tao; Li, Xue-Nan; Lan, Xin-Ran; Liu, Heng-Yuan; Yang, Yu-Fei; Niu, Deng-Ke
2015-05-27
In this study, we identified 19 intron losses, including 11 precise intron losses (PILs), six imprecise intron losses (IILs), one de-exonization, and one exon deletion in tomato and potato, and 17 IILs in Arabidopsis thaliana. Comparative analysis of related genomes confirmed that all of the IILs have been fixed during evolution. Consistent with previous studies, our results indicate that PILs are a major type of intron loss. However, at least in plants, IILs are unlikely to be as rare as previously reported. This article was reviewed by Jun Yu and Zhang Zhang. For complete reviews, see the Reviewers' Reports section.
African Journals Online (AJOL)
antibodies to egg drop syndrome. 1976 (EDS-76) and infectious bursal disease viruses. Avian Pathology, 12: 35 - 39. YUAN, X., WANG, Y., LI, J., YU, K.,. YANG, J., XU, H., ZHANG, Y., AI,. H. and WANG, J. (2013). Surveillance and molecular characterization of Newcastle disease virus in seafowl from coastal areas of China ...
Bioactive components of Gynura divaricata and its potential use in ...
African Journals Online (AJOL)
Bioactive components of Gynura divaricata and its potential use in health, food and medicine:a mini-review. Bing-Qing Xu, Yu-Qing Zhang. Abstract. Background: G. divaricata (L.) DC belongs to genus the Gynura Cass which is a kind of perennial herb that has good health protection efficacy and is especially used widely in ...
Isolation of Stilbenoids and Lignans from Dendrobium hongdie
African Journals Online (AJOL)
Chen YG, Xu JJ, Yu H, Qing C, Zhang YL, Wang LQ, Liu. Y, Wang JH. Cytotoxic phenolics from Bulbophyllum odoratissimum. Food Chem, 2008; 107: 169–173. 17. Hernández-Romero Y, Acevedo L, Sánchez MLÁ, Shier. WT, Abbas HK, Mata R. Phytotoxic activity of bibenzyl derivatives from the Orchid Epidendrum rigidum.
Nonequilibrium steady state of a weakly-driven Kardar–Parisi–Zhang equation
Meerson, Baruch; Sasorov, Pavel V.; Vilenkin, Arkady
2018-05-01
We consider an infinite interface of d > 2 dimensions, governed by the Kardar–Parisi–Zhang (KPZ) equation with a weak Gaussian noise which is delta-correlated in time and has short-range spatial correlations. We study the probability distribution of the interface height H at a point of the substrate, when the interface is initially flat. We show that, in stark contrast with the KPZ equation in d statistics of directed polymers in random potential.
and gallium-doped zinc oxide transparent conducting sol–gel thin films
Indian Academy of Sciences (India)
Administrator
and 1∙76 × 10–2 Ω cm for GZO, when five multilayer coatings are made. The origin of ... indium source make its price increasing every day. On the other hand, zinc ..... Zhao Q, Xu X Y, Song X F, Zhang X Z, Yu D P, Li C P and. Guo L 2006 Appl.
Allcott, Glenn H.
1970-01-01
The mineralized zone at the remotely located Ash Sha'ib ancient mine contains only a small tonnage of moderately low grade sulfide- bearing rock. Based on present data the gross value of the deposit, with a value of $25.00 or more per ton, is $20,000,000. A belt of metasedimentary rocks, intruded by gabbro to the south and granite to the north, was the host for fissure vein-replacement type mineralization. Most of the mineralization is in a siliceous dolomite transected by fissures. The main sulfide mineral is sphalerite, but minor amounts of chalcopyrlte and argentlferous galena contribute to the value of the mineralized sections.
Le langage des couleurs dans les films de Zhang Yimou
Xiaomin Giafferri
2009-01-01
Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le so...
Directory of Open Access Journals (Sweden)
Larisa N. Kuznetsova
2011-04-01
Full Text Available The article considers M.Yu. Lermontov’s linguistic / literary personality through perspective of linguistic personality perception by Great Russian scientist-philologist and linguist, Academician V.V. Vinogradov.
Directory of Open Access Journals (Sweden)
Olga V. Shatalova
2017-10-01
Full Text Available In article the communicative and linguistic parameters of the speech of the publicist of the XX century Yu. Senkevich which are declared as a sample for formation of the language personality in the conditions of development of the modern information and communicative environment are designated. On the example of the analysis of the book «On “Ra” through Atlantic» locates the fact of that Yu.N. Senkevich’s creativity corresponds to the main criteria of popular scientific journalism: high degree of reliability, authoritativeness of the publicist; dynamism, dramatic nature, intelligence of a statement. The unostentatious enlightenment based on updating of scientific knowledge for the addressee and a dialogization of a publicistic discourse, the high level of psychological and philosophical generality, the declaration of humanistic values form specific rhetoric which is supported by the formal and grammatical organization of the speech of the publicist. Priority of syntactic designs of a certain type, stylistic ladders and figures – dynamism of a statement and scale of representation of material define. The humour and easy self-irony as significant characteristics of the language personality define a basis of the rhetorical and stylistic canon realized in publicistic works Yu.N. Senkevich – «the human view of people and society» that in the modern information and communicative environment becomes a necessary reference point.
Air pollution in China, with Junfeng (Jim) Zhang by Ashley Ahearn.
Zhang, Junfeng Jim
2011-06-01
Air pollution in China, one of the world’s oldest civilizations, reflects a combination of traditional and modern-day factors. Severe air pollution in Chinese cities is the result of rapid industrialization, urbanization, and growth in vehicle use. At the same time, traditional indoor burning of solid fuels such as coal and dung presents acute, severe exposures to pollutants including particulate matter, carbon monoxide, arsenic, and mercury. In this podcast, Junfeng (Jim) Zhang tells host Ashley Ahearn about some of the factors that make air pollution a significant problem in China.
Modulation of epithelial sodium channel in human alveolar epithelial ...
African Journals Online (AJOL)
Modulation of epithelial sodium channel in human alveolar epithelial cells by lipoxin A4 through AhR-cAMP-dependent pathway. Bi-Huan Cheng1,2, Li-Wei Pan2, Sheng-Rong Zhang3, Bin-Yu Ying2, Ben-Ji. Wang2, Guo-Liang Lin2 and Shi-Fang Ding1*. 1Department of Critical Care Medicine, Qilu Hospital of Shandong ...
A Study of GaAsSb Nanowires by Molecular Beam Epitaxy for Near IR Applications
2015-09-18
Mosca, S. Franchi , P. Frigeri, E. Gombia, A. Carnera, M. Peroni, Mater. Science and Eng. B 80, 32 (2001). 1 Appendix C Pavan...Hossain N, Hild K, Jin S R, Sweeney S J, Yu S Q, Johnson S R, Ding D and Zhang Y H 2010 Photonics Global Conference IEEE 1 14 [3] Hwang J S, Tsai J T, Su
"Jade Warrior" kupatab Soome sampo Hiina / Kätlin Kaldmaa
Kaldmaa, Kätlin, 1970-
2006-01-01
Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola. Lisatud Ave Randviiru, Elle Kulli ja Antti-Jussi Annila "Esimesed muljed"
http://dx.doi.org/10.4314/ajtcam.v9i2.1
African Journals Online (AJOL)
AJTCAM
UHCC (Chen, 2009; Tong, 2010; Zhang et al., 2006; Zhu and Li, 2006). .... 2006; Yu and Kang, 2009) were identified for further study (726 patients), but without a .... inhibit its transition from G2 phase to M phase in vitro. .... Venook, A. P., Stagg, R. J., Lewis, B. J., Chase, J. L., Ring, E. J., Maroney, T. P., Hohn, D. C., (1990).
Orbital Picture of Yu-Shiba-Rusinov Multiplets
Heinrich, Benjamin W.; Ruby, Michael; Franke, Katharina J.; Peng, Yang; von Oppen, Felix
Magnetic impurities on an s-wave superconductor induce Yu-Shiba-Rusinov (YSR) bound states within the excitation gap of the superconductor. Here, we investigate single manganese (Mn) atoms adsorbed on different surface orientations of superconducting lead (Pb) and the nature of their YSR states. Depending on the adsorption site and surface, we detect a distinct number and characteristic patterns of YSR states around the Mn atoms. We show that the YSR states inherit their properties from the Mn d levels, which are split by the surrounding crystal field. The periodicity of the long-range YSR oscillations allows us to identify a dominant coupling of the d states to the outer Fermi sheet of the two-band superconductor Pb. The long-range and directional nature of the states are promising for the design of coupled adatom structures, which could bear topological phases. We acknowledge funding by the Deutsche Forschungsgemeinschaft through Grant No. FR2726/4 and through collaborative research Grants No. Sfb 658, No. CRC 183, and No. SPP 1666, as well as by the European Research Council through Consolidator Grant NanoSpin.
Period of Light Variability in BL Lac ON 231 Xu Yun Bing1, Zhang ...
Indian Academy of Sciences (India)
period light variability may be greater than the current observation history and needs further monitoring certification (Zhang et al. 1998). To establish the real periods of ON 231, we employ wavelet analysis and DCF method to search a periodicity in the light curves. 2. Periodicity analysis of ON231. 2.1 Light curve of ON 231.
Security analysis of boolean algebra based on Zhang-Wang digital signature scheme
International Nuclear Information System (INIS)
Zheng, Jinbin
2014-01-01
In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software
Security analysis of boolean algebra based on Zhang-Wang digital signature scheme
Energy Technology Data Exchange (ETDEWEB)
Zheng, Jinbin, E-mail: jbzheng518@163.com [School of Mathematics and Computer Science, Long Yan University, Longyan 364012 (China)
2014-10-06
In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software.
International Nuclear Information System (INIS)
Zhang Yunong; Li Zhan
2009-01-01
In this Letter, by following Zhang et al.'s method, a recurrent neural network (termed as Zhang neural network, ZNN) is developed and analyzed for solving online the time-varying convex quadratic-programming problem subject to time-varying linear-equality constraints. Different from conventional gradient-based neural networks (GNN), such a ZNN model makes full use of the time-derivative information of time-varying coefficient. The resultant ZNN model is theoretically proved to have global exponential convergence to the time-varying theoretical optimal solution of the investigated time-varying convex quadratic program. Computer-simulation results further substantiate the effectiveness, efficiency and novelty of such ZNN model and method.
Wang, Jicheng; Zhong, Zhi; Zhang, Wenyi; Bao, Qiuhua; Wei, Aibin; Meng, He; Zhang, Heping
2012-06-01
Studies have found that the survival of probiotics could be strongly enhanced with dairy products as delivery vehicles, but the molecular mechanism by which this might occur has seldom been mentioned. In this study, microarray technology was used to detect the gene expression profile of Lactobacillus casei Zhang with and without fermented milk used as a delivery vehicle during transit in simulated gastrointestinal juice. Numerous genes of L. casei Zhang in strain suspension were upregulated compared to those from L. casei Zhang in fermented milk. These data might indicate that L. casei Zhang is stimulated directly without the protection of fermented milk, and the high-level gene expression observed here may be a stress response at the transcriptional level. A large proportion of genes involved in translation and cell division were downregulated in the bacteria that were in strain suspension during transit in simulated intestinal juice. This may impede protein biosynthesis and cell division and partially explain the lower viability of L. casei Zhang during transit in the gastrointestinal tract without the delivery vehicle. Copyright © 2012 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
A high speed low power low offset dynamic comparator used in SHA-less pipelined ADC
Shubin, Liu; Zhangming, Zhu; Yintang, Yang; Lianxi, Liu
2014-05-01
A novel fully differential high speed high resolution low offset CMOS dynamic comparator has been implemented in the SMIC 0.18 μm process used for a sample-and-hold amplifier (SHA)-less pipelined analog-to-digital converters (ADC). Based on the analysis and optimization between delay time and offset, an enhanced reset architecture with transmission gate was introduced to speed up the comparison and reset procedure. Four inputs with two cross coupled differential pairs, reconstituted bias circuit for tail current transistor and common centroid layouts make the comparator more robust against mismatch and process variations. The simulation results demonstrate that the proposed design achieves 1 mV sensitivity at 2.2 GHz sampling rate with a power consumption of 510 μW, while the mean offset voltage is equal to 10.244 mV.
Bandgap engineered graphene and hexagonal boron nitride for ...
Indian Academy of Sciences (India)
Hybrid struc- tures containing a .... elements have a meaning of local density of states and car- rier density as a ... ing electric field) is responsible to pull down the poten- tial well (or ..... [11] Damon B F, Roksana G-M, Vasili P, Yu-Ming L, George S T,. James C T et al ... D, Zhang Y,. Dubonos S V et al 2004 Science 306 666.
Xu, Weiwei; Meng, Xianjun; Zhu, Anning; Wang, Yu; Luo, Wuyougumo; Kuang, Zifang
2017-01-12
Professor ZHANG Yongshu , who studied from professor LIU Zhangjie , is a famous acupuncturist in Quanzhou of Southern Fujian. The publications authored by professor ZHANG Yongshu were collected in this study to summarize his academic characteristics of acupuncture and moxibustion. The result indicated he highly valued the regulation of yang qi , and established the theory of "developing yang to nourish yin ", which proposes to develop yang qi to achieve the effect of culturing yin ; he summarized eight methods to regulate the governor vessel and conception vessel, which can condition the body's yin and yang ; he paid attention to moxibustion therapy and its dosage, and made the best of direct moxibustion. In addition, he focused on meridian theory with effective application of meridian syndrome differentiation; in clinical treatment, he regulated the hand- yangming meridian to treat diseases by nourishing yang , generating yin and regulating fu .
ZHANG Ting-dong (张亭栋)—— A Pioneer in Treating Leukemia with Arsenous Acid
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
@@ Prof. ZHANG Ting-dong, male, was born in Wuqiao County, He-bei Province on Nov. 8,1932, and in 1950 graduated from Harbin Medical University. And from 1960 to 1963 he studied in and then graduated from Western Doctors'class for Learning Traditional Chinese Medicine(TCM).
Pioline, Boris
2016-01-01
The Kawazumi-Zhang invariant $\\varphi$ for compact genus-two Riemann surfaces was recently shown to be a eigenmode of the Laplacian on the Siegel upper half-plane, away from the separating degeneration divisor. Using this fact and the known behavior of $\\varphi$ in the non-separating degeneration limit, it is shown that $\\varphi$ is equal to the Theta lift of the unique (up to normalization) weak Jacobi form of weight $-2$. This identification provides the complete Fourier-Jacobi expansion of $\\varphi$ near the non-separating node, gives full control on the asymptotics of $\\varphi$ in the various degeneration limits, and provides a efficient numerical procedure to evaluate $\\varphi$ to arbitrary accuracy. It also reveals a mock-type holomorphic Siegel modular form of weight $-2$ underlying $\\varphi$. From the general relation between the Faltings invariant, the Kawazumi-Zhang invariant and the discriminant for hyperelliptic Riemann surfaces, a Theta lift representation for the Faltings invariant in genus two ...
Side channel analysis of some hash based MACs:A response to SHA-3 requirements
DEFF Research Database (Denmark)
The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...... function which is more resistant to known side channel attacks (SCA) when plugged into HMAC, or that has an alternative MAC mode which is more resistant to known SCA than the other submitted alternatives. In response to this, we perform differential power analysis (DPA) on the possible smart card...... implementations of some of the recently proposed MAC alternatives to NMAC (a fully analyzed variant of HMAC) and HMAC algorithms and NMAC/HMAC versions of some recently proposed hash and compression function modes. We show that the recently proposed BNMAC and KMDP MAC schemes are even weaker than NMAC...
Capturing Parent-Child Interactions With Social Media: Comment on Zhang et al. (2015).
Leung, Ricky; Dong, Guanghui; Qin, Xiaoxia; Lin, Shao
2016-06-01
Zhang et al. conducted a qualitative study of children presented with 19 parental structuring behaviors of parental control and were asked to attribute the parent's intent behind the behaviors. The authors developed several conceptual categories, "parent-centered," "child-centered," or "social" interests. Here, we describe how their 12 propositions could be empirically tested in further studies using social media. © The Author(s) 2016.
Directory of Open Access Journals (Sweden)
I Gusti Made Panji Indrawinatha
2016-12-01
Full Text Available Virus komputer merupakan perangkat lunak berbahaya yang dapat merusak data dan menggandakan diri pada sistem komputer. Untuk mendeteksi dan membersihkan virus dari sistem komputer, maka dibuatlah aplikasi antivirus. Dalam mendeteksi berbagai jenis virus sebuah aplikasi antivirus biasanya menggunakan beberapa metode. Pada penelitian ini akan membahas perancangan sebuah aplikasi antivirus menggunakan metode Secure Hash Algorithm 1 (SHA1 dan heuristic string sebagai metode pendeteksian virus. Dari pengujian yang dilakukan diperoleh hasil dimana saat tidak menggunakan heuristic, antivirus hanya mendeteksi 12 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 35%. sedangkan saat menggunakan heuristic, antivirus berhasil mendeteksi 31 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 91%.
Proof and Pedagogy in Ancient China: Examples from Liu Hui's Commentary on "JIU ZHANG SUAN SHU".
Siu, Man-Keung
1993-01-01
Illustrates the pedagogical implications embodied in Liu Hui's discussion on the ancient Chinese mathematical classic "JIU ZHANG SUAN SHU" (Nine Chapters on the Mathematical Art) with respect to aspects of proof and, more generally, the role of proof in mathematics. Provides examples involving area and volume. (Contains 25 references.)…
Development of the SONIX software for the YuMO instrument at the IBR-2 reactor
International Nuclear Information System (INIS)
Kirilov, A.S.; Litvinenko, E.I.; Astakhova, N.V.; Murashevich, S.M.; Petukhova, T.B.; Yudin, V.E.; Gordelij, V.I.; Islamov, A.Kh.; Kuklin, A.I.
2003-01-01
The main results of the modernization of the software complex of the YuMO spectrometer are described. The comparison of the previous MS-DOS based software and new OS-9 based one is carried out. The advantages and disadvantages of each program are described. The main features of the new software complex and the results of its long-term operation are presented. It is shown that the software upgrade essentially improved the spectrometer control. (author)
Many particle approximation of the Aw-Rascle-Zhang second order model for vehicular traffic.
Francesco, Marco Di; Fagioli, Simone; Rosini, Massimiliano D
2017-02-01
We consider the follow-the-leader approximation of the Aw-Rascle-Zhang (ARZ) model for traffic flow in a multi population formulation. We prove rigorous convergence to weak solutions of the ARZ system in the many particle limit in presence of vacuum. The result is based on uniform BV estimates on the discrete particle velocity. We complement our result with numerical simulations of the particle method compared with some exact solutions to the Riemann problem of the ARZ system.
Carter, Merilyn; Cooper, Tom; Anderson, Robyn
2016-01-01
This paper describes the pedagogical framework used by YuMi Deadly Maths, a school change process used to improve mathematics teaching and thus enhance employment and life chances for socially disadvantaged students. The framework, called the RAMR cycle, is capable of being used by mathematics teachers for planning and delivering lessons and units…
Microstructural evolution and mechanical properties of hypereutectic ...
Indian Academy of Sciences (India)
Administrator
2013-07-06
Jul 6, 2013 ... dered (Hekmat-Ardakan et al 2010; Choi and Li 2012). Usually, the .... According to Clapeyron equation (Yu et al 1999) m. 2. 1 m. (. ) d d ,. T V. V. T. P. H. -. = ∆. (1) .... Jung H K, Seo P K and Kang C G 2001 J. Mater. Process. Technol ... Res. 14 141. Zhang H H, Duan H L, Shao G J, Xu L P, Yin J L and Yan B.
International Nuclear Information System (INIS)
2017-01-01
Preface “Among the many well-known fundamental and applied consequences of neutron discovery, one of the first was the emergence of structural neutron diffraction - one of the methods for studying the spatial structure of condensed matter at the atomic level. Investigating the dynamics of biological macromolecules by neutron diffraction methods is an area that is almost untouched. We believe that also in this direction one should expect rapid progress.” Yu.M.Ostanevich and I.N.Serdyuk Uspekhi Fizicheskih Nauk (1982) More than 30 years after Ostanevich and Serdyuk reviewed the then 50 years from the neutron discovery, we are happy to support their statement and prediction by reporting on the further progress in the field of neutron scattering research. Frank Laboratory of Neutron Physics has organized the III International Conference on Small Angle Neutron Scattering (YuMO2016) that was – not coincidently – dedicated to the 80th anniversary of Ostanevich. Yuriy Mechislavovich Ostanevich (1936–1992) has had a determinative and crucial contribution to the construction of spectrometers at the pulsed reactor IBR in Dubna, Russia. He contributed in particular to the development of time-of-flight small-angle neutron scattering (SANS) technique, and the selection of advanced scientific areas for its application. The SANS instrument at the IBR-2 reactor is called YuMO in his honour. The Ostanevich’s leadership and outstanding scientific achievements in SANS studies of polyelectrolytes, small molecules, fractals, metallic glasses, macromolecules, polymers, etc., were recognized also by a number of awards including the State Prize of the Russian Federation in 2000. To this end of course, we should not forget mentioning the contribution of close collaborators of Ostanevich: Laszlo Cser, Josef Plestil as well as Alexander Kunchenko, Vadim Bezzabotnov and Nikolay Gorski. The YuMO2016 conference focused on providing opportunities to discuss various possibilities of
Characteristic Sign Renewals of Kardar-Parisi-Zhang Fluctuations
Takeuchi, Kazumasa A.; Akimoto, Takuma
2016-09-01
Tracking the sign of fluctuations governed by the (1+1)-dimensional Kardar-Parisi-Zhang (KPZ) universality class, we show, both experimentally and numerically, that its evolution has an unexpected link to a simple stochastic model called the renewal process, studied in the context of aging and ergodicity breaking. Although KPZ and the renewal process are fundamentally different in many aspects, we find remarkable agreement in some of the time correlation properties, such as the recurrence time distributions and the persistence probability, while the two systems can be different in other properties. Moreover, we find inequivalence between long-time and ensemble averages in the fraction of time occupied by a specific sign of the KPZ-class fluctuations. The distribution of its long-time average converges to nontrivial broad functions, which are found to differ significantly from that of the renewal process, but instead be characteristic of KPZ. Thus, we obtain a new type of ergodicity breaking for such systems with many-body interactions. Our analysis also detects qualitative differences in time-correlation properties of circular and flat KPZ-class interfaces, which were suggested from previous experiments and simulations but still remain theoretically unexplained.
A note on Wang et al's attack on Zhang et al's multiparty quantum secret sharing
International Nuclear Information System (INIS)
Gao Gan
2012-01-01
Recently, Wang et al (2008 Phys. Lett. A 373 65) proposed an attack on Zhang et al's (2007 Opt. Commun. 269 418) multiparty quantum secret sharing scheme, in which the first and the last agent are reported to be able to cooperatively eavesdrop on all the secret messages without being detected. In this paper, we show that in Wang et al's attack, on average no more than half the secret messages can be eavesdropped. (paper)
Directory of Open Access Journals (Sweden)
Zhang XD
2014-04-01
Full Text Available Xiao-Dong Zhang,1 Jiang Yang,2 Sha-Sha Song,1 Wei Long,1 Jie Chen,1 Xiu Shen,1 Hao Wang,1 Yuan-Ming Sun,1 Pei-Xun Liu,1 Saijun Fan11Tianjin Key Laboratory of Molecular Nuclear Medicine, Institute of Radiation Medicine, Chinese Academy of Medical Sciences and Peking Union Medical College, Tianjin, People's Republic of China; 2Department of Biological Systems Engineering, University of Wisconsin-Madison, Madison, WI, USAAbstract: The use of nanoparticles holds promise for medical applications, such as X-ray imaging, photothermal therapy and radiotherapy. However, the in vivo toxicity of inorganic nanoparticles raises some concern regarding undesirable side effects which prevent their further medical application. Ultrasmall sub-5.5 nm particles can pass through the barrier for renal clearance, minimizing their toxicity. In this letter we address some recent interesting work regarding in vivo toxicity and renal clearance, and discuss the possible strategy of utilizing ultrasmall nanomaterials. We propose that small hydrodynamic sized nanoclusters can achieve both nontoxic and therapeutic clinical features.Keywords: in vivo clearance, gold nanoparticles, small size
S.Yu. Witte's Customs Policy and Regulation of State Import of Industrial Equipment
Directory of Open Access Journals (Sweden)
Антон Юрьевич Петров
2013-12-01
Full Text Available The article considers state import of industrial equipment in the context of the customs regulation of Russia’s foreign trade under S.Yu. Witte as the Minister of Finance (1892–1903. The analysis of archival data reveals the motives which drove various ministries of the Russian empire when they gave preference to foreign producers rather than domestic ones. In the 1890s the Ministry of Finance, on the one hand, and other ministries, on the other hand, were debating the necessity of orders for foreign industrial equipment made by the Russian governmental bodies. The article studies the course and results of this interdepartmental struggle.
Cartmell, Matthew P.
2016-09-01
The Editor wishes to make the reader aware that the paper "A new method for predicting nonlinear structural vibrations induced by ground impact loading" by Jun Liu, Yu Zhang, Bin Yun, Journal of Sound and Vibration, 331 (2012) 2129-2140, did not contain a direct citation of the fundamental and original work in this field by Dr. Mark Svinkin. The Editor regrets that this omission was not noted at the time that the above paper was accepted and published.
Xu,Li; Du,Jing; Wan,Caifeng; Zhang,Yu; Xie,Shaowei; Li,Hongli; Yang,Hong; Li,Fenghua
2018-01-01
Li Xu,1,* Jing Du,1,* Caifeng Wan,1 Yu Zhang,1 Shaowei Xie,1 Hongli Li,1 Hong Yang,2 Fenghua Li1 1Department of Ultrasound, Renji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai, China; 2Department of Chemistry, College of Life and Environmental Science, Shanghai Normal University, Shanghai, China *These authors contributed equally to this work Background: The development of nanoscale molecularly targeted ultrasound contrast agents (UCAs) with high affinity and specif...
Chen,Wei; Ju,Jing; Yang,Yehong; Wang,Hao; Chen,Wenjie; Zhao,Xuelan; Ye,Hongying; Zhang,Yu
2018-01-01
Wei Chen,1 Jing Ju,1 Yehong Yang,2 Hao Wang,3 Wenjie Chen,1 Xuelan Zhao,1 Hongying Ye,2 Yu Zhang1 1Department of Geriatrics, Huashan Hospital, Fudan University, Shanghai, China; 2Department of Endocrinology, Huashan Hospital, Fudan University, Shanghai, China; 3Core Center of Animal Facility, School of Medicine, Fudan University, Shanghai, China Introduction: Diabetic cardiomyopathy is characterized by an imbalance between myocyte death and regeneration mediated by the progressive loss of c...
Future Directions of Nonlinear Dynamics in PhysicaL and Biological Systems,
1992-01-01
the Comision Interministerial de Ciencia y Tecnologia (Spain) under Grant No. TIC 73/89. REFERENCES [1] Yu.S. Kivshar, Zhang Fei, and L. Vizquez, Phys...DYNAMICS Controlling Chaos in Hamiltonian Systems ........................... 129 Y .-C. Lai, M. Ding, and C. Grebogi Deterministic Disorder in Two...all Oi satisfy the following linear differential equations for n = 1 2,..- 8 ,0- , = a n ’ ( 5 ) where xi = x, X2 = Y , x3 = t, Here we note that the
Liu, Yongjun; Wu, Xiaoyun; Sun, Xiaohe; Wang, Dan; Zhong, Ying; Jiang, Dandan; Wang, Tianqi; Yu, Dexin; Zhang, Na
2017-01-01
Yongjun Liu,1 Xiaoyun Wu,1 Xiaohe Sun,1 Dan Wang,1 Ying Zhong,1 Dandan Jiang,1 Tianqi Wang,1 Dexin Yu,2 Na Zhang1 1School of Pharmaceutical Science, Shandong University, 2Department of Radiology Medicine, Qilu Hospital, Jinan, People’s Republic of China Abstract: Developing magnetic resonance imaging (MRI) contrast agents with high relaxivity and specificity was essential to increase MRI diagnostic sensitivity and accuracy. In this study, the MRI contrast agent, vascular endotheli...
Xu XP; Deng DN; Gu YH; Ng CS; Cai X; Xu J; Zhang XS; Ke DG; Yu QH; Chan CK
2018-01-01
Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing att...
Chang, Zhi-Min; Yang, Lin; Zhang, Zheng-Guang; Chen, Xiang-Sheng
2015-12-11
Two new species of the issid genus Neotetricodes Zhang et Chen (Hemiptera: Fulgoromorpha: Issidae): Neotetricodes longispinus Chang et Chen sp. nov. (China: Yunnan) and Neotetricodes xiphoideus Chang et Chen sp. nov. (China: Yunnan) are described and illustrated. The generic characteristic is redefined. A checklist and key to the species of the genus are provided. The female genitalia of the genus are firstly described.
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
The geological survey was carried out which is needed for coal mine design in the Yu Xian coal mine area, Yu Xian coal field, Hebei province, China. The term of survey was 5 years from 1996 to 2000. Activities are mainly for seismic survey and boring survey. Japan was in charge of the seismic survey, and China in charge of the boring survey. Both attained the goal. The results of the activities were summed up in the following 7 items: 1) outline of the survey; 2) general investigation; 3) state of the exploration related materials/machinery; 4) field survey; 5) items of survey; 6) results of the survey; 7) conclusion. In 6), the geological analysis, coal quality survey and coal amount survey were conducted. In the geological analysis, analyzed were the succession of strata, geological structure, and the situation of existence of coal seams. In 7), the following were made clear: geological structure of the survey area, coal seam, coal quality, hydrological geology, other conditions of drilling technology, and coal amount. The coal amount was 328.34 million tons in a total of A/B/C class coals. The total coal amount of Nos. 1 and 5 coal seams was 259.79 million tons, which was 79.1% of the total coal amount in all area. The average thickness of Nos. 1 and 5 coal seams, which are the main minable coal seams, was 3.10m and 2.66m, respectively. (NEDO)
Zhang, Yuli; Han, Jun; Weng, Xinqian; He, Zhongzhu; Zeng, Xiaoyang
This paper presents an Application Specific Instruction-set Processor (ASIP) for the SHA-3 BLAKE algorithm family by instruction set extensions (ISE) from an RISC (reduced instruction set computer) processor. With a design space exploration for this ASIP to increase the performance and reduce the area cost, we accomplish an efficient hardware and software implementation of BLAKE algorithm. The special instructions and their well-matched hardware function unit improve the calculation of the key section of the algorithm, namely G-functions. Also, relaxing the time constraint of the special function unit can decrease its hardware cost, while keeping the high data throughput of the processor. Evaluation results reveal the ASIP achieves 335Mbps and 176Mbps for BLAKE-256 and BLAKE-512. The extra area cost is only 8.06k equivalent gates. The proposed ASIP outperforms several software approaches on various platforms in cycle per byte. In fact, both high throughput and low hardware cost achieved by this programmable processor are comparable to that of ASIC implementations.
Chen,Hong; Xu,Hong; Meng,Yugang; Zhang,Yun; Chen,Junying; Wei,Xiaoning
2016-01-01
Hong Chen,1 Hong Xu,1 Yu-gang Meng,1 Yun Zhang,2 Jun-ying Chen,1 Xiao-ning Wei1 1Department of Gynaecology, The First Affiliated Hospital of Guangxi Medical University, Nanning, Guangxi, 2Department of Gynaecology, The People’s Hospital of Suzhou High Tech District, Suzhou, Jiangsu, People’s Republic of China Background: Uterine leiomyoma is one of the most common benign tumors in women. It dramatically decreases the quality of life in the affected women. However, there ...
2011-02-01
Salmenniemi, U., Ruotsalainen, E., Pihlajamaki, J., Vauhkonen, I., Kai - nulainen, S., Punnonen, K., Vanninen, E., and Laakso, M. (2004). Mul- tiple...cancer: a dawn for evolutionary medicine. Annu. Rev. Genet. 39, 359–407. Wang, Y.X., Zhang, C.L., Yu , R.T., Cho, H.K., Nelson, M.C., Bayuga- Ocampo...calorie diet, Nature 444 (2006) 337–342. [19] J.M. Wu, Z.R. Wang, T.C. Hsieh , J.L. Bruder, J.G. Zou, Y.Z. Huang, Mechanism of cardioprotection by
Directory of Open Access Journals (Sweden)
Jana Rošker
2010-12-01
Full Text Available Recognizing the fact that comprehension, analysis and transmission of reality are based on diversely structured socio-political contexts as well as on different categorical and essential postulates, offers a prospect of enrichment. Thus, this article presents an analysis and interpretation of one of the first Chinese theoreticians, working in the field of intercultural methodology. Although Zhang Dongsun (1886–1973 can be considered as one of the leading Chinese philosophers of the 20th Century, his criticism of Sinicized Marxist ideologies marked him as a political dissident and he was consequently consigned to oblivion for several decades; only recently has his work been rediscovered by a number of younger Chinese theorists, who have shown a growing interest in his ideas. Although he is still relatively unknown in the West, Zhang definitely deserves to be recognized for his contributions to Chinese and comparative philosophy. The present article focuses on his extraordinary ability to introduce Western thought in a way which was compatible with the specific methodology of traditional Chinese thought. According to such presumptions, culture is viewed as an entity composed of a number of specific discourses and relations. The article shows how the interweaving and interdependence of these discourses form different cultural backgrounds, which manifest themselves in the specific, culturally determined structures of language and logic. It also explains the role of traditional elements in his cultural epistemology.
Review on the Book: Pochekaev R.Yu. The Golden Horde Law (Kazan, 2009. 260 p. » 231
Directory of Open Access Journals (Sweden)
E.G. Sayfetdinova
2015-06-01
Full Text Available This paper contains a review of the R.Yu. Pochekaev’s book “The Golden Horde Law”. The reviewer points out that the Pochekaev’s book is a significant academic research in both the study of the Golden Horde history and the law system of the Eurasian Turkic-Mongol peoples. This book is published by the Center for Research on the Golden Horde Civilization at the Sh.Marjani Institute of History of the Academy of Sciences of the Republic of Tatarstan. For several years, the author of this book, R.Yu. Pochekaev, has been concerned with the the history of the Golden Horde State and its law system. He has published a number of works on this topic, the main conclusions of which are reflected in this generalizing work. The study is based on a wide range of sources (annals and chronicles, memoirs of contemporaries, bureaucratic and numismatic materials and numerous studies including the works of foreign specialists in the original language. In his book, the author organically combines the latest achievements of research on both the Golden Horde history and theory and history of law. The book will be of interest to experts of the Golden Horde history and Orientalists, who are often faced with the legal aspects of the material under study.
Diet-derived microRNAs: unicorn or silver bullet?
Witwer, Kenneth W; Zhang, Chen-Yu
2017-01-01
In ancient lore, a bullet cast from silver is the only effective weapon against monsters. The uptake of active diet-derived microRNAs (miRNAs) in consumers may be the silver bullet long sought after in nutrition and oral therapeutics. However, the majority of scientists consider the transfer and regulation of consumer's gene activity by these diet-derived miRNAs to be a fantasy akin to spotting a unicorn. Nevertheless, groups like Dr. Chen-Yu Zhang's lab in Nanjing University have stockpiled breathtaking amounts of data to shoot down these naysayers. Meanwhile, Dr. Ken Witwer at John Hopkins has steadfastly cautioned the field to beware of fallacies caused by contamination, technical artifacts, and confirmation bias. Here, Dr. Witwer and Dr. Zhang share their realities of dietary miRNAs by answering five questions related to this controversial field.
2012-01-01
This collection is dedicated to the 70th jubilee of Yu. N. Savchenko, and presents experimental, theoretical, and numerical investigations written by an international group of well-known authors. The contributions solve very important problems of the high-speed hydrodynamics, such as supersonic motion in water, drag diminishing, dynamics and stability of supercavitating vehicles, water entry and hydrodynamic performances of hydrofoils, ventilated cavities after a disc and under the ship bottom. The book is written for researches, scientists, engineers, and students interested in problems of hydromechanics.
La fuerza expresiva del deseo en Lan Yu de Stanley Kwan .
Directory of Open Access Journals (Sweden)
David L. Eng
2007-12-01
Full Text Available Stanley Kwan's Lan Yu configures the emergence of homosexuality in contemporary China far beyond its validation in recognizably Western identitarian terms: the affirmation of an existing but misrecognized minority population; the defense of sexual "perversion"; the positing of sexual freedom, legal recognition, and political rights; the justification of a bourgeois consumer lifestyle, or even the expression of a universalizing and bindingtove bringing togethertwo abstract individuáis. Instead, in Kwan's film, homosexuality and its expressive desire mark the emergence of a new humanism in (postsocialist China under the shadows of global capitalism and neoliberal development. Gays and lesbians, that is, are harbingers of a new modernity, helping to situate China in its proper place within a cosmopolitan globalized world. From this perspective, homosexuality functions as a critical tool for organizing and evaluating the historical continuities and ruptures among China's (semicolonial past, its revolutionary aspirations for a socialist modernity, and its present investments in a neoliberal capitalist world order.
Formation of the oil composition of the Yu0 Bazhenov formation, Salym oil field
Directory of Open Access Journals (Sweden)
E.V. Soboleva
2017-05-01
Full Text Available The Bazhenov horizon of Western Siberia has been studied in considerable detail from different perspectives and different methods, a large number of studies have been devoted to a wide range of issues related to the lithological composition of rocks, their reservoir properties, the study of organic matter, properties and composition of oil at various analytical levels, and many others. This work is devoted to restoring conditions for the formation of oil properties and composition of the Yu0 Salym oil field, based mainly on the geochemical aspects of the study of oil changes both in area and in the section within the productive layer of Salym structure, using some geological data, such as structural plan for the reflecting horizon B (the roof of the Bazhenov formation, having a complex configuration, reservoir temperatures and pressure, well flow rates, and others. There is no single reservoir at the Salym field in the Yu0 formation. For the conclusions of the geological-geochemical interpretation, a sampling of 61 samples of oil from exploration, appraisal and production wells of the initial stages of production was used, since in the future when oil is extracted, the ecology in the deposits changes, and 21 samples of oil from other fields in the West Siberian oil and gas basin. Conventionally, three types of oils are distinguished, differing in their physicochemical parameters, group hydrocarbon and molecular composition. It was suggested that in addition to the own organic matter of the Bazhenov formation, hydrocarbon fluids of the Vasyugan, Tyumen formations and possibly Paleozoic rocks were involved in the formation of the oil composition. The flow of light liquid hydrocarbons and gases occurred along the zones of faults of different genesis and duration of existence.
Crago, Richard; Qualls, Russell; Szilagyi, Jozsef; Huntington, Justin
2017-07-01
Ma and Zhang (2017) note a concern they have with our rescaled Complementary Relationship (CR) for land surface evaporation when daily average wind speeds are very low (perhaps less than 1 m/s). We discuss conditions and specific formulations that lead to this concern, but ultimately argue that under these conditions, a key assumption behind the CR itself may not be satisfied at the daily time scale. Thus, careful consideration of the reliability of the CR is needed when wind speeds are very low.
Brey, Eric Michael
2014-01-01
This article is a review of the book “Imaging in Cellular and Tissue Engineering” (ISBN-13: 978-1439848036, $149.95, 298 Pages, 114 Illustrations) edited by Y Hanry Yu and Nur Aida Abdul Rahim published by the CRC Press (Taylor&Francis) in 2013. The contents of the book and its relevance to tissue engineering and regenerative medicine are discussed in this invited review.
Le langage des couleurs dans les films de Zhang Yimou
Directory of Open Access Journals (Sweden)
Xiaomin Giafferri
2009-05-01
Full Text Available Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le sorgho rouge, Epouses et concubines, Judou et Hero, ce texte tente de réfléchir sur ces questions: si l’on admet que les limites du récit filmique diffèrent de celles du récit verbal, romanesque par exemple, les couleurs qui ne constituent pas un trait pertinent d’identification, participent-elle à la prise en charge de l’histoire ? Composante de l’espace filmique dont les fonctions narratives sont incontestées, sont-elle définitivement non diégétiques ?
International Nuclear Information System (INIS)
Lin, Wen-Yang; Lin, Feng-Huei; Sadhasivam, S.; Savitha, S.
2010-01-01
The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.
Energy Technology Data Exchange (ETDEWEB)
Lin, Wen-Yang; Lin, Feng-Huei [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Sadhasivam, S., E-mail: rahulsbio@yahoo.co.in [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Savitha, S. [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China)
2010-05-10
The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.
Recent developments on the Kardar-Parisi-Zhang surface-growth equation.
Wio, Horacio S; Escudero, Carlos; Revelli, Jorge A; Deza, Roberto R; de la Lama, Marta S
2011-01-28
The stochastic nonlinear partial differential equation known as the Kardar-Parisi-Zhang (KPZ) equation is a highly successful phenomenological mesoscopic model of surface and interface growth processes. Its suitability for analytical work, its explicit symmetries and its prediction of an exact dynamic scaling relation for a one-dimensional substratum led people to adopt it as a 'standard' model in the field during the last quarter of a century. At the same time, several conjectures deserving closer scrutiny were established as dogmas throughout the community. Among these, we find the beliefs that 'genuine' non-equilibrium processes are non-variational in essence, and that the exactness of the dynamic scaling relation owes its existence to a Galilean symmetry. Additionally, the equivalence among planar and radial interface profiles has been generally assumed in the literature throughout the years. Here--among other topics--we introduce a variational formulation of the KPZ equation, remark on the importance of consistency in discretization and challenge the mainstream view on the necessity for scaling of both Galilean symmetry and the one-dimensional fluctuation-dissipation theorem. We also derive the KPZ equation on a growing domain as a first approximation to radial growth, and outline the differences with respect to the classical case that arises in this new situation.
Fabrication of welded pipes of the KhN45Yu alloy
International Nuclear Information System (INIS)
Lyapunov, A.I.; Krichevskij, E.M.; L'vov, V.N.; Kozlov, N.N.; Kireeva, T.S.
1977-01-01
A highly heat-resistant KhN45Yu (EP 747) alloy has been developed; the alloy is designed to withstand prolonged service in the temperature range of 1000-1300 deg C, or short-term service at 1300-1400 deg C. The satisfactory ductility and good weldability of the alloy have made it possible to obtain sheets and pipes (32 x 2.0 mm) by argon arc welding. The ductility of pipes from EP 747 alloy exceeds that of pipes from KhN78T (EI 435) alloy by 5.10%, the strength being approximately equal. In regard to strength the welded joint differs little from the base metal. The ductility characteristics up to 900 deg C are also equal, since failure occurs in the base metal. At higher temperatures the welded joint fails in the metal of the weld, and its ductility drops sharply. The grain size of the base metal corresponds to No. 3-4. The welded joint has a cast structure with a grain size larger than No. 1, but its ductility characteristics are satisfactory. This structure ensures an increased long-term strength of the material at 1000-1200 deg C
Recent development in clusters of rare earths and actinides. Chemistry and materials
Energy Technology Data Exchange (ETDEWEB)
Zheng, Zhiping (ed.) [Arizona Univ., Tucson, AZ (United States). Dept. of Chemistry and Biochemistry
2017-02-01
This book contains the following eight contributions: 1. Lanthanide Hydroxide Cluster Complexes via Ligand-Controlled Hydrolysis of the Lanthanide Ions (Zhonghao Zhang, Yanan Zhang, and Zhiping Zheng); 2. Synthesis and Structures of Lanthanide-Transition Metal Clusters (Xiu-Ying Zheng, Xiang-Jian Kong, and La-Sheng Long); 3. Hydrothermal Synthesis of Lanthanide and Lanthanide-Transition-Metal Cluster Organic Frameworks via Synergistic Coordination Strategy (Jian-Wen Cheng and Guo-Yu Yang); 4. Oxo Clusters of 5f Elements (Sarah Hickam and Peter C.); 5. Construction and Luminescence Properties of 4f and d-4f Clusters with Salen-Type Schiff Base Ligands (Xiaoping Yang, Shiqing Wang, Chengri Wang, Shaoming Huang, and Richard A.); 6. 4f-Clusters for Cryogenic Magnetic Cooling (Yan-Cong Chen, Jun-Liang Liu, and Ming-Liang Tong); 7. Lanthanide Clusters Toward Single-Molecule Magnets (Tian Han, You-Song Ding, and Yan-Zhen Zheng); 8. Molecular Rare Earth Hydride Clusters (Takanori Shima and Zhaomin Hou).
Recent development in clusters of rare earths and actinides. Chemistry and materials
International Nuclear Information System (INIS)
Zheng, Zhiping
2017-01-01
This book contains the following eight contributions: 1. Lanthanide Hydroxide Cluster Complexes via Ligand-Controlled Hydrolysis of the Lanthanide Ions (Zhonghao Zhang, Yanan Zhang, and Zhiping Zheng); 2. Synthesis and Structures of Lanthanide-Transition Metal Clusters (Xiu-Ying Zheng, Xiang-Jian Kong, and La-Sheng Long); 3. Hydrothermal Synthesis of Lanthanide and Lanthanide-Transition-Metal Cluster Organic Frameworks via Synergistic Coordination Strategy (Jian-Wen Cheng and Guo-Yu Yang); 4. Oxo Clusters of 5f Elements (Sarah Hickam and Peter C.); 5. Construction and Luminescence Properties of 4f and d-4f Clusters with Salen-Type Schiff Base Ligands (Xiaoping Yang, Shiqing Wang, Chengri Wang, Shaoming Huang, and Richard A.); 6. 4f-Clusters for Cryogenic Magnetic Cooling (Yan-Cong Chen, Jun-Liang Liu, and Ming-Liang Tong); 7. Lanthanide Clusters Toward Single-Molecule Magnets (Tian Han, You-Song Ding, and Yan-Zhen Zheng); 8. Molecular Rare Earth Hydride Clusters (Takanori Shima and Zhaomin Hou).
Generalized One-Band Model Based on Zhang-Rice Singlets for Tetragonal CuO
Hamad, I. J.; Manuel, L. O.; Aligia, A. A.
2018-04-01
Tetragonal CuO (T-CuO) has attracted attention because of its structure similar to that of the cuprates. It has been recently proposed as a compound whose study can give an end to the long debate about the proper microscopic modeling for cuprates. In this work, we rigorously derive an effective one-band generalized t -J model for T-CuO, based on orthogonalized Zhang-Rice singlets, and make an estimative calculation of its parameters, based on previous ab initio calculations. By means of the self-consistent Born approximation, we then evaluate the spectral function and the quasiparticle dispersion for a single hole doped in antiferromagnetically ordered half filled T-CuO. Our predictions show very good agreement with angle-resolved photoemission spectra and with theoretical multiband results. We conclude that a generalized t -J model remains the minimal Hamiltonian for a correct description of single-hole dynamics in cuprates.
Yuan, Na
2018-04-01
With the aid of the symbolic computation, we present an improved ( G ‧ / G ) -expansion method, which can be applied to seek more types of exact solutions for certain nonlinear evolution equations. In illustration, we choose the (3 + 1)-dimensional potential Yu-Toda-Sasa-Fukuyama equation to demonstrate the validity and advantages of the method. As a result, abundant explicit and exact nontraveling wave solutions are obtained including two solitary waves solutions, nontraveling wave solutions and dromion soliton solutions. Some particular localized excitations and the interactions between two solitary waves are researched. The method can be also applied to other nonlinear partial differential equations.
A Novel Digital Background Calibration Technique for 16 bit SHA-less Multibit Pipelined ADC
Directory of Open Access Journals (Sweden)
Swina Narula
2016-01-01
Full Text Available In this paper, a high resolution of 16 bit and high speed of 125MS/s, multibit Pipelined ADC with digital background calibration is presented. In order to achieve low power, SHA-less front end is used with multibit stages. The first and second stages are used here as a 3.5 bit and the stages from third to seventh are of 2.5 bit and last stage is of 3-bit flash ADC. After bit alignment and truncation of total 19 bits, 16 bits are used as final digital output. To precise the remove linear gain error of the residue amplifier and capacitor mismatching error, a digital background calibration technique is used, which is a combination of signal dependent dithering (SDD and butterfly shuffler. To improve settling time of residue amplifier, a special circuit of voltage separation is used. With the proposed digital background calibration technique, the spurious-free dynamic range (SFDR has been improved to 97.74 dB @30 MHz and 88.9 dB @150 MHz, and the signal-to-noise and distortion ratio (SNDR has been improved to 79.77 dB @ 30 MHz, and 73.5 dB @ 150 MHz. The implementation of the Pipelined ADC has been completed with technology parameters of 0.18μm CMOS process with 1.8 V supply. Total power consumption is 300 mW by the proposed ADC.
Kondo Effect of U Impurities in Dilute (YU)2Zn17
Takagi, Shigeru; Suzuki, Hiroyuki; Anzai, Kousuke
2001-10-01
Extending previous work on single-site properties of U ions in (LaU)2Zn17, we have investigated, from ρ(T), χ(T) and Cp(T) on single crystals, (Y1-xUx)2Zn17 with x=0.025 and 0.050, which has almost the same unit-cell volume as an antiferromagnetic heavy-electron compound U2Zn17. Remarkable features in the dilute-impurity limit have been clarified, which include Kondo behavior of ρ(T), large and almost isotropic χimp(T), and strongly enhanced Cimp(T)/T with gigantic γimp=2.02 2.05 J/K2·mole-U as T→0 due to a low characteristic energy-scale of the system. It is shown that gross features of the data are explained in terms of the conventional Kondo effect in the presence of the crystal field with the U3+ \\varGamma6 doublet ground state. It is also shown that the variation of γ with the unit-cell volume in related systems is not explained as a volume effect on TK and that even the behavior of fictitious “paramagnetic” U2Zn17 is not described as a collection of U impurities in dilute (YU)2Zn17.
DISCOVERY AND RESEARCH ON JIAHU BONE FLUTES IN WUYANG, CHINA.
Energy Technology Data Exchange (ETDEWEB)
JUZHONG, Z.; HARBOTTLE, G.; XINGHUA, X.; CHANGSUI, W.
2000-11-01
The site of Jiahu is located in Jiahu village, Wuyang County, Henan province, on the Western edge of the broad plain of Huanhuaihai. On its north the site borders the Sha River, in the upper reaches of the Huai River; its latitude is 33{degree} 36 minutes North, longitude 113{degree} 40 minutes East, and it is 67.5 meters above sea level. Between 1983 and 1987, the Henan Cultural Relics and Archaeology Institute carried out six campaigns of excavation here, revealing an area of 2400 square meters. Except for the trial excavation in the spring of 1983, Zhang Juzhong has been in charge of all the excavations. In early May 1986, while excavating tomb 78, Zhang Juzhong and Yang Zhenwei first discovered two funerary bone flutes. They soon found other, similar bone flutes in tombs 73, 94 and 121 respectively. Mr. Zhang's attention was instantly focused on these remarkable finds. In the campaign of autumn 1986, one or two more bone flutes were discovered in each of tombs 233,273, 263 and 270. Finally, in the spring of 1987, again one or two bone flutes were found in each of the tombs 282, 363,341,411,344 and 387. Up to the end of excavation in June 1987, altogether 25 bone flutes had been found, of which 17 were complete or almost complete, 6 broken or fragmentary and 2 were half-finished examples. Among the 17 complete bone flutes, there were 14 having seven holes, one five-hole, one six-hole and one eight-hole bone flute. In particular, the bone flute M282:20 was exquisitely made, and complete. Zhang Juzhong, the discoverer of the bone flutes, researcher Pei Mingxiang, the. ex-director of the division, who came to the digging site to see the progress of the work, and their coworkers were all understandably very excited.
Directory of Open Access Journals (Sweden)
Weiping Fang
Full Text Available Although cotton genic male sterility (GMS plays an important role in the utilization of hybrid vigor, its precise molecular mechanism remains unclear. To characterize the molecular events of pollen abortion, transcriptome analysis, combined with histological observations, was conducted in the cotton GMS line, Yu98-8A. A total of 2,412 genes were identified as significant differentially expressed genes (DEGs before and during the critical pollen abortion stages. Bioinformatics and biochemical analysis showed that the DEGs mainly associated with sugars and starch metabolism, oxidative phosphorylation, and plant endogenous hormones play a critical and complicated role in pollen abortion. These findings extend a better understanding of the molecular events involved in the regulation of pollen abortion in genic male sterile cotton, which may provide a foundation for further research studies on cotton heterosis breeding.
Chen, Qi; Lei, Lei; Li, Yan; Wang, Ji-Guang
2017-10-01
The present study aimed to evaluate the accuracy of the automated oscillometric upper-arm blood pressure monitor YuWell YE690A for blood pressure measurement according to the International Protocol of the European Society of Hypertension revision 2010. Systolic and diastolic blood pressures were measured sequentially in 33 adult Chinese (12 women, 44.2 years of mean age) using a mercury sphygmomanometer (two observers) and the YE690A device (one supervisor). A total of 99 pairs of comparisons were obtained from 33 participants for judgments in two parts with three grading phases. All the blood pressure requirements were fulfilled. The YuWell YE690A device achieved the targets in part 1 of the validation study. The number of absolute differences between device and observers within 5, 10, and 15 mmHg was 79/99, 96/99, and 97/99, respectively, for systolic blood pressure and 72/99, 95/99, and 98/99, respectively, for diastolic blood pressure. The device also fulfilled the criteria in part 2 of the validation study. Thirty-one and 25 participants for systolic and diastolic blood pressure, respectively, had at least two of the three device-observer differences within 5 mmHg (required ≥24). No participant for systolic and two participants for diastolic blood pressure had all the three device-observer comparisons greater than 5 mmHg. The YuWell blood pressure monitor YE690A has passed the requirements of the International Protocol revision 2010 and hence can be recommended for blood pressure measurement in adults.
Directory of Open Access Journals (Sweden)
Yusei Takemoto
2017-12-01
Full Text Available Go-sha-jinki-gan (GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. Using a newly established mouse model for Duchenne muscular dystrophy (DMD, DBA/2-mdx, we showed that GJG significantly increased the body and skeletal muscle weights in comparison to the control DBA/2-mdx mice, regardless of gender. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Both the skeletal muscle regenerative ability and the accumulation of fibrosis (the dystrophic pathology in GJG-fed DBA/2-mdx mice were comparable to those in control DBA/2-mdx mice, suggesting that the cellular target of GJG is myofibers, with no contribution from the muscle satellite cells neither in an direct nor in an indirect manner. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.
Institute of Scientific and Technical Information of China (English)
董传岭
2012-01-01
Liu Zhiji and Zhang Xuecheng are famous for their historical theory in ancient China. They all put forward the theory of historian historians' cultivation which has important sense to improve historian self-cultivation and historical development. Liu Zhiji argued that historians should have "ability, learning, knowledge", Zhang Xuecheng further put forward historian moral on the basis of the Liu Zhiji~s theory,enriched and developed the theory of the historians~ cultiva- tion. They all emphasize "ability,learning, knowledge", Liu Zhiji emphasize "knowledge" mostly, but Zhang Xuecheng relied heavily on "moral". Comparison and analysis on Liu Zhiji and Zhang Xuecheng's theory of self-cultivation,not only enable us to find their theories difference, under- standing the theory deeply, but also has certain enlightenment function on the contemporary historiography development.%我国古代史学理论大家刘知几、章学诚均提出了有关史家修养的理论,刘知几认为史家应具备"才、学、识",章学诚在继承刘知几史家修养理论的基础上,进一步提出"史德",丰富和发展了史家修养理论。刘知几、章学诚均重视"才、学、识",但刘知几最重"史识",章学诚尤重"史德"。比较和分析二者的史家修养理论,不仅能使我们发现他们理论的异同,深刻理解史家修养理论,而且对当今史学发展也具有一定的启示功用。
Energy Technology Data Exchange (ETDEWEB)
Chen, S
1984-01-01
The Khekou basin of the second order which is located in the Eastern part of the Tsziyan basin in the oil and gas Bokhayvan'skiy pool has an area of about 900 km/sup 2/. The main productive level occurs in sandstone beds in the Sha-3 subseries (reaching thickness of about 400 m) of the Shakhetsze series. The Bonan oil field was discovered in this region in 1975. The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels. Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields.
Wang, Ning; Wu, Youran
2012-01-01
With the rapid development of Chinese economy, wealth has spread from largest coastal cities to smaller cities and luxury stores have started to follow. Kelly Mall is the largest high-end department store situated in Zhang Jiagang City, Jiangsu Province, P.R China. This research aims to figure out if Kelly Mall should introduce a new luxury brand, help-ing Kelly Mall’s board members make decision on taking either Burberry or Gucci or both of them into its luxury department. Theoretical framew...
Directory of Open Access Journals (Sweden)
Faiza Alif Fakhrina
2016-11-01
Full Text Available Fingerprint is the skin on the palms of the hands and feet that are covered with small ridge lines. Fingerprint pattern belonging to every human is being unique. There are fingerprint on the ridge pattern will not change during human life. Ridge pattern is characteristic of the fingrprint that can be used for biometric identification. Based on fingerprint ridge pattern into four, namely whorl, ulnar loop, radial loop, and arch. Minutiae Extraction (Crossing Number, Core and Delta, Center Point Location can be used for fingerprint pattern recognition. Some of the methods used in the fingerprint pattern recognition is Minutiae Extraction, and Thinning Zhang-Suen and Stentiford. Croosing Number is used for process Minutiae Extraction, example termination and bifurcation. The classification method used Linear Discriminant Analysis. The result fingerprint pattern recognition is system can recognize fingerprint patter as much as 20 images and system can not recognize fingerprint pattern as much as 10 images. Accuracy of fingerprint pattern recognition is 66%.
Directory of Open Access Journals (Sweden)
Li JY
2016-04-01
Full Text Available Jingya Li,1,* Ruizhen Zhao,1,* Xiaoli Li,1 Wenjun Sun,1 Miao Qu,1 Qisheng Tang,1 Xinke Yang,1 Shujing Zhang2 1Third Affiliated Hospital, 2School of Basic Medical Sciences, Beijing University of Chinese Medicine, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Shen-Qi-Jie-Yu-Fang (SJF is composed of eight Chinese medicinal herbs. It is widely used in traditional Chinese medicine for treating postpartum depression (PPD. Previous studies have shown that SJF treats PPD through the neuroendocrine mechanism. Aim: To further investigate the effect of SJF on the immune system, including the inflammatory response system and CD4+CD25+ regulatory T (Treg cells. Materials and methods: Sprague Dawley rats were used to create an animal model of PPD by inducing hormone-simulated pregnancy followed by hormone withdrawal. After hormone withdrawal, the PPD rats were treated with SJF or fluoxetine for 1, 2, and 4 weeks. Levels of Treg cells in peripheral blood were measured by flow cytometry analysis. Serum interleukin (IL-1β and IL-6 were evaluated by enzyme-linked immunosorbent assay, and gene and protein expressions of IL-1RI, IL-6Rα, and gp130 in the hippocampus were observed by reverse-transcription polymerase chain reaction and Western blot. Results: Serum IL-1β in PPD rats increased at 2 weeks and declined from then on, while serum IL-6 increased at 1, 2, and 4 weeks. Both IL-1β and IL-6 were downregulated by SJF and fluoxetine. Changes in gene and protein expressions of IL-1RI and gp130 in PPD rats were consistent with changes in serum IL-1β, and were able to be regulated by SJF and fluoxetine. The levels of Treg cells were negatively correlated with serum IL-1β and IL-6, and were decreased in PPD rats. The levels of Treg cells were increased by SJF and fluoxetine. Conclusion: Dysfunction of proinflammatory cytokines and Tregs in different stages of PPD was attenuated by SJF and fluoxetine through
Rueda, Oscar M; Diaz-Uriarte, Ramon
2007-10-16
Yu et al. (BMC Bioinformatics 2007,8: 145+) have recently compared the performance of several methods for the detection of genomic amplification and deletion breakpoints using data from high-density single nucleotide polymorphism arrays. One of the methods compared is our non-homogenous Hidden Markov Model approach. Our approach uses Markov Chain Monte Carlo for inference, but Yu et al. ran the sampler for a severely insufficient number of iterations for a Markov Chain Monte Carlo-based method. Moreover, they did not use the appropriate reference level for the non-altered state. We rerun the analysis in Yu et al. using appropriate settings for both the Markov Chain Monte Carlo iterations and the reference level. Additionally, to show how easy it is to obtain answers to additional specific questions, we have added a new analysis targeted specifically to the detection of breakpoints. The reanalysis shows that the performance of our method is comparable to that of the other methods analyzed. In addition, we can provide probabilities of a given spot being a breakpoint, something unique among the methods examined. Markov Chain Monte Carlo methods require using a sufficient number of iterations before they can be assumed to yield samples from the distribution of interest. Running our method with too small a number of iterations cannot be representative of its performance. Moreover, our analysis shows how our original approach can be easily adapted to answer specific additional questions (e.g., identify edges).
International Nuclear Information System (INIS)
2017-01-01
The Organizers of the III International Conference on Small Angle Neutron Scattering dedicated to the 80-th anniversary of Yu. M. Ostanevich, acknowledge the financial support from the Grants of the Governmental Plenipotentiary Representatives of Romania, Slovakia, Czech Republic, scientific projects of the Cooperation Programmes JINR-Romania. Special gratitude to the JINR and FLNP administration and staff is expressed. The conference is also dedicated to the 60th Anniversary of the Joint Institute for Nuclear Research, Dubna. (paper)
Sha, Jian; Liu, Min; Wang, Dong; Swaney, Dennis P; Wang, Yuqiu
2013-07-30
Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen (DN) and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River (SHR) watershed in China. The Regional Nutrient Management model (ReNuMa) was used to infer the primary sources of DN in the SHR watershed. This model is based on the Generalized Watershed Loading Functions (GWLF) and the Net Anthropogenic Nutrient Input (NANI) framework, modified to improve the characterization of subsurface hydrology and septic system loads. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. Copyright © 2013 Elsevier Ltd. All rights reserved.
Yu, Francis T. S.; Jutamulia, Suganda
2008-10-01
Contributors; Preface; 1. Pattern recognition with optics Francis T. S. Yu and Don A. Gregory; 2. Hybrid neural networks for nonlinear pattern recognition Taiwei Lu; 3. Wavelets, optics, and pattern recognition Yao Li and Yunglong Sheng; 4. Applications of the fractional Fourier transform to optical pattern recognition David Mendlovic, Zeev Zalesky and Haldum M. Oxaktas; 5. Optical implementation of mathematical morphology Tien-Hsin Chao; 6. Nonlinear optical correlators with improved discrimination capability for object location and recognition Leonid P. Yaroslavsky; 7. Distortion-invariant quadratic filters Gregory Gheen; 8. Composite filter synthesis as applied to pattern recognition Shizhou Yin and Guowen Lu; 9. Iterative procedures in electro-optical pattern recognition Joseph Shamir; 10. Optoelectronic hybrid system for three-dimensional object pattern recognition Guoguang Mu, Mingzhe Lu and Ying Sun; 11. Applications of photrefractive devices in optical pattern recognition Ziangyang Yang; 12. Optical pattern recognition with microlasers Eung-Gi Paek; 13. Optical properties and applications of bacteriorhodopsin Q. Wang Song and Yu-He Zhang; 14. Liquid-crystal spatial light modulators Aris Tanone and Suganda Jutamulia; 15. Representations of fully complex functions on real-time spatial light modulators Robert W. Cohn and Laurence G. Hassbrook; Index.
China marks World Population Day. Address by Zhang Weiqing: (Excerpts).
Zhang, W
1998-08-01
This is a summary of remarks by Minister Zhang Weiqing of China's State Family Planning Commission (SFPC) given on World Population Day in China. The world's population size has increased by 1 billion since 1987, and will reach 6 billion by 1999. As the most populous developing country in the world, China has a greater population pressure and bears a large responsibility regarding stabilization of the world's population and realization of sustainable development. China has a less developed economy and a high percentage of rural and illiterate persons, many of whom are below the poverty line. The interests of both present and future generations must be taken into account with regard to development. In addition, the modernization drive must include strategies for sustainable development and basic national policies of FP and environmental protection in order to achieve a balance among population growth, the economy, resources, and the environment. After 30 years of effort, China has succeeded in solving its population problem by integrating governmental guidance with voluntary public participation in FP. In 1997, the birthrate decreased to 16.57/1000, and the total fertility rate was below replacement level. Changes in attitude toward marriage and childbearing have occurred, as has awareness of voluntary participation in FP. However, some problems have emerged in the implementation of population and FP programs. China will carry out its programs strictly and effectively while developing the national economy. Goals include: 1) stressing the IEC program regarding contraception and regular FP management and services; 2) integrating the FP program with economic development; 3) helping the public to become well off; 4) protecting maternal and child health; 5) improving the status of women; 6) delivering reproductive services; and 7) improving social security measures. Efforts will be made to enable the public to have a more active part in implementing the FP program.
Sutter, B.; Ming, D. W.; Clearfield, A.; Hossner, L. R.
2003-01-01
The National Aeronautics and Space Administration's (NASA) Advanced Life Support (ALS) Program is evaluating the use of Fe-, Mn-, and Cu-containing synthetic hydroxyapatite (SHA) as a slow release fertilizer for crops that might be grown on the International Space Station or at Lunar and Martian outposts. Separate Fe-, Mn-, and Cu-containing SHA materials along with a transition-metal free SHA (pure-SHA) were synthesized using a precipitation method. Chemical and mineralogical analyses determined if and how Fe, Mn, and Cu were incorporated into the SHA structure. X-ray diffraction (XRD), Rietveld refinement, and transmission electron microscopy (TEM) confirmed that SHA materials with the apatite structure were produced. Chemical analyses indicated that the metal containing SHA materials were deficient in Ca relative to pure-SHA. The shift in the infrared PO4-mu 3 vibrations, smaller unit cell parameters, smaller particle size, and greater structural strain for Fe-, Mn-, and Cu-containing SHA compared with pure-SHA suggested that Fe, Mn, and Cu were incorporated into SHA structure. Rietveld analyses revealed that Fe, Mn, and Cu substituted into the Ca2 site of SHA. An Fe-rich phase was detected by TEM analyses and backscattered electron microscopy in the Fe-containing SHA material with the greatest Fe content. The substitution of metals into SHA suggests that metal-SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P.
Zhao, H; Zhang, H W; Zhang, T; Gu, X M
2016-10-07
The retracted article is: Zhao H, Zhang HW, Zhang T and Gu XM (2016). Tumor necrosis factor alpha gene -308G>A polymorphism association with the risk of esophageal cancer in a Han Chinese population. Genet. Mol. Res. 15: gmr.15025866. Two major concerns were found in this article. Firstly, it was found to be substantially equal to the article "Tumor necrosis factor-alpha gene -308G > A polymorphism alters the risk of hepatocellular carcinoma in a Han Chinese population" published in the Diagnostic Pathology Diagnostic Pathology (2014) 9: 199, by Feng et al.; licensee BioMed Central. 2014 - DOI: 10.1186/s13000-014-0199-3. Secondly, the authors do not discuss limitations of their approaches in the discussion. The discussion is largely an elaboration of the literature in the introduction part. However, even in that context, the discussion does not appropriately review the literature and there are frequent references to conclusions that are not supported by the cited literature. The GMR editorial staff was alerted and after a thorough investigation, there is strong reason to believe that the peer review process was failure. Also, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract this article in accordance with the recommendations of the Committee on Publication Ethics (COPE). The authors and their institutions were advised of this serious breach of ethics.
Xu, Jing-Yuan; Zhu, Yan; Yi, Ze; Wu, Gang; Xie, Guo-Yong; Qin, Min-Jian
2018-01-01
"Wu zhu yu", which is obtained from the dried unripe fruits of Tetradium ruticarpum (A. Jussieu) T. G. Hartley, has been used as a traditional Chinese medicine for treatment of headaches, abdominal colic, and hypertension for thousands of years. The present study was designed to assess the molecular genetic diversity among 25 collected accessions of T. ruticarpum (Wu zhu yu in Chinese) from different areas of China, based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers. Thirteen ISSR primers generated 151 amplification bands, of which 130 were polymorphic. Out of 165 bands that were amplified using 10 iPBS primers, 152 were polymorphic. The iPBS markers displayed a higher proportion of polymorphic loci (PPL = 92.5%) than the ISSR markers (PPL = 84.9%). The results showed that T. ruticarpum possessed high loci polymorphism and genetic differentiation occurred in this plant. The combined data of iPBS and ISSR markers scored on 25 accessions produced five clusters that approximately matched the geographic distribution of the species. The results indicated that both iPBS and ISSR markers were reliable and effective tools for analyzing the genetic diversity in T. ruticarpum. Copyright © 2018 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Zhang W
2016-11-01
Full Text Available Wen Zhang,1 Ruizhen Zhao,1 Xiaoli Li,1 Xia Cui,1 Zijun Zhao,1 Yingqiu Mao,2 Fengzhi Wu,3 Qisheng Tang1 1Department of Encephalopathy, The Third Affiliated Hospital, 2Center of Scientific Research, 3Center of Journals, Beijing University of Chinese Medicine, Chaoyang District, Beijing, People’s Republic of China Background: The Yi-nao-jie-yu decoction (YNJYD is a herbal preparation widely used in the clinics of traditional Chinese medicine and has been recently used as an important new therapeutic agent in poststroke anxiety (PSA. The neuroendocrine–immune system plays an important role in PSA mechanisms, although the modulating effects of YNJYD remain unknown. This study investigated the potential effects of YNJYD on the neuroendocrine–immune system in a rat model of PSA.Materials and methods: The PSA model was induced by injecting collagenase (type VII into the right globus pallidus, accompanied by empty water bottle stimulation for 2 weeks. The sham group and the PSA model group were gavaged with saline, while the treatment groups received buspirone (BuSpar or YNJYD. Behavior was evaluated with the open field test and elevated plus maze once a week. Pathological changes were observed by hematoxylin and eosin staining. Serum levels of tumor necrosis factor, interleukin (IL-6, adrenocorticotropic hormone, thyroid stimulating hormone, free triiodothyronine, free thyroxine, IL-1α, and cortisol were detected by radioimmunoassay. Expression of the γ-aminobutyric acid type A receptor (GABAAR α2 subunit was examined by Western blot and real-time polymerase chain reaction.Results: YNJYD-treated rats exhibited significantly better recovery than BuSpar-treated rats at 21 days and 28 days in the open field test and elevated plus maze. Hematoxylin and eosin staining revealed neural repair in the hippocampus in the treatment groups. Serum levels of IL-1α in the YNJYD group were significantly less than those in the model group and the Bu
Choi, Deung-Jang; Fernández, Carlos García; Herrera, Edwin; Rubio-Verdú, Carmen; Ugeda, Miguel M.; Guillamón, Isabel; Suderow, Hermann; Pascual, José Ignacio; Lorente, Nicolás
2018-04-01
We show that the magnetic ordering of coupled atomic dimers on a superconductor is revealed by their intragap spectral features. Chromium atoms on the superconductor β -Bi2Pd surface display Yu-Shiba-Rusinov bound states, detected as pairs of intragap excitations in tunneling spectra. By means of atomic manipulation with a scanning tunneling microscope's tip, we form Cr dimers with different arrangements and find that their intragap features appear either shifted or split with respect to single atoms. These spectral variations are associated with the magnetic coupling, ferromagnetic or antiferromagnetic, of the dimer, as confirmed by density functional theory simulations. The striking qualitative differences between the observed tunneling spectra prove that intragap Shiba states are extremely sensitive to the magnetic ordering on the atomic scale.
Height distribution tails in the Kardar-Parisi-Zhang equation with Brownian initial conditions
Meerson, Baruch; Schmidt, Johannes
2017-10-01
For stationary interface growth, governed by the Kardar-Parisi-Zhang (KPZ) equation in 1 + 1 dimensions, typical fluctuations of the interface height at long times are described by the Baik-Rains distribution. Recently Chhita et al (2016 arXiv:1611.06690) used the totally asymmetric simple exclusion process (TASEP) to study the height fluctuations in systems of the KPZ universality class for Brownian interfaces with arbitrary diffusion constant. They showed that there is a one-parameter family of long-time distributions, parameterized by the diffusion constant of the initial random height profile. They also computed these distributions numerically by using Monte Carlo (MC) simulations. Here we address this problem analytically and focus on the distribution tails at short times. We determine the (stretched exponential) tails of the height distribution by applying the optimal fluctuation method (OFM) to the KPZ equation. We argue that, by analogy with other initial conditions, the ‘slow’ tail holds at arbitrary times and therefore provides a proper asymptotic to the family of long-time distributions studied in Chhita et al (2016 arXiv:1611.06690). We verify this hypothesis by performing large-scale MC simulations of a TASEP with a parallel-update rule. The ‘fast’ tail, predicted by the OFM, is also expected to hold at arbitrary times, at sufficiently large heights.
Baicalein improves behavioral dysfunction induced by Alzheimer’s disease in rats
Directory of Open Access Journals (Sweden)
Zhou L
2016-12-01
Full Text Available Li Zhou, Sha Tan, Yi-long Shan, Yu-ge Wang, Wei Cai, Xue-hong Huang, Xi-yuan Liao, Hai-yan Li, Lei Zhang, Bing-jun Zhang, Zheng-qi Lu Department of Neurology, The Third Affiliated Hospital of Sun Yat-sen University, Guangzhou, Guangdong, People’s Republic of China Background: Alzheimer’s disease (AD is considered to be a neurodegenerative disorder that is characterized by increased oxidative stress. Medicinal plants, with their antioxidant properties, have been used to cure several human diseases. The aim of the current study was to explore the protective and therapeutic effect of baicalein on AD-induced rats. Materials and methods: Swiss Wistar rats were used in the study. The rats were divided into five groups. Group I: normal control group treated with water; Group II: disease control treated with AlCl3 to induce the mimicking AD for 4 successive weeks (SW; Group III: normal control group treated with baicalein (5 mg/kg for 2 SW followed by combination of baicalein and AlCl3 for 4 SW; Group IV: normal control group treated with baicalein (10 mg/kg for 2 SW followed by combination of baicalein and AlCl3 for 4 SW; Group V: normal control group treated with rivastigmine (0.3 mg/kg for 2 SW followed by combination of rivastigmine and AlCl3 for 4 SW. Moreover, the therapeutic groups are as follows: Group VI: AD disease control treated with AlCl3 for 4 SW and serving as the therapeutic positive group; Group VII: AD disease control + baicalein (5 mg/kg for 12 SW; Group VIII: AD disease control + baicalein (10 mg/kg for 12 SW; Group IX: AD disease control + rivastigmine (0.3 mg/kg for 12 SW. Behavioral test, T-maze, and rotarod test were also performed before and after the treatment. At the end of the experimental study, all the rats were sacrificed and their brains were removed and divided into two portions. The first portion was homogenated for estimating the level of acetylcholinesterase (AchE and acetylcholine (Ach. Another portion was used
Maps of Relocation and Poems of Tang Dynasty Poets: Li Bai, Du Fu, and Han Yu
Directory of Open Access Journals (Sweden)
羅鳳珠、白璧玲、廖泫銘、范毅軍 、鄭錦全 Feng-Ju Lo,Pi-Ling Pai,Hsiung-Ming Liao,I-Chun Fan,Chin-Chuan Cheng
2014-04-01
Full Text Available Geographic environments affect literary contents and genre and thus, since ancient times, geographical area has been used to classify Chinese literature. In 1936 Liang Qichao was keenly aware of the relationship between literature and geography and brought up the idea of “literarygeography”. In 1979 Professor Chen Zhengxiang produced maps of birthplaces of Tang and Song poets to show the shift of Chinese cultural center from north to south. Furthermore, in the pastdecade, the attention to research in literary geography and geographical distribution of writersgradually increased. However, most studies focused on geographical distribution of birthplaces of writers and very few focused on the relationship between poets’ journey and the contents of their writings and their geographic environment. Meanwhile, geographic information system and aerialphotography have developed quickly and have become useful tools for the study of literary geography.Since then, the academic circles in Taiwan have built a solid foundation in this area. While Li Baiand Du Fu were called poetic immortal and poetic sage of the middle and end periods of the heydayof Tang Dynasty, respectively, Han Yu advocated the classical Chinese movement and becameone of the eight great authors of Tang and Song dynasties. Han Yu was also the best representative of Middle Tang poets. While the styles of these three poets differed from each other, they held key positions in the development and evolution of Tang poetry. Their footprints spread all over the countryand greatly affected later developments and contemporary of poetry. This project makes use of the digital Tang Dynasty maps by Tan Qixiang, Tang Dynasty transportation route maps by Yan Gengwang,aerial maps, the All Tang Poems, and chronicles of the poets to build the three poets’ relocation maps and study their poetic literature, language, geography, and interactions with others, in hopesof opening a new research direction
Institute of Scientific and Technical Information of China (English)
Wang Xinde
2000-01-01
@@In 1921, the first independent department of neurology was established in Beijing. Before 1949, all over China only 12 professional doctors lectured neurology in medical colleges. Only 30 medically trained personnel were engaged in the neurological departments. The neurological departments contained roughly 200 beds. The thesis on stroke was written by Zhang Shanlei and published in 1922. Author discussed the cerebral stroke on basis of Chinese traditional medicine and European medicine. The first Textbook of Neurology in China was written by Professor Cheng Yu-lin and was published in 1939. In 1952, the Chinese Society of Neurology and Psychiatry of Chinese Medical Association was established. In 1955, the first issue of the Chinese Journal of Neurology and Psychiatry was published.
Directory of Open Access Journals (Sweden)
Xie LG
2015-12-01
Full Text Available Linguo Xie,1,2,* Yan Sun,2,* Tao Chen,1,2,* Dawei Tian,1,2 Yujuan Li,3 Yu Zhang,1,2 Na Ding,2 Zhonghua Shen,1,2 Hao Xu,1,2 Xuewu Nian,4 Nan Sha,1,2 Ruifa Han,1,2 Hailong Hu,1,2 Changli Wu1,2 Objective: Human murine double minute 2 protein (MDM2 is mainly a negative regulator of p53 tumor suppressor pathway. We aimed to investigate the association between MDM2 SNP309 polymorphism and bladder cancer risk. Methods: A total of 535 bladder cancer patients and 649 health controls were recruited for our study. MDM2 SNP309 T>G polymorphism was genotyped by polymerase chain reaction-ligase detection reaction method. Logistic regression was used to analyze the relationship between the genotype and susceptibility of bladder cancer. Kaplan–Meier estimates and log-rank test were obtained to analyze the association between the genotype and risk of recrudesce in nonmuscle-invasive bladder cancer patients. A multivariable Cox proportional hazards model was fitted to identify independent prognostic factors. To further investigate the association, we conducted a meta-analysis including six studies. Results: The frequency of the MDM2 SNP309 T>G polymorphism showed no significant difference between cases and controls (all P>0.05. In the stratification analysis, the results showed that G allele carriers were prone to have a significant decrease in risk of low-grade bladder cancer (adjusted odds ratio: 0.613, 95% confidence interval: 0.427–0.881, and G variant was associated with a significantly reduced risk of recurrence in nonmuscle-invasive bladder cancer patients with or without chemotherapy (P<0.05. The results of the meta-analysis showed that G allele and GG genotype of MDM2 SNP309 polymorphism were significantly associated with increased risk of bladder cancer in Caucasians (both P<0.05, and no association was observed in total populations and Asians (P>0.05. Conclusion: MDM2 SNP309 T>G polymorphism has no influence on bladder cancer risk in Asians, but
International Nuclear Information System (INIS)
Kuklin, A.I.; Rogov, A.D.; Gorshkova, Yu.E.; Kovalev, Yu.S.; Kutuzov, S.A.; Utrobin, P.K.; Rogachev, A.V.; Ivan'kov, O.I.; Solov'ev, D.V.; Gordelij, V.I.
2011-01-01
Results of experimental and computer modeling investigations of neutron spectra and fluxes obtained with cold and thermal moderators at the IBR-2 reactor (JINR, Dubna) are presented. The studies are done for small-angle neutron scattering (SANS) spectrometer YuMO (beamline number 4 of the IBR-2). The measurements of neutron spectra for two methane cold moderators are done for the standard configuration of the SANS instrument. The data from both moderators under different conditions of their operation are compared. The ratio of experimentally determined neutron fluxes of cold and thermal moderators at different wavelength is shown. Monte Carlo simulations are done to determine spectra for cold methane and thermal moderators. The results of the calculations of the ratio of neutron fluxes of cold and thermal moderators at different wavelength are demonstrated. In addition, the absorption of neutrons in the air gaps on the way from the moderator to the investigated sample is presented. SANS with the protein apoferritin was done in the case of cold methane as well as a thermal moderator and the data were compared. The perspectives for the use of the cold moderator for a SANS spectrometer at the IBR-2 are discussed. The advantages of the YuMO spectrometer with the thermal moderator with respect to the tested cold moderator are shown
Ito, Yasufumi; Takeuchi, Kazumasa A.
2018-04-01
We study height fluctuations of interfaces in the (1 +1 ) -dimensional Kardar-Parisi-Zhang (KPZ) class, growing at different speeds in the left half and the right half of space. Carrying out simulations of the discrete polynuclear growth model with two different growth rates, combined with the standard setting for the droplet, flat, and stationary geometries, we find that the fluctuation properties at and near the boundary are described by the KPZ half-space problem developed in the theoretical literature. In particular, in the droplet case, the distribution at the boundary is given by the largest-eigenvalue distribution of random matrices in the Gaussian symplectic ensemble, often called the GSE Tracy-Widom distribution. We also characterize crossover from the full-space statistics to the half-space one, which arises when the difference between the two growth speeds is small.
Duan, Peizhen; Shen, Juan; Zou, Guohong; Xia, Xu; Jin, Bo; Yu, Jiaxin
2018-04-10
Spherical porous hydroxyapatite (SHA)/graphene oxide (GO) composites with different GO (w/w) content of 16%, 40%, and 71% have been fabricated through a facile and controllable ultrasonic-assisted method at room temperature. The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization. Results showed SHA were covered by GO, and SHA/GO composites had an irregular surface with different degrees of wrinkles. The elastic modulus and hardness of SHA/GO-3 composites were up to 12.45 ± 0.33 GPa and 686.67 ± 26.95 MPa, which indicated that the contents of GO had an effect on SHA/GO composites. And the mechanical properties of SHA/GO-2 composites were similar to SHA particles. The biomimetic mineralization in SBF solution showed the bone-like apatite layer on composites surface, which demonstrated that the SHA/GO materials had osseointegration property. Moreover, in vitro cytocompatibility of SHA/GO-2 composites and pure GO were evaluated by cell adhesion and proliferation tests using MC3T3-E1 cells, which demonstrated that the SHA/GO composites can act as a good template for the cells growth and adhesion. These results suggested that the SHA/GO composites will be a promising material for biomedical application.
Directory of Open Access Journals (Sweden)
Insung Jung
2004-08-01
Full Text Available The Internet, high-speed electronic communications, and computers have transformed the way we teach and learn. With the development of these new information and communication technologies, the idea of online education has been adopted in many developed, and more recently in developing countries, to bring wider opportunities to people in the form of increased access to flexible and interactive, open and distance learning systems. As stated in the Introduction of “Advancing Online Learning in Asia” edited by Murphy, Shin, and Zhang, online education is now everywhere and it “is changing the ways in which educational institutions interact with their students, for both traditional and distance education universities.” By examining recent developments of online education in Asia from multiple perspectives, this book has a potential to be an invaluable resource to educators. Taking cases from the Asian region in which online learning was introduced, implemented, and experienced, this book presents the cases from a number of perspectives, especially from student perspectives, and addresses pedagogical and technical issues faced by online educators. The breadth of the articles in this book provides a wide range of online learning cases and varied perspectives, which should clearly appeal to educators, researchers, administrators, and policy makers in online education.
Directory of Open Access Journals (Sweden)
Li B
2014-10-01
Full Text Available Bo Li,1,2 Xiao-Yong Zhang,1 Jian-Zhong Yang,1 Yu-Jie Zhang,1 Wen-Xin Li,1 Chun-Hai Fan,1 Qing Huang1 1Laboratory of Physical Biology, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai, 2Department of Human Anatomy, College of Basic Medical Sciences, Jilin University, Changchun, People’s Republic of China Abstract: In this study, we assessed the in vivo behavior and toxicology of nanoscale graphene oxide (NGO in mice after intravenous injection. The influence of a polyethylene glycol (PEG coating on the distribution and toxicity of the NGO was also investigated. The results show that NGO is mainly retained in the liver, lung, and spleen. Retention in the lung is partially due to NGO aggregation. The PEG coating reduces the retention of NGO in the liver, lung, and spleen and promotes the clearance of NGO from these organs, but NGO and NGO-PEG are still present after 3 months. The PEG coating effectively reduces the early weight loss caused by NGO and alleviates NGO-induced acute tissue injuries, which can include damage to the liver, lung, and kidney, and chronic hepatic and lung fibrosis. Keywords: graphene oxide, biodistribution, toxicity, polyethylene glycol
Final report for LDRD Project 93633 : new hash function for data protection.
Energy Technology Data Exchange (ETDEWEB)
Draelos, Timothy John; Dautenhahn, Nathan; Schroeppel, Richard Crabtree; Tolk, Keith Michael; Orman, Hilarie (PurpleStreak, Inc.); Walker, Andrea Mae; Malone, Sean; Lee, Eric; Neumann, William Douglas; Cordwell, William R.; Torgerson, Mark Dolan; Anderson, Eric; Lanzone, Andrew J.; Collins, Michael Joseph; McDonald, Timothy Scott; Caskey, Susan Adele
2009-03-01
The security of the widely-used cryptographic hash function SHA1 has been impugned. We have developed two replacement hash functions. The first, SHA1X, is a drop-in replacement for SHA1. The second, SANDstorm, has been submitted as a candidate to the NIST-sponsored SHA3 Hash Function competition.
Gräske, Johannes; Fischer, Thomas; Kuhlmey, Adelheid; Wolf-Ostermann, Karin
2012-01-01
Shared-housing arrangements (SHA) in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia. To evaluate the impact of SHA on the quality of life (QoL) of residents, an appropriate setting- and dementia-specific QoL instrument is needed. This article aims to identify QoL instruments that relate to the core domains of SHA. After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA. None of the existing instruments was identified as having been developed for SHA. Matching of the instrument domains with the SHA core domains leads to the conclusion that Quality of Life-Alzheimer's Disease, Dementia Quality of Life, Alzheimer Disease-Related Quality of Life, and QUALIDEM are adequate instruments for measuring the dementia-specific QoL of persons living in SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA. The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust (e.g., reliability and validity) will further elucidation of the appropriateness of the instruments for SHA. Copyright © 2012 Mosby, Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Etzkorn, Markus; Eltschka, Matthias; Jaeck, Berthold; Topp, Andreas; Ast, Christian R. [Max-Planck-Institute for Solid State Research, 70569 Stuttgart (Germany); Kern, Klaus [Max-Planck-Institute for Solid State Research, 70569 Stuttgart (Germany); Ecole Polytechnique Federale de Lausanne, 1015 Lausanne (Switzerland)
2016-07-01
The interaction of a local magnetic impurity with a superconductor causes the formation of Yu-Shiba-Rusinov (YSR)states in the vicinity of the impurity. These have recently received increasing attention in the context of Majorana Fermions and other exotic states that might be created from the mutual interplay. YSR states have been extensively studied by scanning tunneling microscopy and so far have been discussed mainly in the limit of point scattering impurities. Here we present our investigations of the local properties of single magnetic Copper-Phthalocynane molecules on the (5x1) reconstructed, superconducting V(100) surface measured at 15 mK temperature. We find very intense YSR states with energies that depend on the precise absorbtion geometry of the molecule. At the same time we find no indication of a local suppression of the superconducting gap around the impurity. We follow the state evolution in real space for about 3 nm corresponding to about three orders of magnitude in spectral intensity. The spectra display rich structure with local variations in the electron-hole asymmetries. The observed intensity changes in the spectra can not be described on the basis of a single point like scattering potential.
D.V. Nefedov
2016-01-01
This book is a study at the intersection of such academic disciplines as general history, history of state and law and source study. The subcect of R.Yu. Pochevalev’s book appears very relevant since the interest of the scientific community and readership toward the Golden Horde and its role in the history of the Russian state remains traditionally high for several centuries. However, the author is trying to take a fresh look at this state and refute the stereotype of the Golden Horde as a...
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
This data book summarized the proceedings and the technical report of the management committee on the Japan-China geological structure survey based on the consultation concluded between NEDO and China's bureau of coal field geology and a report meeting on the Yu Xian project. In the exploration, conducted were the boring survey of 10 boreholes, seismic survey of 2D (71 traverse lines, 180.105km) and 3D (1.5km{sup 2}), VSP (6 holes (345 shots)) and the low velocity band survey (2,072 shots). The geological structure of the area presented the syncline structure with a gentle line associated with foldings and a number of faults and was classified into the medium class or the class of a little complication in the Chinese standard. The number of the faults confirmed in this exploration totaled 57. Coal reserves by coal seam were 157.22 million tons at No. 5 seam and 102.57 million tons at No. 1 seam. The total amount of the two seams was 79.1% of the total coal amount in all area. The coal quality of Nos. 1 and 5 was brown coal - flame coal in the Chinese classification, and subbituminous coal B - subbituminous coal C in the ASTM classification. The coal, however, cannot be used for process raw coal. There is a technical potentiality of the fixed bed pressurized gasification. (NEDO)
Seniors' experiences of living in special housing accommodation
Hellberg, Ingela; Augustsson, Veronica; Hellström Muhli, Ulla
2011-01-01
This article presents a hermeneutic phenomenological analysis of interview material in which 12 seniors living in Special Housing Accommodation (SHA) facilities reflect on the experience of living in such facilities. Of particular interest in the analysis is living in a SHA as a phenomenon. The finding shows that the phenomenon of lived experience in a SHA seems to be a state of ambiguity regarding one's existence, which is made up of several constituents (elements of meaning). The analysis contributes to the understanding of how the phenomenon of SHA living is coming into existence as a need, due to an individual's failing health; however, the SHA is not considered to be a true home. Accordingly, this has consequences to the subject position for the seniors in that they have to navigate between existing and not existing. The seniors learn to cope with living in the SHA by lowering their expectations of life and existence while the SHA provides the prerequisites for their existence. An implication for promoting care is to support the seniors to enable a full existence of life within SHA living. PMID:21412446
Implementation of 4-way Superscalar Hash MIPS Processor Using FPGA
Sahib Omran, Safaa; Fouad Jumma, Laith
2018-05-01
Due to the quick advancements in the personal communications systems and wireless communications, giving data security has turned into a more essential subject. This security idea turns into a more confounded subject when next-generation system requirements and constant calculation speed are considered in real-time. Hash functions are among the most essential cryptographic primitives and utilized as a part of the many fields of signature authentication and communication integrity. These functions are utilized to acquire a settled size unique fingerprint or hash value of an arbitrary length of message. In this paper, Secure Hash Algorithms (SHA) of types SHA-1, SHA-2 (SHA-224, SHA-256) and SHA-3 (BLAKE) are implemented on Field-Programmable Gate Array (FPGA) in a processor structure. The design is described and implemented using a hardware description language, namely VHSIC “Very High Speed Integrated Circuit” Hardware Description Language (VHDL). Since the logical operation of the hash types of (SHA-1, SHA-224, SHA-256 and SHA-3) are 32-bits, so a Superscalar Hash Microprocessor without Interlocked Pipelines (MIPS) processor are designed with only few instructions that were required in invoking the desired Hash algorithms, when the four types of hash algorithms executed sequentially using the designed processor, the total time required equal to approximately 342 us, with a throughput of 4.8 Mbps while the required to execute the same four hash algorithms using the designed four-way superscalar is reduced to 237 us with improved the throughput to 5.1 Mbps.
Directory of Open Access Journals (Sweden)
Liu Z
2016-05-01
Full Text Available Zhiguo Liu,1,* Shufang Yu,1,* Di Chen,1 Guoliang Shen,1 Yu Wang,1 Leping Hou,2 Dan Lin,1 Jinsan Zhang,1 Faqing Ye1 1School of Pharmaceutical Sciences, Wenzhou Medical University, Wenzhou, 2Second Affiliated Hospital of Zhejiang University School of Medicine, Hangzhou, People’s Republic of China *These authors contributed equally to this work Abstract: FGFR1 is well known as a molecular target in anticancer drug design. TKI258 plays an important role in RTK inhibitors. Utilizing TKI258 as a lead compound that contains a quinazolinone nucleus, we synthesized four series of 3-vinyl-quinoxalin-2(1H-one derivatives, a total of 27 compounds. We further evaluated these compounds for FGFR1 inhibition ability as well as cytotoxicity against four cancer cell lines (H460, B16-F10, Hela229, and Hct116 in vitro. Some compounds displayed good-to-excellent potency against the four tested cancer cell lines compared with TKI258. Structure–activity relationship analyses indicated that small substituents at the side chain of the 3-vinyl-quinoxalin-2(1H-one were more effective than large substituents. Lastly, we used molecular docking to obtain further insight into the interactions between the compounds and FGFR1. Keywords: FGFR1, synthesis, quinoxaline, antitumor activity, kinase inhibitor
Hao Weng, Chung; Yeh, Chao Hsien
2017-04-01
The rivers in Taiwan have the characteristic of large slope gradient and fast flow velocity caused by rugged terrain. And Taiwan often aces many typhoons which will bring large rainfall in the summer. In early Taiwan, river management was more focus on flood control, flood protection and disaster reduction. In recent years, the rise of ecological conservation awareness for the precious fish species brings spotlight on the Taiwan salmon (Oncorhynchus masou formosanus) which lives in the river section of this study. In order to make sure ecological corridor continuing, dam removal is the frequently discussed measure in recent years and its impact on environmental is also highly concerned. Since the dam removal may causes severe changes to the river channel, the action of dam removal needs careful evaluation. As one of the endangered species, Taiwan salmon is considered a national treasure of Taiwan and it was originally an offshore migration of the Pacific salmon. After the ice age and geographical isolation, it becomes as an unique subspecies of Taiwan and evolved into landlocked salmon. Now the Taiwan salmon habitats only exists in few upstream creeks and the total number of wild Taiwan salmon in 2015 was about 4,300. In order to expand the connectivity of the fish habitats in Chi-Jia-Wan creek basin, several dam removal projects had completed with good results. Therefore, this paper focuses on the dam removal of Yu-Sheng creek dam. In this paper, a digital elevation model (DEM) of about 1 kilometer channel of the Yu-Sheng creek dam is obtained by unmanned aerial vehicle (UAV). Using CCHE2D model, the simulation of dam removal will reveal the impact on channel morphology. After model parameter identification and verification, this study simulated the scenarios of three historical typhoon events with recurrence interval of two years, fifteen years, and three decades under four different patterns of dam removal to identify the the head erosion, flow pattern, and
Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary].
2013-02-01
The Maryland State Highway Administration (SHA) has a commitment to : maintaining at least 84 percent of the SHA pavement network in : acceptable overall condition. The SHA also intends to increase the use of : recycled materials and to use products ...
论张洁小说女性三种形态的身体%On the Three Forms of Female Body in Zhang Jie’s Novels
Institute of Scientific and Technical Information of China (English)
黄晓娟; 邱慧婷
2016-01-01
Zhang Jie,the only female writer having been twice awarded the Mao Dun Literature Awards, has been focusing on the destiny of female character and broadening the way of portraying females. Different forms of female body presented in her novel represented her reflection on female destiny and patriarchal culture in different dimensions.Her exploring,constructing and pursuing of the ideal female personality can be found in her analysis of different forms of female body such as the feminized body,the suffering body and the masculinized body,which can also be contributed to the understanding of Zhang Jie’s literary world and her reflections on the harmony between the sexes.%张洁是中国文坛唯一两次获得“茅盾文学奖”的女作家,一直致力于女性命运的关照和女性写作视野的开拓。她小说中的女性呈现出不同的身体形态,代表着作者对女性命运和男权文化不同维度的思考。通过雌化的身体、承受的身体和雄化的身体等不同形态身体的探析,可以发现张洁对理想女性人格积极探寻和建构追求的过程,有助于深入认知张洁的文学世界及其对两性和谐的思考。
Directory of Open Access Journals (Sweden)
Shi J
2013-07-01
Full Text Available Jinjin Shi,* Rourou Ma,* Lei Wang, Jing Zhang, Ruiyuan Liu, Lulu Li, Yan Liu, Lin Hou, Xiaoyuan Yu, Jun Gao, Zhenzhong Zhang School of Pharmaceutical Sciences, Zhengzhou University, Zhengzhou, Henan, People's Republic of China*These authors contributed equally to this workAbstract: Carbon nanotubes (CNTs have shown great potential in both photothermal therapy and drug delivery. In this study, a CNT derivative, hyaluronic acid-derivatized CNTs (HA-CNTs with high aqueous solubility, neutral pH, and tumor-targeting activity, were synthesized and characterized, and then a new photodynamic therapy agent, hematoporphyrin monomethyl ether (HMME, was adsorbed onto the functionalized CNTs to develop HMME-HA-CNTs. Tumor growth inhibition was investigated both in vivo and in vitro by a combination of photothermal therapy and photodynamic therapy using HMME-HA-CNTs. The ability of HMME-HA-CNT nanoparticles to combine local specific photodynamic therapy with external near-infrared photothermal therapy significantly improved the therapeutic efficacy of cancer treatment. Compared with photodynamic therapy or photothermal therapy alone, the combined treatment demonstrated a synergistic effect, resulting in higher therapeutic efficacy without obvious toxic effects to normal organs. Overall, it was demonstrated that HMME-HA-CNTs could be successfully applied to photodynamic therapy and photothermal therapy simultaneously in future tumor therapy.Keywords: photodynamic therapy, photothermal therapy, HA-derivatized carbon nanotubes, tumor targeting, synergistic effect, hematoporphyrin monomethyl ether
Synthesis of 125 I - Salicyl Hydroxamic Acid for Urinary Bladder Imaging
International Nuclear Information System (INIS)
Ibrahim, I.T.; Abou EL Zahab, M.; Hamed, M.
2015-01-01
Salicylhydroxamic acid is a salicylate derivative. Radiolabeling of Salicyl hydroxamic acid ( SHA ) with iodine-125 may have considerable interest for imaging of urinary bladder. This study is aimed to optimize the radiolabeling yield of Salicyl hydroxamic with radio iodine (125-123) using chloramine - T (CAT) as an oxidizing agent with respect to factors that affect the reaction conditions such as SHA amount, CAT amount, reaction time and ph of the reaction mixture. In - vitro stability of the radiolabeled complex was checked and it was found to be stable for up to 24 h. 125 I-SHA was injected via intravenous administration routes into normal male Sprague – Dawley rats. Bio - distribution studies have revealed that 125 I-SHA was excreted in urine with extent that it could give a clear image for urinary bladder especially if the bladder it tightly closed. The amount of 125 I - Salicyl hydroxamic excreted was increased in case of giving potassium bicarbonate to rat before injection of 125 I-SHA. The result of biodistribution study of 125 I - SHA in experimental animal suggest ed the possibility of using 123 I-SHA to image the urinary bladder
Maximum of an Airy process plus Brownian motion and memory in Kardar-Parisi-Zhang growth
Le Doussal, Pierre
2017-12-01
We obtain several exact results for universal distributions involving the maximum of the Airy2 process minus a parabola and plus a Brownian motion, with applications to the one-dimensional Kardar-Parisi-Zhang (KPZ) stochastic growth universality class. This allows one to obtain (i) the universal limit, for large time separation, of the two-time height correlation for droplet initial conditions, e.g., C∞=limt2/t1→+∞h(t1) h (t2)¯c/h(t1)2¯c, with C∞≈0.623 , as well as conditional moments, which quantify ergodicity breaking in the time evolution; (ii) in the same limit, the distribution of the midpoint position x (t1) of a directed polymer of length t2; and (iii) the height distribution in stationary KPZ with a step. These results are derived from the replica Bethe ansatz for the KPZ continuum equation, with a "decoupling assumption" in the large time limit. They agree and confirm, whenever they can be compared, with (i) our recent tail results for two-time KPZ with the work by de Nardis and Le Doussal [J. Stat. Mech. (2017) 053212, 10.1088/1742-5468/aa6bce], checked in experiments with the work by Takeuchi and co-workers [De Nardis et al., Phys. Rev. Lett. 118, 125701 (2017), 10.1103/PhysRevLett.118.125701] and (ii) a recent result of Maes and Thiery [J. Stat. Phys. 168, 937 (2017), 10.1007/s10955-017-1839-2] on midpoint position.
Computació distribuïda sobre dispositius mòbils
Marugán Calles, Jose Carlos
2015-01-01
En aquest projecte, s'ha desenvolupat una plataforma que ajuda a la paral·lelització d’aplicacions utilitzant dispositius mòbils com a nodes o processadors. Per al seu desenvolupament, el projecte s'ha dividit en tres subprojectes (client, servidor i proveïdor). La plataforma de computació distribuïda i paral·lelització es compon dels subprojectes client i servidor. El subprojecte proveïdor s'ha desenvolupat per utilitzar la plataforma de computació distribuïda creada, i concretament, s'ha de...
Chen, Weiwei; Huang, Hao; Chen, Rong; Feng, Shangyuan; Yu, Yun; Lin, Duo; Lin, Jia
2014-11-01
This study aimed to assess, through surface-enhanced Raman scattering (SERS) spectroscopy, the incorporation of calcium hydroxyapatite (CHA ~960 cm-1) and other biochemical substances in the repair of complete radial fractures in rabbits treated with or without Huo-Xue-Hua-Yu decoction (HXHYD) therapy. A total of 18 rabbits with complete radial fractures were randomly divided into two groups; one group was treated with HXHYD therapy and the other without therapy acted as a control. The animals were sacrificed at 15, 30 and 45 d after surgery. Specimens were routinely prepared for SERS measurement and high quality SERS spectra from a mixture of bone tissues and silver nanoparticles were obtained. The mineral-to-matrix ratios from the control and treated groups were calculated. Results showed that both deposition content of CHA measured by SERS spectroscopy and the mineral-to-matrix ratio in the treated group were always greater than those of the control group during the experiment, demonstrating that HXHYD therapy is effective in improving fracture healing and that SERS spectroscopy might be a novel tool to assess fracture healing.
Directory of Open Access Journals (Sweden)
Chen SL
2013-04-01
Full Text Available Shao-Liang Chen, Jian-Cheng Zhu, Xiao-Bo Li, Fei Ye, Jun-Jie Zhang, Zhi-Zhong Liu, Nai-Liang Tian, Song Lin, Cheng-Yu Lv Nanjing First Hospital, Nanjing Medical University, Nanjing, People's Republic of China Background: Stent grafting for treatment of type B aortic dissection has been extensively used. However, the difference in the long-term clinical outcome between patients with chronic versus acute type B aortic dissection remains unknown. This study aimed to analyze the difference in long-term clinical outcome after endovascular repair for patients with chronic (93% complete false-lumen thrombosis. Untreated tear and type I endoleak were predictors of clinical events during follow-up. Conclusion: Comparable long-term clinical results were achieved in patients with chronic or acute type B aortic dissection after implantation of a stent graft. Keywords: aortic dissection, endovascular repair, procedure-related events, propensity score matching
Using choice architecture to exploit a university Distinct Urban Mine.
Pierron, Xavier; Williams, Ian D; Shaw, Peter J; Cleaver, Victoria
2017-10-01
There are widespread concerns regarding the potential future scarcity of ferrous and non-ferrous materials. However, there are already potentially rich reserves of secondary materials via high ownership of Electrical and Electronic Equipment (EEE) in economically-developed nations. Young people are particularly high consumers of EEE, thus university students and campuses may present an opportunity to harness this potential. University Distinct Urban Mines (DUM) may be used to exemplify how potential reserves of secondary metals may be exploited, and could contribute to the transition from a linear to a circular economy. This study aimed to evaluate small household appliances (SHA) DUM from a UK university, with the objectives to identify and quantify student households' SHA ownership, WEEE recycling, stockpiling and discarding habits amongst student households, assess and evaluate the monetary potential of SHA DUM at UK level, and propose methods to exploit DUM for universities in the UK. To this purpose, a quantitative survey was undertaken to measure students' ownership and discarding behaviour with respect to SHA. The amounts of ferrous and non-ferrous materials were then estimated and converted to monetary values from secondary materials market data to appraise the SHA DUM overall value. Thirty-five per cent of SHA are discarded in the general refuse. Broken personal care appliances (PCA) tend to be discarded due to hygiene and small size factors. When in working order, SHA tend to be equally reused, recycled or stockpiled. We conclude that a total of 189 tonnes of ferrous and non-ferrous materials were available via discarding or being stockpiled at the University of Southampton. Extrapolated to UK higher education level, discarded and stockpiled SHA represent a potential worth ∼USD 11 million. To initiate DUM exploitation within Higher Education campuses, we suggest improving users' choice architecture by providing collection methods specific to broken SHA
Periprosthetic bone remodelling of short-stem total hip arthroplasty: a systematic review.
Yan, Shuang G; Weber, Patrick; Steinbrück, Arnd; Hua, Xingyi; Jansson, Volkmar; Schmidutz, Florian
2017-11-27
Short-stem hip arthroplasty (SHA) was designed to preserve bone stock and provide an improved load transfer. To gain more evidence regarding the load transfer, this review analysed the periprosthetic bone remodelling of SHA in comparison to standard hip arthroplasty (THA). PubMed and ScienceDirect were screened to extract dual-energy X-ray absorptiometry (DXA) studies evaluating the periprosthetic bone remodelling of SHA and two proven THA designs. From the studies included, the postoperative change in periprosthetic bone mineral density (BMD) after one year and the trend over two years was determined. Fifteen studies with four SHAs (CFP, Metha, Nanos, Fitmore) and two THAs (CLS and Bicontact) designs were included. All SHA and THA stems revealed an initial decrease at the calcar and major trochanter (Gruen 1 and 7) with the Metha, Nanos and Fitmore showing a smaller and more balanced remodelling compared to THA. The pattern after one year and the trend over two years argue for a methaphyseal anchorage of the Metha and Nanos, whereas the Fitmore and CFP seem to anchor metha-diaphyseal. Clearly different pattern of bone remodelling were observed between all four SHAs. Periprosthetic bone remodelling is also present in SHA, with the main bone reduction observed proximally. However, certain SHA stems show a more balanced remodelling compared to THA, arguing for a favourable load transfer. Also, the femoral length where bone remodelling occurs is clearly shorter in SHA. As distinctively different pattern between the SHA designs were observed, they should not be judged as a single implant group.
Directory of Open Access Journals (Sweden)
О. В. Полевщикова
2015-09-01
Full Text Available The professor of Novorossiysky (Odessa University I. Yu. Timchenko (1863-1939 managed to collect a remarkable library on the history of Mathematics which contained primarily antiquarian books including incunabula and 16th century editions. Various aspects of this valuabe book collection have been studied lately. Books from this dispersed collection have been revealed and examined de visu. Their cataloguing incudes the description of individual book copies in view of their provenance. The purpose of the article is to provide the information on a complex of owners’ recordings and dedicatory inscriptions as well as bookplates left on the books making an attempt to trace the fate of the copies incorporated in the library of the Odessa mathematician. The information collected is considered in the context of the history of Mathematics. Many may characterise both direct and indirect expressions of the readers’ interests in books and reading. The study of provenance records demonstrate that the copies acquired by professor Timchenko used to be in the libraries of a number of men of science – mathematicians, physicists, philologists, etc. The findings of this article enable to enlarge the database of provenance making the practical value and results of the research.
Modeling compositional dynamics based on GC and purine contents of protein-coding sequences
Zhang, Zhang
2010-11-08
Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.
Modeling compositional dynamics based on GC and purine contents of protein-coding sequences
Zhang, Zhang; Yu, Jun
2010-01-01
Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.
Directory of Open Access Journals (Sweden)
Yu D
2017-09-01
Full Text Available Dinglai Yu,1 Tingting Ye,1 Yukai Xiang,1 Zhehao Shi,1 Jie Zhang,1 Bin Lou,1 Fan Zhang,1 Bicheng Chen,1,2 Mengtao Zhou1 1Department of Surgery, The First Affiliated Hospital, Wenzhou Medical University, Wenzhou, Zhejiang Province, People’s Republic of China; 2Zhejiang Provincial Top Key Discipline in Surgery, Wenzhou Key Laboratory of Surgery, Wenzhou, Zhejiang Province, People’s Republic of China Abstract: Quercetin, a flavone, is multifaceted, having anti-oxidative, anti-inflammatory, and anticancer properties. In the present study, we explored the effects of quercetin on the epithelial–mesenchymal transition (EMT and invasion of pancreatic cancer cells and the underlying mechanisms. We noted that quercetin exerted pronounced inhibitory effects in PANC-1 and PATU-8988 cells. Moreover, quercetin inhibited EMT and decreased the secretion of matrix metalloproteinase (MMP. Meanwhile, we determined the activity of STAT3 after quercetin treatment. STAT3 phosphorylation decreased following treatment with quercetin. We also used activating agent of STAT3, IL-6, to induce an increase in cell malignancy and to observe the effects of treatment with quercetin. As expected, the EMT and MMP secretion increased with activation of the STAT3 signaling pathway, and quercetin reversed IL-6-induced EMT, invasion, and migration. Therefore, our results demonstrate that quercetin triggers inhibition of EMT, invasion, and metastasis by blocking the STAT3 signaling pathway, and thus, quercetin merits further investigation. Keywords: quercetin, EMT, MMPs, STAT3, pancreatic cancer
S1P transporter SPNS2 regulates proper postnatal retinal morphogenesis.
Fang, Chao; Bian, Ganlan; Ren, Pan; Xiang, Jie; Song, Jun; Yu, Caiyong; Zhang, Qian; Liu, Ling; Chen, Kun; Liu, Fangfang; Zhang, Kun; Wu, Chunfeng; Sun, Ruixia; Hu, Dan; Ju, Gong; Wang, Jian
2018-02-08
Spinster homolog 2 (SPNS2) is the membrane transporter of sphingosine-1-phosphate (S1P), and it participates in several physiologic processes by activating different S1P receptors (S1PRs). However, its functions in the nervous system remain largely unclear. We explored the important role of SPNS2 in the process of retinal morphogenesis using a spns2-deficient rat model. In the absence of the functional SPNS2 transporter, we observed progressively aggravating laminar disorganization of the epithelium at the postnatal stage of retinal development. Disrupted cell polarity, delayed cell-cycle exit of retinal progenitor cells, and insufficient migration of newborn neurons were proposed in this study as potential mechanisms accounting for this structural disorder. In addition, we analyzed the expression profiles of spns2 and s1prs, and proposed that SPNS2 regulated retinal morphogenesis by establishing the S1P level in the eye and activating S1PR3 signaling. These data indicate that SPNS2 is indispensable for normal retinal morphogenesis and provide new insights on the role of S1P in the developing retina using an established in vivo model.-Fang, C., Bian, G., Ren, P., Xiang, J., Song, J., Yu, C., Zhang, Q., Liu, L., Chen, K., Liu, F., Zhang, K., Wu, C., Sun, R., Hu, D., Ju, G., Wang, J. S1P transporter SPNS2 regulates proper postnatal retinal morphogenesis.
EDITORIAL: Nanowires for energy Nanowires for energy
LaPierre, Ray; Sunkara, Mahendra
2012-05-01
This special issue of Nanotechnology focuses on studies illustrating the application of nanowires for energy including solar cells, efficient lighting and water splitting. Over the next three decades, nanotechnology will make significant contributions towards meeting the increased energy needs of the planet, now known as the TeraWatt challenge. Nanowires in particular are poised to contribute significantly in this development as presented in the review by Hiralal et al [1]. Nanowires exhibit light trapping properties that can act as a broadband anti-reflection coating to enhance the efficiency of solar cells. In this issue, Li et al [2] and Wang et al [3] present the optical properties of silicon nanowire and nanocone arrays. In addition to enhanced optical properties, core-shell nanowires also have the potential for efficient charge carrier collection across the nanowire diameter as presented in the contribution by Yu et al [4] for radial junction a-Si solar cells. Hybrid approaches that combine organic and inorganic materials also have potential for high efficiency photovoltaics. A Si-based hybrid solar cell is presented by Zhang et al [5] with a photoconversion efficiency of over 7%. The quintessential example of hybrid solar cells is the dye-sensitized solar cell (DSSC) where an organic absorber (dye) coats an inorganic material (typically a ZnO nanostructure). Herman et al [6] present a method of enhancing the efficiency of a DSSC by increasing the hetero-interfacial area with a unique hierarchical weeping willow ZnO structure. The increased surface area allows for higher dye loading, light harvesting, and reduced charge recombination through direct conduction along the ZnO branches. Another unique ZnO growth method is presented by Calestani et al [7] using a solution-free and catalyst-free approach by pulsed electron deposition (PED). Nanowires can also make more efficient use of electrical power. Light emitting diodes, for example, will eventually become the
Lee, Sang-Woon; Kim, Seong-Gon; Balázsi, Csaba; Chae, Weon-Sik; Lee, Hee-Ok
2012-03-01
The objective of this study was to evaluate the physical properties of synthetic hydroxyapatite (sHA) and hydroxyapatite from eggshells (eHA) by Fourier-transform infrared (FT-IR) and x-ray diffraction (XRD) and to compare the regenerative ability of the bone using sHA and eHA in a rabbit calvarial defect model. FT-IR and XRD were used to compare the physical properties of sHA and eHA. sHA was purchased from Sigma, and eHA was kindly donated from the Hungarian academy of science. Sixteen New Zealand white rabbits were used for the animal study. After the formation of a bilateral parietal bony defect (diameter 8.0 mm), either sHA or eHA was grafted into the defect. The defect in the control was left unfilled. Bone regeneration was evaluated by histomorphometry at 4 and 8 weeks after the operation. The peak broadening of the XRD experiments were in agreement with scanning electron microscope observation; the sHA had a smaller granule size than the eHA. The eHA had impurities phases of CaO (International Center for Diffraction Data (ICDD) 075-0264) and Ca(OH)(2) (ICDD 072-0156). Total new bone was 17.11 ± 10.24% in the control group, 28.81 ± 12.63% in sHA group, and 25.68 ± 10.89% in eHA group at 4 weeks after the operation. The difference was not statistically significant (P > .05). Total new bone at 8 weeks after the operation was 27.50 ± 10.89% in the control group, 38.62 ± 17.42% in sHA group, and 41.99 ± 8.44% in the eHA group. When comparing the sHA group to the control group, the difference was not statistically significant (P > .05). However, the eHA group was significantly different from the control group (P = .038). When comparing the eHA group to the sHA group, the difference was not statistically significant (P > .05). Both types of HA showed higher bone formation than the unfilled control. However, eHA had significantly higher bone formation than the unfilled control at 8 weeks after operation. Copyright © 2012 Elsevier Inc. All rights reserved.
Zhou, Yongbo; Sun, Xuejin; Mielonen, Tero; Li, Haoran; Zhang, Riwei; Li, Yan; Zhang, Chuanliang
2018-01-01
For inhomogeneous cirrus clouds, cloud optical thickness (COT) and effective diameter (De) provided by the Moderate Resolution Imaging Spectrometer (MODIS) Collection 6 cloud products are associated with errors due to the single habit assumption (SHA), independent pixel assumption (IPA), photon absorption effect (PAE), and plane-parallel assumption (PPA). SHA means that every cirrus cloud is assumed to have the same shape habit of ice crystals. IPA errors are caused by three-dimensional (3D) radiative effects. PPA and PAE errors are caused by cloud inhomogeneity. We proposed a method to single out these different errors. These errors were examined using the Spherical Harmonics Discrete Ordinate Method simulations done for the MODIS 0.86 μm and 2.13 μm bands. Four midlatitude and tropical cirrus cases were studied. For the COT retrieval, the impacts of SHA and IPA were especially large for optically thick cirrus cases. SHA errors in COT varied distinctly with scattering angles. For the De retrieval, SHA decreased De under most circumstances. PAE decreased De for optically thick cirrus cases. For the COT and De retrievals, the dominant error source was SHA for overhead sun whereas for oblique sun, it could be any of SHA, IPA, and PAE, varying with cirrus cases and sun-satellite viewing geometries. On the domain average, the SHA errors in COT (De) were within -16.1%-42.6% (-38.7%-2.0%), whereas the 3-D radiative effects- and cloud inhomogeneity-induced errors in COT (De) were within -5.6%-19.6% (-2.9%-8.0%) and -2.6%-0% (-3.7%-9.8%), respectively.
Zhang, Peng; He, Min; Zhao, Yunhe; Ren, Yupeng; Wei, Yan; Mu, Wei; Liu, Feng
2016-07-01
Clothianidin is a second-generation neonicotinoid insecticide that is quite effective against Bradysia odoriphaga Yang and Zhang, the major insect pest affecting Chinese chive in northern China. In this study, the dissipation of clothianidin in soil and its residue in leaves and pseudostems/bulbs as well as its control efficacy against B. odoriphaga and two other secondary pests were investigated in Chinese chive fields after soil application of clothianidin by the directional spray-washing method. The half-life of clothianidin was 35.73-36.10 days, and it could be detected in Chinese chive plants in both treatment plots up to 240 days after a single soil application. Clothianidin applied at 3.0 and 6.0 kg AI ha(-1) could suppress B. odoriphaga population growth, achieve satisfactory levels of pest control for almost 10 months and reduce the losses of the yield in winter. Moreover, the treatments also significantly reduced Thrips alliorum and Acrolepia alliella populations up to nearly 180 days after one application. Clothianidin can be considered to show long-lasting efficacy against B. odoriphaga and to be safe for use in Chinese chive at 3.0 and 6.0 kg AI ha(-1) once in the early root-rearing period to control B. odoriphaga in these cultivation ecosystems. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
International Nuclear Information System (INIS)
Chen, Weiwei; Huang, Hao; Yu, Yun; Lin, Duo; Chen, Rong; Feng, Shangyuan; Lin, Jia
2014-01-01
This study aimed to assess, through surface-enhanced Raman scattering (SERS) spectroscopy, the incorporation of calcium hydroxyapatite (CHA ∼960 cm −1 ) and other biochemical substances in the repair of complete radial fractures in rabbits treated with or without Huo–Xue–Hua–Yu decoction (HXHYD) therapy. A total of 18 rabbits with complete radial fractures were randomly divided into two groups; one group was treated with HXHYD therapy and the other without therapy acted as a control. The animals were sacrificed at 15, 30 and 45 d after surgery. Specimens were routinely prepared for SERS measurement and high quality SERS spectra from a mixture of bone tissues and silver nanoparticles were obtained. The mineral-to-matrix ratios from the control and treated groups were calculated. Results showed that both deposition content of CHA measured by SERS spectroscopy and the mineral-to-matrix ratio in the treated group were always greater than those of the control group during the experiment, demonstrating that HXHYD therapy is effective in improving fracture healing and that SERS spectroscopy might be a novel tool to assess fracture healing. (letter)
The negative cell cycle regulator, Tob (transducer of ErbB-2), is involved in motor skill learning
International Nuclear Information System (INIS)
Wang Xinming; Gao Xiang; Zhang Xuehan; Tu Yanyang; Jin Meilei; Zhao Guoping; Yu Lei; Jing Naihe; Li Baoming
2006-01-01
Tob (transducer of ErbB-2) is a negative cell cycle regulator with anti-proliferative activity in peripheral tissues. Our previous study identified Tob as a protein involved in hippocampus-dependent memory consolidation (M.L. Jin, X.M. Wang, Y.Y. Tu, X.H. Zhang, X. Gao, N. Guo, Z.Q. Xie, G.P. Zhao, N.H. Jing, B.M. Li, Y.Yu, The negative cell cycle regulator, Tob (Transducer of ErbB-2), is a multifunctional protein involved in hippocampus-dependent learning and memory, Neuroscience 131 (2005) 647-659). Here, we provide evidence that Tob in the central nervous system is engaged in acquisition of motor skill. Tob has a relatively high expression in the cerebellum. Tob expression is up-regulated in the cerebellum after rats receive training on a rotarod-running task. Rats infused with Tob antisense oligonucleotides into the 4th ventricle exhibit a severe deficit in running on a rotating rod or walking across a horizontally elevated beam
Directory of Open Access Journals (Sweden)
Cai BQ
2014-04-01
Full Text Available Bai-qiang Cai,1 Shao-xi Cai,2 Rong-chang Chen,3 Li-ying Cui,4 Yu-lin Feng,5 Yu-tong Gu,6 Shao-guang Huang,7 Rong-yu Liu,8 Guang-nan Liu,9 Huan-zhong Shi,10 Yi Shi,11 Yuan-lin Song,6 Tie-ying Sun,12 Chang-zheng Wang,13 Jing-lan Wang,1 Fu-qiang Wen,5 Wei Xiao,14 Yong-jian Xu,15 Xi-xin Yan,16 Wan-zhen Yao,17 Qin Yu,18 Jing Zhang,6 Jin-ping Zheng,3 Jie Liu,6 Chun-xue Bai6 1Department of Pulmonary Medicine, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing, 2Southern Medical University South Hospital, Guangzhou, 3The First Affiliated Hospital of Guangzhou Medical College and Guangzhou Institute of Respiratory Diseases, Guangzhou, 4Affiliate Hospital of Inner Mongolia Medical University, Huhehaote, 5Huaxi Hospital of Sichuan University, Chendu, 6Zhongshan Hospital, Shanghai Medical College, Fudan University and Shanghai Respiratory Research Institute, Shanghai, 7Ruijing Hospital of Shanghai Jiaotong University, Shanghai, 8The First Affiliated University of Anhui Medical University, Hefei, 9The First Affiliated University of Guangxi Medical University, Nanning, 10Beijing Chao-Yang Hospital, Capital Medical University, Beijing, 11General Hospital of Nanjing Military Region, Nanjing, 12Beijing Hospital of the Ministry of Health, Beijing, 13Xinqiao Hospital, Third Military Medical University, Chongqing, 14Qilu Hospital of Shandong University, Jinan, 15Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, 16The Second Affiliated Hospital of Hebei Medical University and Hebei Research Institute of Respiratory Medicine, Shijiazhuang, 17The Third Affiliated Hospital of Beijing University, Beijing, 18The First Affiliated University of Lanzhou University, Lanzhou, People's Republic of China Abstract: Chronic obstructive pulmonary disease (COPD is a common disease that severely threatens human health. Acute exacerbation of COPD (AECOPD is a major cause of
Revision after shoulder replacement for acute fracture of the proximal humerus
DEFF Research Database (Denmark)
Brorson, Stig; Salomonsson, Björn; Jensen, Steen L
2017-01-01
Background and purpose - For more than half a century, stemmed hemiarthroplasty (SHA) has been used in the treatment of comminuted and displaced fractures of the proximal humerus. Reverse shoulder arthroplasty (RSA) has been increasingly popular in cases where it is difficult to obtain satisfactory...... to the national shoulder arthroplasty registries in Denmark, Sweden, and Norway. We included 6,756 shoulder arthroplasties performed for acute fractures between 2004 and 2013. Results - There were 6,112 SHAs (90%) and 565 RSAs (8.4%). The cumulative arthroplasty survival rate after 5 years was 0.96 for both SHA...... and RSA. The relative risk of revision of RSA was 1.4 (95% CI: 0.9-2.2) with SHA as reference. For both types of arthroplasty, the most common reason for revision was infection (SHA 0.8%, RSA 2.1%). The relative risk of revision due to infection was 3.1 (95% CI: 1.6-5.9) for RSA with SHA as reference...
Wolf-Ostermann, Karin; Worch, Andreas; Fischer, Thomas; Wulff, Ines; Gräske, Johannes
2012-11-01
To compare different health outcomes as well as quality of life (QoL) between people with dementia living in shared-housing arrangements (SHA) and special care units (SCU) in nursing homes. Often situated in large apartments in mostly urban settings, SHA are a specific German kind of small-scale living facilities for older care-dependent persons, predominantly suffering from dementia. SHA are completely disconnected from traditional nursing homes. In a longitudinal design, all new residents of SHA and SCU suffering with dementia in Berlin were surveyed for one year. They were assessed when they moved into the SHA or SCU and again 6 and 12 months later. We surveyed physical and psychological health outcomes including ADL-functioning (Barthel), neuropsychiatric symptoms of dementia (NPI) and challenging behaviour (Cohen-Mansfield agitation inventory) as well as QoL (Qualidem). Fifty-six persons (43 women, 13 men) were recruited into the longitudinal study. The average age was 82·5 years at admission, participants mostly had a moderate level of cognitive impairment (mean Mini Mental State Examination = 13·3), prevalence of neuropsychiatric symptoms was high. During the one-year follow-up, analyses show a significant decrease in cognitive abilities but also of neuropsychiatric symptoms in both groups. In SHA, QoL increases on average during the one-year study period. Both types of facilities attract slightly different populations according to our data. Comparison of SHA residents to SCU residents documented no significant beneficial effects of settings in terms of health outcomes. As no clear advantage of either SHA or SCU in nursing homes can be demonstrated for residents with dementia who move in newly, it is impossible to give a clear evidence-based recommendation and the decision for one setting or the other can be made according solely to personal preference of the resident. © 2012 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Tung-Yuan Lai
2016-04-01
Full Text Available Sha Shen Mai Men Dong Tang (SMD-2; 沙參麥冬湯 shā shēn mài dōng tāng is a Chinese medicinal herb (CMH; 中草藥 zhōng cǎo yào used to treat symptoms associated with cancer therapy. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper (Cu, zinc (Zn, and selenium (Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy. Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial. Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment. Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations (GEEs. After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly. Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. Urinary Zn and Se levels and the ratios of Zn to Cu and Se to Cu, but not urinary Cu levels, increased significantly during and after treatment when assessed using the GEE model. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system.
Directory of Open Access Journals (Sweden)
Yu Z
2014-07-01
Full Text Available Zhan Yu,1,* Min Yu,2,* Zhimin Zhou,3 Zhibao Zhang,3 Bo Du,3 Qingqing Xiong3 1Second Artillery General Hospital, Beijing, 2Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, College of Basic Medicine, China Medical University, Shenyang, 3Institute of Biomedical Engineering, Chinese Academy of Medical Sciences, Peking Union Medical College, Key Laboratory of Biomedical Material of Tianjin, Tianjin, People’s Republic of China *These authors contributed equallyto this work Abstract: Controlled-release carriers for local drug delivery have attracted increasing attention for inner-ear treatment recently. In this paper, flower-shaped bovine serum albumin (FBSA particles were prepared by a modified desolvation method followed by glutaraldehyde or heat denaturation. The size of the FBSA particles varied from 10 µm to 100 µm, and most were 50–80 µm. Heat-denatured FBSA particles have good cytocompatibility with a prolonged survival time for L929 cells. The FBSA particles were utilized as carriers to investigate the release behaviors of the model drug – rhodamine B. Rhodamine B showed a sustained-release effect and penetrated the round-window membrane of guinea pigs. We also confirmed the attachment of FBSA particles onto the round-window membrane by microscopy. The FBSA particles, with good biocompatibility, drug-loading capacity, adhesive capability, and biodegradability, may have potential applications in the field of local drug delivery for inner-ear disease treatment. Keywords: bovine serum albumin (BSA, controlled release, local delivery, round-window membrane
Energy Technology Data Exchange (ETDEWEB)
Liu, Hao; Li, Ke [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China); Xu, Liang [The University of Kansas, Department of Molecular Biosciences (United States); Wu, Daocheng, E-mail: wudaocheng@mail.xjtu.edu.cn [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China)
2014-12-15
To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications.
International Nuclear Information System (INIS)
Liu, Hao; Li, Ke; Xu, Liang; Wu, Daocheng
2014-01-01
To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications
Directory of Open Access Journals (Sweden)
Xiaojie Yang
2016-10-01
Full Text Available Hybrid vigor contributes in a large way to the yield and quality of cotton (Gossypium hirsutum fiber. Although microRNAs play essential regulatory roles in flower induction and development, it is still unclear if microRNAs are involved in male sterility, as the regulatory molecular mechanisms of male sterility in cotton need to be better defined. In this study, two independent small RNA libraries were constructed and sequenced from the young buds collected from the sporogenous cell formation to the meiosis stage of the male sterile line Yu98-8A and the near-isogenic line. Sequencing revealed 1588 and 1536 known microRNAs and 347 and 351 novel miRNAs from male sterile and male fertile libraries, respectively. MicroRNA expression profiles revealed that 49 conserved and 51 novel miRNAs were differentially expressed. Bioinformatic and degradome analysis indicated the regulatory complexity of microRNAs during flower induction and development. Further RT-qPCR and physiological analysis indicated that, among the different Kyoto Encyclopedia Gene and Genomes pathways, indole-3-acetic acid and gibberellic acid signaling transduction pathways may play pivotal regulatory functions in male sterility.
2. Sino-German workshop on fuel cells. Book of abstracts
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-07-01
The CD-ROM contains the content of 13 lectures and 19 proposals for joint projects, which were presented on the second Sino-German Workshop on fuel cells. The topics of the 13 lectures are: Ab-initio calculations of oxygen species on low-index platinum surfaces (Pachenko, M.T.M. Koper, T.E. Shubina, S.J. Mitchell, E. Roduner). Cross-Linked (Composite) Polyaryl Blend Membranes for Membrane Fuel Cells. (J.A. Kerres, A. Ullrich, W. Zhang, M. Hein, V. Gogel, L. Joerissen, Th. Frey, A. Friedrich). Performance and Methanol Permeation of Direct Methanol Fuel Cells: Dependence on Operating Conditions and on Electrode Structure(V. Gogel, Th. Frey, K.A. Friedrich, L. Joerissen, J. Garche, Z. Yongsheng). Experimental Investigation of Flow Bed Configuration Effect on Performance of Liquid Feed Direct Methanol Fuel Cells. (H. Guo, C.F. Ma, M.H. Wang, F. Ye, J. Yu, Y. Wang, C.Y. Wang). Improvement of MEAs for DMFC by a tuned production sequence assisted by mathematical modelling (Lindermeir, G. Rosenthal, U. Kunz, U. Hoffmann). Performance of the self-breathing air DMFC with solution grafted PVDF-g-PSSA membranes (X. Qiu, G. Guo, W. Li, W. Zhu, L. Chen). Modeling the Effects of Methanol Crossover on DMFC (J. Zhang, Y. Wang). The characteristics of 40 kW PEM fuel cell engine for vehicle(M. Hou, P. Ming, H. Zhang). A New and Simple Method for Preparing Biocathode in Biofuel Cells (D. Sun, C. Cai, X. Li, W. Xing, T. Lu). Nonlinear Model Reduction of a Dynamic Two-dimensional Molten Carbonate Fuel Cell Model (M. Mangold, M. Sheng). Recent Advances in Design and Fabrication of Low-Temperature Solid Oxide Fuel Cells (C. Xia, G. Meng). Novel CVD Techniques for Micro- and IT-SOFC Fabrication (G. Meng, H. Song, Q. Dong, D. Peng). Fundamental properties of La{sub 0.6}Sr{sub 0.4}Co{sub 0.8}Fe{sub 0.2}O{sub 3-{delta}} at high temperatures (S. Wang, T.-L. Wen).
Directory of Open Access Journals (Sweden)
Zhang L
2013-03-01
Full Text Available Lei Zhang,1,* Yanjun Su,1,* Chen Wang,2 Yongsheng Sha,1 Hong Zhu,3 Shumin Xie,4 Sabrina Kwauk,5 Jing Zhang,2 Yunshou Lin,2 Changli Wang1,*1Department of Thoracic Surgery, Key Laboratory of Cancer Prevention and Therapy, Tianjin Lung Cancer Center, Tianjin Medical University Cancer Institute and Hospital, Tianjin, 2Tianjin Medical University, Tianjin, 3Department of Public Health, Tianjin Medical University, Tianjin, 4Xiangya Medical School of Central-South University, Changsha, People's Republic of China; 5School of Public Health, Harvard University, Boston, Cambridge, MA, USA*These authors contributed equally to this workPurpose: This study assessed the nutritional status of elderly Chinese lung cancer inpatients using a revised version of the Mini-Nutritional Assessment (MNA® tool.Patients and methods: The revised version of the MNA tool was used to assess the nutritional status of 180 elderly Chinese lung cancer inpatients prior to their scheduled surgery between June 2010 and July 2011. Patients' demographic data, anthropometric parameters, and biochemical markers were collected and analyzed.Results: Among the 180 inpatients who underwent the MNA, 9% were malnourished (MNA score < 19, 33% were at risk of malnutrition (MNA score 19–23, and 58% were well nourished (MNA score ≥ 24. There was significant correlation between the MNA scores of patients who were malnourished, at risk of malnutrition, and well nourished (P < 0.001, as well as between total MNA score and most MNA questions. The three patient groups with different nutritional statuses differed significantly in their responses to anthropometrics and global, diet, and subjective assessments.Conclusion: Incidence rates of malnutrition prior to surgery are high among elderly Chinese lung cancer inpatients. The revised MNA is a valid and reliable tool that can be used to assess and prevent malnutrition among these inpatients.Keywords: malnutrition, MNA-SF, nutrition, inpatients, diet
Finite-size effects in the short-time height distribution of the Kardar-Parisi-Zhang equation
Smith, Naftali R.; Meerson, Baruch; Sasorov, Pavel
2018-02-01
We use the optimal fluctuation method to evaluate the short-time probability distribution P(H, L, t) of height at a single point, H=h(x=0, t) , of the evolving Kardar-Parisi-Zhang (KPZ) interface h(x, t) on a ring of length 2L. The process starts from a flat interface. At short times typical (small) height fluctuations are unaffected by the KPZ nonlinearity and belong to the Edwards-Wilkinson universality class. The nonlinearity, however, strongly affects the (asymmetric) tails of P(H) . At large L/\\sqrt{t} the faster-decaying tail has a double structure: it is L-independent, -\\lnP˜≤ft\\vert H\\right\\vert 5/2/t1/2 , at intermediately large \\vert H\\vert , and L-dependent, -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , at very large \\vert H\\vert . The transition between these two regimes is sharp and, in the large L/\\sqrt{t} limit, behaves as a fractional-order phase transition. The transition point H=Hc+ depends on L/\\sqrt{t} . At small L/\\sqrt{t} , the double structure of the faster tail disappears, and only the very large-H tail, -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , is observed. The slower-decaying tail does not show any L-dependence at large L/\\sqrt{t} , where it coincides with the slower tail of the GOE Tracy-Widom distribution. At small L/\\sqrt{t} this tail also has a double structure. The transition between the two regimes occurs at a value of height H=Hc- which depends on L/\\sqrt{t} . At L/\\sqrt{t} \\to 0 the transition behaves as a mean-field-like second-order phase transition. At \\vert H\\vert c-\\vert the slower tail behaves as -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , whereas at \\vert H\\vert >\\vert H_c-\\vert it coincides with the slower tail of the GOE Tracy-Widom distribution.
Triazole derivatives with improved in vitro antifungal activity over azole drugs
Directory of Open Access Journals (Sweden)
Yu S
2014-04-01
Full Text Available Shichong Yu,1,* Xiaoyun Chai,1,* Yanwei Wang,1 Yongbing Cao,2 Jun Zhang,3 Qiuye Wu,1 Dazhi Zhang,1 Yuanying Jiang,2 Tianhua Yan,4 Qingyan Sun11Department of Organic Chemistry, School of Pharmacy, Second Military Medical University, Shanghai, People's Republic of China; 2Drug Research Center, School of Pharmacy, Second Military Medical University, Shanghai, People's Republic of China; 3Overseas Education Faculty of the Second Military Medical University, Shanghai, People's Republic of China; 4Department of Pharmacology, School of Pharmacy, China Pharmaceutical University, Nanjing, People's Republic of China*These authors contributed equally to this workAbstract: A series of triazole antifungal agents with piperidine side chains was designed and synthesized. The results of antifungal tests against eight human pathogenic fungi in vitro showed that all the compounds exhibited moderate-to-excellent activities. Molecular docking between 8d and the active site of Candida albicans CYP51 was provided based on the computational docking results. The triazole interacts with the iron of the heme group. The difluorophenyl group is located in the S3 subsite and its fluorine atom (2-F can form H-bonds with Gly307. The side chain is oriented into the S4 subsite and formed hydrophobic and van der Waals interactions with the amino residues. Moreover, the phenyl group in the side chain interacts with the phenol group of Phe380 through the formation of π–π face-to-edge interactions.Keywords: synthesis, CYP51, molecular docking, azole agents
Meyer, Saskia; Gräske, Johannes; Worch, Andreas; Wolf-Ostermann, Karin
2015-12-01
Malnutrition in the elderly is an important nursing challenge. Persons with dementia disease are often affected by malnutrition. During recent years, shared-housing arrangements (SHA) for older care-dependent people, frequently with dementia disease, have evolved in Germany. SHA can be an alternative to traditional residential care in nursing homes. The prevalence of malnutrition in SHA is compared to the prevalence in community dwellings and lower than the prevalence of malnutrition in nursing homes. There are no scientific data about the development of the nutritional status of older care-dependent people in SHA over one year. The aim of this study is to describe the nutritional status of care-dependent people with dementia disease living in SHA and to investigate changes over a period of one year. A longitudinal study with a one-year follow-up was performed. Standardised interviews with nurses were conducted concerning nutritional status (Mini Nutritional Assessment--MNA), cognitive capacities (Mini Mental State Examination--MMSE), activities of daily living (Extended Barthel-Index--EBI) and socio-demographic characteristics. Nutritional data were available for 45 residents at baseline and 36 residents at follow-up. At baseline, 45 residents with an average age of 78.4 years living in SHA in the state of Berlin, Germany, were included in the study. Predominantly, residents were female (73.3%) and diagnosed with dementia (88.9%), with a moderate to severe cognitive impairment (MMSE: 10.8) and low daily living abilities (EBI: 33.7). Most residents (80.6%) have a risk of malnutrition regarding the MNA. The average MNA score did decline slightly within one year (t0 = 20.8 vs. t1 = 19.7). Regular screenings for malnutrition using validated standardised assessments, which are easy to apply, should be implemented in SHA to avoid nutritional and health-related problems arising from malnutrition. Flexible structures for care, as in SHA, can facilitate coping with
International Nuclear Information System (INIS)
Cherepashchuk, Anatolii M
2009-01-01
We comment on the methodological note by A A Grib and Yu V Pavlov [Phys. Usp. 52 257 (2009)] to show that its authors are incorrect in understanding a passage that they quote from A M Cherepashchuk's book Black Holes in the Universe (Fryazino: Vek-2, 2005, p.7) and which supposes an astronaut to be at rest in the vicinity of the horizon (not to fall freely into a black hole!). With this error corrected, Grib and Pavlov's note is quite useful methodologically. (letters to the editors)
Directory of Open Access Journals (Sweden)
Sha N
2015-11-01
Full Text Available Nan Sha,* Linguo Xie,* Tao Chen,* Chen Xing, Xiaoteng Liu, Yu Zhang, Zhonghua Shen, Hao Xu, Zhouliang Wu, Hailong Hu, Changli Wu Department of Urology, Tianjin Key Laboratory of Urology, Tianjin Institute of Urology, Second Hospital of Tianjin Medical University, Tianjin, People’s Republic of China *These authors contributed equally to this work Objective: To evaluate the clinical significance of lymphovascular invasion (LVI on recurrence and progression rates in patients with pT1 urothelial carcinoma of bladder after transurethral resection.Methods: This retrospective study was performed with 155 patients with newly diagnosed pT1 urothelial carcinoma of bladder who were treated with transurethral resection of bladder tumor at our institution from January 2006 to January 2010. The presence or absence of LVI was examined by pathologists. Chi-square test was performed to identify the correlations between LVI and other clinical and pathological features. Kaplan–Meier method was used to estimate the recurrence-free survival (RFS and progression-free survival curves and difference was determined by the log-rank test. Univariate and multivariate analyses were performed to determine the predictive factors through a Cox proportional hazards analysis model.Results: LVI was detected in a total of 34 patients (21.9%. While LVI was associated with high-grade tumors (P<0.001 and intravesical therapy (P=0.009. Correlations with age (P=0.227, sex (P=0.376, tumor size (P=0.969, tumor multiplicity (P=0.196, carcinoma in situ (P=0.321, and smoking (P=0.438 were not statistically significant. There was a statistically significant tendency toward higher recurrence rate and shorter RFS time in LVI-positive patients. However, no statistically significant differences were observed in progression rate between the two groups. Moreover, multivariate Cox proportional hazards analysis revealed that LVI, tumor size, and smoking were independent prognostic predictors of
Directory of Open Access Journals (Sweden)
Zhang Y
2016-01-01
Full Text Available Yu Zhang,1,* Linguo Xie,1,* Tao Chen,1,* Wanqin Xie,2 Zhouliang Wu,1 Hao Xu,1 Chen Xing,1 Nan Sha,1 Zhonghua Shen,1 Yunkai Qie,1 Xiaoteng Liu,1 Hailong Hu,1 Changli Wu1 1Department of Urology, The Second Hospital of Tianjin Medical University, Tianjin Institute of Urology, Tianjin, 2Key Laboratory of Genetics and Birth Health of Hunan Province, The Family Planning Research Institute of Hunan Province, Changsha, People’s Republic of China *These authors contributed equally to this work Objective: The management of stage 1 and grade 3 (T1G3 bladder cancer continues to be controversial. Although the transurethral resection of bladder tumor (TURBT followed by intravesical chemotherapy is a conservative strategy for treatment of T1G3 bladder cancer, a relatively high risk of tumor recurrence and progression remains regarding the therapy. This study aimed to compare the efficacy of intravenous chemotherapy combined with intravesical chemotherapy versus intravesical chemotherapy alone for T1G3 bladder cancer after TURBT surgery. Methods: We retrospectively reviewed the cases of 457 patients who were newly diagnosed with T1G3 bladder urothelial carcinoma between January 2009 and March 2014. After TURBT, 281 patients received intravesical chemotherapy alone, whereas 176 patients underwent intravesical chemotherapy in combination with intravenous chemotherapy. Tumor recurrence and progression were monitored periodically by urine cytology and cystoscopy in follow-up. Recurrence-free survival and progression-free survival of the two chemotherapy strategies following TURBT were analyzed. Univariable and multivariable Cox hazards analyses were performed to predict the prognostic factors for tumor recurrence and progression. Results: The tumor recurrence rate was 36.7% for patients who received intravesical chemotherapy alone after TURBT, compared with 19.9% for patients who received intravenous chemotherapy combined with intravesical chemotherapy after
Sustainable practices and related performances at state highway agencies.
2010-12-01
This report identifies seven ways in which an SHA can harm the environment: (1) excessive consumption of virgin materials; (2) unnecessary levels or amounts of storm water runoff; (3) release of environmental contaminants by SHA employees and conract...
Cid Solé, Òscar
2012-01-01
El projecte que s'ha dut a terme és un estudi introductori del funcionament de la tecnologia NX fent ús d'una eina lliure com és FreeNX. Aquesta tecnologia està destinada a millorar el rendiment dels processos de comunicació que s'estableixen quan volem accedir a un escriptori remot. El resultat d'aquest estudi s'ha plasmat en un appliance que integra el servidor esmentat juntament amb una aplicació que s'ha desenvolupat per a la gestió d'escriptoris remots utilitzant el servidor FreeNX i els...
Dávila Molina, Antonio Jesús
2007-01-01
En aquest projecte, s'ha dissenyat, construït i programat un robot autònom, dotat de sistema de locomoció i sensors que li permeten navegar sense impactar en un entorn controlat. Per assolir aquests objectius s'ha dissenyat i programat una unitat de control que gestiona el hardware de baix volum de dades amb diferents modes d'operació, abstraient-lo en una única interfície. Posteriorment s'ha integrat aquest sistema en l'entorn de robòtica Pyro. Aquest entorn permet usar i adaptar, segons es ...
The 2nd International Conference on Agricultural and Biological Sciences (ABS 2016
Directory of Open Access Journals (Sweden)
Lei Pei
2016-10-01
Salvia of Labiatae in China Xiaojuan Li, Ning Xu, Guofu Zhou, Ming Wan, Qi Lin, Fanyun Meng, Jianxiu Li 15 Three pulling resistance models of pioneer plant in landslide area Yichang Chen, Koayung Yu, Chunpin Chang 16 The comparison of physiological and biochemical mechanisms of Reaumuria soongorica and Salsola passerine in different growth pattern Zijuan Zhou, Peixi Su, Rui Shi, Tingting Xie 17 Resources use efficiency of the cosmopolitan plant Potentilla anserina L. in different alpine habitats in China Rui Shi, Peixi Su, Zijuan Zhou 18 Cloning of PPDK gene from Red Amaranand transformation of Alfalfa Xuelan Liu, Yan Zhang, Xiangfa Wei 19 Variation and cluster analysis of morphological characters and nutrient content of Chucrasia tabularis seed Chong Wu, Yanlei Yin, Lijuan Feng, Xuemei Yang, Fei Wang 20 Effect of the planting density of the areca nut on the growth of intercropped Vanilla Hua Wang, Huifa Zhuang, Zihui Zhu, Hui Wang
Directory of Open Access Journals (Sweden)
Yi Zheng
2007-01-01
Full Text Available The essay explores the public social dimension of the “great cultural essays” as a popular post-socialist genre. It looks into the genre’s emergence and popularity as part of the making of a middleclass taste in contemporary China and its claim to a re-imagined cultural national inheritance. In particular, the discussion focuses on the example of essayist Yu Qiuyu and examines the implications of his successful transformation of an obsolete historical “Culture” into a desirable commodity that offers spiritual home to the aspiring and successful of a “Greater China”.
Cherepashchuk, Anatolii M.
2009-08-01
We comment on the methodological note by A A Grib and Yu V Pavlov [Phys. Usp. 52 257 (2009)] to show that its authors are incorrect in understanding a passage that they quote from A M Cherepashchuk's book Black Holes in the Universe (Fryazino: Vek-2, 2005, p.7) and which supposes an astronaut to be at rest in the vicinity of the horizon (not to fall freely into a black hole!). With this error corrected, Grib and Pavlov's note is quite useful methodologically.
Energy Technology Data Exchange (ETDEWEB)
Sethi, P.; Krishnia, S.; Li, S.H.; Lew, W.S., E-mail: wensiang@ntu.edu.sg
2017-03-15
We investigate and quantify spin-orbit torque (SOT) strength by current induced effective in-plane magnetic fields and spin Hall angle (SHA) using AC harmonic Hall voltage measurements techniques on Ta/Pt/Co/Pt/Co/Ta thin film structures. The proposed Co/Pt thin film double stack gives property enhancement on thermal stability and perpendicular magnetization anisotropy strength over the single stack Pt/Co/Ta. In the proposed Co/Pt double stack we observed that increasing the Ta capping thickness to three times enhances the SHA in similar order, consistent with larger spin injection efficiency. Doubling the Pt spacer layer thickness reduces the SHA by nearly 1.4 times, due to partial cancellation of SOT by bottom layer Pt, negating the increase from the top Co/Pt interface. The in-plane current threshold for magnetization switching is lower with the increase of the SHA.
2011-01-01
The Chinese community at CERN and the CERN CineClub, on the occasion of the Chinese New Year, invite everyone to two days of films Thursday 3 February 2011 at 20:30 - CERN Council Chamber Eat drink man woman Directed by Ang LEE (Taiwan, 1994) 122 min. With Sihung Lung, Yu-Wen Wang, Chien-Lien Wu, Kuei-Mei Yang Senior Master Chef Chu lives in a large house in Taipei with his three unmarried daughters, Jia-Jen, a chemistry teacher converted to Christianity, Jia-Chien, an airline executive, and Jia-Ning, a student who also works in a fast food restaurant. Life in the house revolves around the ritual of an elaborate dinner each Sunday, and the love lives of all the family members. Original version Mandarin with English subtitles Friday 4 February 2011 at 19:30 - CERN Council Chamber Adieu, ma concubine Directed by Chen KAIGE (China / Hong Kong, 1993) 171 min. With Leslie Cheung, Fengyi Zhang, Li Gong "Farewell, My Concubine" is a movie with two parallel, intertwined stories. It is the story of two performers in t...
Advances in the targeted therapy of liposarcoma
Directory of Open Access Journals (Sweden)
Guan Z
2015-01-01
Full Text Available Zhonghai Guan,1 Xiongfei Yu,1 Haohao Wang,1 Haiyong Wang,1 Jing Zhang,1 Guangliang Li,2 Jiang Cao,3 Lisong Teng1 1Department of Surgical Oncology, First Affiliated Hospital, College of Medicine, Zhejiang University, 2Department of Medicine Oncology, Zhejiang Cancer Hospital, 3Clinical Research Center, The 2nd Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang, People’s Republic of China Abstract: Liposarcoma (LPS is the most common type of soft-tissue sarcoma. Complete surgical resection is the only curative means for localized disease; however, both radiation and conventional cytotoxic chemotherapy remain controversial for metastatic or unresectable disease. An increasing number of trials with novel targeted therapy of LPS have provided encouraging data during recent years. This review will provide an overview of the advances in our understanding of LPS and summarize the results of recent trials with novel therapies targeting different genetic and molecular aberrations for different subtypes of LPS. Keywords: well-/dedifferentiated, myxoid/round cell, pleomorphic, soft-tissue sarcoma
Earthquake Hazard Assessment: an Independent Review
Kossobokov, Vladimir
2016-04-01
Seismic hazard assessment (SHA), from term-less (probabilistic PSHA or deterministic DSHA) to time-dependent (t-DASH) including short-term earthquake forecast/prediction (StEF), is not an easy task that implies a delicate application of statistics to data of limited size and different accuracy. Regretfully, in many cases of SHA, t-DASH, and StEF, the claims of a high potential and efficiency of the methodology are based on a flawed application of statistics and hardly suitable for communication to decision makers. The necessity and possibility of applying the modified tools of Earthquake Prediction Strategies, in particular, the Error Diagram, introduced by G.M. Molchan in early 1990ies for evaluation of SHA, and the Seismic Roulette null-hypothesis as a measure of the alerted space, is evident, and such a testing must be done in advance claiming hazardous areas and/or times. The set of errors, i.e. the rates of failure and of the alerted space-time volume, compared to those obtained in the same number of random guess trials permits evaluating the SHA method effectiveness and determining the optimal choice of the parameters in regard to specified cost-benefit functions. These and other information obtained in such a testing may supply us with a realistic estimate of confidence in SHA results and related recommendations on the level of risks for decision making in regard to engineering design, insurance, and emergency management. These basics of SHA evaluation are exemplified with a few cases of misleading "seismic hazard maps", "precursors", and "forecast/prediction methods".
Chan, T.
2016-12-01
The Hong Kong International Airport (HKIA) handles a large amount of air traffic, at 68.5 million passengers per year (approx. 40.1 million flights per year). Given that flight demand is forecast to reach 97 million passengers per year (approx 60.2 million flights per year) by 2030, the HKIA must optimise runway capacity in order to meet growing demand. Hence, the Airport Authority Hong Kong (AAHK) has put forward a proposal to expand the airport into a three-runway system by building a third runway. However, this presents many environmental constraints. These include major impacts on marine ecology; especially the Chinese White Dolphins (Sousa chinensis) that live around the Sha Chau and Lung Kwu Chau Marine Park north to the airport. Due to that the third runway will reclaim approximately 650 hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park. This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation (often discerned by a "click" sound) to communicate and navigate, increasing marine traffic (re-routing) causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries. Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years (2013-2016) has shown that noise pollution is increasing (as indicated by the increase of frequencies around 100 125 kHz) and that it has caused disruption in regular dolphin movement (irregular clicking sequence) .
High expression of HEF1 is associated with poor prognosis in urinary bladder carcinoma
Directory of Open Access Journals (Sweden)
Zhang Q
2014-07-01
Full Text Available Qi Zhang,1 Hui-Ju Wang,2 Da-Hong Zhang,1 Guo-Qing Ru,3 Xu-Jun He,2 Ying-Yu Ma2 1Department of Urology, 2Key Laboratory of Gastroenterology of Zhejiang Province, 3Department of Pathology, Zhejiang Provincial People's Hospital, Hangzhou, People's Republic of China Abstract: Human enhancer of filamentation 1 (HEF1 is a multidomain scaffolding protein that has been thought to play an important role in the tumor progression of various cancers. HEF1 expression has not previously been reported in urinary bladder carcinoma, and little is known about its prognostic significance. The aim of this study was to evaluate the expression patterns of HEF1 in urinary bladder carcinoma and to investigate its prognostic significance. HEF1 expression was analyzed by immunohistochemistry using tissue microarray. A significant relationship between HEF1 expression and sex, tumor size, number of tumors, invasion depth, lymph node metastasis, and distant metastasis was found, and high expression of HEF1 was associated with worse overall survival when compared to low expression of HEF1. Multivariate analysis showed that HEF1 expression was an independent prognostic factor for overall survival in urinary bladder carcinoma. We investigated HEF1 expression in urinary bladder carcinoma and found that high HEF1 expression was associated with advanced stage, large tumor size, and shortened progression-free survival. Although the biologic function of HEF1 in urinary bladder carcinoma remains unknown, the expression of HEF1 can provide new prognostic information for disease progression. Keywords: human enhancer of filamentation 1, progression-free survival, immunohistochemistry, metastasis, bladder cancer
Directory of Open Access Journals (Sweden)
Zhang ZH
2016-05-01
Full Text Available Zhihong Zhang,1,2 Yu Zhu,1 Yun Ling,3 Lijuan Zhang,1 Hongwei Wan1 1Department of Nursing, Shanghai Proton and Heavy Ion Center, 2Shanghai First Maternity and Infant Hospital, Tongji University School of Medicine, 3Department of Human Resource, Shanghai Proton and Heavy Ion Center, Shanghai, People’s Republic of China Abstract: Nasogastric tube (NGT and percutaneous endoscopic gastrostomy were frequently used in the head and neck cancer patients when malnutrition was present. Nevertheless, the evidence was inclusive in terms of the choice and the time of tube placement. The aim of this network meta-analysis was to evaluate the comparative effects of prophylactic percutaneous endoscopic gastrostomy (pPEG, reactive percutaneous endoscopic gastrostomy (rPEG, and NGT in the head and neck cancer patients receiving radiotherapy or chemoradiotherapy. Databases of PubMed, Web of Science, and Elsevier were searched from inception to October 2015. Thirteen studies enrolling 1,631 participants were included in this network meta-analysis. The results indicated that both pPEG and NGT were superior to rPEG in the management of weight loss. pPEG was associated with the least rate of treatment interruption and nutrition-related hospital admission among pPEG, rPEG, and NGT. Meanwhile, there was no difference in tube-related complications. Our study suggested that pPEG might be a better choice in malnutrition management in the head and neck cancer patients undergoing radiotherapy or chemoradiotherapy. However, its effects need to be further investigated in more randomized controlled trials. Keywords: malnutrition, tube feeding, weight loss, treatment interruption, readmission, complication
Desarrollo de una interfaz gráfica mediante Galaxy para Qiime
Navas Molina, Jose Antonio
2012-01-01
En aquest projecte s'ha desenvolupat un paquet Python que permet la integració del pipeline QIIME a la plataforma Galaxy de forma automàtica. També s'ha replicat la pàgina web FastUniFrac utilitzant scripts de QIIME integrats en Galaxy.
Yang, Y; Huang, S; Wang, J; Jan, G; Jeantet, R; Chen, X D
2017-04-01
Food-related carbohydrates and proteins are often used as thermoprotectants for probiotic lactobacilli during industrial production and processing. However, the effect of inorganic salts is rarely reported. Magnesium is the second-most abundant cation in bacteria, and commonly found in various foods. Mg 2+ homeostasis is important in Salmonella and has been reported to play a critical role in their thermotolerance. However, the role of Mg 2+ in thermotolerance of other bacteria, in particular probiotic bacteria, still remains a hypothesis. In this study, the effect of Mg 2+ on thermotolerance of probiotic lactobacilli was investigated in three well-documented probiotic strains, Lactobacillus rhamnosus GG, Lactobacillus casei Zhang and Lactobacillus plantarum P-8, in comparison with Zn 2+ and Na + . Concentrations of Mg 2+ between 10 and 50 mmol l -1 were found to increase the bacterial survival upon heat challenge. Remarkably, Mg 2+ addition at 20 mmol l -1 led to a 100-fold higher survival of L. rhamnosus GG upon heat challenge. This preliminary study also showed that Mg 2+ shortened the heat-induced extended lag time of bacteria, which indicated the improvement in bacterial recovery from thermal injury. In order to improve the productivity and stability of live probiotics, extensive investigations have been carried out to improve thermotolerance of probiotics. However, most of these studies focused on the effects of carbohydrates, proteins or amino acids. The roles of inorganic salts in various food materials, which have rarely been reported, should be considered when incorporating probiotics into these foods. In this study, Mg 2+ was found to play a significant role in the thermotolerance of probiotic lactobacilli. A novel strategy may be available in the near future by employing magnesium salts as protective agents of probiotics during manufacturing process. © 2017 The Society for Applied Microbiology.
International Nuclear Information System (INIS)
Schwarz, S.; Ellen, R.P.; Grove, D.A.
1987-01-01
There is limited evidence, mostly indirect, to suggest that the adherence of Bacteroides gingivalis to teeth may be enhanced by the presence of gram-positive dental plaque bacteria like Actinomyces viscosus. The purpose of this study was to carry out direct quantitative assessments of the cohesion of B gingivalis and A. viscosus by using an in vitro assay modeled on the natural sequence in which these two species colonize the teeth. The assay allowed comparisons to be made of the adherence of 3 H-labeled B. gingivalis 2561 and 381 to saliva-coated hydroxyapatite beads (S-HA) and A. viscosus WVU627- or T14V-coated S-HA (actinobeads) in equilibrium and kinetics binding studies. A series of preliminary binding studies with 3H-labeled A. viscosus and parallel studies by scanning electron microscopy with unlabeled A. viscosus were conducted to establish a protocol by which actinobeads suitable for subsequent Bacteroides adherence experiments could be prepared. By scanning electron microscopy, the actinobeads had only small gaps of exposed S-HA between essentially irreversibly bound A. viscosus cells. Furthermore, B. gingivalis cells appeared to bind preferentially to the Actinomyces cells instead of the exposed S-HA. B. gingivalis binding to both S-HA and actinobeads was saturable with at least 2 X 10(9) to 3 X 10(9) cells per ml, and equilibrium with saturating concentrations was reached within 10 to 20 min. B. gingivalis always bound in greater numbers to the actinobeads than to S-HA. These findings provide direct measurements supporting the concept that cohesion with dental plaque bacteria like A. viscosus may foster the establishment of B. gingivalis on teeth by enhancing its adherence
Small circuits for cryptography.
Energy Technology Data Exchange (ETDEWEB)
Torgerson, Mark Dolan; Draelos, Timothy John; Schroeppel, Richard Crabtree; Miller, Russell D.; Anderson, William Erik
2005-10-01
This report examines a number of hardware circuit design issues associated with implementing certain functions in FPGA and ASIC technologies. Here we show circuit designs for AES and SHA-1 that have an extremely small hardware footprint, yet show reasonably good performance characteristics as compared to the state of the art designs found in the literature. Our AES performance numbers are fueled by an optimized composite field S-box design for the Stratix chipset. Our SHA-1 designs use register packing and feedback functionalities of the Stratix LE, which reduce the logic element usage by as much as 72% as compared to other SHA-1 designs.
Portolés, Laura; Martí, Otilia
2017-01-01
Tradicionalment, l'ensenyament de llengües s'ha basat en un enfocament monolingüe i l'estricta separació de llengües a l'aula s'ha considerat un requisit indefugible per garantir l'èxit d'aquest procés d'aprenentatge. No obstant això, s'ha demostrat que l'ús flexible del repertori lingüístic de l'alumnat, conegut com a translanguaging, també pot resultar beneficiós per tal d'aprendre l'anglès com a llengua estrangera (vid. Jones i Lewis, 2014).El present estudi té com a objectiu examinar el t...
A functional SNP upstream of the ADRB2 gene is associated with COPD
Directory of Open Access Journals (Sweden)
Li JX
2018-03-01
Full Text Available Jin-Xiu Li,1,2,* Wei-Ping Fu,3,* Jing Zhang,4 Xiao-Hua Zhang,1,2 Chang Sun,1,5 Lu-Ming Dai,3 Li Zhong,1,5,6 Li Yu,1,2 Ya-Ping Zhang1,7 1State Key Laboratory for Conservation and Utilization of Bio-Resource in Yunnan, 2Key Laboratory for Animal Genetic Diversity and Evolution of High Education in Yunnan Province, School of Life Sciences, Yunnan University, 3Department of Respiratory Critical Care Medicine, 4Department of Thoracic Surgery, The First Affiliated Hospital of Kunming Medical University, Kunming, 5College of Life Sciences, 6Provincial Demonstration Center for Experimental Biology Education, Shaanxi Normal University, Xi’an, 7State Key Laboratory of Genetic Resources and Evolution, and Yunnan Laboratory of Molecular Biology of Domestic Animals, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China *These authors contributed equally to this work Background: Previous studies have suggested that β2-adrenergic receptor (ADRB2 is associated with COPD. However, the role of genetic polymorphisms in ADRB2 on COPD has not been evaluated yet. Methods: In this study, SNaPshot genotyping, luciferase assay, chromatin immunoprecipitation and real-time polymerase chain reaction were adopted to investigate the association between ADRB2 genetic polymorphisms and COPD, comprehensively. Results: One single nucleotide polymorphism (rs12654778, located upstream of ADRB2, showed a significant association with COPD by the logistic regression analysis after adjusting for age, sex and smoking history (p=0.04 in 200 COPD patients and 222 controls from southwest Chinese population. Furthermore, the luciferase assay indicated that rs12654778-A allele reduced the relative promoter activity by ~26% compared with rs12654778-G allele (p=0.0034. The chromatin immunoprecipitation analysis demonstrated that rs12654778 modulated the binding affinity of transcription factor neurofibromin 1. In addition, a significantly reduced expression of ADRB
Directory of Open Access Journals (Sweden)
Dai S
2018-05-01
Full Text Available Shuhong Dai,1 Yu Qi,1 Jie Fu,1 Na Li,1 Xu Zhang,1 Juan Zhang,2 Wei Zhang,2 Haijun Xu,1 Hai Zhou,1 Zhengliang Ma2 1Department of Anesthesiology, XuZhou Central Hospital, Xuzhou, China; 2The Affiliated Nanjing Drum Tower Hospital, Medical School, Nanjing University, Nanjing, China Background: Dexmedetomidine (DEX could have an analgesic effect on pain transmission through the modulation of brain-derived neurotrophic factor (BDNF. In addition, KCC2-induced shift in neuronal Cl- homeostasis is crucial for postsynaptic inhibition mediated by GABAA receptors. Accumulating evidence shows that nerve injury, peripheral inflammation and stress activate the spinal BDNF/TrkB signal, which results in the downregulation of KCC2 transport and expression, eventually leads to GAGAergic disinhibition and hyperalgesia. The aim of this experiment was to explore the interaction between DEX and KCC2 at a molecular level in rats in the persistent postsurgical pain (PPSP. Methods: PPSP in rats was evoked by the skin/muscle incision and retraction (SMIR. Mechanical hypersensitivity was assessed with the Dynamic Plantar Aesthesiometer. Western blot and immunofluorescence assay were used to assess the expressions of related proteins. Results: In the first part of our experiment, the results revealed that the BDNF/TrkB-KCC2 signal plays a critical role in the development of SMIR-evoked PPSP; the second part showed that intraperitoneal administrations of 40 µg/kg DEX at 15 min presurgery and 1 to 3 days post-surgery significantly attenuated SMIR-evoked PPSP. Simultaneously, SMIR-induced KCC2 downregulation was partly reversed, which coincided with the inhibition of the BDNF/TrkB signal in the spinal dorsal horn. Moreover, intrathecal administrations of KCC2 inhibitor VU0240551 significantly reduced the analgesic effect of DEX on SMIR-evoked PPSP. Conclusion: The results of our study indicated that DEX attenuated PPSP by restoring KCC2 function through reducing BDNF
Directory of Open Access Journals (Sweden)
Shao XH
2014-08-01
Full Text Available Xing-Hui Shao,1 Yan-Min Yang,1 Jun Zhu,1 Han Zhang,1 Yao Liu,1 Xin Gao,1 Li-Tian Yu,1 Li-Sheng Liu,1 Li Zhao,2 Peng-Fei Yu,3 Hua Zhang,4 Qing He,5 Xiao-Dan Gu6 1Emergency and Intensive Care Center, Fuwai Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing, 2Department of Emergency, Fu Xing Hospital, Capital Medical University, Beijing, 3Department of Cardiology, Pingdu People’s Hospital, Pingdu, 4Department of Emergency, Qingdao Municipal Hospital, Qingdao, 5Department of Emergency, West China Hospital, Sichuan University, Chengdu, 6Department of Emergency, Sixth People’s Hospital of Chengdu, Chengdu, People’s Republic of China Background: Atrial fibrillation (AF disproportionately affects older adults. However, direct comparison of clinical features, medical therapy, and outcomes in AF patients aged 65–74 and ≥75 years is rare. The objective of the present study was to evaluate the differences in clinical characteristics and prognosis in these two age-groups of geriatric patients with AF.Materials and methods: A total of 1,336 individuals aged ≥65 years from a Chinese AF registry were assessed in the present study: 570 were in the 65- to 74-year group, and 766 were in the ≥75-year group. Multivariable Cox hazards regression was performed to analyze the major adverse cardiac events (MACEs between groups.Results: In our population, the older group were more likely to have coronary artery disease, hypertension, previous stroke, cognitive disorder, or chronic obstructive pulmonary disease, and the 65- to 74-year group were more likely to have valvular heart disease, left ventricular systolic dysfunction, or sleep apnea. The older patients had 1.2-fold higher mean CHADS2 (congestive heart failure, hypertension, age ≥75 years, diabetes, stroke scores, but less probability of being prescribed drugs. Compared with those aged 65–74 years, the older group had a higher risk of death (hazard ratio 2
Adoption of the Hash algorithm in a conceptual model for the civil registry of Ecuador
Toapanta, Moisés; Mafla, Enrique; Orizaga, Antonio
2018-04-01
The Hash security algorithm was analyzed in order to mitigate information security in a distributed architecture. The objective of this research is to develop a prototype for the Adoption of the algorithm Hash in a conceptual model for the Civil Registry of Ecuador. The deductive method was used in order to analyze the published articles that have a direct relation with the research project "Algorithms and Security Protocols for the Civil Registry of Ecuador" and articles related to the Hash security algorithm. It resulted from this research: That the SHA-1 security algorithm is appropriate for use in Ecuador's civil registry; we adopted the SHA-1 algorithm used in the flowchart technique and finally we obtained the adoption of the hash algorithm in a conceptual model. It is concluded that from the comparison of the DM5 and SHA-1 algorithm, it is suggested that in the case of an implementation, the SHA-1 algorithm is taken due to the amount of information and data available from the Civil Registry of Ecuador; It is determined that the SHA-1 algorithm that was defined using the flowchart technique can be modified according to the requirements of each institution; the model for adopting the hash algorithm in a conceptual model is a prototype that can be modified according to all the actors that make up each organization.
Directory of Open Access Journals (Sweden)
D.V. Nefedov
2016-12-01
Full Text Available This book is a study at the intersection of such academic disciplines as general history, history of state and law and source study. The subcect of R.Yu. Pochevalev’s book appears very relevant since the interest of the scientific community and readership toward the Golden Horde and its role in the history of the Russian state remains traditionally high for several centuries. However, the author is trying to take a fresh look at this state and refute the stereotype of the Golden Horde as a some kind of bunch of nomads who lived only by plundering neighboring sedentary peoples. He succeeds in this by studying such an important part of the Golden Horde history as its law and legal culture. The book examines a number of questions on the history of state and law of the Golden Horde, which have not previously been the subject of a special study (for example, possessions of the Golden Horde in other uluses, dualism of power in different states, relations between authorities and traders, etc.. On some other issues that have already been studied by experts, he proposes new interpretations in the framework of historical and legal approach (for example, the causes of intestine strife in the Golden Horde in the mid-14th century, yarliks of the Golden Horde khans granted to the Russian Chruch, relations of the Golden Horde rulers and Italian colonies in the Northern Black Sea region. The author examines to a great extent the themes of state and legal regulation of economic relations: status of merchants in the Golden Horde and post-Golden Horde states, role of economic sanctions in the resolution of political conflicts. In other essays contained in the book, the author also emphasizes the role of the economic component of the political and legal relations. For example, R.Yu. Pochekaev convincingly shows that relations of the Golden Horde with other states of the Mongol Empire was based on the principle of mutual provision of possessions to the rulers of
Institute of Scientific and Technical Information of China (English)
JIN; Xuanye; ZHAO; Yuewei; XIE; Jie; ZHAO; Jingquan
2004-01-01
[1]Diwu, Z. J., Novel therapeutic and diagnostic application of hypocrellins and hypericins Photochem, Photobiol., 1995, 61(6):529-539.[2]Zhang, Z. Y., Wang, N. H., EPR studies of singlet oxygen and free radicals generated during photosensitization of hypocrellin B,Free Radical Biol. Med., 1993 14: 1-9.[3]Chowdhury, P. K., Das, K., Datta, A. et al., A comparison of the excited-state processes of nearly symmetrical perylene quinones:hypocrellin A and hypomycin B, J. Photochem. Photobiol. A:Chem., 2002, 154: 107-116.[4]Hudson, J. B., Zhou, J., Chen, J. et al., Hypocrellin, from Hypocrella bambusae, is phototoxic to human immunodeficiency virus, Photochem. Photobiol., 1994, 60: 253-255.[5]Xu, S. J., Chen, S., Zhang, M. H. et al., First synthesis of methylated Hypocrellin and its fluorescent excited state: A cautionary tale, J. Org. Chem., 2003, 68: 2048-2050.[6]Zhang, K. H., Zhang, Z. Y., Molecular thermodynamics of the configuration of perylenequinonoid pigments, Sci. Sin. (B), 1997,27: 357-360.[7]Kawakami, M., Koya, K., Ukai, T. et al., Structure-activity of novel rhodacyanine dyes as antitumor agents, J. Med. Chem.,1998, 41(1): 130-142.[8]Vaupel, P., Kallinowski, F., Okunieff, P., Blood flow, oxygen and nutrient supply, and metabolic microenvironment of human tumors: A review, Cancer Res., 1989, 49: 6449-6465.[9]Patel, A. A., Gawlinski, E. T., Lemieux, S. K. et al., A cellular automaton model of early tumor growth and invasion, J. Theor.Biol., 2001, 213(3): 315-331.[10]Vorpai, E. S., Samtso, M. P., Chalov, V. N. et al., Fluorescence of the polymethine dyes, TIKS and diagnostics of cancer, J. Appl.Spectrosc., 2001, 68(3): 468-472.[11]Zadnia, A., Campbell, R., Sharma, M., The scope of dansyl vs.fluorescein label in fluorescence postlabeling assay for DNA damage, Anal. Biochem., 1994, 218: 444-448.[12]Yu, C. L., Chen, S., Zhang, M. H. et al., Spectroscopic studies and photodynamic actions of hypocrellin B in liposome
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. O P Sha. Articles written in Sadhana. Volume 31 Issue 5 October 2006 pp 645-659. An investigation into design of fair surfaces over irregular domains using data-dependent triangulation · R Sharma O P Sha · More Details Abstract Fulltext PDF. Design of fair surfaces over irregular domains is a ...
Zhang, Tao; Fang, Xiaomin; Song, Chunhui; Appel, Erwin; Wang, Yadong
2017-07-01
Qiao et al. (2016) commented on our work (Zhang et al., 2014) and rejected our reinterpretation of the magnetostratigraphic results of Huang et al. (2006) and Li et al. (2006), with the results gained using the Dynamic Time Warping Algorithm technique (DTWAT) as their main basis. However, Qiao et al. (2016) did not provide details of their modeling inputs, and, in particular, the parameters they chose for their calculations, where such parameters can have a serious impact upon any results. We therefore performed calculations using the same software (i.e., Qupydon) as Qiao et al. (2016), using reliable parameter settings. The results showed that the ;interesting correlation; of a 6000 minimum cost output completely correlate with the magnetostratigraphic Chrons C18r to C3An.1n ( 40-6 Ma), which is consistent with our reinterpreted magnetostratigraphic results. Furthermore, we summarized previous biostratigraphic studies of nearby areas; the data resulting from this process also supported our reinterpreted magnetostratigraphic correlation. We were therefore able to confirm the revised magnetostratigraphic correlation of Zhang et al. (2014).
Directory of Open Access Journals (Sweden)
Shiming Cao
2018-02-01
Full Text Available Metal ions are widely present in flotation pulp. Metal ions change solution chemistry and mineral surface properties, consequently affecting mineral flotation. In this work, the effect of strontium ions on bastnaesite flotation with salicylhydroxamic acid (SHA was investigated by microflotation tests, contact angle measurements, zeta-potential measurements, and X-ray photoelectron spectroscopy (XPS analysis. Microflotation tests confirmed that the addition of strontium ions decreased bastnaesite floatability, compared with that in the absence of strontium ions. Contact angle measurements suggested that the pretreatment of strontium ions decreased SHA adsorption. Zeta potential measurements confirmed that the bastnaesite was depressed by the adsorption of positively charged strontium species, and the lower adsorption capacity of SHA onto the bastnaesite surfaces was obtained after modifying with strontium ions. XPS analysis demonstrated that strontium ions adsorbed onto the bastnaesite surfaces through the interaction between strontium ions and oxygen atoms of surface ≡ CeOH 0 groups. This occurrence hindered surface Ce sites which chelated with SHA and therefore, decreased bastnaesite floatability.
Hormonal-Pheromonal Interrelationships in Ticks and Parasitic Mites.
1986-12-01
II. Maturation and pherumone activity. 15 J. * V IBID 20: 424-439. Gaber , S.H.A., G.M. Khalil, D.E. Sonenshine, and M.A. Moez. Precocene-2 effects on...the camel tick, Hyalomma dromedarii. I. Adult responses. IBID 20: 534-540. Khalil, G.M., S.H.A. Gaber , D.E. Sonenshine, and S.M. Gad. IBID. 2. Larval
Stupazzini, M.; Smerzini, C.; Cauzzi, C.; Faccioli, E.; Galadini, F.; Gori, S.
2009-04-01
Recently the Italian Department of Civil Protection (DPC), in cooperation with Istituto Nazionale di Geofisica e Vulcanologia (INGV) has promoted the 'S2' research project (http://nuovoprogettoesse2.stru.polimi.it/) aimed at the design, testing and application of an open-source code for seismic hazard assessment (SHA). The tool envisaged will likely differ in several important respects from an existing international initiative (Open SHA, Field et al., 2003). In particular, while "the OpenSHA collaboration model envisions scientists developing their own attenuation relationships and earthquake rupture forecasts, which they will deploy and maintain in their own systems", the main purpose of S2 project is to provide a flexible computational tool for SHA, primarily suited for the needs of DPC, which not necessarily are scientific needs. Within S2, a crucial issue is to make alternative approaches available to quantify the ground motion, with emphasis on the near field region. The SHA architecture envisaged will allow for the use of ground motion descriptions other than those yielded by empirical attenuation equations, for instance user generated motions provided by deterministic source and wave propagation simulations. In this contribution, after a brief presentation of Project S2, we intend to illustrate some preliminary 3D scenario simulations performed in the alluvial basin of Sulmona (Central Italy), as an example of the type of descriptions that can be handled in the future SHA architecture. In detail, we selected some seismogenic sources (from the DISS database), believed to be responsible for a number of destructive historical earthquakes, and derive from them a family of simplified geometrical and mechanical source models spanning across a reasonable range of parameters, so that the extent of the main uncertainties can be covered. Then, purely deterministic (for frequencies Journal of Seismology, 1, 237-251. Field, E.H., T.H. Jordan, and C.A. Cornell (2003
Energy Technology Data Exchange (ETDEWEB)
Yun, Yuxing [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; State Key Laboratory of Severe Weather, Chinese Academy of Meteorological Sciences, Beijing China; Fan, Jiwen [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Xiao, Heng [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Zhang, Guang J. [Scripps Institution of Oceanography, University of California, San Diego CA USA; Ghan, Steven J. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Xu, Kuan-Man [NASA Langley Research Center, Hampton VA USA; Ma, Po-Lun [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Gustafson, William I. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA
2017-11-01
Realistic modeling of cumulus convection at fine model resolutions (a few to a few tens of km) is problematic since it requires the cumulus scheme to adapt to higher resolution than they were originally designed for (~100 km). To solve this problem, we implement the spatial averaging method proposed in Xiao et al. (2015) and also propose a temporal averaging method for the large-scale convective available potential energy (CAPE) tendency in the Zhang-McFarlane (ZM) cumulus parameterization. The resolution adaptability of the original ZM scheme, the scheme with spatial averaging, and the scheme with both spatial and temporal averaging at 4-32 km resolution is assessed using the Weather Research and Forecasting (WRF) model, by comparing with Cloud Resolving Model (CRM) results. We find that the original ZM scheme has very poor resolution adaptability, with sub-grid convective transport and precipitation increasing significantly as the resolution increases. The spatial averaging method improves the resolution adaptability of the ZM scheme and better conserves the total transport of moist static energy and total precipitation. With the temporal averaging method, the resolution adaptability of the scheme is further improved, with sub-grid convective precipitation becoming smaller than resolved precipitation for resolution higher than 8 km, which is consistent with the results from the CRM simulation. Both the spatial distribution and time series of precipitation are improved with the spatial and temporal averaging methods. The results may be helpful for developing resolution adaptability for other cumulus parameterizations that are based on quasi-equilibrium assumption.
Economic values for production traits for different sheep breeds in Kosovo
Directory of Open Access Journals (Sweden)
Hysen Bytyqi
2015-10-01
Full Text Available Generally, all traits of economic importance should be included in the breeding goal of livestock breeding programmes. The main aim of this study was to examine economic values for a combination of dairy and meat traits of the dual purpose Bardhoka (BAR, Balusha (BAL, Sharri (SHA and Kosova (KOS sheep breeds in Kosovo. The underlying herd model is based on a deterministic approach considering a sheep flock with milk production, lamb fattening and replacement stock. In order to examine the economic impact for different sheep breeds, the production traits considered were milk (milk yield and fattening (daily gain. For each lactation cycle among the breeds the main revenues resulted from selling milk (€ 61.82/46.03/26.37/27.22 and fattened lambs (€ 34.06/39.88/35.42/33.92 for BAR/BAL/ SHA/KOS, respectively. For BAR and BAL the economic value per average ewe place and year was € 37.7 for both breeds, while for SHA and KOS it was € 35.1 and € 32.5, respectively. For lamb fattening, daily gain was found to have the highest economic value at € 7.00 for BAL, SHA and KOS, while for BAR it was € 6.67. The relative economic values for milk yield and daily gain for BAR, BAL, SHA and KOS were 84.96:15.04, 84.42:15.58, 83.45:16.55, and 82.36:17.64, respectively.
Directory of Open Access Journals (Sweden)
Fan YJ
2015-08-01
Full Text Available Yujuan Fan,* Yu Zhang,* Xuesong Li,* Hui Zheng, Yuping Song, Ning Zhang, Chunfang Shen, Xiaofang Fan, Fengdong Ren, Jiayi Shen, Guoguang Ren, Jialin Yang Department of Endocrinology, Central Hospital of Minhang District, Minhang Hospital affiliated to Fudan University, Shanghai, People’s Republic of China *These authors contributed equally to this work Background: The objective of this study was to assess the effects of metformin monotherapy or combined treatment with a dipeptidyl peptidase-4 inhibitor (vildagliptin on apelin levels in patients with type 2 diabetes mellitus. Methods: Twenty-five patients with poor glycemic control (glycosylated hemoglobin >6.5% [48 mmol/mol] taking 1,000 mg of metformin daily and 25 healthy controls matched for age and body mass index were enrolled in this study. Anthropometric parameters, glycemic and lipid profile, insulin resistance (homeostasis model assessment of insulin resistance index, and apelin levels were measured at baseline and at 12-week and 24-week visits. Results: At baseline, apelin levels were higher in the T2DM patients than in the controls (1.93±1.81 ng/mL versus 6.09±4.90 ng/mL; P<0.05. After 12 weeks, when vildagliptin was added, fasting blood glucose and glycosylated hemoglobin decreased, and apelin levels increased further (from 6.09±4.90 ng/mL to 24.23±12.59 ng/mL; P<0.05. Follow-up at 24 weeks showed no further improvement in the glycemic profile and no further increase in apelin levels. Conclusion: Both metformin and vildagliptin favorably changed glycemic indices and apelin levels. For patients inadequately controlled on a low dose of metformin, addition of vildagliptin may be helpful. Keywords: glucagon-like peptides, glucose-dependent insulinotropic polypeptide, antidiabetic drug, adipocytokine
Quantum dot-induced viral capsid assembling in dissociation buffer
Directory of Open Access Journals (Sweden)
Gao D
2013-06-01
Full Text Available Ding Gao,1,2 Zhi-Ping Zhang,1 Feng Li,3 Dong Men,1 Jiao-Yu Deng,1 Hong-Ping Wei,1 Xian-En Zhang,1 Zong-Qiang Cui1 1State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan, 2Graduate University of Chinese Academy of Sciences, Beijing, 3Division of Nanobiomedicine and i-Lab, Suzhou Institute of Nano-Tech and Nano-Bionics, Chinese Academy of Sciences, Suzhou, People's Republic of China Abstract: Viruses encapsulating inorganic nanoparticles are a novel type of nanostructure with applications in biomedicine and biosensors. However, the encapsulation and assembly mechanisms of these hybridized virus-based nanoparticles (VNPs are still unknown. In this article, it was found that quantum dots (QDs can induce simian virus 40 (SV40 capsid assembly in dissociation buffer, where viral capsids should be disassembled. The analysis of the transmission electron microscope, dynamic light scattering, sucrose density gradient centrifugation, and cryo-electron microscopy single particle reconstruction experimental results showed that the SV40 major capsid protein 1 (VP1 can be assembled into ≈25 nm capsids in the dissociation buffer when QDs are present and that the QDs are encapsulated in the SV40 capsids. Moreover, it was determined that there is a strong affinity between QDs and the SV40 VP1 proteins (KD = 2.19E-10 M, which should play an important role in QD encapsulation in the SV40 viral capsids. This study provides a new understanding of the assembly mechanism of SV40 virus-based nanoparticles with QDs, which may help in the design and construction of other similar virus-based nanoparticles. Keywords: quantum dots, simian virus 40, self-assembly, encapsulation, virus-based nanoparticles
Directory of Open Access Journals (Sweden)
Zhang L
2011-10-01
Full Text Available Ling Zhang1,*, Xiang Gao1,2,*, Ke Men1, BiLan Wang1, Shuang Zhang1, Jinfeng Qiu1, Meijuan Huang1, MaLing Gou1, Ning Huang2, ZhiYong Qian1, Xia Zhao1, YuQuan Wei11State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medical School, 2Department of Pathophysiology, College of Preclinical and Forensic Medical Sciences, Sichuan University, Chengdu, People’s Republic of China*These authors contributed equally to this workBackground: Gene therapy provides a novel method for the prevention and treatment of cancer, but the clinical application of gene therapy is restricted, mainly because of the absence of an efficient and safe gene delivery system. Recently, we developed a novel nonviral gene carrier, ie, heparin-polyethyleneimine (HPEI nanoparticles for this purpose.Methods and results: HPEI nanoparticles were used to deliver plasmid-expressing mouse survivin-T34A (ms-T34A to treat C-26 carcinoma in vitro and in vivo. According to the in vitro studies, HPEI nanoparticles could efficiently transfect the pGFP report gene into C-26 cells, with a transfection efficiency of 30.5% ± 2%. Moreover, HPEI nanoparticle-mediated ms-T34A could efficiently inhibit the proliferation of C-26 cells by induction of apoptosis in vitro. Based on the in vivo studies, HPEI nanoparticles could transfect the Lac-Z report gene into C-26 cells in vivo. Intratumoral injection of HPEI nanoparticle-mediated ms-T34A significantly inhibited growth of subcutaneous C-26 carcinoma in vivo by induction of apoptosis and inhibition of angiogenesis.Conclusion: This research suggests that HPEI nanoparticle-mediated ms-T34A may have a promising role in C-26 colon carcinoma therapy.Keywords: gene therapy, mouse survivin-T34A, colon cancer, polyethyleneimine, nanoparticles, cancer therapy
Kuai, Le; Zhang, Jing-Ting; Deng, Yu; Xu, Shun; Xu, Xun-Zhe; Wu, Min-Feng; Guo, Dong-Jie; Chen, Yu; Wu, Ren-Jie; Zhao, Xing-Qiang; Nian, Hua; Li, Bin; Li, Fu-Lun
2018-01-29
Sheng-ji Hua-yu(SJHY) formula is one of the most useful Traditional Chinese medicine (TCM) in the treatment of the delayed diabetic wound. However, elucidating the related molecular biological mechanism of how the SJHY Formula affects excessive inflammation in the process of re-epithelialization of diabetic wound healing is a task urgently needed to be fulfilled. The objectives of this study is to evaluate the effect of antagonisic expression of pro-/anti-inflammatory factors on transforming growth factor-β(TGF-β) superfamily (activin and follistatin) in the process of re-epithelialization of diabetic wound healing in vivo, and to characterize the involvement of the activin/follistatin protein expression regulation, phospho-Smad (pSmad2), and Nuclear factor kappa B p50 (NF-kB) p50 in the diabetic wound healing effects of SJHY formula. SJHY Formula was prepared by pharmaceutical preparation room of Yueyang Hospital of Integrated Traditional Chinese and Western Medicine. Diabetic wound healing activity was evaluated by circular excision wound models. Wound healing activity was examined by macroscopic evaluation. Activin/follistatin expression regulation, protein expression of pSmad2 and NF-kB p50 in skin tissue of wounds were analyzed by Real Time PCR, Western blot, immunohistochemistry and hematoxylin and eosin (H&E) staining. Macroscopic evaluation analysis showed that wound healing of diabetic mice was delayed, and SJHY Formula accelerated wound healing time of diabetic mice. Real Time PCR analysis showed higher mRNA expression of activin/follistatin in diabetic delayed wound versus the wound in normal mice. Western Blot immunoassay analysis showed reduction of activin/follistatin proteins levels by SJHY Formula treatment 15 days after injury. Immunohistochemistry investigated the reduction of pSmad2 and NF-kB p50 nuclear staining in the epidermis of diabetic SJHY versus diabetic control mice on day 15 after wounding. H&E staining revealed that SJHY Formula
Directory of Open Access Journals (Sweden)
Zhao Y
2017-12-01
Full Text Available Yu-Jie Zhao,1 Wei-Peng Sun,2 Jian-Hong Peng,1 Yu-Xiang Deng,1 Yu-Jing Fang,1 Jun Huang,2 Hui-Zhong Zhang,3 De-Sen Wan,1 Jun-Zhong Lin,1,* Zhi-Zhong Pan,1,* 1Department of Colorectal Surgery, State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Sun Yat-sen University Cancer Center, 2Department of Colorectal Surgery, The Sixth Affiliated Hospital of Sun Yat-sen University, 3Department of Pathology, Sun Yat-sen University Cancer Center, Guangzhou, People’s Republic of China *These authors contributed equally to this work Objective: Increased expression of programmed death-ligand 1 (PD-L1 on tumor cells can be found in various malignancies; however, very limited information is known about its role in anal squamous cell carcinoma (ASCC. This study explored PD-L1 expression in ASCC patients and its association with patients’ clinicopathological features, CD8+ T cell infiltration, and prognosis.Methods: Formalin-fixed paraffin-embedded tumor samples from 26 patients with ASCC were retrieved. The levels of PD-L1 expression on the membrane of both tumor cells and tumor-infiltrating mononuclear cells (TIMCs were evaluated by immunohistochemistry. CD8+ T cell densities, both within tumors and at the tumor–stromal interface, were also analyzed. Baseline clinicopathological characteristics, human papilloma virus (HPV status, and outcome data correlated with PD-L1-positive staining.Results: PD-L1 expression on tumor cells and TIMCs was observed in 46% and 50% of patients, respectively. Nineteen patients (73% were HPV positive, with 7 showing PD-L1-positive staining on tumor cells and 9 showing PD-L1-positive staining on TIMCs. Increasing CD8+ density within tumors, but not immune stroma, was significantly associated with decreased PD-L1 expression by both tumor cells and TIMCs (P=0.0043 and P=0.0007. Patients with negative PD-L1 expression had significantly better progression-free survival (P=0.038 and P
Zhang, Ruilei; Song, Chao; Qi, Xin; Wang, Xinhua
2016-07-05
The subgenus Tripodura Townes of Polypedilum Kieffer from China including 26 species is reviewed. Eleven new species, named P. (T.) absensilobum Zhang & Wang sp. n., P. (T.) apiculusetosum Zhang & Wang sp. n., P. (T.) arcuatum Zhang & Wang sp. n., P. (T.) bilamella Zhang & Wang sp. n., P. (T.) conghuaense Zhang & Wang sp. n., P. (T.) dengae Zhang & Wang sp. n., P. (T.) mengmanense Zhang & Wang sp. n., P. (T.) napahaiense Zhang & Wang sp. n., P. (T.) parallelum Zhang & Wang sp. n., P. (T.) pollicium Zhang & Wang sp. n. and P. (T.) trapezium Zhang & Wang sp. n. are described and illustrated based on male imagines. Three species, P. (T.) quadriguttatum Kieffer, P. (T.) unifascia (Tokunaga) and P. (T.) udominutum Niitsuma are firstly recorded in China. A key to known male imagines of Chinese species and an updated world checklist of subgenus Tripodura are presented.
J-SHIS - an integrated system for knowing seismic hazard information in Japan
Azuma, H.; Fujiwara, H.; Kawai, S.; Hao, K. X.; Morikawa, N.
2015-12-01
An integrated system of Japan seismic hazard information station (J-SHIS) was established in 2005 for issuing and exchanging information of the National Seismic Hazard Maps for Japan that are based on seismic hazard assessment (SHA). A simplified app, also named J-SHIS, for smartphones is popularly used in Japan based on the integrated system of http://www.j-shis.bosai.go.jp/map/?lang=en. "Smartphone tells hazard" is realized on a cellphone, a tablet and/or a PC. At a given spot, the comprehensive information of SHA map can be easily obtained as below: 1) A SHA probability at given intensity (JMA=5-, 5+, 6-, 6+) within 30 years. 2) A site amplification factor varies within 0.5 ~ 3.0 and expectation is 1 based on surface geology map information. 3) A depth of seismic basement down to ~3,000m based on deeper borehole and geological structure. 4) Scenario earthquake maps: By choosing an active fault, one got the average case for different parameters of the modeling. Then choose a case, you got the shaking map of intensity with color scale. "Seismic Hazard Karte tells more hazard" is another app based on website of http://www.j-shis.bosai.go.jp/labs/karte/. (1) For every mesh of 250m x 250m, professional service SHA information is provided over national-world. (2) With five ranks for eight items, comprehensive SHA information could be delivered. (3) Site amplification factor with an average index is given. (4) Deeper geologic structure modeling is provided with borehole profiling. (5) A SHA probability is assessed within 30 and/or 50 years for the given site. (6) Seismic Hazard curves are given for earthquake sources from inland active fault, subduction zone, undetermined and their summarization. (7) The JMA seismic intensities are assessed in long-term averaged periods of 500-years to ~100,000 years. The app of J-SHIS can be downloaded freely from http://www.j-shis.bosai.go.jp/app-jshis.
Influence on grip of knife handle surface characteristics and wearing protective gloves.
Claudon, Laurent
2006-11-01
Ten subjects were asked to apply maximum torques on knife handles with either their bare hand or their hand wearing a Kevlar fibre protective glove. Four knife handles (2 roughnesses, 2 hardnesses) were tested. Surface electromyograms of 6 upper limb and shoulder muscles were recorded and subject opinions on both knife handle hardness and friction in the hand were also assessed. The results revealed the significant influence of wearing gloves (pgloves greatly increased the torque independently of the other two parameters. Under the bare hand condition, a 90 degrees ShA slightly rough handle provided the greatest torque. Subject opinion agreed with the observed effects on recorded torque values except for the hardness factor, for which a preference for the 70 degrees ShA value over the 90 degrees ShA value emerged.
The SCEC Community Modeling Environment(SCEC/CME): A Collaboratory for Seismic Hazard Analysis
Maechling, P. J.; Jordan, T. H.; Minster, J. B.; Moore, R.; Kesselman, C.
2005-12-01
The SCEC Community Modeling Environment (SCEC/CME) Project is an NSF-supported Geosciences/IT partnership that is actively developing an advanced information infrastructure for system-level earthquake science in Southern California. This partnership includes SCEC, USC's Information Sciences Institute (ISI), the San Diego Supercomputer Center (SDSC), the Incorporated Institutions for Research in Seismology (IRIS), and the U.S. Geological Survey. The goal of the SCEC/CME is to develop seismological applications and information technology (IT) infrastructure to support the development of Seismic Hazard Analysis (SHA) programs and other geophysical simulations. The SHA application programs developed on the Project include a Probabilistic Seismic Hazard Analysis system called OpenSHA. OpenSHA computational elements that are currently available include a collection of attenuation relationships, and several Earthquake Rupture Forecasts (ERFs). Geophysicists in the collaboration have also developed Anelastic Wave Models (AWMs) using both finite-difference and finite-element approaches. Earthquake simulations using these codes have been run for a variety of earthquake sources. Rupture Dynamic Model (RDM) codes have also been developed that simulate friction-based fault slip. The SCEC/CME collaboration has also developed IT software and hardware infrastructure to support the development, execution, and analysis of these SHA programs. To support computationally expensive simulations, we have constructed a grid-based scientific workflow system. Using the SCEC grid, project collaborators can submit computations from the SCEC/CME servers to High Performance Computers at USC and TeraGrid High Performance Computing Centers. Data generated and archived by the SCEC/CME is stored in a digital library system, the Storage Resource Broker (SRB). This system provides a robust and secure system for maintaining the association between the data seta and their metadata. To provide an easy
RAS1, a quantitative trait locus for salt tolerance and ABA sensitivity in Arabidopsis
Ren, Zhonghai
2010-03-08
Soil salinity limits agricultural production and is a major obstacle for feeding the growing world population. We used natural genetic variation in salt tolerance among different Arabidopsis accessions to map a major quantitative trait locus (QTL) for salt tolerance and abscisic acid (ABA) sensitivity during seed germination and early seedling growth. A recombinant inbred population derived from Landsberg erecta (Ler; salt and ABA sensitive) x Shakdara (Sha; salt and ABA resistant) was used for QTL mapping. High-resolution mapping and cloning of this QTL, Response to ABA and Salt 1 (RAS1), revealed that it is an ABA- and salt stress-inducible gene and encodes a previously undescribed plant-specific protein. A premature stop codon results in a truncated RAS1 protein in Sha. Reducing the expression of RAS1 by transfer-DNA insertion in Col or RNA interference in Ler leads to decreased salt and ABA sensitivity, whereas overexpression of the Ler allele but not the Sha allele causes increased salt and ABA sensitivity. Our results suggest that RAS1 functions as a negative regulator of salt tolerance during seed germination and early seedling growth by enhancing ABA sensitivity and that its loss of function contributes to the increased salt tolerance of Sha.
Mueller, Michael; Morgan, David
2017-07-01
International comparisons of health spending and financing are most frequently carried out using datasets of international organisations based on the System of Health Accounts (SHA). This accounting framework has recently been updated and 2016 saw the first international data collection under the new SHA 2011 guidelines. In addition to reaching better comparability of health spending figures and greater country coverage, the updated framework has seen changes in the dimension of health financing leading to important consequences when analysing health financing data. This article presents the first results of health spending and financing data collected under this new framework and highlights the areas where SHA 2011 has become a more useful tool for policy analysis, by complementing data on expenditure of health financing schemes with information about their revenue streams. It describes the major conceptual changes in the scope of health financing and highlights why comprehensive analyses based on SHA 2011 can provide for a more complete description and comparison of health financing across countries, facilitate a more meaningful discussion of fiscal sustainability of health spending by also analysing the revenues of compulsory public schemes and help to clarify the role of governments in financing health care - which is generally much bigger than previously documented. Copyright © 2017 Elsevier B.V. All rights reserved.
Status and trends of native birds in the Keauhou and Kilauea forest, Hawai`i Island.
Camp, Richard J.; Jacobi, James D.; Pratt, Thane K.; Gorresen, P. Marcos; Rubenstein, Tanya
2010-01-01
A Safe Harbor Agreement (SHA) is a voluntary arrangement between the U.S. Fish and Wildlife Service and non-Federal landowners to promote the protection, conservation, and recovery of listed species without imposing further land use restrictions on the landowners. Kamehameha Schools is considering entering into a SHA for their Keauhou and Kīlauea Forest lands on the island of Hawai′i. Bird surveys were conducted in 2008 to determine the current occurrence and density of listed species for the Keauhou and Kīlauea Forest, a prerequisite for establishing an agreement. Because of different management practices in the proposed SHA area we stratified the survey data into intact and altered forest strata. The listed passerines—′Akiapōlā′au (Hemignathus munroi), Hawai′i Creeper (Oreomystis mana), and Hawai′i ′Ākepa (Loxops coccineus)—occur in both strata but at low densities. The endangered ′Io (Hawaiian Hawk; Buteo solitarius) also occurs within both strata at low densities. This report was prepared for the U.S. Fish and Wildlife Service and Kamehameha Schools to provide information they can use to establish baseline levels for the SHA. In addition, we describe the status and trends of the non-listed native birds.
Directory of Open Access Journals (Sweden)
Ernani Pinto
2011-04-01
Full Text Available We present here the effect of heavy metals and of different light intensities on the biosynthesis of fatty acids and pigments in the macroalga Gracilaria tenuistipitata (var. liui Zhang & Xia. In order to verify the fatty acid content, gas chromatography with flame ionization detection (GC-FID was employed. Pigments (major carotenoids and chlorophyl-a were monitored by liquid chromatography with diode array detection (HPLC-DAD. Cultures of G. tenuistipitata were exposed to cadmium (Cd2+, 200 ppb and copper (Cu2+, 200 ppb, as well as to different light conditions (low light: 100 µmol.photons.m-2.s-1, or high light: 1000 µmol.photons.m-2.s-1. Cd2+ and Cu2+ increased the saturated and monounsaturated fatty acid content [14:0, 16:0, 18:0, 18:1 (n-7 and 18:1 (n-9] and all major pigments (violaxanthin, antheraxanthin, lutein, zeaxanthin, chlorophyll-a and β-carotene. Both heavy metals decreased the levels of polyunsaturated fatty acids (PUFA [18:2 (n-6, 18:3 (n-6, 18:5 (n-4, 20:4 (n-6, 20:5 (n-3, 22:6 (n-3]. G. tenuistipitata cultures were exposed to high light intensity for five days and no statistically significant differences were observed in the content of fatty acids. On the other hand, the levels of pigments rose markedly for chlorophyll-a and all of the carotenoids studied.
Com traduir i modificar un dels formats bibliogràfics de RefWorks al castellà
Feliu, M. Àngels
2010-01-01
L'ús de gestors de referències com RefWorks agilitza el treball dels autors però el seu ús en castellà presenta dificultats a causa de la seva construcció original en anglès. Per això, un dels formats de RefWorks s'ha adaptat a les normes gramaticals i ortogràfiques del castellà i s'ha posat a disposició de la comunitat científica.
Qi, Xiaoxiao; Wu, Jun; Wang, Lifen; Li, Leiting; Cao, Yufen; Tian, Luming; Dong, Xingguang; Zhang, Shaoling
2013-10-23
'Kuerlexiangli' (Pyrus sinkiangensis Yu), a native pear of Xinjiang, China, is an important agricultural fruit and primary export to the international market. However, fruit with persistent calyxes affect fruit shape and quality. Although several studies have looked into the physiological aspects of the calyx abscission process, the underlying molecular mechanisms remain unknown. In order to better understand the molecular basis of the process of calyx abscission, materials at three critical stages of regulation, with 6000 × Flusilazole plus 300 × PBO treatment (calyx abscising treatment) and 50 mg.L-1GA3 treatment (calyx persisting treatment), were collected and cDNA fragments were sequenced using digital transcript abundance measurements to identify candidate genes. Digital transcript abundance measurements was performed using high-throughput Illumina GAII sequencing on seven samples that were collected at three important stages of the calyx abscission process with chemical agent treatments promoting calyx abscission and persistence. Altogether more than 251,123,845 high quality reads were obtained with approximately 8.0 M raw data for each library. The values of 69.85%-71.90% of clean data in the digital transcript abundance measurements could be mapped to the pear genome database. There were 12,054 differentially expressed genes having Gene Ontology (GO) terms and associating with 251 Kyoto Encyclopedia of Genes and Genomes (KEGG) defined pathways. The differentially expressed genes correlated with calyx abscission were mainly involved in photosynthesis, plant hormone signal transduction, cell wall modification, transcriptional regulation, and carbohydrate metabolism. Furthermore, candidate calyx abscission-specific genes, e.g. Inflorescence deficient in abscission gene, were identified. Quantitative real-time PCR was used to confirm the digital transcript abundance measurements results. We identified candidate genes that showed highly dynamic changes in
张綖《诗余图谱》词调论刍议%A Elementary Analysis on the Theory of Ci-poetry Tune of Zhang Yan's Shiyu Tupu
Institute of Scientific and Technical Information of China (English)
张海涛
2012-01-01
Zhang Yan's Shiyu Tupu is the stereotyped works which shows that Ci-poetry started to depend on metrical(closely related to poetry) instead of temperament(closely related to music).One important symbol is his exploration on the tune of ci-poetry.He was not only the first one that divided the tune of Ci-poetry into three types,but also a research pioneer doing on issues such as"one tune but different names"and"one tune but different styles".What Zhangyan did laid a solid foundation for further study of future generationgs.%张綖的《诗余图谱》是词由音律向格律转变的定型之作,其中一个重要标志便是其对于词调的探讨。该书不仅首创了词调三分法,而且对同调异名和一调多体等问题皆有开拓之功,为后人的进一步研究打下了坚实的基础。
Lifescience Database Archive (English)
Full Text Available Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST...] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb
Lifescience Database Archive (English)
Full Text Available inghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST ... Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb
Lifescience Database Archive (English)
Full Text Available nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a...Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb M
Spline and spline wavelet methods with applications to signal and image processing
Averbuch, Amir Z; Zheludev, Valery A
This volume provides universal methodologies accompanied by Matlab software to manipulate numerous signal and image processing applications. It is done with discrete and polynomial periodic splines. Various contributions of splines to signal and image processing from a unified perspective are presented. This presentation is based on Zak transform and on Spline Harmonic Analysis (SHA) methodology. SHA combines approximation capabilities of splines with the computational efficiency of the Fast Fourier transform. SHA reduces the design of different spline types such as splines, spline wavelets (SW), wavelet frames (SWF) and wavelet packets (SWP) and their manipulations by simple operations. Digital filters, produced by wavelets design process, give birth to subdivision schemes. Subdivision schemes enable to perform fast explicit computation of splines' values at dyadic and triadic rational points. This is used for signals and images upsampling. In addition to the design of a diverse library of splines, SW, SWP a...
Wong, M H; Lau, W M
1985-04-01
An ecological survey was conducted on the roadside vegetation at three different sites: Tai Po, a commercial and residential area (average annual daily traffic (AADT) = 23730; and Shek O and Wu Kai Sha, recreational areas (AADT = 1590 and 20, respectively). Cynodon dactylon and Eleusine indica were the two most dominant species recorded. The Tai Po site had higher Pb contents in both soil and plant, followed by Shek O, and then Wu Kai Sha. Tillers of C. dactylon and E. indica from the three sites were subjected to a series concentrations of Pb(NO3)2. By comparing their indexes of tolerance and values of 14-day EC50 (effective concentration reducing the normal root growth by 50%), roadside populations of the two grasses collected from Tai Po and Shek O, especially the former one, were more tolerant to elevated levels of Pb compared with those collected from Wu Kai Sha.
Lifescience Database Archive (English)
Full Text Available A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),... [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Wong, Moses; Chau, Pui Hing; Cheung, Francis; Phillips, David R; Woo, Jean
2015-01-01
To address the age-friendliness of living environment in cities, the World Health Organization (WHO) launched the "Age-friendly cities" (AFC) initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed. Two quantitative studies on AFC conducted in two Hong Kong districts-Sha Tin and Tuen Mun-were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO's AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores. Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores. District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and infrastructure and higher socio-economic status, but lower
Lifescience Database Archive (English)
Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAS...erence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAS...erence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available : Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, an.... Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped
Lifescience Database Archive (English)
Full Text Available Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST an...ce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL...eference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997)...9 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available en, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST...rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and... Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped
Lifescience Database Archive (English)
Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and ...Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped B
Lifescience Database Archive (English)
Full Text Available ro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199....19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web..., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199
Lifescience Database Archive (English)
Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and ...Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped B
Lifescience Database Archive (English)
Full Text Available nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL
Lifescience Database Archive (English)
Full Text Available nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL
Wu, Chongde; Zhang, Juan; Chen, Wei; Wang, Miao; Du, Guocheng; Chen, Jian
2012-01-01
Lactobacillus casei has traditionally been recognized as a probiotic and frequently used as an adjunct culture in fermented dairy products, where acid stress is an environmental condition commonly encountered. In the present study, we carried out a comparative physiological and proteomic study to investigate lactic-acid-induced alterations in Lactobacillus casei Zhang (WT) and its acid-resistant mutant. Analysis of the physiological data showed that the mutant exhibited 33.8% higher glucose phosphoenolpyruvate:sugar phosphotransferase system activity and lower glycolytic pH compared with the WT under acidic conditions. In addition, significant differences were detected in both cells during acid stress between intracellular physiological state, including intracellular pH, H(+)-ATPase activity, and intracellular ATP pool. Comparison of the proteomic data based on 2D-DIGE and i-TRAQ indicated that acid stress invoked a global change in both strains. The mutant protected the cells against acid damage by regulating the expression of key proteins involved in cellular metabolism, DNA replication, RNA synthesis, translation, and some chaperones. Proteome results were validated by Lactobacillus casei displaying higher intracellular aspartate and arginine levels, and the survival at pH 3.3 was improved 1.36- and 2.10-fold by the addition of 50-mM aspartate and arginine, respectively. To our knowledge, this is the first demonstration that aspartate may be involved in acid tolerance in Lactobacillus casei. Results presented here may help us understand acid resistance mechanisms and help formulate new strategies to enhance the industrial applications of this species.
Lifescience Database Archive (English)
Full Text Available hul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David...n, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST
Lifescience Database Archive (English)
Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe
Lifescience Database Archive (English)
Full Text Available ul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David ..., Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a
Lifescience Database Archive (English)
Full Text Available chul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi...en, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST
Lifescience Database Archive (English)
Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe
Lifescience Database Archive (English)
Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe
Lifescience Database Archive (English)
Full Text Available Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gener...] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb
Lifescience Database Archive (English)
Full Text Available chaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a ...008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G
Lifescience Database Archive (English)
Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...hen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma
Lifescience Database Archive (English)
Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman ... 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available 2-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (19
Lifescience Database Archive (English)
Full Text Available ul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David ..., Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a
Lifescience Database Archive (English)
Full Text Available ltschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and D...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL
Lifescience Database Archive (English)
Full Text Available 8] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1
Lifescience Database Archive (English)
Full Text Available rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G
Lifescience Database Archive (English)
Full Text Available , Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J....Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and
Lifescience Database Archive (English)
Full Text Available lejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma...TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available chul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi...ejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and P
Lifescience Database Archive (English)
Full Text Available Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997)...chaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a
Lifescience Database Archive (English)
Full Text Available fer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new ...-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available 02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip
Lifescience Database Archive (English)
Full Text Available ejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman...X 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997...Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a
Tisaniba, a new genus of marpissoid jumping spiders from Borneo (Araneae: Salticidae).
Zhang, Jun-Xia; Maddison, Wayne P
2014-08-14
Six new species of marpissoid jumping spiders from Sarawak, Borneo, are described in the new genus Tisaniba Zhang & Maddison. They are the type species, T. mulu Zhang & Maddison sp. nov., as well as the species T. bijibijan Zhang & Maddison sp. nov., T. dik Zhang & Maddison sp. nov., T. kubah Zhang & Maddison sp. nov., T. selan Zhang & Maddison sp. nov., and T. selasi Zhang & Maddison sp. nov. The spiders are small and brown to black, living in leaf litter in the tropical forest. Phylogenetic analyses based on 28s and 16sND1 genes indicate that they are a distinctive group within the marpissoids. Diagnostic illustrations and photographs of living spiders are provided for all species.
The 2nd International Conference on Water Resource and Environment (WRE 2016
Directory of Open Access Journals (Sweden)
Zhouli Liu
2016-11-01
Full Text Available Table of contents 01 The eco-toxicological effects of cadmium stress on five ornamental plants Zhouli Liu, Wei Chen, Xingyuan He, Shuai Yu, Weihang Ding 02 Study on the formation and release mechanisms of hydrogen sulfide in Longtan coal mine Jianjun Liu, Yuliang Wu, Kaixiang Fan 03 Coral bleaching in the North Reef of China’s Xisha Islands in 2014 Yuanchao Li, Xinqing Zheng, Shiquan Chen, Haiqun Xie 04 Soil chemical characteristics in a Cunninghamia lanceolata stand suffering from ice-snow damage Jie Li, Zhuomin Wang, Li Xue 05 Diversity of understory vegetation was under a Cunninghamia lanceolata stand suffering from ice-snow damage Zhiyang Lie, Weilong Huang, Tongtong Zhou, Li Xue 06 The effect of water, nitrogen and harvesting time on yield and biomass allocation of Helianthus tuberosus L. Kai Gao, Tiexia Zhu 07 The vertical variation of microbial communities in the sediment of sea cucumber pond Weiteng Mao, Pei Yu, Xinfang Lv, Yunchun Li 08 Indicating significances of alpine plant functional groups to environmental change Peixi Su, Rui Shi 09 Research on the daily CH4 fluxes of soil in summer mangrove community at Yingluogang of Guangxi, China Yong Jiang, Xingbin Chen, Shichu liang 10 Beach protection structures in middle and lower reaches of Yangtze River Junfeng Xu 11 Social responsibility management of large dam project with owner as core: an empirical case in China Jiwei Zhu, Zhao Zhai, Linan Zhou, Yun Le, Li Cao 12 The ecological function value assessment analysis of urban waterfront Jiwei Zhu, Ping Lu, Zhiqian Huang, Bei Zhou 13 Mechanism of diurnal osmotic potential changes and adjustment of three Caragana species in different habitats of the Inner Mongolia Plateau Zhirong Zheng, Shihai Lv, Chaoyang Feng 14 Biodiversity of phytoplankton and environmental influences analysis of Longfeng Wetland, China Nan Song, Yan Liu, Xinxin Lu, Yawen Fan 15 The effect of human activities on culturable soil microbes from Yaoquan Mountain in
Lifescience Database Archive (English)
Full Text Available ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip...A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST
Lifescience Database Archive (English)
Full Text Available .19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web... Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lifescience Database Archive (English)
Full Text Available ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new...2-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available haffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a n...-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL...nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generat
Lifescience Database Archive (English)
Full Text Available [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...l, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J
Lifescience Database Archive (English)
Full Text Available er, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new g...2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip
Lifescience Database Archive (English)
Full Text Available homas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),..., Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gen
Lifescience Database Archive (English)
Full Text Available ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip...andro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI
Lifescience Database Archive (English)
Full Text Available homas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),...haffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a n
The Decision to Produce Altcoins: Miners' Arbitrage in Cryptocurrency Markets
Adam Hayes
2015-01-01
Bitcoin has become the de facto 'gold' standard among cryptocurrencies as it is the most widely accepted in commerce, has the largest mining network, and greatest volume of transactions. Because of this, miners of other SHA-256 cryptocurrencies will tend to convert those altcoins into bitcoin in order to transact in a meaningful way with the real economy. The result is that bitcoin mining regulates that of all other SHA-256 blockchains. Specifically, what matters is the expected number of bit...
Lifescience Database Archive (English)
Full Text Available as L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Ga...inghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new genera
Lifescience Database Archive (English)
Full Text Available 2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...tschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Da
Lifescience Database Archive (English)
Full Text Available as L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Ga...fer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new
Lifescience Database Archive (English)
Full Text Available BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille
Lifescience Database Archive (English)
Full Text Available .2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ltschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and D
Lifescience Database Archive (English)
Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G...Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gener
Lifescience Database Archive (English)
Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available ASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,
Lifescience Database Archive (English)
Full Text Available s L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gap...er, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new g
Lifescience Database Archive (English)
Full Text Available BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille
Lifescience Database Archive (English)
Full Text Available mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G...Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gener
Lifescience Database Archive (English)
Full Text Available STX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,
Lifescience Database Archive (English)
Full Text Available n F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman ...o A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLA
Lifescience Database Archive (English)
Full Text Available ASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,
a new record of zoraptera (insecta) from kenya, with remarks on their
African Journals Online (AJOL)
... Kenyan species has rather fine, short, and comparatively simple metafemoral spines ... The structure found in the current species might be related to this type of .... D.K. Yeates, K. Yoshizawa, Q. Zhang, R. Zhang, W. Zhang, Y. Zhang, J. Zhao,.
Zhu, Jian-Ping
2011-12-01
The Yellow Emperor's Classic of Internal Medicine, created in the Warring States period (475 to 221 BC) described a phenomenon whereby the eastern, western, northern, southern, and central regions were liable to different diseases. It brought forward the principle of treatment in accordance with local conditions. Lv's Spring and Autumn Annals, Huai Nan Tzu (Huainanzi), and the Regiment of Health (Yangshenglun) in the Qin, Han, Wei, Jin, and Southern and Northern Dynasties all describe regional diseases such as goiter (endemic goiter) and yellowish teeth (dental fluorosis) as being caused by geologic and climatic factors. Zhang (miasma), first mentioned in the Han Dynasty, was considered related to the summer heat and dampness particular to the geographical environment of the south. Zhang was further associated with malaria in the Jin Dynasty. General Treatise on the Etiology and Symptomology of Diseases (Zhubingyuanhou Lun), in the Sui Dynasty, held that as a type of poisonous gas, Zhang was the predisposing cause of malaria, seasonal disease, and barbiers, among other conditions. General Guide (Zhinan Zonglun), in the Southern Song Dynasty, regarded Zhang malaria as a separate disease. Healthy Prescription in the Southern Wuling District (Lingnan Weisheng Fang), in the late Song and early Yuan Dynasties, explicitly put forward the concepts of cold Zhang, hot Zhang, and lockjaw Zhang. Guidelines for Treatment of Zhang Malaria (Zhangnue Zhinan), in the Ming Dynasty, maintained that cold Zhang was equivalent to malaria, while hot Zhang and lockjaw Zhang were equivalent to cold damage, the latter of which can be treated by prescriptions for cold damage. Records on Zhang gas and Zhang disease decreased during the Ming and Qing Dynasties.
Investigating the origin of the Chinese name for alfalfa
Sun, Q. Z.; Xu, L. J.; Tang, X. J.; Ma, J. T.; Wang, D.; Li, D.; Liu, Q.; Tao, Y.; Li, F.
2017-02-01
It is assured that alfalfa (Medicago sativa L.) was introduced in Han dynasty. There are cognitive differences on whether Zhang Qian introduced alfalfa. Based on the previous studies, research inductive method was used. The relationship between Zhang Qian and alfalfa introduction was analyzed from the motivation, experience and influence of Zhang Qian to the Western Regions and the image generation of Zhang Qian brought back alfalfa’s seeds. Till to now, there are four opinions about Zhang Qian introducing Alfalfa seeds, including : (1) Zhang Qian introduced alfalfa seeds;(2) Zhang Qian did not introduce alfalfa seeds;(3) the information of Zhang Qian transferring alfalfa;(4)for commemoration Zhang Qian to the Western Regions. Although there are not direct historical materials to support Zhang Qian brought alfalfa seed to Han dynasty, it believes and confirms that the introducing of alfalfa is inextricably interwoven with Zhang Qian’s western travel. Zhangqian brought relative information from western regions during the introduction, which was the basis of non-native theory, and after that, Chinese began to plant alfalfa in Han dynasty., According to historical literatures, it is clear that the Chinese diplomat brought alfalfa seeds back to China. Alfalfa, as the favorite forage to Ferghana horse, have been already planted in Dawan in Han dynasty. Despite the debate, Zhangqian played an important pioneering role in introducing alfalfa.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Properties of ternary NiFeW alloy coating by jet electrodeposition · J K YU J ZHAO M Q YU ... Article ID 43. Effects of static electricity and fabrication parameters on PVDF film properties ..... PING YANG JUN HU YOUCHUN YU BIN WANG ... Studies of thermally assisted interactions of polysulphide polymer with ionic liquids.
Lifescience Database Archive (English)
Full Text Available X 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...chul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi
Lifescience Database Archive (English)
Full Text Available , Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a...LASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a
Lifescience Database Archive (English)
Full Text Available TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a
Lifescience Database Archive (English)
Full Text Available andro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI...2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available dro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-B...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a
Effect of nitrates on embryo induction efficiency in cotton (Gossypium ...
African Journals Online (AJOL)
Fred
cotton species (Zhang, 1994b). Somatic embryogenesis and plant regeneration systems have been established from cotton tissue, protoplasts and ovules (Zhang and Li,. 1992; Feng and Zhang, 1994; Zhang, 1995). Regeneration procedures have been used to obtain genetically modified plants after Agrobacterium- ...
International Nuclear Information System (INIS)
Chen, P.-Y.; Huang, Lynn L.H.; Hsieh, H.-J.
2007-01-01
For long-term culture, murine adipose-derived stromal cells (mADSCs) at latter passages demonstrated a marked decline in proliferative activity, exhibited senescent morphology and reduced differentiation potentials, particularly osteogenesis. To extend the lifespan of mADSCs, two culture conditions containing hyaluronan (HA) was compared in our study, one as a culture medium supplement (SHA), and the other where HA was pre-coated on culture surface (CHA). mADSCs cultivated with SHA exhibited a prolonged lifespan, reduced cellular senescence, and enhanced osteogenic potential compared to regular culture condition (control). Upon CHA treatment, mADSCs tended to form cell aggregates with gradual growth profiles, while their differentiation activities remained similar to SHA groups. After transferring mADSCs from CHA to control surface, they were shown to have an extended lifespan and an increase of osteogenic potential. Our results suggested that HA can be useful for preserving the proliferation and differentiation potentials of long-term cultured mADSCs
Liao, Wayne C; Hsueh, Chiu-Yen; Chan, Chin-Feng
2014-01-01
This study showed that both water extracts (WAF-W) and ethanol extracts (EAF-W) of Auricularia fuscosuccinea (Montagne) Farlow, white strain (AF-W) demonstrated significantly stronger antioxidative effects than did commercially available Tremella fuciformis sporocarp extracts (WSK; with the exception of EAF-W in terms of superoxide radical scavenging activity levels). The moisture retention capacity of WAF-W is as potent as that of sodium hyaluronate (SHA), but less than that of WSK. No corrugation or fissures were observed in WAF-W film; only the SHA and WSK films demonstrated such effects in low-moisture conditions. The WAF-W solution also exhibited stable viscosity at high temperatures, indicating that the WAF-W film was more stable compared with the SHA and WSK films. WAF-W induced no adverse effects when a hen's egg test was performed on the chorioallantoic membrane (CAM). This study demonstrated that WAF-W exhibits excellent potential as a topical material for skin moisturizing and anti-aging effects.
Institute of Scientific and Technical Information of China (English)
骈韵頔
2013-01-01
张小夫以中国深厚的历史文化、传统的声乐、器乐为依托,利用自己丰富的电子音乐技术手段,创作了大量具有强烈中国民族气息的现代电子音乐作品,其中《诺日朗》是其最优秀的作品之一。本文通过仔细分析作品《诺日朗》的音乐发展过程以及作品中主要的三种素材类型,来探讨电子音乐作品中核心素材的演变方式,并以此论证张小夫注重“技术性”与“可听性”、“民族性”三者相结合的创作理念。%With Chinese history and culture , traditional vocal music and instruments as the foundation , Zhang Xiaofu has pro-duced a lot of electronic music works with Chinese style by taking advantage of much electronic music technology .Norlong is one of his best works .The thesis analyses the music developing process and three different material types in this music in detail to discuss the evolution of core material in the works of electronic music and prove Zhang Xiaofu's creative idea of the combination of "technology","audibility"and "nationality"in music.
Sistema predictiu per a evolució de pacients. Aplicació al cas d'asma infantil
Rubia Galera, Ivan de La
2015-01-01
[CATALÀ] S'ha dissenyat una aplicació que permet treballar amb dades de pacients i episodis, preprocessar-les i entrenar models amb algorismes d'aprenentatge automàtic que ofereixen bons resultats. S'ha experimentat amb dades de pacients d'asma infantil de l'hospital de Sant Joan de Déu. [ANGLÈS] We've developed an application that can deal with patient data, preprocess it and train models with machine learning algorithms that have given good results. We've experimented with data from Hosp...
Catalytic Oxidation by Transition Metal Ions in Zeolites.
1984-09-28
exotic schemes were developed. It was previously demonstrated that MoCI5 may be reacted with a HYu (here Yu denotes a steam-stabilized or...34ultrastable" zeolite) to form a MoYu zeolite and HC1 which is removed from the system.1 In this study, MoYu zeolites have been prepared by reacting HYu with Mo
Directory of Open Access Journals (Sweden)
Zhao JH
2017-07-01
Full Text Available Ji-Hui Zhao,1,* Qi-Bo Zhang,1,* Bao Liu,2 Xiang-Hua Piao,1 Yu-Lu Yan,1 Xiao-Ge Hu,1 Kuan Zhou,1 Yong-Tai Zhang,1 Nian-Ping Feng1 1School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People’s Republic of China; 2Anethesiology Department, Augusta University, Augusta, GA, USA *These authors contributed equally to this work Purpose: To enhance the immunogenicity of the model subunit vaccine, ovalbumin (OVA was combined with platycodin (PD, a saponin adjuvant. To reduce the toxicity of PD, OVA, and adjuvant were loaded together into liposomes before being incorporated into a dissolving microneedle array.Methods: OVA- and PD-loaded liposomes (OVA-PD-Lipos were prepared using the film dispersion method. Their uptake behavior, toxicity to mouse bone marrow dendritic cells (BMDCs, and hemolytic activity to rabbit red blood cells (RBCs were evaluated. The OVA-PD-Lipos were incorporated into a dissolving microneedle array. The chemical stability of OVA and the physical stability of OVA-PD-Lipos in microneedle arrays were investigated. The immune response of Institute of Cancer Research mice and potential skin irritation reaction of rabbits to OVA-PD-Lipos-MNs were evaluated.Results: The uptake of OVA by mouse BMDCs was greatly enhanced when OVA was prepared as OVA-PD-Lipos, and in this form, the toxicity of PD was dramatically reduced. OVA was chemically stable as OVA-PD-Lipos, when OVA-PD-Lipos was incorporated into a dissolving microneedle array. Institute of Cancer Research mice treated with OVA-PD-Lipos-MNs showed a significantly enhanced immune response. PD combined with OVA elicited a balanced Th1 and Th2 humoral immune response in mice, with minimal irritation in rabbit skin.Conclusion: The dissolving microneedle array-based system is a promising delivery vehicle for subunit vaccine and its adjuvant. Keywords: subunit vaccine, saponin adjuvant, liposomes, dissolving microneedle array, intradermal vaccination
Directory of Open Access Journals (Sweden)
Zhou GC
2013-02-01
Full Text Available Guichen Zhou,1,2,* Ying Lu,1,* He Zhang,1,* Yan Chen,1 Yuan Yu,1 Jing Gao,1 Duxin Sun,3 Guoqing Zhang,2 Hao Zou,1 Yanqiang Zhong1 1Department of Pharmaceutical Science, Second Military Medical University, Shanghai, People's Republic of China; 2Department of Pharmacy, East Hospital of Hepatobiliary Surgery, Shanghai, People's Republic of China; 3Department of Pharmaceutical Sciences, University of Michigan, Ann Arbor, MI, USA*These authors contributed equally to this workPurpose: The aim of this report was to introduce a novel “core-membrane” microgel drug-delivery device for spontaneously pulsed release without any external trigger.Methods: The microgel core was prepared with alginate and chitosan. The semipermeable membrane outside the microgel was made of polyelectrolytes including polycation poly(allylamine hydrochloride and sodium polystyrene sulfonate. The drug release of this novel system was governed by the swelling pressure of the core and the rupture of the outer membrane.Results: The size of the core-membrane microgel drug-delivery device was 452.90 ± 2.71 µm. The surface charge depended on the layer-by-layer coating of polyelectrolytes, with zeta potential of 38.6 ± 1.4 mV. The confocal microscope exhibited the layer-by-layer outer membrane and inner core. The in vitro release profile showed that the content release remained low during the first 2.67 hours. After this lag time, the cumulative release increased to 80% in the next 0.95 hours, which suggested a pulsed drug release. The in vivo drug release in mice showed that the outer membrane was ruptured at approximately 3 to 4 hours, as drug was explosively released.Conclusion: These data suggest that the encapsulated substance in the core-membrane microgel delivery device can achieve a massive drug release after outer membrane rupture. This device was an effective system for pulsed drug delivery.Keywords: polyelectrolyte, chitosan–alginate, microgels, layer-by-layer, pulsed
Lifescience Database Archive (English)
Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J....t BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jing...hui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and
Lifescience Database Archive (English)
Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J....t BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jing...hui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and
Institute of Scientific and Technical Information of China (English)
ZHANG; Junhui
2005-01-01
., Hogstrup, J. et al., The budget of turbulent kinetic energy in the marine atmospheric surface layer,Air-Sea Exchange: Physics, Chemistry, and Dynamics (ed. Geernaert, G.L.), Dordrecht: Kluwer Academic Publishers, 1999, 153-173.[23]Zhang, N., Yu, G. R., Yu, Z. L. et al., Analysis on factors affecting net primary productivity distribution in Changbai Mountains based on process model for landscape scale, Chinese Journal of Applied Ecology, 2003, 14: 659-664.[24]Zhang, J. H., Han, S. J., Yu, G. R., Seasonal variation in carbon dioxide exchange over a 200-year-old Chinese broad-leaved Korean pinemixed forest, Agricultural and Forest Meteorology, 2004, submitted.[25]Lin, L.S., Carbon flux across soil-atmosphere interface in broad-leaved Korean pine mixed forest in Changbai Mountains, Ph.D. Thesis,Chinese Academy of Sciences, China (in Chinese), 2004.[26]Zhang, J. H., Structures of and dominant exchange processes across canopy-atmosphere, soil-atmosphere interfaces in broad-leaved Koreanpine mixed forest of Changbai Mountains, Ph.D. Thesis, Chinese Academy of Sciences, China (in Chinese), 2002.[27]See footnote 1) on page 89.
Lifescience Database Archive (English)
Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...t BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jing...hui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and
Directory of Open Access Journals (Sweden)
Nesin M.A.
2017-12-01
Full Text Available This article contains a review of the monograph by Yu.V. Seleznev published in early 2017 and dedicated to the relations of Russian princes with the Golden Horde’s khans and their status among the Golden Horde’s nobility. This work is the first comprehensive study in the historiography of this issue for all two and a half centuries of the Tartar domination. The monograph was published for the first time in 2013 and served as the basis for a doctoral dissertation, which Seleznev defended in 2015. The book was reprinted with certain changes in 2017. The book commendably contains an abundance of factual material through the use of diverse sources and strands of historiography. Seleznev examines the social terminology of Golden Horde-Russian relations, the structure of the Golden Horde’s nobility and the trips of princes to the Horde, drawing attention not only to the status of the great Vladimir and Moscow princes, but also that of other great and appanage princes. He makes a significant contribution to the resolving the debate regarding the nature of the Golden Horde’s domination in Rus’ by examining in detail the relationship of the Russian princes with the Golden Horde’s authorities in different years. The book’s author proposed to divide the Golden Horde’s “yoke” into seven periods characterized by “changes in the degree of sovereignty and jurisdiction of the khan in relation to Russian principalities”. The author of this review agrees with the main conclusions of the book under review, but at the same time he notes some reservations and criticisms, which do not, however, reduce the academic caliber of the monograph.
Rotational Rebound Attacks on Reduced Skein
DEFF Research Database (Denmark)
Khovratovich, Dmitry; Nikolić, Ivica; Rechberger, Christian
2014-01-01
ciphers, including the new standard SHA-3 (Keccak). The rebound attack is a start-from-the-middle approach for finding differential paths and conforming pairs in byte-oriented designs like Substitution-Permutation networks and AES. We apply our new compositional attack to the reduced version of the hash...... number of rounds. We also use neutral bits and message modification methods from the practice of collision search in MD5 and SHA-1 hash functions. These methods push the rotational property through more rounds than previous analysis suggested, and eventually establish a distinguishing property...
Wong, Moses; Chau, Pui Hing; Cheung, Francis; Phillips, David R.; Woo, Jean
2015-01-01
Background To address the age-friendliness of living environment in cities, the World Health Organization (WHO) launched the “Age-friendly cities” (AFC) initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed. Methodology Two quantitative studies on AFC conducted in two Hong Kong districts—Sha Tin and Tuen Mun—were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO’s AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores. Results Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores. Conclusions District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and
Directory of Open Access Journals (Sweden)
Moses Wong
Full Text Available To address the age-friendliness of living environment in cities, the World Health Organization (WHO launched the "Age-friendly cities" (AFC initiative in 2005. To date, however, no universal standard tool for assessing age-friendliness of a community has been agreed.Two quantitative studies on AFC conducted in two Hong Kong districts-Sha Tin and Tuen Mun-were compared. A total of 801 residents aged ≥50 years were interviewed using structured questionnaires based on the WHO's AFC criteria. District-wide differences in age-friendliness were compared on the basis of eight domain scores. Multiple linear regression was used to examine associations with demographic and socio-economic characteristics. The provision of services and amenities was also compared to help explain the difference in domain scores.Variations in mean domain scores were observed in both districts. Sha Tin showed significantly lower scores in outdoor spaces and buildings, transportation, social participation, respect and social inclusion, civic participation and employment, communication and information, as compared with Tuen Mun. Although a significantly higher score on the housing domain was observed in Sha Tin, differences in community and health services domains were insignificant. Socio-demographic factors, such as age group, gender, area of residence, type of housing, experience of elderly care, employment status, self-rated health and income, were associated with domain scores. However, variations in services and amenities provision appeared not to be strongly associated with district-wide difference in domain scores.District differences in public opinions towards age-friendly characteristics were observed in this study. Except for two of the eight domains, Sha Tin had significantly lower scores than Tuen Mun. Some socio-demographic indicators seemed predictive to the differences. Paradoxically, Sha Tin had better services and infrastructure and higher socio
Hydroxyapatite from fish scale for potential use as bone scaffold or regenerative material
Energy Technology Data Exchange (ETDEWEB)
Pon-On, Weeraphat, E-mail: fsciwpp@ku.ac.th [Department of Physics, Faculty of Science, Kasetsart University, Bangkok (Thailand); Suntornsaratoon, Panan [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Charoenphandhu, Narattaphol [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Department of Physiology, Faculty of Science, Mahidol University, Bangkok (Thailand); Thongbunchoo, Jirawan [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Krishnamra, Nateetip [Center of Calcium and Bone Research, Faculty of Science, Mahidol University, Bangkok (Thailand); Department of Physiology, Faculty of Science, Mahidol University, Bangkok (Thailand); Tang, I. Ming [Department of Materials Science, Faculty of Science, Kasetsart University, Bangkok 10900 (Thailand)
2016-05-01
The present paper studies the physico-chemical, bioactivity and biological properties of hydroxyapatite (HA) which is derived from fish scale (FS) (FSHA) and compares them with those of synthesized HA (sHA) obtained by co-precipitation from chemical solution as a standard. The analysis shows that the FSHA is composed of flat-plate nanocrystal with a narrow width size of about 15–20 nm and having a range of 100 nm in length and that the calcium phosphate ratio (Ca/P) is 2.01 (Ca-rich CaP). Whereas, synthesized HA consists of sub-micron HA particle having a Ca/P ratio of 1.65. Bioactivity test shows that the FSHA forms more new apatite than does the sHA after being incubated in simulated body fluid (SBF) for 7 days. Moreover, the biocompatibility study shows a higher osteoblast like cell adhesion on the FSHA surface than on the sHA substrate after 3 days of culturing. Our results also show the shape of the osteoblast cells on the FSHA changes from being a rounded shape to being a flattened shape reflecting its spreading behavior on this surface. MTT assay and ALP analysis show significant increases in the proliferation and activity of osteoblasts over the FSHA scaffold after 5 days of culturing as compared to those covering the sHA substrates. These results confirm that the bio-materials derived from fish scale (FSHA) are biologically better than the chemically synthesized HA and have the potential for use as a bone scaffold or as regenerative materials. - Highlights: • Preparation of hydroxyapatite (HA) which is derived from fish scale (FS) (FSHA) and their bioactivities • The FSHA is composed of flat-plate nanocrystal with a narrow size of 15–20 nm. • Bioactivity test shows that the FSHA forms more new apatite than does the sHA after being incubated SBF. • In vitro cell availability tests show a higher cell adhesion on the FSHA surface.
Institute of Scientific and Technical Information of China (English)
Xiao Long
2006-01-01
@@ In China, bank governors belong to one of the celebrity business,men clubs that enjoy great power.Entrepreneurs are always happy to know them, as a good relationship with the bankers can normally bring advantages when applying for loans. The close ties between entrepreneurs and bankers also generate risks, however, and the banking industry has proven to be one of the most risk-laden places in terms of corruptions and fund embezzlements.
Aasia: missioon "Hiina" / Xiaotian Zhang
Zhang, Xiaotian
2011-01-01
Hiina ja Põhjamaade ärisuhete pikk ajalugu. Eesti, Soome, Rootsi ja Hiina koostööprogramm BENCH (Beneficial Business Relations between the Central Baltic Region and China, 2007-2013). Diagramm "Soome, Rootsi ja Eesti Kaubavahetus Hiinaga"
Bibliography of Soviet Laser Developments, Number 86, November - December 1986.
1987-12-01
Rudnitskaya, A.A.; Librovich, N.B.; Fialkov , Yu.Ya. (IKhF). Ion-molecular interactions in H(sub2)SO(sub4) - diethyl ether and H(sub2)SO(sub4... FIALKOV YU YA 94 GIPPIUS N A 104 DOLGOV-SAVEL’YEV G G 24 FILIMONOV D A 100 GIRDAUSKAS V V 64 DONRACHEV S 1 50 FILIPPOV 0 K 80 GIRENKO YU N 21
Directory of Open Access Journals (Sweden)
Yu KF
2013-07-01
Full Text Available Ke-Fu Yu,1 Wei-Qiang Zhang,1 Li-Min Luo,1 Ping Song,1 Dan Li,1 Ruo Du,1 Wei Ren,1 Dan Huang,1 Wan-Liang Lu,1,2 Xuan Zhang,1 Qiang Zhang1,2 1Department of Pharmaceutics, School of Pharmaceutical Sciences, Peking University, Beijing, People’s Republic of China; 2State Key Laboratory of Natural and Biomimetic Drugs, School of Pharmaceutical Sciences, Peking University, Beijing, People’s Republic of China Abstract: Considering the fact that iRGD (tumor-homing peptide demonstrates tumor-targeting and tumor-penetrating activity, and that B16-F10 (murine melanoma cells overexpress both αv integrin receptor and neuropilin-1 (NRP-1, the purpose of this study was to prepare a novel doxorubicin (DOX-loaded, iRGD-modified, sterically-stabilized liposome (SSL (iRGD-SSL-DOX in order to evaluate its antitumor activity on B16-F10 melanoma cells in vitro and in vivo. The iRGD-SSL-DOX was prepared using a thin-film hydration method. The characteristics of iRGD-SSL-DOX were evaluated. The in vitro leakage of DOX from iRGD-SSL-DOX was tested. The in vitro tumor-targeting and tumor-penetrating characteristics of iRGD-modified liposomes on B16-F10 cells were investigated. The in vivo tumor-targeting and tumor-penetrating activities of iRGD-modified liposomes were performed in B16-F10 tumor-bearing nude mice. The antitumor effect of iRGD-SSL-DOX was evaluated in B16-F10 tumor-bearing C57BL/6 mice in vivo. The average particle size of the iRGD-SSL-DOX was found to be 91 nm with a polydispersity index (PDI of 0.16. The entrapment efficiency of iRGD-SSL-DOX was 98.36%. The leakage of DOX from iRGD-SSL-DOX at the 24-hour time point was only 7.5%. The results obtained from the in vitro flow cytometry and confocal microscopy, as well as in vivo biodistribution and confocal immunofluorescence microscopy experiments, indicate that the tumor-targeting and tumor-penetrating activity of the iRGD-modified SSL was higher than that of unmodified SSL. In vivo antitumor activity
Zhang, Keda; Zeng, Xiaobin; Chen, Yonggang; Zhao, Rong; Wang, Hui; Wu, Jinhu
2017-01-25
Qian-Yu decoction (QYD) is a traditional Chinese medicinal recipe composed of Radix astragali (Astragalus membranaceus (Fisch.) Bunge var. mongholicus (Bunge) P.K. Hsiao, Fabaceae ), Herba epimedii (Epimedium brevicornum Maxim., Berberidaceae), Herba leonuri (Leonurus japonicus Houtt., Lamiaceae), Cortex phellodendri (Phellodendron chinense Schneid., Rutaceae) and Radix achyranthis bidentatae (Achyranthes bidentata Bl., Amaranthaceae). This study aimed to evaluate the therapeutic activity of QYD against carrageenan-induced chronic prostatic/chronic pelvic pain syndrome (CP/CPPS) in rats and further elucidate its effective components. Three types of components, total polysaccharides, total flavonoids and total saponins were separately extracted from QYD. Carrageenan-induced CP/CPPS rats were intragastrically administered with lyophilized product of QYD, individual extracts and all the combined forms of extracts for three weeks. Prostatic index (PI) was determined and histopathological analysis was performed. The levels of tumor necrosis factor alpha (TNF-α), interleukin-1 beta (IL-1β), cyclooxygenase-2 (COX-2) and prostaglandin E2 (PEG2) in rat prostate tissues were measured using ELISA. The production of inducible nitric oxide synthase (iNOS) was evaluated by an enzymatic activity assay, and the release of nitric oxide (NO) was determined by a nitrate/nitrite assay. Treatment with QYD significantly ameliorated the histological changes of CP/CPPS rats and reduced the PI by 44.3%, with a marked downregulation of TNF-α (42.8% reduction), IL-1β (45.3%), COX-2 (36.6%), PGE2 (44.2%), iNOS (54.1%) and NO (46.0%). Each of three extracts attenuated the symptom of CP/CPPS, but much more weakly than QYD. The combined administration of three extracts showed efficacy comparable to that of QYD while better than that of any combination of two extracts. A principal component analysis of the six inflammatory mediators as variables indicated that the effects of TS on CP
Shirayama, Yukihiko; Ishima, Tamaki; Oda, Yasunori; Okamura, Naoe; Iyo, Masaomi; Hashimoto, Kenji
2015-09-15
The role of neuropeptide S (NPS) in depression remains unclear. We examined the antidepressant-like effects of NPS infusions into the shell or core regions of the nucleus accumbens (NAc) and into the bed nucleus of the stria terminalis (BNST) of learned helplessness (LH) rats (an animal model of depression). Infusions of NPS (10 pmol/side) into the NAc shell, but not the NAc core and BNST, exerted antidepressant-like effects in the LH paradigm. Implying that behavioral deficits could be improved in the conditioned avoidance test. Coinfusion of SHA68 (an NPS receptor antagonist, 100 pmol/side) with NPS into the NAc shell blocked these effects. In contrast, NPS receptor antagonism by SHA68 in the BNST induced antidepressant-like effects. Infusions of NPS into the NAc shell or SHA68 into the BNST did not produce memory deficits or locomotor activation in the passive avoidance and open field tests. These results suggest that excitatory and inhibitory actions by the NPS system are integral to the depression in LH animals. Copyright © 2015 Elsevier B.V. All rights reserved.
Soil and applied sulphur utilization by sunflower grown on vertisol under rainfed conditions
International Nuclear Information System (INIS)
Sreemannarayana, B.; Sreenivasa Raju, A.
1993-01-01
In a field experiment, conducted with sunflower genotypes viz., Morden, APSH-11, and EC 68414 grown on a local black clay loam soil, fertilizer sulphur (labelled with 35 S) was applied at the rate of 0, 20, 40 and 60 kg S/ha through gypsum and ammonium sulphate. Among the sunflower genotypes, EC 68414 utilized maximum sulphur from the sources at any given growth stage i.e., star, bud, flowering and maturity. Sulphur applied through ammonium sulphate resulted in highest S utilization by all the genotypes at all the stages of growth. Though, sulphur uptake showed an increase, the S utilization decreased with increase in levels of S. The S uptake was highest at 60 kg S/ha level applied through any of the sources. The soil S uptake was higher than fertilizer S uptake at any given stage of crop. Maximum yields were recorded at 40 kg S/ha level signifying that this dose is optimum for sunflower grown on black clay loam soils. (author). 17 refs., 3 tabs
New name, fiaxtion of correct spelling of three leafhopper taxa (Hemiptera: Cicadellidae)
The leafhopper genus Aspidia Yang & Zhang is a junior homonym and replaced here by Sochinsogonoidea, nomen novum. Nilgiriscopus Viraktamath and Roxasellana stellata Zhang & Zhang are fixed as the correct original spellings....
International Nuclear Information System (INIS)
Yu Qiucheng; Huang Baocai; Zhang Zhiming; Liu Luxiang; Xu Guozhan
2006-01-01
The sterility lines Yu-08A was developed through the treatment of free-magnetic field for one year and selection by back-crossing with its parent in vitro and in the field from 1995 to 2000. The abortive fertility of sterility (Yu-08A) was stable and free-setting was 100%. The propagation yield of Yu-08A was 58.1% higher than that of Zhensan 97A, and the hybrid propagation of Yu-08A crossing-over with 97-066 was 62.6% higher than that of Zhensan 97A crossing-over with Minghui 63 in the same season and the same field. The yield of hybrid (Yuyou No.1, obtained from Yu-08A crossing-over with 97-066) was 5%8% higher than Zhensan 97A crossing-over with Minghuei 63. the rice quality of hybrid Yuyou No.1 reaches the second grade high-quality standard issued by the Ministry of Agriculture. (authors)
Li, Shengyao; Guo, Ming; Mao, Huimin; Gao, Zhuye; Xu, Hao; Shi, Dazhuo
2016-09-15
Recurrent cardiovascular event remains high in stable coronary artery disease (SCAD), especially in patients with multiple risk factors, despite a high rate of use conventional treatment. Traditional Chinese Medicine (TCM) is a promising complementary and alternative medicine for treating SCAD, while evidence for its effect on long-term survival is limited. This study was designed to test if Chinese herbal medicine in addition to conventional treatment is more effective than conventional treatment alone in reducing major adverse cardiac event (MACE) for SCAD patients with multiple risk factors during a 1-year follow-up. This is a multicenter, placebo-controlled, double-blinded, randomized controlled clinical trial. A total of 1500 patients are randomized in a 1:1 ratio to receive the Qing-Xin-Jie-Yu Granules (QXJYG) or the placebo granules, twice daily for 6 months. The primary outcome is the combined outcomes including cardiac death, nonfatal myocardial infarction and revascularization. The secondary outcome is the combined outcomes including all-cause mortality, re-admission for acute coronary syndrome (ACS), heart failure, malignant supraventricular and ventricular arrhythmia influencing hemodynamics, ischemic stroke, and other thromboembolic events during 1-year follow-up. The assessment is performed at baseline (before randomization), 1, 3, 6, 9, and 12 months after randomization. This is the first multicenter trial sponsored by the national funding of China to evaluate TCM in combination with conventional treatment on 1-year survival in high-risk SCAD patients. If successful, it will provide an evidence-based complementary therapeutic approach for reducing MACE from SCAD. The trial was registered in the Chinese Clinical Trial Registry on December 28, 2013. The registration number is ChiCTR-TRC-13004370 .
An Analysis of Navy Nurse Corps Accession Sources
2014-03-01
1 I. INTRODUCTION A. BACKGROUND Since 1998, the United States has experienced a nationwide nursing shortage (Juraschek, Zhang, Ranganathan ...supply of RNs in the civilian workforce (Juraschek, Zhang, Ranganathan , & Lin, 2012). A study by Juraschek, Zhang, Ranganathan , & Lin (2012...Postgraduate School, Monterey, CA. Retrieved from www.dtic.mil/cgi- bin/GetTRDoc?AD=ADA344570 Juraschek, S. P., Zhang, X., Ranganathan , V. K., & Lin, V
Isolation and identification of two galangin metabolites from rat urine ...
African Journals Online (AJOL)
Isolation and identification of two galangin metabolites from rat urine and determination of their in vitro hypolipidemic activity. Xuguang Zhang, Shouqian Cheng, Hailong Li, Xiaopo Zhang, Feng Chen, Youbin Li, Junqing Zhang, Yinfeng Tan ...
Reparació de l'espina bífida fetal amb tècniques no agressives
García Fontecha, César Galo
2010-01-01
La malformació congènita que suposa l'espina bífida comporta trastorns i lesions irreversibles que dificultaran el desenvolupament d'una vida normal en l'afectat, podent fins i tot morir en els seus primers anys de vida. Per als casos d'espina bífida, s'ha considerat la interrupció legal de l'embaràs o la intervenció quirúrgica en el moment del naixement, encara que en les últimes dècades s'ha optat per la reparació intrauterina. Aquest treball suposa un avenç en aquest aspecte, ja que propos...
Aumasson, Jean-Philippe; Phan, Raphael; Henzen, Luca
2014-01-01
This is a comprehensive description of the cryptographic hash function BLAKE, one of the five final contenders in the NIST SHA3 competition, and of BLAKE2, an improved version popular among developers. It describes how BLAKE was designed and why BLAKE2 was developed, and it offers guidelines on implementing and using BLAKE, with a focus on software implementation. In the first two chapters, the authors offer a short introduction to cryptographic hashing, the SHA3 competition, and BLAKE. They review applications of cryptographic hashing, they describe some basic notions such as security de
Newlook : desenvolupament d'un comerç online
Balasch Pérez, David; Universitat Autònoma de Barcelona. Escola d'Enginyeria
2015-01-01
El comerç online suposa un gran avanç per les empreses que es dediquen a aquest sector, ja que, Internet ha suposat un increment important dins d'aquesta industria i tot el sector que és dedica a la venda de productes, per tant, tots ells han de disposar d'un sistema adaptable a qualsevol dispositiu mòbil, ja que no podem oblidar que la venda d'aquests dispositius s'ha incrementat notablement en els últims anys. Aquest projecte s'ha desenvolupament amb la motivació de crear una pàgina web ada...
Concurso NIST. Análisis del concurso (2007-2012)
Martín Sierra, Marían
2014-01-01
El objetivo de este proyecto es dar a conocer el concurso SHA-3, concurso que ha transcurrido durante los últimos años y que ha promovido el Instituto Nacional de Estándares y Tecnología, también conocido como NIST, con el objetivo de encontrar el nuevo algoritmo criptográfico de función resumen SHA-3 que se utilizará de estándar de aquí en adelante. Con este fin se ha realizado un estudio sobre criptografía en general y sobre algunos de los algoritmos criptográficos de func...
Comportamiento mecánico de las juntas tipo T-bolt en materiales compuestos gruesos
Martínez Moll, Víctor
2003-01-01
En aquest treball s'ha realitzat una anàlisi de la junta T-bolt aplicada a la unió de laminats gruixuts amb elements metàl·lics. Més concretament, l'estudi es centra en el tipus de juntes T-bolt emprades en la unió entre les pales i la boixa de grans aerogeneradors, que constitueix una de les principals aplicacions d'aquest tipus de junta.En primer lloc, s'ha realitzat una anàlisi simplificada dels factors que influeixen al comportament de la junta, a partir del qual es justifica la necessit...
Directory of Open Access Journals (Sweden)
Sheng-Ping Guo
2016-12-01
Full Text Available During the infamous Nanking Atrocity, some Western businesspersons and missionaries established the Nanking Safety Zone to protect about 250,000 refugees. When the Japanese army was pressing on Nanking, Minnie Vautrin, an educational missionary from the United Christian Missionary Society, took charge of the Ginling College campus. As one of the 25 refugee camps, Ginling provided shelter to about 10,000 women and children in late December 1937—the hardest time during World War II in China. With her neutral identity of American nationality, Vautrin seriously struggled with Japanese soldiers when they were seizing Chinese women for rape from the campus; thus, she helped many women avoid the possible fate of sexual violence and slaughter. The Chinese people promoted her as a “Goddess of Mercy”, in the Chinese language a “Living Buddha” (Huo pu sa or “Guanyin Buddha” (Guan Yin pu sa. The Chinese central government awarded her the Order of Jade (Cai Yu xun zhang. Drawing from Vautrin’s diaries and other original materials, this paper narrates this Christian female missionary’s moving story in humanism, evangelism, and internationalism. Her devotion to the Chinese refugee women and children made her an eyewitness to the Nanking Massacre, a rehabilitator of refugee sufferings, and a mental and bodily victim of disastrous war.
Directory of Open Access Journals (Sweden)
Wu B
2017-09-01
Full Text Available Bo Wu,1,2 Shu-Ting Lu,1 Kai Deng,2 Hui Yu,2 Can Cui,2 Yang Zhang,2 Ming Wu,2 Ren-Xi Zhuo,2 Hai-Bo Xu,1 Shi-Wen Huang2 1Department of Radiology, Zhongnan Hospital of Wuhan University, 2Key Laboratory of Biomedical Polymers, Ministry of Education, Department of Chemistry, Wuhan University, Wuhan, People’s Republic of China Abstract: In recent years, there has been increasing interest in developing a multifunctional nanoscale platform for cancer monitoring and chemotherapy. However, there is still a big challenge for current clinic contrast agents to improve their poor tumor selectivity and response. Herein, we report a new kind of Gd complex and folate-coated redox-sensitive lipid-polymer hybrid nanoparticle (Gd-FLPNP for tumor-targeted magnetic resonance imaging and therapy. Gd-FLPNPs can simultaneously accomplish diagnostic imaging, and specific targeting and controlled release of doxorubicin (DOX. They exhibit good monodispersity, excellent size stability, and a well-defined core-shell structure. Paramagnetic nanoparticles based on gadolinium-diethylenetriaminepentaacetic acid-bis-cetylamine have paramagnetic properties with an approximately two-fold enhancement in the longitudinal relaxivity compared to clinical used Magnevist. For targeted and reduction-sensitive drug delivery, Gd-FLPNPs released DOX faster and enhanced cell uptake in vitro, and exhibited better antitumor effect both in vitro and in vivo. Keywords: redox-sensitive, tumor-targeted, gadolinium, contrast agents, PLGA
Hajam, Irshad Ahmed; Lee, John Hwa
2017-06-01
Recombinant Salmonella strains expressing foreign heterologous antigens have been extensively studied as promising live vaccine delivery vehicles. In this study, we constructed attenuated smooth (S-HA) and rough (R-HA) Salmonella strains expressing hemagglutinin (HA) of H9N2, a low pathogenic avian influenza A virus. We then investigated the HA-specific immune responses following oral immunization with either S-HA or R-HA strain in chicken model. We further examined the effects of the preexisting anti-Salmonella immunity on the subsequent elicitation of the HA and the Salmonella ompA specific immune responses. Our results showed that primary immunization with either the S-HA or the R-HA strain elicited comparable HA-specific immune responses and the responses were significantly (pSalmonella vector control. When chickens were pre-immunized with the smooth Salmonella carrier alone and then vaccinated with either S-HA or R-HA strain 3, 6 and 9 weeks later, respectively, significant reductions were seen for HA-specific immune responses at week 6, a point which corresponded to the peak of the primary Salmonella-specific antibody responses. No reductions were seen at week 3 and 9, albeit, the HA-specific immune responses were boosted at week 9, a point which corresponded to the lowest primary Salmonella-specific antibody responses. The ompA recall responses remain refractory at week 3 and 6 following deliberate immunization with the carrier strain, but were significantly (pSalmonella immunity inhibits antigen-specific immune responses and this effect could be avoided by carefully selecting the time point when carrier-specific immune responses are relatively low. Copyright © 2017 Elsevier B.V. All rights reserved.
Self-stigma and empowerment in combined-CMHA and consumer-run services: two controlled trials.
Segal, Steven P; Silverman, Carol J; Temkin, Tanya L
2013-10-01
Self-help agencies (SHAs) are consumer-operated service organizations managed as participatory democracies involving members in all management tasks. Hierarchically organized board- and staff-run consumer-operated service programs (BSR-COSPs) are consumer managed, but they afford members less decision-making power. This study considered the relative effectiveness of SHAs and BSR-COSPs working jointly with community mental health agencies (CMHAs) and the role of organizational empowerment in reducing self-stigma. Clients seeking CMHA services were assigned in separate randomized controlled trials to a trial of combined SHA and CMHA services versus regular CMHA services (N=505) or to a trial of combined BSR-COSP and CMHA services versus regular CMHA services (N=139). Self-stigma, organizational empowerment, and self-efficacy were assessed at baseline and eight months with the Attitudes Toward Persons With Mental Illness Scale, the Organizationally Mediated Empowerment Scale, and the Self-Efficacy Scale. Outcomes were evaluated with fully recursive path analysis models. SHA-CMHA participants experienced greater positive change in self-stigma than CMHA-only participants, a result attributable to participation in the combined condition (b=1.20, p=.016) and increased organizational empowerment (b=.27, p=.003). BSR-COSP-CMHA participants experienced greater negative change in self-stigma than CMHA-only participants, a result attributable to participation in the combined service (b=-4.73, p=.031). In the SHA-CMHA trial, participants showed positive change in self-efficacy, whereas the change among BSR-COSP-CMHA participants was negative. Differential organizational empowerment efforts in the SHA and BSR-COSP appeared to account for the differing outcomes. Members experienced reduced self-stigma and increases in self-efficacy when they were engaged in responsible roles.
Malannotte-Rizzoli, Paola
2003-01-01
The effort of this first year of research has been focused on the assimilation of TOPEX/Poseidon altimetric data into a primitive equation model of the Atlantic tropical/subtropical circulation. A reduced-rank, stationary Kalman filter has been constructed to assimilate the altimetric sea surface height anomaly (SHA) into the model. The goal is to assess how the inter-hemispheric transports between the Atlantic subtropics and tropics are affected by the assimilation and how the subsurface thermocline structure , and its variability ,is dynamically constrained by the SHA. The model is a reduced-gravity primitive equation GCM of the upper Atlantic Ocean between 30 S and 30 N. The assimilation scheme is an approximation to the extended Kalman filter in which the error covariances of the state estimates are calculated only in a reduced- dimension subspace. The subspace is defined by the leading empirical orthogonal functions calculated from an unconstrained model calculation. Both an identical twin experiment using simulated SHA observations and assimilation of the real TOPEX data were performed. Results from the twin experiments demonstrate the ability of the method to constrain the ocean circulation and the subsurface temperature structure. The impact on the subsurface temperature structure of TOPEX assimilation was assessed using data from expandable bathythermographs. This showed a substantial improvement in the estimated temperature variability only within 13 degrees in latitude around the equator. The impact of TOPEX SHA assimilation on zonally integrated meridional transport across different latitudes was also estimated. Again within 13 degrees from the equator both the mean amplitude and interannual variability of the surface and subsurface transports were significantly enhanced, while the transports were insensitive to the assimilation in the subtropics.
Turbulent structure at the midsection of an annular flow
Ghaemi, S.; Rafati, S.; Bizhani, M.; Kuru, E.
2015-10-01
The turbulent flow in the midsection of an annular gap between two concentric tubes at Reynolds number of 59 200-90 800 based on hydraulic diameter (dh = 57 mm) and average velocity is experimentally investigated. Measurements are carried out using particle tracking velocimetry (PTV) and planar particle image velocimetry (PIV) with spatial resolution of 0.0068dh (size of the binning window) and 0.0129dh (size of the interrogation window), respectively. Both PTV and PIV results show that the location of maximum mean streamwise velocity (yU) does not coincide with the locations of zero shear stress (yuv), minimum streamwise velocity fluctuation (yu2), and minimum radial velocity fluctuation (yv2). The separation between yU and yuv is 0.013dh based on PTV while PIV underestimates the separation distance as 0.0063dh. Conditional averages of turbulent fluctuations based on the four quadrants across the annulus demonstrate that the inner and outer wall flows overlap in the midsection. In the midsection, the flow is subject to opposing sweep/ejection events originating from both the inner and outer walls. The opposite quadrant events of the two boundary layers cancel out at yuv while the local minimum of spatial correlation of u (maximum mixing of the two wall flows) occurs at yU. Investigation of the budget of Reynolds shear stress showed that production and advection terms act towards the coincidence of the yU and yuv while the dissipation term works against the coincidence of the two points. The location of max also overlaps with zero dissipation of . The production of turbulent kinetic energy is slightly negative in the narrow region between yU and yuv. This negative production acts towards smoothing the mean velocity profile at the joint of the two wall flows by equalizing its curvature (∂2/∂y2) on the two sides of yU. The small separation distance of the yU and yuv is associated with slight deviation from the fully developed condition.
Bowers, Holly A; Marin, Roman; Birch, James M; Scholin, Christopher A
2017-12-01
New sandwich hybridization assay (SHA) probes for detecting Pseudo-nitzschia species (P. arenysensis, P. fraudulenta, P. hasleana, P. pungens) are presented, along with updated cross-reactivity information on historical probes (SHA and FISH; fluorescence in situ hybridization) targeting P. australis and P. multiseries. Pseudo-nitzschia species are a cosmopolitan group of diatoms that produce varying levels of domoic acid (DA), a neurotoxin that can accumulate in finfish and shellfish and transfer throughout the food web. Consumption of infected food sources can lead to illness in humans (amnesic shellfish poisoning; ASP) and marine wildlife (domoic acid poisoning; DAP). The threat of human illness, along with economic loss from fishery closures has resulted in the implementation of monitoring protocols and intensive ecological studies. SHA probes have been instrumental in some of these efforts, as the technique performs well in complex heterogeneous sample matrices and has been adapted to benchtop and deployable (Environmental Sample Processor) platforms. The expanded probe set will enhance future efforts towards understanding spatial, temporal and successional patterns in species during bloom and non-bloom periods. Copyright © 2017 Elsevier B.V. All rights reserved.
Ding, Kang; Wang, Yan; Jiang, Weimin; Zhang, Yu; Yin, Hongping; Fang, Zhuyuan
2015-03-25
Qian Yang Yu Yin Granule (QYYYG), a traditional Chinese herbal medicine, has been indicated for renal damage in hypertension for decades in China, but little remains known regarding its underlying molecular mechanism. Therefore, we performed the current study in order to investigate the underlying molecular mechanism of QYYYG in the treatment of hypertensive renal damage. We hypothesize that QYYYG relieves hypertensive renal injury through an angiotensin II (Ang II)-nicotinamide adenine dinucleotide phosphate (NAPDH)-oxidase (NOX)-reactive oxygen species (ROS) pathway. In this study, we investigated the effects of QYYYG-containing serum (QYGS) in human mesangial cells (HMCs) against Ang II-induced cell proliferation, ROS production, and inflammation through the seropharmacological method. We found that QYGS could inhibit cell proliferation in Ang II-treated HMCs. In addition, QYGS considerably suppressed production of ROS, decreased mRNA and protein expression of NAPDH-oxidase 4 (NOX4), p22 (phox) , and activated Ras-related C3 botulinum toxin substrate 1 (GTP-Rac1); as well as counteracted the up-regulation of inflammatory markers including tumor necrosis factor-α (TNF-α), nuclear factor-κB (NF-κB) p65, and interleukin 6 (IL-6). These effects were further confirmed in HMCs transfected with specific small interfering RNA (siRNA) targeting NOX4. Taken together, these results suggest that a NOX4-dependent pathway plays an important role in regulating the inhibitory effect of QYGS. Our findings provide new insights into the molecular mechanisms of QYYYG and their role in the treatment of hypertensive nephropathy.
Desenvolupament d'una aplicació per Internet amb Java2 EE.TFC Intranet Escolar
Mistou Fité, Elena
2012-01-01
L'objectiu principal de l'aplicació serà la de proporcionar una eina més de comunicació entre l'escola, els professors i les famílies dels alumnes. Aquest projecte s'ha desenvolupat en Java amb implementació del patró MVC amb Struts2. Per al tractament de la persistència de les dades, s'ha utilitzat Hibernate y MySql com a base de dades. El objetivo principal de la aplicación será la de proporcionar una herramienta más de comunicación entre la escuela, los profesores y las familias de los...
Pretractament amb hidròlisi parcial de residus lignocel·lulòsics
González i Anadón, Glòria
1985-01-01
Aquest resum recull el treball realitzat sobre la hidròlisi àcida de la fracció hemicel?lulòsica de residus agrícoles, com un pretractament de la cel?lulosa present, cara a la hidròlisi enzimàtica. S'ha treballat amb palla de blat, a la qual s'ha sotmès a un procés de mòlta i garbellat a fi d'aconseguir un substrat el més homogeni possible. Un cop seleccionades les variables d'operació, s'han dut a terme experiències a diferents concentracions d'àcid sulfíric i diverses tem...
Directory of Open Access Journals (Sweden)
P. G. Klyucharev
2014-01-01
Full Text Available In the paper the author considers hardware implementation of the GRACE-H family general cellular automata based cryptographic hash functions. VHDL is used as a language and Altera FPGA as a platform for hardware implementation. Performance and effectiveness of the FPGA implementations of GRACE-H hash functions were compared with Keccak (SHA-3, SHA-256, BLAKE, Groestl, JH, Skein hash functions. According to the performed tests, performance of the hardware implementation of GRACE-H family hash functions significantly (up to 12 times exceeded performance of the hardware implementation of previously known hash functions, and effectiveness of that hardware implementation was also better (up to 4 times.
A novel nanobody specific for respiratory surfactant protein A has potential for lung targeting
Directory of Open Access Journals (Sweden)
Wang SM
2015-04-01
Full Text Available Shan-Mei Wang,1,* Xian He,2,* Nan Li,1,* Feng Yu,3 Yang Hu,1 Liu-Sheng Wang,1 Peng Zhang,4 Yu-Kui Du,1 Shan-Shan Du,1 Zhao-Fang Yin,1 Ya-Ru Wei,1 Xavier Mulet,5 Greg Coia,6 Dong Weng,1 Jian-Hua He,3 Min Wu,7 Hui-Ping Li1 1Department of Respiratory Medicine, Shanghai Pulmonary Hospital, School of Medicine, Tongji University, Shanghai, 2School of Medicine, Suzhou University, SuZhou, 3Shanghai Institute of Applied Physics, Chinese Academy of Sciences, 4Department of Chest Surgery, Shanghai Pulmonary Hospital, School of Medicine, Tongji University, Shanghai, People’s Republic of China; 5CSIRO (Commonwealth Scientific and Industrial Research Materials Science and Engineering, Clayton, 6CSIRO Materials Science and Engineering, Parkville, Melbourne, VIC, Australia; 7Department of Basic Sciences, University of North Dakota, Grand Forks, ND, USA *These authors contributed equally to this work Abstract: Lung-targeting drugs are thought to be potential therapies of refractory lung diseases by maximizing local drug concentrations in the lung to avoid systemic circulation. However, a major limitation in developing lung-targeted drugs is the acquirement of lung-specific ligands. Pulmonary surfactant protein A (SPA is predominantly synthesized by type II alveolar epithelial cells, and may serve as a potential lung-targeting ligand. Here, we generated recombinant rat pulmonary SPA (rSPA as an antigen and immunized an alpaca to produce two nanobodies (the smallest naturally occurring antibodies specific for rSPA, designated Nb6 and Nb17. To assess these nanobodies’ potential for lung targeting, we evaluated their specificity to lung tissue and toxicity in mice. Using immunohistochemistry, we demonstrated that these anti-rSPA nanobodies selectively bound to rat lungs with high affinity. Furthermore, we intravenously injected fluorescein isothiocyanate-Nb17 in nude mice and observed its preferential accumulation in the lung to other tissues, suggesting high
Directory of Open Access Journals (Sweden)
Sun JJ
2017-06-01
Full Text Available Jing-Jing Sun,1,2 Xiao-Min Liu,2 Chen-Yu Shen,2 Xiao-Qian Zhang,1,2 Gao-Xiang Sun,2 Kun Feng,2 Bo Xu,2 Xia-Jin Ren,1,2 Xiang-Yun Ma,1,2 Po-Zi Liu2 1Medical Center, Tsinghua University, Beijing, China, 2Department of Psychiatry, YuQuan Hospital, Tsinghua University, Beijing, China Purpose: Daytime complaints such as memory and attention deficits and failure to accomplish daily tasks are common in insomnia patients. However, objective psychological tests to detect cognitive impairment are equivocal. Neural function associated with cognitive performance may explain the discrepancy. The aim of this study was to investigate the hemodynamic response patterns of patients with chronic insomnia disorder (CID using the noninvasive and low-cost functional neuroimaging technique of multichannel near-infrared spectroscopy (NIRS in order to identify changes of neural function associated with cognitive performance.Patients and methods: Twenty-four CID patients and twenty-five healthy controls matched for age, right-hand dominance, educational level, and gender were examined during verbal fluency tasks (VFT using NIRS. A covariance analysis was conducted to analyze differences of oxygenated hemoglobin (oxy-Hb changes in prefrontal cortex (PFC between the two groups and reduce the influence of the severity of depression. Pearson correlation coeffcients were calculated to examine the relationship between the oxy-Hb changes, with the severity of insomnia and depressive symptoms assessed by the Pittsburgh Sleep Quality Index (PSQI and the Hamilton Rating Scale for Depression (HAMD.Results: The number of words generated during the VFT in CID groups showed no statistical differences with healthy controls. CID patients showed hypoactivation in the PFC during the cognitive task. In addition, we found that the function of left orbitofrontal cortex (OFC during the VFT was significantly negatively correlated with the PSQI scores and the function of right dorsolateral PFC
African Journals Online (AJOL)
Items 101 - 150 of 1250 ... Vol 10, No 6 (2013), A study on the anticancer activity of ethanol extract of ... S Han, X Lv, Y Wang, H Gong, C Zhang, A Tong, N Yan ... YJ Wanga, Y Zhenga, GF Zhang, JP Zhanga, CX Wua, SQ Zhang, HL Ouyang, ...
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Dong Zhang. Articles written in Bulletin of Materials Science. Volume 34 Issue 1 February 2011 pp 25-28. Aqueous colloids of graphene oxide nanosheets by exfoliation of graphite oxide without ultrasonication · Tian-You Zhang Dong Zhang · More Details Abstract Fulltext PDF.
African Journal of Biotechnology - Vol 10, No 60 (2011)
African Journals Online (AJOL)
Microsatellite variability reveals significant genetic differentiation of giant pandas (Ailuropoda melanoleuca) in the Minshan A habitat · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J Yang, R Hou, F Shen, X Yang, L Zhang, L Chen, W Chen, W Zhang, Q Zhu, Z Zhang ...
Papa, Stefania; Bartoli, Giovanni; Álvarez-Romero, Marta; Zornoza, Raúl; Carillo, Petronia; Fioretto, Antonietta
2017-04-01
, Air, and Soil Pollution 169: 101-123; -Liu L, Hu LL, Tang JJ, Li YF, Zhang Q, Chen X. 2012. Food safety assessment of planting patterns of four vegetable-type crops grown in soil contaminated by electronic waste activities. Journal of Environmental Management. 93(1):22-30. doi:10.1016/j.jenvman.2011.08.021 -Chang C. Y., Yu H. Y., Chen J. J., L i F. B., Zhang H. H., Liu C. P., 2014. Accumulation of heavy metals in leaf vegetables from agricultural soils and associated potential health risks in the Pearl River Delta, South China Environ. Monit. Assess. 2014; 186(3): 1547-1560. -Wong SC, Li XD, Zhang G, Qi SH, MinYS, 2002 Heavy metals in agricultural soils of the Pearl River Delta, South China Environmental Pollution, 119 (1) 33-4
Directory of Open Access Journals (Sweden)
Zhang BF
2018-04-01
Full Text Available Bin-Fei Zhang,* Xing Wei,* Hai Huang, Peng-Fei Wang, Ping Liu, Shuang-Wei Qu, Jia-Hao Li, Hu Wang, Yu-Xuan Cong, Yan Zhuang, Kun Zhang Department of Orthopedic Trauma, Hong-Hui Hospital, Xi’an Jiaotong University College of Medicine, Beilin District, Xi’an, Shaanxi, China *These authors contributed equally to this work Objective: To investigate the incidences of deep vein thrombosis (DVT before and after operation in inpatients with hip fractures in both lower extremities.Patients and methods: We collected the clinical data of 463 patients with lower extremities fractures who presented at Xi’an Honghui Hospital between July 1, 2014, and October 31, 2016 and met all the inclusion criteria. Doppler ultrasonography was used to diagnose DVT. The patients were examined preoperatively and postoperatively and divided into the thrombosis and non-thrombosis group according to the ultrasonographic findings. We divided the DVT cases into central, peripheral, and mixed thromboses.Results: The incidence of preoperative DVT was 34.98%, and the prevalence of DVT on the uninjured side was 13.60%. This composition ratio increased to 57.23% postoperatively, and the prevalence of DVT on the uninjured side was 25.05%. Age (odds ratio [OR], 1.03; 95% CI: 1.01–1.04; P=0.002, venous thrombosis at admission (OR, 4.05; 95% CI, 2.30–7.13; P=0.000, and the days between the fracture and the operation (OR, 1.10; 95% CI, 1.02–1.20; P=0.020 were the independent risk factors of preoperative DVT. Coronary heart disease (OR, 1.85; 95% CI: 1.18–2.89; P=0.007, venous thrombosis at admission (OR, 22.35; 95% CI: 6.78–73.60; P=0.000, days between fracture and operation (OR, 1.06; 95% CI: 1.01–1.11; P=0.021, and blood loss (OR, 1.002; 95% CI: 1.000–1.003; P=0.014 were independent risk factors of postoperative DVT.Conclusion: The actual incidence of DVT after hip fracture may be underestimated. The incidences of preoperative and postoperative DVTs and the incidence
Directory of Open Access Journals (Sweden)
Li Y
2017-08-01
Full Text Available Yang Li,1,* Yanhong Duo,2,3,* Shiyun Bao,1 Lisheng He,4 Kai Ling,5 Jinfeng Luo,4 Yue Zhang,1 Hao Huang,2 Han Zhang,2 Xiaofang Yu1 1Department of Hepatobiliary and Pancreas Surgery, Second Clinical Medical College of Jinan University, Shenzhen People’s Hospital, 2Shenzhen Engineering Laboratory of Phosphorene and Optoelectronics, Collaborative Innovation Center for Optoelectronic Science and Technology, Key Laboratory of Optoelectronic Devices and Systems of Ministry of Education and Guangdong Province, College of Optoelectronic Engineering, Shenzhen University, Shenzhen, 3Key Laboratory of Plant Cell Activities and Stress Adaptation, Ministry of Education, School of Life Sciences, Lanzhou University, Lanzhou, 4Department of Pathology, 5Institute of Respiratory Diseases, Second Clinical Medical College of Jinan University, Shenzhen People’s Hospital, Shenzhen, China *These authors contributed equally to this work Abstract: DM1, a maytansine derivative, is a highly potential cytotoxic agent but with severe side effects; therefore, its application in clinical cancer therapy is limited. Here, in order to mitigate this intrinsic drawback of DM1, we developed mesoporous silica nanoparticles (MSNs loaded with DM1 and surface-decorated with hydrochloride dopamine (PDA, polyethylene glycol (PEG, and epithelial cell adhesion molecule (EpCAM aptamer (APt for the targeted treatment of colorectal cancer (CRC. In this system, the PDA coating could be used as pH-sensitive gatekeepers to control the release of DM1 from MSNs in response to the pH stimulus and EpCAM APt-guided active targeting enables the increased delivery of DM1 to CRC as well as a reduction in toxicity and side effects by minimizing the exposure of normal tissues to DM1. Results demonstrated that DM1 inhibited the formation of microtubules and induced apoptosis in tumor cells via caspase signaling. In comparison with the control groups, the MSNs-DM1@PDA-PEG-APt bioconjugates exhibited
Zhang, Jing; Sun, Lei; Liu, Yu; Wang, Hongyi; Sun, Ningling; Zhang, Puhong
2017-03-08
manner in clinical trial. ©Jing Zhang, Lei Sun, Yu Liu, Hongyi Wang, Ningling Sun, Puhong Zhang. Originally published in the Journal of Medical Internet Research (http://www.jmir.org), 08.03.2017.
[Analysis of the intensity of professional collaboration among nurses in a critical care area].
Bengoechea Calpe, L; Marín Fernández, B; Regaira Martínez, E
2016-01-01
To analyse the intensity of professional collaboration (IPC) between the nurses in a multidisciplinary critical area (CA) and the relationship with the workplace "intensive care unit (ICU) and special hospitalisation area (SHA)", educational level, age, and years of professional activity in CA. A cross-sectional descriptive study was conducted with 57 nurses from CA, recording socio-demographic data: age, educational level, speciality titles, years of professional activity and workday type, years of professional activity in the CA, and involvement in scientific works. Tool: Intensity of Inter-professional Collaboration Questionnaire. SPSS 20.0. The study included a total of 47 nurses (ICU/SHA), with a mean age of 35.91 (9.59) years. Almost three-quarters (74.46%) were nursing graduates with a posgraduate in ICU. Median and interquartile range of professional experience was 14 and 14.50 years, respectively, and years working in CA was 8.50 and 16 years, respectively. Just over half of them (51.10%) worked part-time, and 61.70% participated in scientific works. The mean IPC score was 61.68 (6.84), with 57.40% providing values of high IPC. The relationship between the workplace (ICU/SHA) and educational level with IPC was not statistically significant (p>.05). There are statistical significant differences between IPC with age and years of professional activity in CA (p<.05). The present study demonstrates the existence of good IPC in the CA. Younger nurses obtain a better IPC score, as well as nurses who have been working for less time in CA. Nurses with a Degree or Masters have a higher level of IPC than the rest, as well as nurses who perform professional activity combining ICU and SHA. Copyright © 2015 Elsevier España, S.L.U. y SEEIUC. All rights reserved.
Sellers, Katie; Leider, Jonathon P; Harper, Elizabeth; Castrucci, Brian C; Bharthapudi, Kiran; Liss-Levinson, Rivka; Jarris, Paul E; Hunter, Edward L
2015-01-01
Public health practitioners, policy makers, and researchers alike have called for more data on individual worker's perceptions about workplace environment, job satisfaction, and training needs for a quarter of a century. The Public Health Workforce Interests and Needs Survey (PH WINS) was created to answer that call. Characterize key components of the public health workforce, including demographics, workplace environment, perceptions about national trends, and perceived training needs. A nationally representative survey of central office employees at state health agencies (SHAs) was conducted in 2014. Approximately 25,000 e-mail invitations to a Web-based survey were sent out to public health staff in 37 states, based on a stratified sampling approach. Balanced repeated replication weights were used to account for the complex sampling design. A total of 10,246 permanently employed SHA central office employees participated in PH WINS (46% response rate). Perceptions about training needs; workplace environment and job satisfaction; national initiatives and trends; and demographics. Although the majority of staff said they were somewhat or very satisfied with their job (79%; 95% confidence interval [CI], 78-80), as well as their organization (65%; 95% CI, 64-66), more than 42% (95% CI, 41-43) were considering leaving their organization in the next year or retiring before 2020; 4% of those were considering leaving for another job elsewhere in governmental public health. The majority of public health staff at SHA central offices are female (72%; 95% CI, 71-73), non-Hispanic white (70%; 95% CI, 69-71), and older than 40 years (73%; 95% CI, 72-74). The greatest training needs include influencing policy development, preparing a budget, and training related to the social determinants of health. PH WINS represents the first nationally representative survey of SHA employees. It holds significant potential to help answer previously unaddressed questions in public health
FAST Maser Surveys J. S. Zhang
Indian Academy of Sciences (India)
nese institutions and industries and the first light is expected to be in 2016. FAST ... tem, extragalactic pulsar, high redshift megamasers and radio signals from exoplan- ets (Nan et al. ... Since OH maser emission was detected in galactic molecular clouds in 1960s. (Weaver ... OH maser (other three lines are weak or absent).
DONG JIE Zhang, LIANG Wang, ZHON
Indian Academy of Sciences (India)
User
development, hairless nude skin, and short life (Abitbol et al., 2015; Bryson et al., 2013). On the ... Foxn1 maintains TECs to support T-cell development via mcm2 ... were ligated upstream of the firefly luciferase gene in the plasmid pGL3-Basic.
FAST Maser Surveys J. S. Zhang
Indian Academy of Sciences (India)
are found to be closely associated with ultra-compact HII regions, embedded IR sources, hot molecular cores, Herbig-Haro objects, and outflows etc., which can be used to probe star formation. And OH masers in circumstellar envelopes (cir- cumstellar masers) were found to be related to outflowing and cool winds from the.
African Journal of Biotechnology - Vol 11, No 14 (2012)
African Journals Online (AJOL)
DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HD Ding, HJ Zhang, XH Zhu, H Liu, JS Liang, B Lu, 3259-3269 ... DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Y Hanying, X Wei, G Xingxi, 3370-3378 ... FULL TEXT DOWNLOAD FULL TEXT. J Zhang, YC Huang, Q Zhang, ZP Hong, YC Zhou, WL Chen, 3388-3393 ...
Strategic hospital alliances: impact on financial performance.
Clement, J P; McCue, M J; Luke, R D; Bramble, J D; Rossiter, L F; Ozcan, Y A; Pai, C W
1997-01-01
Acute care hospitals have increasingly been forming local strategic hospital alliances (SHAs), which consume considerable resources in forming and may affect the competitiveness of provider markets. This research shows that SHAs and market factors, which have been perceived to be threats to hospitals, are related to hospitals' financial performance. Among the findings are that SHA members have higher net revenues but that they are not more effective at cost control. Nor do the higher net revenues result in higher cash flow. However, increasing SHA penetration in a market is related to lower net revenues per case. In addition, the penetration of private health maintenance organizations in markets is associated with lower revenues and expenses.
Traducció i subtitulació de l'òpera : 'Madama Butterfly'
Martínez Benavente, Ferran
2016-01-01
Després de l'experiència dels anys de carrera a la Facultat de Traducció i Interpretació hi ha la prova final, que és poder aplicar tot allò que s'ha après a un treball d'abast més important. S'hi ha de demostrar el domini de les llengües que s'han estudiat i, evidentment, el domini de la llengua d'arribada. A més a més de traduir, també s'ha d'aplicar els coneixements adquirits en altres assignatures, com ara la subtitulació. L'elecció de l'òpera de Madama Butterfly és prou encertada perquè ...
Phytochemical and Biological Properties of Ajuga decumbens ...
African Journals Online (AJOL)
Zhang B, Zeng FJ, Zhang XY. Study on anti-infection effect of Ajuga decumbens. Chin J Nosocomiol 2014;. 24: 2937-3939. 52. Li M, Peng WH. Chemical constituents and pharmacological research progress of Ajuga decumbens. J pr tradit Chinese mede 2012; 28: 322-. 323. 53. Ma SC, Du J, But PPH, Deng XL, Zhang YW, ...
Performance of free-range chickens reared in production modules enriched with shade net and perches
Directory of Open Access Journals (Sweden)
MJB Santos
2014-03-01
Full Text Available An experiment was carried out to evaluate the effect of environmental enrichment in a free-range chicken production system on live performance as a function of microclimate, physiological parameters, and performance parameters. Four production modules were divided into four pens with 10 birds each, totaling 60 birds. The following treatments were applied: access to a paddock (TEST, access to a paddock with perches (PER, access to a paddock with artificial shade (SHA, and access to the paddock with perches and artificial shade (PESH. The PESH production module presented the best globe temperature (Tbg,ºC and enthalpy (h, kJ/kg, and thereby, the best thermal environmental conditions, which ensured the longest permanence time of the birds in the paddock. The SHA and PESH modules promoted the lowest respiratory rate and shank and comb temperatures. Live performance was influenced by the presence of environmental enrichment (modules SHA and PESH, with the highest live weight (LW and weight gain (WG and the lowest feed conversion ratio (FCR and metabolizable energy intake (MEI. Parts yield, such as giblets, were not influenced by production modules, except for PESH, which promoted higher offal weight. In general, chickens reared in enriched production modules presented greatest performance and comfort results and were considered close to optimal rearing conditions.
Directory of Open Access Journals (Sweden)
Adnan Haider
2014-01-01
Full Text Available Tissue engineering is faced with an uphill challenge to design a platform with appropriate topography and suitable surface chemistry, which could encourage desired cellular activities and guide bone tissue regeneration. To develop such scaffolds, composite nanofiber scaffolds of nHA and sHA with PLGA were fabricated using electrospinning technique. nHA was synthesized using precipitation method, whereas sHA was purchased. The nHA and sHA were suspended in PLGA solution separately and electrospun at optimized electrospinning parameters. The composite nanofiber scaffolds were characterized by FE-SEM, EDX analysis, TEM, XRD analysis, FTIR, and X-ray photoelectron. The potential of the HA/PLGA composite nanofiber as bone scaffolds in terms of their bioactivity and biocompatibility was assessed by culturing the osteoblastic cells onto the composite nanofiber scaffolds. The results from in vitro studies revealed that the nHA/PLGA composite nanofiber scaffolds showed higher cellular adhesion, proliferation, and enhanced osteogenesis performance, along with increased Ca+2 ions release compared to the sHA/PLGA composite nanofiber scaffolds and pristine PLGA nanofiber scaffold. The results show that the structural dependent property of HA might affect its potential as bone scaffold and implantable materials in regenerative medicine and clinical tissue engineering.
Analysis and Implementation of Cryptographic Hash Functions in Programmable Logic Devices
Directory of Open Access Journals (Sweden)
Tautvydas Brukštus
2016-06-01
Full Text Available In this day’s world, more and more focused on data pro-tection. For data protection using cryptographic science. It is also important for the safe storage of passwords for this uses a cryp-tographic hash function. In this article has been selected the SHA-256 cryptographic hash function to implement and explore, based on fact that it is now a popular and safe. SHA-256 cryp-tographic function did not find any theoretical gaps or conflict situations. Also SHA-256 cryptographic hash function used cryptographic currencies. Currently cryptographic currency is popular and their value is high. For the measurements have been chosen programmable logic integrated circuits as they less effi-ciency then ASIC. We chose Altera Corporation produced prog-rammable logic integrated circuits. Counting speed will be inves-tigated by three programmable logic integrated circuit. We will use programmable logic integrated circuits belong to the same family, but different generations. Each programmable logic integ-rated circuit made using different dimension technology. Choo-sing these programmable logic integrated circuits: EP3C16, EP4CE115 and 5CSEMA5F31. To compare calculations perfor-mances parameters are provided in the tables and graphs. Re-search show the calculation speed and stability of different prog-rammable logic circuits.
Treatment of peripheral vestibular dysfunction using photobiomodulation
Lee, Min Young; Hyun, Jai-Hwan; Suh, Myung-Whan; Ahn, Jin-Chul; Chung, Phil-Sang; Jung, Jae Yun; Rhee, Chung Ku
2017-08-01
Gentamicin, which is still used in modern medicine, is a known vestibular toxic agent, and various degrees of balance problems have been observed after exposure to this pharmacologic agent. Photobiomodulation is a candidate therapy for vertigo due to its ability to reach deep inner ear organs such as the cochlea. Previous reports have suggested that photobiomodulation can improve hearing and cochlea function. However, few studies have examined the effect of photobiomodulation on balance dysfunction. We used a rat model to mimic human vestibulopathy resulting from gentamicin treatment and evaluated the effect of photobiomodulation on vestibular toxicity. Slow harmonic acceleration (SHA) rotating platform testing was used for functional evaluation and both qualitative and quantitative epifluorescence analyses of cupula histopathology were performed. Animals were divided into gentamicin only and gentamicin plus laser treatment groups. Laser treatment was applied to one ear, and function and histopathology were evaluated in both ears. Decreased function was observed in both ears after gentamicin treatment, demonstrated by low gain and no SHA asymmetry. Laser treatment minimized the damage resulting from gentamicin treatment as shown by SHA asymmetry and recovered gain in the treated ear. Histology results reflected the functional results, showing increased hair cell density and epifluorescence intensity in laser-treated cupulae.
Tan, Shu-Qiu; Geng, Xue; Liu, Jorn-Hon; Pan, Wynn Hwai-Tzong; Wang, Li-Xiang; Liu, Hui-Kang; Hu, Lei; Chao, Hsiao-Ming
2017-07-14
Retinal ischemia-related eye diseases result in visual dysfunction. This study investigates the protective effects and mechanisms of Xue-Fu-Zhu-Yu decoction (XFZYD) with respect to retinal ischemia. Retinal ischemia (I) was induced in Wistar rats by a high intraocular pressure (HIOP) of 120 mmHg for 1 h, which was followed by reperfusion of the ischemic eye; the fellow untreated eye acted as a control. Electroretinogram (ERG), biochemistry and histopathology investigations were performed. Significant ischemic changes occurred after ischemia including decreased ERG b-wave ratios, less numerous retinal ganglion cells (RGCs), reduced inner retinal thickness, fewer choline acetyltransferase (ChAT) labeled amacrine cell bodies, increased glial fibrillary acidic protein (GFAP) immunoreactivity and increased vimentin Müller immunolabeling. These were accompanied by significant increases in the mRNA/protein concentrations of vascular endothelium growth factor, hypoxia-inducible factor-1α, pyruvate kinase M2 and retinoblastoma-binding protein 2. The ischemic changes were concentration-dependently and significantly altered when XFZYD was given for seven consecutive days before or after retina ischemia, compared to vehicle. These alterations included enhanced ERG b-wave amplitudes, more numerous RGCs, enhanced inner retinal thickness, a greater number of ChAT immunolabeled amacrine cell bodies and decreased GFAP/vimentin immunoreactivity. Furthermore, decreased mRNA levels of VEGF, HIF-1α, PKM2, and RBP2 were also found. Reduced protein concentrations of VEGF, HIF-1α, PKM2, and RBP2 were also demonstrated. Furthermore, there was an inhibition of the ischemia-associated increased ratios (target protein/β-actin) in the protein levels of VEGF, HIF-1α, PKM2, and RBP2, which were induced by Shikonin, JIB-04 or Avastin. XFZYD would seem to protect against well-known retinal ischemic changes via a synergistic inhibition of RBP2 and PKM2, as well as down-regulation of HIF-1
Directory of Open Access Journals (Sweden)
Yu Zhang
2008-10-01
Full Text Available Junko H Ohyashiki1, Ryoko Hamamura2, Chiaki Kobayashi2, Yu Zhang2, Kazuma Ohyashiki21Intractable Immune System Disease Research Center, Tokyo Medical University, Tokyo, Japan; 2First Department of Internal Medicine, Tokyo Medical University, Tokyo, JapanAbstract: There is a need to identify the regulatory gene interaction of anticancer drugs on target cancer cells. Whole genome expression profiling offers promise in this regard, but can be complicated by the challenge of identifying the genes affected by hundreds to thousands of genes that induce changes in expression. A proteasome inhibitor, bortezomib, could be a potential therapeutic agent in treating adult T-cell leukemia (ATL patients, however, the underlying mechanism by which bortezomib induces cell death in ATL cells via gene regulatory network has not been fully elucidated. Here we show that a Bayesian statistical framework by VoyaGene® identified a secreted protein acidic and rich in cysteine (SPARC gene, a tumor-invasiveness related gene, as a possible modulator of bortezomib-induced cell death in ATL cells. Functional analysis using RNAi experiments revealed that inhibition of the expression SPARC by siRNA enhanced the apoptotic effect of bortezomib on ATL cells in accordance with an increase of cleaved caspase 3. Targeting SPARC may help to treat ATL patients in combination with bortezomib. This work shows that a network biology approach can be used advantageously to identify the genetic interaction related to anticancer effects.Keywords: network biology, adult T cell leukemia, bortezomib, SPARC
Directory of Open Access Journals (Sweden)
Yu Y
2017-08-01
Full Text Available Yanyan Yu, Gaoxing Su, Hongyan Zhu, Qing Zhu, Yong Chen, Bohui Xu, Yuqin Li, Wei Zhang School of Pharmacy, Nantong University, Nantong, People’s Republic of China Abstract: In this study, we fabricated a novel electrochemical biosensing platform on the basis of target-triggered proximity hybridization-mediated isothermal exponential amplification reaction (EXPAR for ultrasensitive protein analysis. Through rational design, the aptamers for protein recognition were integrated within two DNA probes. Via proximity hybridization principle, the affinity protein-binding event was converted into DNA assembly process. The recognition of protein by aptamers can trigger the strand displacement through the increase of the local concentrations of the involved probes. As a consequence, the output DNA was displaced, which can hybridize with the duplex probes immobilized on the electrode surface subsequently, leading to the initiation of the EXPAR as well as the cleavage of duplex probes. Each cleavage will release the gold nanoparticles (AuNPs binding sequence. With the modification of G-quadruplex sequence, electrochemical signals were yielded by the AuNPs through oxidizing 3,3',5,5'-tetramethylbenzidine in the presence of H2O2. The study we proposed exhibited high sensitivity toward platelet-derived growth factor BB (PDGF-BB with the detection limit of 52 fM. And, this method also showed great selectivity among the PDGF isoforms and performed well in spiked human serum samples. Keywords: electrochemical biosensor, proximity hybridization, PDGF-BB, isothermal exponential amplification, G-quadruplex
Probabilistic Flexural Fatigue in Plain and Fiber-Reinforced Concrete.
Ríos, José D; Cifuentes, Héctor; Yu, Rena C; Ruiz, Gonzalo
2017-07-07
The objective of this work is two-fold. First, we attempt to fit the experimental data on the flexural fatigue of plain and fiber-reinforced concrete with a probabilistic model (Saucedo, Yu, Medeiros, Zhang and Ruiz, Int. J. Fatigue, 2013, 48, 308-318). This model was validated for compressive fatigue at various loading frequencies, but not for flexural fatigue. Since the model is probabilistic, it is not necessarily related to the specific mechanism of fatigue damage, but rather generically explains the fatigue distribution in concrete (plain or reinforced with fibers) for damage under compression, tension or flexion. In this work, more than 100 series of flexural fatigue tests in the literature are fit with excellent results. Since the distribution of monotonic tests was not available in the majority of cases, a two-step procedure is established to estimate the model parameters based solely on fatigue tests. The coefficient of regression was more than 0.90 except for particular cases where not all tests were strictly performed under the same loading conditions, which confirms the applicability of the model to flexural fatigue data analysis. Moreover, the model parameters are closely related to fatigue performance, which demonstrates the predictive capacity of the model. For instance, the scale parameter is related to flexural strength, which improves with the addition of fibers. Similarly, fiber increases the scattering of fatigue life, which is reflected by the decreasing shape parameter.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. YU-HUI HOU. Articles written in Journal of Chemical Sciences. Volume 130 Issue 1 January 2018 pp 6. Efficient click reaction towards novel sulfonamide hybrids by molecular hybridization strategy as antiproliferative agents · DONG-JUN FU YU-HUI HOU SAI-YANG ZHANG ...
Dang, Li-Hong; Zhang, Bin; Li, Zi-Zhong
2016-03-08
A new leafhopper genus of the tribe Idiocerini (Hemiptera: Cicadomorpha: Cicadellidae), Chinaocerus, is described from the southwest China together with three new species, C. kangdingensis Zhang & Li sp. nov. (Sichuan Province), C. bispinatus Zhang & Li sp. nov. (Yunnan Province) and C. shii Zhang & Li sp. nov. (Sichuan Province). Descriptions and illustrations of these three new species are provided, and a key for their separation is also given.
Directory of Open Access Journals (Sweden)
Xuesong Zhang
2014-01-01
Full Text Available A novel biomedical material composed of spherical hydroxyapatite (s-HA and polyamide 66 (PA biocomposite (s-HA/PA was prepared, and its composition, mechanical properties, and cytocompatibility were characterized and evaluated. The results showed that HA distributed uniformly in the s-HA/PA matrix. Strong molecule interactions and chemical bonds were presented between the s-HA and PA in the composites confirmed by IR and XRD. The composite had excellent compressive strength in the range between 95 and 132 MPa, close to that of natural bone. In vitro experiments showed the s-HA/PA composite could improve cell growth, proliferation, and differentiation. Therefore, the developed s-HA/PA composites in this study might be used for tissue engineering and bone repair.
Demarcation of secondary hyperalgesia zones
DEFF Research Database (Denmark)
Ringsted, Thomas K; Enghuus, Casper; Petersen, Morten A
2015-01-01
of analgesic drug effects in humans. However, since the methods applied in demarcating the secondary hyperalgesia zone seem inconsistent across studies, we examined the effect of a standardized approach upon the measurement of SHA following a first degree burn injury (BI). NEW METHOD: The study was a two.......0001). No day-to-day or observer-to-observer differences in SHAs were observed. Intraclass correlation coefficients, in the range of 0.51 to 0.84, indicated a moderate to almost perfect reliability between observers. COMPARISON WITH EXISTING METHODS: No standardized approach in SHA-assessment has hitherto been...... presented. CONCLUSIONS: This is the first study to demonstrate that demarcation of secondary hyperalgesia zones depends on the developed pressure of the punctate stimulator used....
Comprehensive highway corridor planning with sustainability indicators.
2011-10-01
"The Maryland State Highway Administration (SHA) has initiated major planning efforts to improve transportation : efficiency, safety, and sustainability on critical highway corridors through its Comprehensive Highway Corridor : (CHC) program. This pr...
MOSAIC : Model of Sustainability and Integrated Corridors : [research summary].
2015-02-01
In order to improve transportation, environmental, and livability : conditions for Maryland residents and visitors, the Maryland : State Highway Administration (SHA) initiated planning efforts to : improve critical highway corridors and promote susta...
2015-02-01
The Maryland State Highway Administration (SHA) has initiated major planning efforts to improve transportation : efficiency, safety, and sustainability on critical highway corridors through its Comprehensive Highway Corridor : (CHC) program. This pro...
Interaction of Synuclein and Inflammation in Dopaminergic Neurodegeneration
2014-06-01
induces degeneration of dopaminergic neurons: implications for progression of Parkinson’s disease. Neurotox Res. 19: 63-72, (2011). Kalia, L. V., S...1998). Zhang J, Niu N, Wang M, McNutt MA, Zhang D, Zhang B, Lu S, Liu Y, Liu Z. Neuron-derived IgG protects dopaminergic neurons from insult by 6...AD_________________ Award Number: W81XWH-08-1-0465 TITLE: Interaction of Synuclein and Inflammation in Dopaminergic
Comprehensive highway corridor planning with sustainability indicators : [research summary].
2013-04-01
The Maryland State Highway Administration (SHA) has initiated major planning : efforts to improve transportation efficiency, safety and sustainability on critical : highway corridors through its Comprehensive Highway Corridor (CHC) program. : It is i...
Exact solitary ion acoustic waves in a magnetoplasma
International Nuclear Information System (INIS)
Ray, D.
1979-01-01
Solitary ion acoustic waves in a magnetoplasma have been studied by Shukla and Yu [J. Math. Phys. 19, 2506 (1978)]. A more rigorous study confirms the conditions that Shukla and Yu said would be necessary for humps. However, it is shown that a density cavity is also possible in the limiting case
New Jurassic tettigarctid cicadas from China with a novel example of disruptive coloration
Directory of Open Access Journals (Sweden)
Jun Chen
2016-12-01
Full Text Available Tettigarctidae is the most primitive family of Cicadoidea, with only two relict species. Although they are relatively well known from Eurasia, Australia, Africa, and South America, their Mesozoic examples are typically preserved only as isolated forewings. Herein, a new genus Sanmai Chen, Zhang, and B. Wang with three new species (Sanmai kongi Chen, Zhang, and B. Wang, S. mengi Chen, Zhang, and B. Wang, and S. xuni Chen, Zhang, and B. Wang are described based on fossil specimens from the Middle–Upper Jurassic of northeastern China, with well-preserved body structures, forewing and hindwing venations, making it the hitherto best known extinct tettigarctid taxon. The new genus, provisionally assigned to the tribe Turutanoviini, provides some new information about the evolution and palaeobiogeography of Mesozoic Tettigarctidae. The genus Paraprosbole is synonymized with Shuraboprosbole. In addition, the coloration pattern of forewing, prominent on some specimens of Sanmai kongi Chen, Zhang, and B. Wang sp. nov. and Sanmai xuni Chen, Zhang, and B. Wang sp. nov., represents a novel example of disruptive coloration in Tettigarctidae, which can effectively break up the body outline as well as surface, and so likely enabled these cicadas to reduce the detectability of potential predators.
Sustainable landscaping practices for enhancing vegetation establishment.
2016-02-01
Soil compaction can severely limit the success of vegetation establishment. Current grading and landscaping : practices commonly produce compacted soils of varied textures and profiles within SHA medians and roadsides, : resulting in limited capacity...
On Field Theory of Open Strings, Tachyon Condensation and Closed Strings
Shatashvili, Samson L.
2001-01-01
I review the physical properties of different vacua in the background independent open string field theory. Talk presented at Strings 2001, Mumbai, India, http://theory.theory.tifr.res.in/strings/Proceedings/#sha-s.
Efficient and effective implementation of alternative project delivery methods.
2017-05-01
Over the past decade, the Maryland Department of Transportation State Highway : Administration (MDOT SHA) has implemented Alternative Project Delivery (APD) methods : in a number of transportation projects. While these innovative practices have produ...
Chuangzaoli xinlixue yu jiechu rencai peiyang
DEFF Research Database (Denmark)
Shi, Jiannong; Chen, N.; Du, Xiangyun
2012-01-01
as individual’s personal characteristics rather as the results of active interaction of creative individual and the environment. Creativity is a process of accumulation from quantitative changes to qualitative changes during a period of time. Meanwhile the authors discuss issues about individual’s creativity......The authors emphasize the importance of systemic perspectives for understanding human creativity after briefly introducing and commenting different theories or perspectives on creativity. It is emphasized that the manifestation of creativity or excellent achievement should not be treated...
Selected papers of Yu. I. Manin
Manin, Yu I
1996-01-01
The book is a collection of research and review articles in several areas of modern mathematics and mathematical physics published in the span of three decades. The ICM Kyoto talk "Mathematics as Metaphor" summarises the author's view on mathematics as an outgrowth of natural language.
He, Liang; Zhang, Siliang; Zhang, Xiaowen; Liu, Rui; Guan, Haixia; Zhang, Hao
2017-01-01
Liang He,1,* Siliang Zhang,2,* Xiaowen Zhang,3 Rui Liu,2 Haixia Guan,2 Hao Zhang1 1Department of Thyroid Surgery, The First Hospital of China Medical University, Shenyang, Liaoning, 2Department of Endocrinology and Metabolism, The Endocrine Institute and The Liaoning Provincial Key Laboratory of Endocrine Diseases, The First Hospital of China Medical University, Shenyang, Liaoning, 3Department of Endocrinology and Metabolism, Drum Tower Hospital Affiliated to Nanjing University Medical Schoo...
International Nuclear Information System (INIS)
Liu Qing; Zhu Jiamin; Hong Bihai
2008-01-01
A modified variable-coefficient projective Riccati equation method is proposed and applied to a (2 + 1)-dimensional simplified and generalized Broer-Kaup system. It is shown that the method presented by Huang and Zhang [Huang DJ, Zhang HQ. Chaos, Solitons and Fractals 2005; 23:601] is a special case of our method. The results obtained in the paper include many new formal solutions besides the all solutions found by Huang and Zhang
Fluorescence of Er3+:AlN Polycrystalline Ceramic
2012-01-01
Refractive Index of Air,” Metrologia 2(2), 71–80 (1966). 31. V. Yu. Davydov, Yu. E. Kitaev, I. N. Goncharuk, A. N. Smirnov, J. Graul, O. Semchinova, D...sieve and stored in a vacuum desiccator. The size distribution of the powders was measured using a Horiba LA -910 Light Scattering Particle Size
Characterization and photocatalytic activity of boron-doped TiO2 thin ...
Indian Academy of Sciences (India)
Wintec
Chen Daimai, Wang Dong Yang and Jiang Zhongyi 2006 Ind. Eng. Chem. 45 4110. Cheng Jen-hao 2003 A study on photocatalytic oxidation of aque- ous chlorobenzene solution by nanostructured film of TiO2,. Master Thesis, National Sun Yat-Sen University, Taiwan. Deki S, Henin Yu Yu Ko, Fujita T, Akamatsu K, Mizuhata ...
Brain-Based Devices for Neuromorphic Computer Systems
2013-07-01
Science. 233(4771):1416-9. Goldman-Rakic, P.S. (1995). Cellular basis of working memory. Neuron. 14(3):477-85. Haider, B., Krause, M.R., Duque , A., Yu...Haider, B., Krause, M. R., Duque , A., Yu, Y., Touryan, J., Mazer, J. A., and McCormick, D. A. (2010). Synaptic and network mechanisms of sparse and
Relationships among Constitution, Stress, and Discomfort in the First Trimester
Directory of Open Access Journals (Sweden)
Hsiao-Ling Wang
2012-01-01
trimester of pregnancy. We adopted a descriptive and correlational research design and collected data from 261 pregnant women during their first trimester in southern Taiwan using structured questionnaires. Results showed that (1 stress was significantly and positively correlated with Yang-Xu, Yin-Xu, and Tan-Shi-Yu-Zhi constitutions, respectively; (2 Yin-Xu and Tan-Shi-Yu-Zhi constitutions had significant correlations with all symptoms of discomfort, while Yang-Xu had significant correlations with all symptoms of discomfort except for “running nose”; (3 Tan-Shi-Yu-Zhi constitution and stress were two indicators for “fatigue”; Tan-Shi-Yu-Zhi was the indicator for “nausea”; Yang-Xu and Yin-Xu were indicators for “frequent urination.” Our findings also indicate that stress level affects constitutional changes and that stress and constitutional change affect the incidence of discomfort. This research can help healthcare professionals observe these discomforts and provide individualized care for pregnant women, to nurture pregnant women into neutral-type constitution, minimize their levels of discomfort, and promote the health of the fetus and the mother.
Optimization Process for Configuration of Flexible Joined-Wing
2004-03-01
T5NQX&bYX& hYU deZQX&N�b p hYLvVWy p SE� p SZQyvX,L � TY�qdeZM\\CTHaMShc\\�SZWN�hYdek�b p de��OZWX[TYT deZ�b p X���deZWy3klLc��kOP�NWX[b|X[ hYU deZWdeZQy...LvdeZQX&N ��deZWy�[LvZQ�&X&aWb p ST�ZWL Z oedeZWXqSh(NWX&��L hYU �SbYdeLvZ � p ShcS�[b|X[hYdeTYbYde�[Tc\\�b p X�THbYhYVW�&bYVWhcSoOL aWbYdeUd`uOS...5^5^5^5^5^5^5^;^5^5^5^5^5^ ^ev^ r X[bYX& hYU deZQX&N © aQbYdeU�So�KfLvZQnWy VWhcSbYdeL Z¿^5^5^5^5^5^ ^ev^`ª ] VW��OoedeZQy
Deveza, L A; Kraus, V B; Collins, J E; Guermazi, A; Roemer, F W; Nevitt, M C; Hunter, D J
2017-09-20
To determine the relationship between synovitis detected on non-contrast-enhanced (non-CE) magnetic resonance imaging (MRI), biochemical markers of inflammation, and clinical assessment of effusion in people with knee osteoarthritis (OA). We examined data from the OA Biomarkers Consortium within the Osteoarthritis Initiative (n = 600). Non-CE MRIs were semi-quantitatively scored (grades 0-3) for severity of Hoffa synovitis and effusion synovitis. Serum (s) matrix metalloproteinase-3 (sMMP-3), hyaluronic acid (sHA), and nitrated epitope of the α-helical region of type II collagen (sColl2-1NO2) were quantified. The bulge and patellar tap clinical tests were performed at baseline and performance characteristics were assessed for the detection of effusion synovitis on MRI. Multinomial logistic regression adjusted for covariates was used to assess the association between biochemical and imaging markers at baseline and over 12 and 24 months. At baseline, sHA and sMMP-3 were associated with moderate to large (score ≥ 2, n = 117) effusion synovitis, with odds ratio = 1.35 and 1.30 per 1 standard deviation in biochemical markers (95% confidence intervals 1.07, 1.71 and 1.00, 1.69), c-statistics 0.640 and 0.626, respectively. The c-statistics for the presence of Hoffa synovitis (score ≥ 2) were 0.693, 0.694, and 0.694 for sHA, sMMP-3, and sColl2-1NO2, respectively. There was no significant association between biochemical markers (baseline and 12 and 24 month time-integrated concentrations) and changes in MRI markers. The bulge and patellar tap signs were 22.0% and 4.3% sensitive and 88.8% and 94.8% specific, respectively, for detecting effusion synovitis (score ≥ 1) on MRI. sHA and sMMP-3 were modestly associated with effusion synovitis at baseline. Clinical signs of effusion are insensitive but highly specific for the presence of any effusion synovitis on non-CE MRI.
Luo, Qiulan; Zhang, Claire Shuiqing; Yang, Lihong; Zhang, Anthony Lin; Guo, Xinfeng; Xue, Charlie Changli; Lu, Chuanjian
2017-11-06
Chinese herbal medicine formula Yu ping feng san (YPFS) is commonly used for allergic rhinitis (AR). Previous review had summarized the effectiveness and safety of YPFS, however without any subgroup analysis performed to provide detailed evidence for guiding clinical practice. YPFS was recommended for the management of AR by Chinese medicine clinical practice guideline, but the treatment duration of YPFS was also not specified. The aim of this study is to evaluate the effectiveness and safety of YPFS in treating adult AR with the most recent evidence, and attempt to specify the duration of utilisation through subgroup meta-analyses. Seven databases were searched from their inceptions to September 2017. Randomized controlled trials (RCTs) evaluating YPFS for adult AR were included. Methodological quality of studies was assessed using the Cochrane risk of bias tool. Meta-analysis and subgroup meta-analyses were conducted for evaluating the effectiveness of YPFS. The Grading of Recommendations Assessment, Development and Evaluation (GRADE) approach was used for rating the quality of evidence. Twenty-two RCTs involving 23 comparisons were included in this review. YPFS was compared to placebo, pharmacotherapy, and used as an add-on treatment compared to pharmacotherapy. Meta-analyses were feasible for the outcomes of four individual nasal symptom scores and "effective rate". Four individual nasal symptom scores decreased after YPFS' combination treatment: itchy nose (MD-0.46, 95% CI[-0.50, -0.42]), sneezing (MD-0.41, 95% CI[-0.47, -0.35]), blocked nose (MD-0.46, 95% CI[-0.54, -0.39]) and runny nose (MD-0.42, 95% CI[-0.58, -0.26]). Based on "effective rate", meta-analysis showed that YPFS did not achieve better effect than pharmacotherapy (RR1.07, 95%CI [0.94, 1.22), but its combination with pharmacotherapy seemed more effective than pharmacotherapy alone (RR1.27, 95%CI [1.19, 1.34]) (low quality). Subgroup analysis suggested that YPFS was not superior to the second
Evaluation of Ti-6Al-4V surface treatments for use with a polyphenylquinoxaline adhesive
Progar, Donald J.
1987-01-01
Three surface treatments for Ti-6Al-4V adherends were evaluated using a thermoplastic polymer monoether polyphenylquinoxaline, MEPPQ, which had been shown in previous studies to have good potential as a high temperature adhesive for aerospace applications. Initial results based on long term thermal exposure at 232 C (450 F) using the phosphate-fluoride (PF) and chromic acid anodized (CAA) treatments with MEPPQ adhesive were not encouraging. A significant improvement in strength retention and a change in failure mode (cohesive) at 232 C (450 F) was found for the SHA treated specimens compared to the PF and CAA treatments. Although an improvement in long term thermal durability was obtained with the SHA treatment of Ti-6Al-4V, an improved surface treatment with better long term durability is still required for aerospace applications.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. R G Veliyev1 Mir Hasan Yu Seyidov1 2 E M Kerimova1 R Z Sadykhov1 Yu G Asadov1 F M Seyidov1 N Z Gasanov1. Institute of Physics, Azerbaijan National Academy of Sciences, Az 1143, Baku, Azerbaijan; Department of Physics, Gebze Institute of Technology, Gebze 41400, Kocaeli, Turkey ...
International Nuclear Information System (INIS)
2011-01-01
The scientific session 'Econophysics and evolutionary economics' of the Division of Physical Sciences of the Russian Academy of Sciences (RAS) took place on 2 November 2010 in the conference hall of the Lebedev Physical Institute, Russian Academy of Sciences. The session agenda announced on the website www.gpad.ac.ru of the RAS Physical Sciences Division listed the following reports: (1) Maevsky V I (Institute of Economics, RAS, Moscow) 'The transition from simple reproduction to economic growth'; (2) Yudanov A Yu (Financial University of the Government of the Russian Federation, Moscow) 'Experimental data on the development of fast-growing innovative companies in Russia'; (3) Pospelov I G (Dorodnitsyn Computation Center, RAS, Moscow) 'Why is it sometimes possible to successfully model an economy?' (4) Chernyavskii D S (Lebedev Physical Institute, RAS, Moscow) 'Theoretical economics'; (5) Romanovskii M Yu (Prokhorov Institute of General Physics, RAS, Moscow) 'Nonclassical random walks and the phenomenology of fluctuations of the yield of securities in the securities market'; (6) Dubovikov M M, Starchenko N V (INTRAST Management Company, Moscow Engineering Physics Institute, Moscow) 'Fractal analysis of financial time series and the prediction problem'; Papers written on the basis of these reports are published below. The transition from simple reproduction to economic growth, V I Maevsky, S Yu Malkov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 729-733. High-growth firms in Russia: experimental data and prospects for the econophysical simulation of economic modernization, A Yu Yudanov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 733-737. Equilibrium models of economics in the period of a global financial crisis, I G Pospelov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 738-742. On econophysics and its place in modern theoretical economics, D S Chernavskii, N I Starkov, S Yu Malkov, Yu V Kosse, A V Shcherbakov Physics-Uspekhi, 2011, Volume 54, Number
2011-07-01
The scientific session "Econophysics and evolutionary economics" of the Division of Physical Sciences of the Russian Academy of Sciences (RAS) took place on 2 November 2010 in the conference hall of the Lebedev Physical Institute, Russian Academy of Sciences. The session agenda announced on the website www.gpad.ac.ru of the RAS Physical Sciences Division listed the following reports: (1) Maevsky V I (Institute of Economics, RAS, Moscow) "The transition from simple reproduction to economic growth"; (2) Yudanov A Yu (Financial University of the Government of the Russian Federation, Moscow) "Experimental data on the development of fast-growing innovative companies in Russia"; (3) Pospelov I G (Dorodnitsyn Computation Center, RAS, Moscow) "Why is it sometimes possible to successfully model an economy? (4) Chernyavskii D S (Lebedev Physical Institute, RAS, Moscow) "Theoretical economics"; (5) Romanovskii M Yu (Prokhorov Institute of General Physics, RAS, Moscow) "Nonclassical random walks and the phenomenology of fluctuations of the yield of securities in the securities market"; (6) Dubovikov M M, Starchenko N V (INTRAST Management Company, Moscow Engineering Physics Institute, Moscow) "Fractal analysis of financial time series and the prediction problem"; Papers written on the basis of these reports are published below. • The transition from simple reproduction to economic growth, V I Maevsky, S Yu Malkov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 729-733 • High-growth firms in Russia: experimental data and prospects for the econophysical simulation of economic modernization, A Yu Yudanov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 733-737 • Equilibrium models of economics in the period of a global financial crisis, I G Pospelov Physics-Uspekhi, 2011, Volume 54, Number 7, Pages 738-742 • On econophysics and its place in modern theoretical economics, D S Chernavskii, N I Starkov, S Yu Malkov, Yu V Kosse, A V Shcherbakov Physics-Uspekhi, 2011, Volume
PREFACE: XXVIII International Conference on Photonic, Electronic and Atomic Collisions (ICPEAC 2013)
Xiao, Guoqing; Cai, Xiaohong; Ding, Dajun; Ma, Xinwen; Zhao, Yongtao
2014-04-01
express its great appreciation to National Natural Science Foundation of China (NSFC), Chinese Academy of Sciences (CAS), International Union of Pure and Applied Physics (IUPAP), IMP, and IMP-YIPA for financial support, to Fangfang Ruan, Qiang Liang, Dacheng Zhang, Shukai Tian, Yuyu Wang, Wenping Zhu, Wei Liang, Mingwu Zhang, Haibo Yuan, Shan Sha, Jieru Ren, Jie Yang and Zhenhai Chen for their contributions to the organization, and to the volunteer group from Lanzhou University, the High School Attached Northwest Normal University and IMP for their excellent volunteer work. The Local Organizing Committee would like to thank all of the participants and the authors of the proceedings for their supports and contributions to the conference. Guoqing Xiao Director of Institute of Modern Physics, Chinese Academy of Sciences
Mantle electrical conductivity profile of Niger delta region
Indian Academy of Sciences (India)
netic stations installed in Lagos by magnetic dataset (MAGDAS) in 2008 and data from magnetometers ... Gauss spherical harmonic analysis (SHA) method was used to separate the ...... frequency sounding by the results of the spherical har-.
Innovative contracting strategies for combating climate change : research summary.
2011-11-01
Problem: : Under the States Smart, Green & Growing initiative, SHA is committed to reducing : greenhouse gas (GHG) emissions from on- and off-road vehicles and equipment. To : meet the commitment and address associated challenges, the agency...
Wang, Chunye; Guo, Jianyou; Guo, Rongjuan
2017-01-24
Depression is a mental disorder characterized by a pervasive low mood and loss of pleasure or interest in usual activities, and often results in cognitive dysfunction. The disturbance of cognitive processes associated with depression, especially the impairment of learning and memory, exacerbates illness and increases recurrence of depression. XingPiJieYu (XPJY) is one of the most widely clinical formulas of traditional Chinese medicine (TCM) and can improve the symptoms of depression, including learning and memory. However, its regulatory effects haven't been comprehensively studied so far. Recently, some animal tests have indicated that the cyclic adenosine monophosphate (cAMP)-protein kinase A (PKA)-cAMP response element-binding protein (CREB)-brain derived neurotrophic factor (BDNF) signaling pathway in hippocampus is closely related to depression and the pathogenesis of cognitive function impairments. The present study was performed to investigate the effect and mechanism of XPJY on depression and learning and memory in animal model. The rat model of depression was established by chronic unpredictable stress (CUS) for 21 days. The rats were randomly divided into six groups: control group, CUS group, CUS + XPJY (1.4 g/kg, 0.7 g/kg and 0.35 g/kg) groups, and CUS + sertraline (10 mg/kg) group. The sucrose preference, open field exploration and Morris water maze (MWM) were tested. The expression of cAMP, CREB, PKA and BDNF protein in hippocampus was examined with Elisa and Western Blot. The mRNA level of CREB and BDNF in hippocampus was measured with PCR. The results demonstrated that rats subjected to CUS exhibited decreases in sucrose preference, total ambulation, percentage of central ambulation, rearing in the open field test and spatial performance in the MWM. CUS reduced the expression of cAMP, PKA, CREB and BDNF in hippocampus of model rats. These effects could be reversed by XPJY. The results indicated that XPJY can improve depression and
Development of the scintillator-based probe for fast-ion losses in the HL-2A tokamak
Zhang, Y. P.; Liu, Yi; Luo, X. B.; Isobe, M.; Yuan, G. L.; Liu, Y. Q.; Hua, Y.; Song, X. Y.; Yang, J. W.; Li, X.; Chen, W.; Li, Y.; Yan, L. W.; Song, X. M.; Yang, Q. W.; Duan, X. R.
2014-05-01
A new scintillator-based lost fast-ion probe (SLIP) has been developed and operated in the HL-2A tokamak [L. W. Yan, X. R. Duan, X. T. Ding, J. Q. Dong, Q. W. Yang, Yi Liu, X. L. Zou, D. Q. Liu, W. M. Xuan, L. Y. Chen, J. Rao, X. M. Song, Y. Huang, W. C. Mao, Q. M. Wang, Q. Li, Z. Cao, B. Li, J. Y. Cao, G. J. Lei, J. H. Zhang, X. D. Li, W. Chen, J. Chen, C. H. Cui, Z. Y. Cui, Z. C. Deng, Y. B. Dong, B. B. Feng, Q. D. Gao, X. Y. Han, W. Y. Hong, M. Huang, X. Q. Ji, Z. H. Kang, D. F. Kong, T. Lan, G. S. Li, H. J. Li, Qing Li, W. Li, Y. G. Li, A. D. Liu, Z. T. Liu, C. W. Luo, X. H. Mao, Y. D. Pan, J. F. Peng, Z. B. Shi, S. D. Song, X. Y. Song, H. J. Sun, A. K. Wang, M. X. Wang, Y. Q. Wang, W. W. Xiao, Y. F. Xie, L. H. Yao, D. L. Yu, B. S. Yuan, K. J. Zhao, G. W. Zhong, J. Zhou, J. C. Yan, C. X. Yu, C. H. Pan, Y. Liu, and the HL-2A Team, Nucl. Fusion 51, 094016 (2011)] to measure the losses of neutral beam ions. The design of the probe is based on the concept of the α-particle detectors on Tokamak Fusion Test Reactor (TFTR) using scintillator plates. The probe is capable of traveling across an equatorial plane port and sweeping the aperture angle rotationally with respect to the axis of the probe shaft by two step motors, in order to optimize the radial position and the collimator angle. The energy and the pitch angle of the lost fast ions can be simultaneously measured if the two-dimensional image of scintillation light intensity due to the impact of the lost fast ions is detected. Measurements of the fast-ion losses using the probe have been performed during HL-2A neutral beam injection discharges. The clear experimental evidence of enhanced losses of beam ions during disruptions has been obtained by means of the SLIP system. A detailed description of the probe system and the first experimental results are reported.
Development of the scintillator-based probe for fast-ion losses in the HL-2A tokamak
Energy Technology Data Exchange (ETDEWEB)
Zhang, Y. P., E-mail: zhangyp@swip.ac.cn; Liu, Yi; Yuan, G. L.; Song, X. Y.; Yang, J. W.; Li, X.; Chen, W.; Li, Y.; Yan, L. W.; Song, X. M.; Yang, Q. W.; Duan, X. R. [Southwestern Institute of Physics, P.O. Box 432, Chengdu 610041 (China); Luo, X. B.; Liu, Y. Q.; Hua, Y. [Institute of Nuclear Science and Technology, Sichuan University, Chengdu 610041 (China); Isobe, M. [National Institute for Fusion Science, 322-6 Oroshi-cho, Toki 509-5259 (Japan)
2014-05-15
A new scintillator-based lost fast-ion probe (SLIP) has been developed and operated in the HL-2A tokamak [L. W. Yan, X. R. Duan, X. T. Ding, J. Q. Dong, Q. W. Yang, Yi Liu, X. L. Zou, D. Q. Liu, W. M. Xuan, L. Y. Chen, J. Rao, X. M. Song, Y. Huang, W. C. Mao, Q. M. Wang, Q. Li, Z. Cao, B. Li, J. Y. Cao, G. J. Lei, J. H. Zhang, X. D. Li, W. Chen, J. Chen, C. H. Cui, Z. Y. Cui, Z. C. Deng, Y. B. Dong, B. B. Feng, Q. D. Gao, X. Y. Han, W. Y. Hong, M. Huang, X. Q. Ji, Z. H. Kang, D. F. Kong, T. Lan, G. S. Li, H. J. Li, Qing Li, W. Li, Y. G. Li, A. D. Liu, Z. T. Liu, C. W. Luo, X. H. Mao, Y. D. Pan, J. F. Peng, Z. B. Shi, S. D. Song, X. Y. Song, H. J. Sun, A. K. Wang, M. X. Wang, Y. Q. Wang, W. W. Xiao, Y. F. Xie, L. H. Yao, D. L. Yu, B. S. Yuan, K. J. Zhao, G. W. Zhong, J. Zhou, J. C. Yan, C. X. Yu, C. H. Pan, Y. Liu, and the HL-2A Team , Nucl. Fusion 51, 094016 (2011)] to measure the losses of neutral beam ions. The design of the probe is based on the concept of the α-particle detectors on Tokamak Fusion Test Reactor (TFTR) using scintillator plates. The probe is capable of traveling across an equatorial plane port and sweeping the aperture angle rotationally with respect to the axis of the probe shaft by two step motors, in order to optimize the radial position and the collimator angle. The energy and the pitch angle of the lost fast ions can be simultaneously measured if the two-dimensional image of scintillation light intensity due to the impact of the lost fast ions is detected. Measurements of the fast-ion losses using the probe have been performed during HL-2A neutral beam injection discharges. The clear experimental evidence of enhanced losses of beam ions during disruptions has been obtained by means of the SLIP system. A detailed description of the probe system and the first experimental results are reported.
Development of the scintillator-based probe for fast-ion losses in the HL-2A tokamak
International Nuclear Information System (INIS)
Zhang, Y. P.; Liu, Yi; Yuan, G. L.; Song, X. Y.; Yang, J. W.; Li, X.; Chen, W.; Li, Y.; Yan, L. W.; Song, X. M.; Yang, Q. W.; Duan, X. R.; Luo, X. B.; Liu, Y. Q.; Hua, Y.; Isobe, M.
2014-01-01
A new scintillator-based lost fast-ion probe (SLIP) has been developed and operated in the HL-2A tokamak [L. W. Yan, X. R. Duan, X. T. Ding, J. Q. Dong, Q. W. Yang, Yi Liu, X. L. Zou, D. Q. Liu, W. M. Xuan, L. Y. Chen, J. Rao, X. M. Song, Y. Huang, W. C. Mao, Q. M. Wang, Q. Li, Z. Cao, B. Li, J. Y. Cao, G. J. Lei, J. H. Zhang, X. D. Li, W. Chen, J. Chen, C. H. Cui, Z. Y. Cui, Z. C. Deng, Y. B. Dong, B. B. Feng, Q. D. Gao, X. Y. Han, W. Y. Hong, M. Huang, X. Q. Ji, Z. H. Kang, D. F. Kong, T. Lan, G. S. Li, H. J. Li, Qing Li, W. Li, Y. G. Li, A. D. Liu, Z. T. Liu, C. W. Luo, X. H. Mao, Y. D. Pan, J. F. Peng, Z. B. Shi, S. D. Song, X. Y. Song, H. J. Sun, A. K. Wang, M. X. Wang, Y. Q. Wang, W. W. Xiao, Y. F. Xie, L. H. Yao, D. L. Yu, B. S. Yuan, K. J. Zhao, G. W. Zhong, J. Zhou, J. C. Yan, C. X. Yu, C. H. Pan, Y. Liu, and the HL-2A Team , Nucl. Fusion 51, 094016 (2011)] to measure the losses of neutral beam ions. The design of the probe is based on the concept of the α-particle detectors on Tokamak Fusion Test Reactor (TFTR) using scintillator plates. The probe is capable of traveling across an equatorial plane port and sweeping the aperture angle rotationally with respect to the axis of the probe shaft by two step motors, in order to optimize the radial position and the collimator angle. The energy and the pitch angle of the lost fast ions can be simultaneously measured if the two-dimensional image of scintillation light intensity due to the impact of the lost fast ions is detected. Measurements of the fast-ion losses using the probe have been performed during HL-2A neutral beam injection discharges. The clear experimental evidence of enhanced losses of beam ions during disruptions has been obtained by means of the SLIP system. A detailed description of the probe system and the first experimental results are reported
... to prevent colds or relieve cold symptoms. Andrographis (Andrographis paniculata) Chinese herbal medicines Green tea Guided imagery Hydrotherapy ... measurements (VAS) to assess the effectiveness of standardized Andrographis paniculata extract SHA-10 in reducing the symptoms of ...
Lifescience Database Archive (English)
Full Text Available iqytlsdrdwksmlpsieaslralikigaieasipis gfkpgnqdtieqyikaiksngyksnqtvilsahqmgscrmgssksnsvvnengeswdvkr lfiadgsvl...llikkikikikis*yy**kk--- ---*lvksikkyyqtvgriqvqswrlpnshialsgsncafmwddsfnfkkrmlkaryysg fisicrdtvpgkirldkdgrspk