WorldWideScience

Sample records for sha zhang yu

  1. zhang xiurong

    Home; Journals; Bulletin of Materials Science. ZHANG XIURONG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 48. Structures and electronic properties of W m Cu n ( n + m ≤ 7 ) clusters · YU ZHICHENG ZHANG XIURONG HUO PEIYING GAO KUN · More Details Abstract Fulltext PDF.

  2. w zhang

    Home; Journals; Bulletin of Materials Science. W ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...

  3. p zhang

    Home; Journals; Bulletin of Materials Science. P ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 51. Effect of oxygen vacancies on Li-storage of anatase TiO 2 (001) facets: a first principles study · H CHEN Y H DING X Q TANG W ZHANG J R YIN P ZHANG Y JIANG · More Details ...

  4. Ping Zhang

    Home; Journals; Bulletin of Materials Science. PING ZHANG. Articles written in Bulletin of Materials Science. Volume 36 Issue 6 November 2013 pp 1073-1077. Intrinsic structure and friction properties of graphene and graphene oxide nanosheets studied by scanning probe microscopy · Yan-Huai Ding Hu-Ming Ren Fei-Hu ...

  5. dujuan zhang

    Home; Journals; Bulletin of Materials Science. DUJUAN ZHANG. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 59. In vitro bioactivity evaluation of α -calcium sulphate hemihydrate and bioactive glass composites for their potential use in bone regeneration · YANYAN ZHENG CHENGDONG ...

  6. [Gao Jingyi. Han yu yu bei Ou yu yan : Han yu yu Wula'er yu yan ji Yin Ou yu yan tong yuan tan jiu] / Ago Künnap

    Künnap, Ago, 1941-

    2010-01-01

    Arvustus: Gao Jingyi. Han yu yu bei Ou yu yan : Han yu yu Wula'er yu yan ji Yin Ou yu yan tong yuan tan jiu = Chinese language and languages of northern Europe. Beijing : Zhongguo she hui ke xue chu ban she, 2008

  7. Preimages for Step-Reduced SHA-2

    Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian

    2009-01-01

    In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...

  8. The first collision for full SHA-1

    M.M.J. Stevens (Marc); E. Bursztein (Elie); P. Karpman (Pierre); A. Albertini (Ange); Y. Markov (Yarik)

    2017-01-01

    textabstractSHA-1 is a widely used 1995 NIST cryptographic hash function standard that was officially deprecated by NIST in 2011 due to fundamental security weaknesses demonstrated in various analyses and theoretical attacks. Despite its deprecation, SHA-1 remains widely used in 2017 for document

  9. Jing Tong Yu Shu, a traditional Chinese medicine, suppresses IL-1β ...

    Zhang et al. 2953. Tropical ... Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a ..... Flower A, Liu JP, Chen S, Lewith G, Little P. Chinese ... Mol Hum Reprod 2000; 6: 269-275. 18.

  10. Zhang functions and various models

    Zhang, Yunong

    2015-01-01

    This book focuses on solving different types of time-varying problems. It presents various Zhang dynamics (ZD) models by defining various Zhang functions (ZFs) in real and complex domains. It then provides theoretical analyses of such ZD models and illustrates their results. It also uses simulations to substantiate their efficacy and show the feasibility of the presented ZD approach (i.e., different ZFs leading to different ZD models), which is further applied to the repetitive motion planning (RMP) of redundant robots, showing its application potential.

  11. "Pipa Fairy Maiden" Zhang Hongyan

    1995-01-01

    WHEN Zhang Hongyan plays the completely traditional Chinese musical instrument, the pipa, she is called a "pipa fairy maiden" by her audiences, "the pipa queen with outstanding talent and appearance" by the Hong Kong press and "a national flower of the Women Philharmonic Orchestra" in Singapore. Having completed her master’s degree program at the folk music department of the Central Conservatory of Music. Zhang is continuing there as a teacher. On the unforgettable night of June 9, 1992, Zhang Hongyan presented her first solo concerto concert at the Beijing Concert Hall, in cooperation with the celebrated Central Philharmonic Orchestra based in Beijing and its famous conductor Hu Yongyan. This concert made her the first folk musical instrument player to present a special concerto concert in cooperation with a Western style orchestra. It is the result of many years of effort. Zhang was born in Shengxian County, Zhejiang Province, famous as the home of Yue Opera. Her father is a musician with a Yue Opera

  12. Dicty_cDB: SHA665 [Dicty_cDB

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  13. SHA-1, SAT-solving, and CNF

    Motara, YM

    2017-09-01

    Full Text Available the intersection between the SHA-1 preimage problem, the encoding of that problem for SAT-solving, and SAT-solving. The results demonstrate that SAT-solving is not yet a viable approach to take to solve the preimage problem, and also indicate that some...

  14. Zhang Qing and His Meticulous Chinese Paintings

    JULIE; M.SEGRAVES

    2002-01-01

    ZHANG Qing was initially drawn to the bird and flower paint-ings of the Tang and Song dynasties (7th-12th centuries). Later,Qing Dynasty (1644-1911) artist Ren Bonian, famous for hispaintings of figures, also became an important influence.Although Zhang Qing considers his style to be firmly rooted in tradi-

  15. Dicty_cDB: SHA393 [Dicty_cDB

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  16. 76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256

    2011-03-02

    ... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...

  17. LDPC and SHA based iris recognition for image authentication

    K. Seetharaman

    2012-11-01

    Full Text Available We introduce a novel way to authenticate an image using Low Density Parity Check (LDPC and Secure Hash Algorithm (SHA based iris recognition method with reversible watermarking scheme, which is based on Integer Wavelet Transform (IWT and threshold embedding technique. The parity checks and parity matrix of LDPC encoding and cancellable biometrics i.e., hash string of unique iris code from SHA-512 are embedded into an image for authentication purpose using reversible watermarking scheme based on IWT and threshold embedding technique. Simply by reversing the embedding process, the original image, parity checks, parity matrix and SHA-512 hash are extracted back from watermarked-image. For authentication, the new hash string produced by employing SHA-512 on error corrected iris code from live person is compared with hash string extracted from watermarked-image. The LDPC code reduces the hamming distance for genuine comparisons by a larger amount than for the impostor comparisons. This results in better separation between genuine and impostor users which improves the authentication performance. Security of this scheme is very high due to the security complexity of SHA-512, which is 2256 under birthday attack. Experimental results show that this approach can assure more accurate authentication with a low false rejection or false acceptance rate and outperforms the prior arts in terms of PSNR.

  18. Second-Preimage Analysis of Reduced SHA-1

    Rechberger, Christian

    2010-01-01

    Many applications using cryptographic hash functions do not require collision resistance, but some kind of preimage resistance. That's also the reason why the widely used SHA-1 continues to be recommended in all applications except digital signatures after 2010. Recent work on preimage and second...

  19. D.SYM.4 SHA-3 Design and Cryptanalysis Report

    Gauravaram, Praveen; Thomsen, Søren Steffen

    2011-01-01

    The competition to select a new secure hash function standard SHA-3 was initiated in response to surprising progress in the cryptanalysis of existing hash function constructions that started in 2004. In this report we survey design and cryptanalytic results of those 14 candidates that remain in t...

  20. On security arguments of the second round SHA-3 candidates

    Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart

    2012-01-01

    of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...... and review arguments and bounds against classes of differential attacks.We discuss all the SHA-3 candidates at a high functional level, analyze, and summarize the security reduction results and bounds against differential attacks. Additionally, we generalize the well-known proof of collision resistance...

  1. Twist of Magnetic Fields in Solar Active Regions Hongqi Zhang ...

    tribpo

    in active regions also shows the butterfly pattern through the solar cycle. And, less than 30% of the active regions do not follow the general trend (Zhang & Bao 1998). The longitudinal distribution of current helicity parameter h|| of active regions in both the hemispheres in the last decade was presented by Zhang & Bao ...

  2. Mapping PetaSHA Applications to TeraGrid Architectures

    Cui, Y.; Moore, R.; Olsen, K.; Zhu, J.; Dalguer, L. A.; Day, S.; Cruz-Atienza, V.; Maechling, P.; Jordan, T.

    2007-12-01

    The Southern California Earthquake Center (SCEC) has a science program in developing an integrated cyberfacility - PetaSHA - for executing physics-based seismic hazard analysis (SHA) computations. The NSF has awarded PetaSHA 15 million allocation service units this year on the fastest supercomputers available within the NSF TeraGrid. However, one size does not fit all, a range of systems are needed to support this effort at different stages of the simulations. Enabling PetaSHA simulations on those TeraGrid architectures to solve both dynamic rupture and seismic wave propagation have been a challenge from both hardware and software levels. This is an adaptation procedure to meet specific requirements of each architecture. It is important to determine how fundamental system attributes affect application performance. We present an adaptive approach in our PetaSHA application that enables the simultaneous optimization of both computation and communication at run-time using flexible settings. These techniques optimize initialization, source/media partition and MPI-IO output in different ways to achieve optimal performance on the target machines. The resulting code is a factor of four faster than the orignial version. New MPI-I/O capabilities have been added for the accurate Staggered-Grid Split-Node (SGSN) method for dynamic rupture propagation in the velocity-stress staggered-grid finite difference scheme (Dalguer and Day, JGR, 2007), We use execution workflow across TeraGrid sites for managing the resulting data volumes. Our lessons learned indicate that minimizing time to solution is most critical, in particular when scheduling large scale simulations across supercomputer sites. The TeraShake platform has been ported to multiple architectures including TACC Dell lonestar and Abe, Cray XT3 Bigben and Blue Gene/L. Parallel efficiency of 96% with the PetaSHA application Olsen-AWM has been demonstrated on 40,960 Blue Gene/L processors at IBM TJ Watson Center. Notable

  3. [Diagnosis and treatment characteristics of head-wind sha in She medicine].

    Zou, Guangyi; Xu, Xiangdong; Zheng, Songming; Yan, Lianhe; Lei, Houxing; Zhang, Qiao-ling; Xiang, Yingmei; Ye, Yiping; Song, Liwei

    2015-03-01

    The diagnosis and treatment characteristics of head-wind sha in She medicine were analyzed and summarized. By visiting She-nationality villages and towns in Zhejiang province and Fujian province and interviewing hundreds of doctors of She medicine, the sha diagnosis, sha differentiation, experience and theory of treatment were arranged, and a comprehensive summary on theory and application of head-wind sha in She medicine such as pathogeny, name of disease, mechanism, diagnosis, differential diagnosis and treatment was made. It is believed that the methods of diagnosis and treatment in She medicine for head-wind sha could effectively enhance curative effect, safety and patients' quality of life, and the further research should be carried out.

  4. Further investigations on a question of Zhang and Lü

    Abhijit Banerjee

    2015-09-01

    Full Text Available In the paper taking the question of Zhang and Lü [15] into background, wepresent one theorem which will improve and extend results of Banerjee-Majumdar [2] and arecent result of Li-Huang [9].

  5. On soliton solutions of the Wu-Zhang system

    Inc Mustafa

    2016-01-01

    Full Text Available In this paper, the extended tanh and hirota methods are used to construct soliton solutions for the WuZhang (WZ system. Singular solitary wave, periodic and multi soliton solutions of the WZ system are obtained.

  6. Mortal Ancestors, Immortal Images: Zhang Dai’s Biographical Portraits

    Duncan M. Campbell

    2012-01-01

    Towards the end of his long life, the prolific late-Ming historian and essayist Zhang Dai 張岱 (1597-?1684) completed a book that he had been working on for many years. Entitled Portraits of the Eminent and Worthy Immortals of Zhejiang During the Ming Dynasty (You Ming yuyue san bu xiu tuzan 有明於越三不朽名賢圖贊) the book included the short biographies (with poetic panegyrics) and portraits of 109 men and women of Zhang Dai’s hometown of Shaoxing, one of the epicentres of China’s élite cultural life. Th...

  7. Mortal Ancestors, Immortal Images: Zhang Dai’s Biographical Portraits

    Duncan M. Campbell

    2012-11-01

    Full Text Available Towards the end of his long life, the prolific late-Ming historian and essayist Zhang Dai 張岱 (1597-?1684 completed a book that he had been working on for many years. Entitled Portraits of the Eminent and Worthy Immortals of Zhejiang During the Ming Dynasty (You Ming yuyue san bu xiu tuzan 有明於越三不朽名賢圖贊 the book included the short biographies (with poetic panegyrics and portraits of 109 men and women of Zhang Dai’s hometown of Shaoxing, one of the epicentres of China’s élite cultural life. The book was organised according to the “Three Immortalities of Life”: moral force, meritorious service, and wise words. Zhang also included a number of his own friends and family members in this collection. This paper discusses aspects the relationship between text and image in this late-imperial Chinese work, both in the context of Zhang Dai’s practice as a biographer who had a strong visual sense and in regard to his particular historical plight as someone who had survived the collapse of one dynasty and who had lived on under its successor regime.

  8. Relational demography in coach-athlete dyads | Zhang | African ...

    This study used an adapted version of Zhang's (2004) trust questionnaire to examine perceived characteristic and trust differences between coach and athlete dyads that differ in gender or ethnicity as well as in dyads that were similar. The four different gender dyad groups were male athlete with male coach (MAMC), ...

  9. [Learning experience of acupuncture technique from professor ZHANG Jin].

    Xue, Hongsheng; Zhang, Jin

    2017-08-12

    As a famous acupuncturist in the world, professor ZHANG Jin believes the key of acupuncture technique is the use of force, and the understanding of the "concentrating the force into needle body" is essential to understand the essence of acupuncture technique. With deep study of Huangdi Neijing ( The Inner Canon of Huangdi ) and Zhenjiu Dacheng ( Compendium of Acupuncture and Moxibustion ), the author further learned professor ZHANG Jin 's theory and operation specification of "concentrating force into needle body, so the force arriving before and together with needle". The whole-body force should be subtly focused on the tip of needle, and gentle force at tip of needle could get significant reinforcing and reducing effect. In addition, proper timing at tip of needle could start reinforcing and reducing effect, lead qi to disease location, and achieve superior clinical efficacy.

  10. Jing Tong Yu Shu , a traditional Chinese medicine, suppresses IL ...

    Purpose: To evaluate the effect of a traditional Chinese medicine, Jing Tong Yu Shu (JTYS) on endometriosis in a rat surgical model. Methods: Endometriosis was induced in 40 female rats. The rats were randomly divided into 4 groups: three JTYS groups given different doses of the drug, and a saline group. After four ...

  11. False become true: Christie's catalogue of Zhang Hongtu

    Sandra Valenzuela Arellano

    2013-06-01

    Full Text Available By analyzing the series Christie’s Catalogue Project by the artist Zhang Hongtu, this essay traces relationships between: Cultural heritance, national identity, fakeness, popular culture and legitimacy of power structures, within contemporary China. Contemporary art creates assemblies of meanings related to its time, sometimes relating the present with history, high with vernacular culture, soft power with the construction of collective memory. This essay aims to reconstruct with words, through textual and visual analysis, those visual assemblies.

  12. A one-time pad color image cryptosystem based on SHA-3 and multiple chaotic systems

    Wang, Xingyuan; Wang, Siwei; Zhang, Yingqian; Luo, Chao

    2018-04-01

    A novel image encryption algorithm is proposed that combines the SHA-3 hash function and two chaotic systems: the hyper-chaotic Lorenz and Chen systems. First, 384 bit keystream hash values are obtained by applying SHA-3 to plaintext. The sensitivity of the SHA-3 algorithm and chaotic systems ensures the effect of a one-time pad. Second, the color image is expanded into three-dimensional space. During permutation, it undergoes plane-plane displacements in the x, y and z dimensions. During diffusion, we use the adjacent pixel dataset and corresponding chaotic value to encrypt each pixel. Finally, the structure of alternating between permutation and diffusion is applied to enhance the level of security. Furthermore, we design techniques to improve the algorithm's encryption speed. Our experimental simulations show that the proposed cryptosystem achieves excellent encryption performance and can resist brute-force, statistical, and chosen-plaintext attacks.

  13. [Autobiography of modern acupuncturist Yu Shu-zhuang].

    Li, Jia-jian' i; Guo, Jing; Yu, Zhen-zhong; Wang, Lin-peng

    2014-11-01

    Professor YU Shu-zhuang is a distinguished acupuncturist in China. He has practiced the TCM acupuncture-moxibustion clinical, educational and scientific research for 60 years in his life. In clinic, he summarized the experiences "five-ming first"; in treatment, he insisted "dredging" and "regulating", protecting the function of spleen and stomach, and needles should be less but specific. In the meanwhile, he made a deep study on the function and clinical effects of specific acupoints, and used the research results of propagated sensation along channel to guide clinical treatment, forming his special academic points. Professor YU has educated a great number of acupuncture-moxibustion talents in China and foreign countries, making great contribution to the popularization of acupuncture-moxibustion in the worldwide.

  14. Le langage des couleurs dans les films de Zhang Yimou

    Xiaomin Giafferri

    2009-01-01

    Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le so...

  15. Data harmonization and federated analysis of population-based studies : the BioSHaRE project

    Doiron, Dany; Burton, Paul; Marcon, Yannick; Gaye, Amadou; Wolffenbuttel, Bruce H R; Perola, Markus; Stolk, Ronald P; Foco, Luisa; Minelli, Cosetta; Waldenberger, Melanie; Holle, Rolf; Kvaløy, Kirsti; Hillege, Hans L; Tassé, Anne-Marie; Ferretti, Vincent; Fortier, Isabel

    2013-01-01

    ABSTRACTS BACKGROUND: Individual-level data pooling of large population-based studies across research centres in international research projects faces many hurdles. The BioSHaRE (Biobank Standardisation and Harmonisation for Research Excellence in the European Union) project aims to address these

  16. Side channel analysis of some hash based MACs: A response to SHA-3 requirements

    Gauravaram, Praveen; Okeya, Katsuyuki

    2008-01-01

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...

  17. Dynamics analysis of fractional order Yu-Wang system

    Bhalekar, Sachin

    2013-10-01

    Fractional order version of a dynamical system introduced by Yu and Wang (Engineering, Technology & Applied Science Research, 2, (2012) 209-215) is discussed in this article. The basic dynamical properties of the system are studied. Minimum effective dimension 0.942329 for the existence of chaos in the proposed system is obtained using the analytical result. For chaos detection, we have calculated maximum Lyapunov exponents for various values of fractional order. Feedback control method is then used to control chaos in the system. Further, the system is synchronized with itself and with fractional order financial system using active control technique. Modified Adams-Bashforth-Moulton algorithm is used for numerical simulations.

  18. Aesthetic Function Realized in the Selected Modern Chinese Essays by Zhang Peiji

    罗丹

    2014-01-01

    The selected modern Chinese essays translated by Zhang Peiji is a masterpiece for Chinese scholars to do translation research. Prof. Zhang not only excels at translating the Chinese works accurately but also conveys the aesthetic value in the translated version. This paper wil analyse the aesthetic function used in Zhang Peiji’s selected modern Chinese essays from five aspects, music value, rhythm value, ful-grownness value, conciseness value and artistic conception value.

  19. Effects of Gua-Sha therapy on breast engorgement: a randomized controlled trial.

    Chiu, Jin-Yu; Gau, Meei-Ling; Kuo, Shu-Yu; Chang, Yung-Hsien; Kuo, Su-Chen; Tu, Hui-Chuan

    2010-03-01

    Breast engorgement is a common problem that affects the initiation and duration of breastfeeding. Limited solutions are available to relieve the discomfort associated with breast engorgement. Thus, further investigation of methods to achieve effective relief of symptoms is critical to promote breastfeeding success. : The purpose of this study was to determine the effects of two breast care methods, that is, scraping (Gua-Sha) therapy (administered to the experimental group) and traditional breast care (i.e., massage and heating; administered to the control group). A randomized controlled trial was conducted on 54 postpartum women at a Level III medical teaching hospital. Participant inclusion criteria included postpartum breastfeeding women (a) who had an uncomplicated delivery and (b) who were experiencing breast engorgement problems. The Gua-Sha protocol selected appropriate acupoint positions, which included ST16, ST18, SP17, and CV17. Each position was lightly scraped seven times in two cycles. For the control group, we used hot packs and massage for 20 min in accordance with recommendations given in an obstetrical technique textbook. Results showed no statistical differences between the two groups at baseline. Body temperature, breast temperature, breast engorgement, pain levels, and discomforting levels were statistically different between the two groups at 5 and 30 min after intervention (p account. Our findings provided empirical evidence supporting that Gua-Sha therapy may be used as an effective technique in the management of breast engorgement. By using Gua-Sha therapy, nurses can handle breast engorgement problems more effectively in primary care and hence help patients both physically and psychologically.

  20. A comparative study of Message Digest 5(MD5) and SHA256 algorithm

    Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.

    2018-03-01

    The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.

  1. Le langage des couleurs dans les films de Zhang Yimou

    Xiaomin Giafferri

    2009-05-01

    Full Text Available Tout film, ou du moins tout film de fiction, est récit. Représentation visuelle et sonore, le film transpose à l’écran la réalité par un enchaînement d’images, où des traits physiques, gestes, mouvements, paysages se combinent pour former un espace de fiction. Le cinéma en tant qu’art possède un langage spécifique ; dans un film coloré, les couleurs comme moyen d’expression font partie du langage pictural. A partir de quatre films de Zhang Yimou connus en Europe, Le sorgho rouge, Epouses et concubines, Judou et Hero, ce texte tente de réfléchir sur ces questions: si l’on admet que les limites du récit filmique diffèrent de celles du récit verbal, romanesque par exemple, les couleurs qui ne constituent pas un trait pertinent d’identification, participent-elle à la prise en charge de l’histoire ? Composante de l’espace filmique dont les fonctions narratives sont incontestées, sont-elle définitivement non diégétiques ?

  2. Characteristic Sign Renewals of Kardar-Parisi-Zhang Fluctuations

    Takeuchi, Kazumasa A.; Akimoto, Takuma

    2016-09-01

    Tracking the sign of fluctuations governed by the (1+1)-dimensional Kardar-Parisi-Zhang (KPZ) universality class, we show, both experimentally and numerically, that its evolution has an unexpected link to a simple stochastic model called the renewal process, studied in the context of aging and ergodicity breaking. Although KPZ and the renewal process are fundamentally different in many aspects, we find remarkable agreement in some of the time correlation properties, such as the recurrence time distributions and the persistence probability, while the two systems can be different in other properties. Moreover, we find inequivalence between long-time and ensemble averages in the fraction of time occupied by a specific sign of the KPZ-class fluctuations. The distribution of its long-time average converges to nontrivial broad functions, which are found to differ significantly from that of the renewal process, but instead be characteristic of KPZ. Thus, we obtain a new type of ergodicity breaking for such systems with many-body interactions. Our analysis also detects qualitative differences in time-correlation properties of circular and flat KPZ-class interfaces, which were suggested from previous experiments and simulations but still remain theoretically unexplained.

  3. Insight into the mechanism of action of temporin-SHa, a new broad-spectrum antiparasitic and antibacterial agent.

    Zahid Raja

    Full Text Available Antimicrobial peptides (AMPs are promising drugs to kill resistant pathogens. In contrast to bacteria, protozoan parasites, such as Leishmania, were little studied. Therefore, the antiparasitic mechanism of AMPs is still unclear. In this study, we sought to get further insight into this mechanism by focusing our attention on temporin-SHa (SHa, a small broad-spectrum AMP previously shown to be active against Leishmania infantum. To improve activity, we designed analogs of SHa and compared the antibacterial and antiparasitic mechanisms. [K3]SHa emerged as a highly potent compound active against a wide range of bacteria, yeasts/fungi, and trypanosomatids (Leishmania and Trypanosoma, with leishmanicidal intramacrophagic activity and efficiency toward antibiotic-resistant strains of S. aureus and antimony-resistant L. infantum. Multipassage resistance selection demonstrated that temporins-SH, particularly [K3]SHa, are not prone to induce resistance in Escherichia coli. Analysis of the mode of action revealed that bacterial and parasite killing occur through a similar membranolytic mechanism involving rapid membrane permeabilization and depolarization. This was confirmed by high-resolution imaging (atomic force microscopy and field emission gun-scanning electron microscopy. Multiple combined techniques (nuclear magnetic resonance, surface plasmon resonance, differential scanning calorimetry allowed us to detail peptide-membrane interactions. [K3]SHa was shown to interact selectively with anionic model membranes with a 4-fold higher affinity (KD = 3 x 10-8 M than SHa. The amphipathic α-helical peptide inserts in-plane in the hydrophobic lipid bilayer and disrupts the acyl chain packing via a detergent-like effect. Interestingly, cellular events, such as mitochondrial membrane depolarization or DNA fragmentation, were observed in L. infantum promastigotes after exposure to SHa and [K3]SHa at concentrations above IC50. Our results indicate that these

  4. Yu.S. Osipov's work in mathematical control theory

    Kryazhimskiy, Arkady A

    2006-01-01

    This paper gives an overview of Yu.S. Osipov's work in mathematical control theory, including development of the theory of positional differential games for control systems with time delay; analysis of the phenomenon of infinite dimensionality of the state space of a dynamical system in the context of differential games; development of the theory of dynamical inversion (dynamical regularization) for finite- and infinite-dimensional control systems; applications of methods of the theory of positional differential games beyond the scope of the theory itself; work on new differential-game methods and on methods of control under incomplete information. The author of this overview is the first student of Osipov, and also his longstanding colleague.

  5. Immunological evaluation of Lactobacillus casei Zhang: a newly isolated strain from koumiss in Inner Mongolia, China

    Du Ruiting

    2008-11-01

    Full Text Available Abstract Background There is increasing evidence to suggest an immunomodulation function both within the intestines and systemically upon consuming probiotic species. We recently isolated a novel LAB, Lactobacillus caseiZhang (LcZhang from koumiss. LcZhang exhibited favorable probiotic properties, such as acid resistance, bile resistance, gastrointestinal (GI colonization ability, etc. In order to examine the immunomodulatory qualities of LcZhang, we administered LcZhang to healthy mice with varying doses of either live or heat-killed LcZhang and measured various parameters of the host immune response. Results The study was performed in four separate experiments via oral administration of live and heat-killed LcZhang to BALB/c mice for several consecutive days. We investigated the immunomodulating capacity of LcZhang in vivo by analyzing the profile of cytokines, T cell subpopulations, and immunoglobulin concentrations induced in blood serum and intestinal fluid in BALB/c mice. Only live bacteria elicited a wide range of immune responses, which include the increased production of interferon-γ (IFN-γ, and depression of tumor necrosis factor-α (TNF-α levels. In addition, interleukin-2 (IL-2 and IL-2 receptor gene transcription increased significantly, but the proportion of T cell subsets appeared to be unaffected. We also observed that LcZhang was capable of inducing gut mucosal responses by enhancing the production of secretory Immunoglobulin A (sIgA as well influencing the systemic immunity via the cytokines released to the circulating blood. Conclusion The present work shows that the dose-dependent administration of LcZhang is capable of influencing immune responses, implying that it may be a valuable strain for probiotic use in humans.

  6. Dr. Yu Wang, Director, Natural Science Division, National Science Council, Taiwan

    Patrice Loïez

    2001-01-01

    Photo 01: L. to r.: Dr. Philippe Bloch, CERN CMS ECAL Deputy Project Manager, Dr. Yu Wang, Dr. Etiennette Auffray, CERN, responsible of the CERN ECAL Regional Centre. Photo 02: L. to r.: Dr. Yu Wang, Dr. Philippe Bloch, Dr. Apollo GO, National Central University, Taiwan, Dr. Etiennette Auffray.

  7. Comments on Yu N Parkhomenko's paper 'Role of aberration effects in dispersive cavities'

    Anokhov, S P

    1999-01-01

    The legitimacy of the approach, proposed by Yu N Parkhomenko for dealing with the operation of solid-state lasers with dispersive cavities, is discussed. Additional information is provided on the neodymium glass laser, used in the present author's experiment. Comment on A Yu N Parkhomenko 1998 Quantum Electron. 28 1102. (discussion)

  8. China marks World Population Day. Address by Zhang Weiqing: (Excerpts).

    Zhang, W

    1998-08-01

    This is a summary of remarks by Minister Zhang Weiqing of China's State Family Planning Commission (SFPC) given on World Population Day in China. The world's population size has increased by 1 billion since 1987, and will reach 6 billion by 1999. As the most populous developing country in the world, China has a greater population pressure and bears a large responsibility regarding stabilization of the world's population and realization of sustainable development. China has a less developed economy and a high percentage of rural and illiterate persons, many of whom are below the poverty line. The interests of both present and future generations must be taken into account with regard to development. In addition, the modernization drive must include strategies for sustainable development and basic national policies of FP and environmental protection in order to achieve a balance among population growth, the economy, resources, and the environment. After 30 years of effort, China has succeeded in solving its population problem by integrating governmental guidance with voluntary public participation in FP. In 1997, the birthrate decreased to 16.57/1000, and the total fertility rate was below replacement level. Changes in attitude toward marriage and childbearing have occurred, as has awareness of voluntary participation in FP. However, some problems have emerged in the implementation of population and FP programs. China will carry out its programs strictly and effectively while developing the national economy. Goals include: 1) stressing the IEC program regarding contraception and regular FP management and services; 2) integrating the FP program with economic development; 3) helping the public to become well off; 4) protecting maternal and child health; 5) improving the status of women; 6) delivering reproductive services; and 7) improving social security measures. Efforts will be made to enable the public to have a more active part in implementing the FP program.

  9. How to apply SHA 2011 at a subnational level in China's practical situation: take children health expenditure as an example.

    Li, Mingyang; Zheng, Ang; Duan, Wenjuan; Mu, Xin; Liu, Chunli; Yang, Yang; Wang, Xin

    2018-06-01

    System of Health Accounts 2011 (SHA 2011) is a new health care accounts system, revised from SHA 1.0 by the Organisation for Economic Co-operation and Development (OECD), the World Health Organization (WHO) and Eurostat. It keeps the former tri-axial relationship and develops three analytical interfaces, in order to fix the existing shortcomings and make it more convenient for analysis and comparison across countries. SHA 2011 was introduced in China in 2014, and little about its application in China has been reported. This study takes children as an example to study how to apply SHA 2011 at the subnational level in the practical situation of China's health system. Multistage random sampling method was applied and 3 532 517 samples from 252 institutions were included in the study. Official yearbooks and account reports helped the estimation of provincial data. The formula to calculate Current Health Expenditure (CHE) was introduced step-by-step. STATA 10.0 was used for statistics. Under the frame of SHA 2011, the CHE for children in Liaoning was calculated as US$ 0.74 billion in 2014; 98.56% of the expenditure was spent in hospital and the allocation to primary health care institutions was insufficient. Infection, maternal and prenatal diseases cost the most in terms of Global Burden of Disease (GBD), and respiratory system diseases took the leading place in terms of International Classification of Disease Tenth Revision (ICD-10). In addition, medical income contributed most to the health financing. The method to apply SHA 2011 at the subnational level is feasible in China. It makes health accounts more adaptable to rapidly developing health systems and makes the financing data more readily available for analytical use. SHA 2011 is a better health expenditure accounts system to reveal the actual burden on residents and deserves further promotion in China as well as around the world.

  10. BioShaDock: a community driven bioinformatics shared Docker-based tools registry.

    Moreews, François; Sallou, Olivier; Ménager, Hervé; Le Bras, Yvan; Monjeaud, Cyril; Blanchet, Christophe; Collin, Olivier

    2015-01-01

    Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  11. Metal complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid and benzohydroxamic acid. Crystal and molecular structure of [Cu(phen)2(Cl)]Cl x H2Sha, a model for a peroxidase-inhibitor complex.

    O'Brien, E C; Farkas, E; Gil, M J; Fitzgerald, D; Castineras, A; Nolan, K B

    2000-04-01

    Stability constants of iron(III), copper(II), nickel(II) and zinc(II) complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid (HAha) and benzohydroxamic acid (HBha) have been determined at 25.0 degrees C, I=0.2 mol dm(-3) KCl in aqueous solution. The complex stability order, iron(III) > copper(II) > nickel(II) approximately = zinc(II) was observed whilst complexes of H2Sha were found to be more stable than those of the other two ligands. In the preparation of ternary metal ion complexes of these ligands and 1,10-phenanthroline (phen) the crystalline complex [Cu(phen)2(Cl)]Cl x H2Sha was obtained and its crystal structure determined. This complex is a model for hydroxamate-peroxidase inhibitor interactions.

  12. Orbital Picture of Yu-Shiba-Rusinov Multiplets

    Heinrich, Benjamin W.; Ruby, Michael; Franke, Katharina J.; Peng, Yang; von Oppen, Felix

    Magnetic impurities on an s-wave superconductor induce Yu-Shiba-Rusinov (YSR) bound states within the excitation gap of the superconductor. Here, we investigate single manganese (Mn) atoms adsorbed on different surface orientations of superconducting lead (Pb) and the nature of their YSR states. Depending on the adsorption site and surface, we detect a distinct number and characteristic patterns of YSR states around the Mn atoms. We show that the YSR states inherit their properties from the Mn d levels, which are split by the surrounding crystal field. The periodicity of the long-range YSR oscillations allows us to identify a dominant coupling of the d states to the outer Fermi sheet of the two-band superconductor Pb. The long-range and directional nature of the states are promising for the design of coupled adatom structures, which could bear topological phases. We acknowledge funding by the Deutsche Forschungsgemeinschaft through Grant No. FR2726/4 and through collaborative research Grants No. Sfb 658, No. CRC 183, and No. SPP 1666, as well as by the European Research Council through Consolidator Grant NanoSpin.

  13. Characterization of biocomposites of sheep hydroxyapatite (SHA)/shellac/sugar as bone filler material

    Triyono, Joko; Rizha, Yushak; Triyono, Teguh

    2018-04-01

    The use of biomaterials in orthopedics is increasing. This led to the growth of innovations in the field of medicine, one of them is the development of biomaterials. Study of Sheep Hydroxyapatite (SHA)/shellac/sugar biocomposite characterization was to determine the phase of the material, porosity, hardness and compressive strength of them. This research was conducted to develop new types of biomaterials that can be used as bone filler material. The analysis that used in this research was dry methods. The results showed that observation of XRD (X-Ray Diffraction) shows the pattern of diffraction 2θ: 31.6472°, 32.7753°, 32.0723°, The highest hardness of SHA/shellac/sugar ratio was 70:30% (7.38±0.1395 VHN) and the lowest at 50:50% (4.91±0.37 VHN). The highest Diametral Tensile Strength (DTS) test was 70:30% (5.43±1.395 MPa) and the lowest at 50:50% (3.10±0.26 MPa). SEM observations are performed to see the material porosity.

  14. Dr.Zhang Ren's Experience in Acupuncture Treatment of Obstinate Eye Diseases

    2006-01-01

    @@ Dr.Zhang Ren (張仁), the board chairman of Shanghai Acupuncture Association, has been engaging in acupuncture treatment for more than 30years, during which he has kept on exploring the acupuncture therapies for obstinate diseases,especially for the obstinate eye diseases, ant summed up rich experience in this aspect. The following is a summary of what the author has learned from Dr. Zhang Ren.

  15. Dealing with completeness, structural hierarchy, and seismic coupling issues: three major challenges for #Fault2SHA

    Valensise, Gianluca; Barba, Salvatore; Basili, Roberto; Bonini, Lorenzo; Burrato, Pierfrancesco; Carafa, Michele; Kastelic, Vanja; Fracassi, Umberto; Maesano, Francesco Emanuele; Tarabusi, Gabriele; Tiberti, Mara Monica; Vannoli, Paola

    2016-04-01

    The vast majority of active faulting studies are performed at the scale of individual, presumably seismogenic faults or fault strands. Most SHA approaches and models, however, require homogeneus information on potential earthquake sources over the entire tectonic domain encompassing the site(s) of interest. Although it is out of question that accurate SHA must rely on robust investigations of individual potential earthquake sources, it is only by gathering this information in regionally extensive databases that one can address some of the most outstanding issues in the use of #Fault2SHA. We will briefly recall three issues that are particularly relevant in the investigation of seismogenic faulting in southern Europe. A fundamental challenge is the completeness of the geologic record of active faulting. In most tectonic environments many potential seismogenic faults are blind or hidden, or deform the lower crust without leaving a discernible signal at the surface, or occur offshore, or slip so slowly that nontectonic erosional-depositional processes easily outpace their surface effects. Investigating only well-expressed faults is scientifically rewarding but also potentially misleading as it draws attention on the least insidious faults, leading to a potential underestimation of the regional earthquake potential. A further issue concerns the hierarchy of fault systems. Most active faults do not comprise seismogenic sources per se but are part of larger systems, and slip only in conjunction with the master fault of each system. In the most insidious cases, only secondary faults are expressed at the surface while the master fault lies hidden beneath them. This may result in an overestimation of the true number of seismogenic sources that occur in each region and in a biased identification of the characteristics of the main player in each system. Recent investigations of geologic and geodetic vs earthquake release budgets have shown that the "seismic coupling", which

  16. Side channel analysis of some hash based MACs:A response to SHA-3 requirements

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...... function which is more resistant to known side channel attacks (SCA) when plugged into HMAC, or that has an alternative MAC mode which is more resistant to known SCA than the other submitted alternatives. In response to this, we perform differential power analysis (DPA) on the possible smart card...... implementations of some of the recently proposed MAC alternatives to NMAC (a fully analyzed variant of HMAC) and HMAC algorithms and NMAC/HMAC versions of some recently proposed hash and compression function modes. We show that the recently proposed BNMAC and KMDP MAC schemes are even weaker than NMAC...

  17. A high speed low power low offset dynamic comparator used in SHA-less pipelined ADC

    Shubin, Liu; Zhangming, Zhu; Yintang, Yang; Lianxi, Liu

    2014-05-01

    A novel fully differential high speed high resolution low offset CMOS dynamic comparator has been implemented in the SMIC 0.18 μm process used for a sample-and-hold amplifier (SHA)-less pipelined analog-to-digital converters (ADC). Based on the analysis and optimization between delay time and offset, an enhanced reset architecture with transmission gate was introduced to speed up the comparison and reset procedure. Four inputs with two cross coupled differential pairs, reconstituted bias circuit for tail current transistor and common centroid layouts make the comparator more robust against mismatch and process variations. The simulation results demonstrate that the proposed design achieves 1 mV sensitivity at 2.2 GHz sampling rate with a power consumption of 510 μW, while the mean offset voltage is equal to 10.244 mV.

  18. Effect of LongZhang Gargle on Biofilm Formation and Acidogenicity of Streptococcus mutans In Vitro

    Yutao Yang

    2016-01-01

    Full Text Available Streptococcus mutans, with the ability of high-rate acid production and strong biofilm formation, is considered the predominant bacterial species in the pathogenesis of human dental caries. Natural products which may be bioactive against S. mutans have become a hot spot to researches to control dental caries. LongZhang Gargle, completely made from Chinese herbs, was investigated for its effects on acid production and biofilm formation by S. mutans in this study. The results showed an antimicrobial activity of LongZhang Gargle against S. mutans planktonic growth at the minimum inhibitory concentration (MIC of 16% and minimum bactericidal concentration (MBC of 32%. Acid production was significantly inhibited at sub-MIC concentrations. Biofilm formation was also significantly disrupted, and 8% was the minimum concentration that resulted in at least 50% inhibition of biofilm formation (MBIC50. A scanning electron microscopy (SEM showed an effective disruption of LongZhang Gargle on S. mutans biofilm integrity. In addition, a confocal laser scanning microscopy (CLSM suggested that the extracellular polysaccharides (EPS synthesis could be inhibited by LongZhang Gargle at a relatively low concentration. These findings suggest that LongZhang Gargle may be a promising natural anticariogenic agent in that it suppresses planktonic growth, acid production, and biofilm formation against S. mutans.

  19. Integrative Genomic and Proteomic Analysis of the Response of Lactobacillus casei Zhang to Glucose Restriction.

    Yu, Jie; Hui, Wenyan; Cao, Chenxia; Pan, Lin; Zhang, Heping; Zhang, Wenyi

    2018-03-02

    Nutrient starvation is an important survival challenge for bacteria during industrial production of functional foods. As next-generation sequencing technology has greatly advanced, we performed proteomic and genomic analysis to investigate the response of Lactobacillus casei Zhang to a glucose-restricted environment. L. casei Zhang strains were permitted to evolve in glucose-restricted or normal medium from a common ancestor over a 3 year period, and they were sampled at 1000, 2000, 3000, 4000, 5000, 6000, 7000, and 8000 generations and subjected to proteomic and genomic analyses. Genomic resequencing data revealed different point mutations and other mutational events in each selected generation of L. casei Zhang under glucose restriction stress. The differentially expressed proteins induced by glucose restriction were mostly related to fructose and mannose metabolism, carbohydrate metabolic processes, lyase activity, and amino-acid-transporting ATPase activity. Integrative proteomic and genomic analysis revealed that the mutations protected L. casei Zhang against glucose starvation by regulating other cellular carbohydrate, fatty acid, and amino acid catabolism; phosphoenolpyruvate system pathway activation; glycogen synthesis; ATP consumption; pyruvate metabolism; and general stress-response protein expression. The results help reveal the mechanisms of adapting to glucose starvation and provide new strategies for enhancing the industrial utility of L. casei Zhang.

  20. Roles of putative sodium-hydrogen antiporter (SHA) genes in S. coelicolor A3(2) culture with pH variation.

    Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun

    2011-09-01

    Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.

  1. Yu Kilchun’s Concept of Reform of the Tax System in the Korean Empire

    Jinah Yang

    2016-08-01

    Full Text Available Yu Kilchun in “Semubu (Tax Department” criticizes the trend of the tax system, in which the authority to impose and collect taxes had been taken away from the local magistrates and the isŏ class (composed of hyangni, local functionaries, and sŏri, petty clerks during the Kabo Reform was once again returned to them. Yu Kilchun devised a concept of tax system reform on the premise of the reorganization of the administrative districts into the chu-kun-hyang-ri (state-county-district-village system. Yu’s idea was to make myŏn (hyang, district a governing administrative unit, placed under direct government control. To fund the operation of local governments, Yu proposed to create local taxes, chu taxes and hyang. Tax amounts were to be determined by local assemblies, chuhoe and hyanghoe, which were given the authority to deliberate on budget. The authority to review tax sources, levy and collect taxes was given to hyang, a small unit of administrative division. By imbuing this authority to hyang, Yu Kilchun planned to exclude local magistrates and the isŏ class in the tax collection process. Since “Semubu” discusses the reorganization of administrative divisions and local tax administration, as well as local tax system reform, the discovery of this text is significant, as it expands the range of the reform ideas proposed by Yu Kilchun, and furthermore the Enlightenment Party.

  2. YU Ren-cun(郁仁存)——A Famous Oncologist in Integrative Medicine

    2008-01-01

    @@ YU Ren-cun was born on August 1,1934.After graduating from Jiangxi Medical College in 1955,he took part in the very first Western Doctors' Class for Learning Traditional Chinese Medicine (TCM) held in Beijing from March 1959 to December 1961.Prof.YU systematically learned TCM while taking this class.Since 1962,he has been working in the Beijing Hospital of Traditional Chinese Medicine,eventually being promoted to a Chief Physician by the Beijing Municipal Government in May of 1981.In 1997,Prof.YU was selected as a well-known veteran for the National TCM Doctor Inheritance Work by the State Administration of Traditional Chinese Medicine (SATCM).The State Council of China has awarded him a special subsidy every month for his excellent work.

  3. Proof and Pedagogy in Ancient China: Examples from Liu Hui's Commentary on "JIU ZHANG SUAN SHU".

    Siu, Man-Keung

    1993-01-01

    Illustrates the pedagogical implications embodied in Liu Hui's discussion on the ancient Chinese mathematical classic "JIU ZHANG SUAN SHU" (Nine Chapters on the Mathematical Art) with respect to aspects of proof and, more generally, the role of proof in mathematics. Provides examples involving area and volume. (Contains 25 references.)…

  4. Period of Light Variability in BL Lac ON 231 Xu Yun Bing1, Zhang ...

    period light variability may be greater than the current observation history and needs further monitoring certification (Zhang et al. 1998). To establish the real periods of ON 231, we employ wavelet analysis and DCF method to search a periodicity in the light curves. 2. Periodicity analysis of ON231. 2.1 Light curve of ON 231.

  5. Fermentation characteristics and transit tolerance of probiotic Lactobacillus casei Zhang in soymilk and bovine milk during storage.

    Wang, J; Guo, Z; Zhang, Q; Yan, L; Chen, W; Liu, X-M; Zhang, H-P

    2009-06-01

    Lactobacillus casei Zhang is a novel strain that was screened out of koumiss collected in Inner Mongolia, and our previous research showed that L. casei Zhang has health benefits such as cholesterol-reducing and immunomodulating effects. The fermentation characteristics of L. casei Zhang in soymilk and bovine milk and the transit tolerance of L. casei Zhang in fermented milk products during refrigerated storage for 28 d were assessed. A faster decrease in pH and faster growth of L. casei Zhang during fermentation were observed in soymilk compared with bovine milk at various inoculation rates, probably because of the low pH buffering capacity of soymilk. The fermented bovine milk samples had much higher final titratable acidity (TA) values (between 0.80 and 0.93%) than the soymilk samples (between 0.40 and 0.46%). Dramatic increases in TA values in the fermented soymilk samples during storage were observed, and the TA values of the fermented soymilk samples changed from survival rates of freshly prepared cultures of L. casei Zhang in simulated gastric juice at pH 2.0 and 2.5 were 31 and 69%, respectively, and the delivery of L. casei Zhang through fermented soymilk and bovine milk significantly improved the viability of L. casei Zhang in simulated gastric transit. Lactobacillus casei Zhang showed good tolerance to simulated gastric juice and intestinal juice in the fermented soymilk and bovine milk samples, and maintained high viability (>10(8) cfu/g) during storage at 4 degrees C for 28 d. Our results indicated that both soymilk and bovine milk could serve as vehicles for delivery of probiotic L. casei Zhang, and further research is needed to elucidate the mechanism of the change in pH and TA of L. casei Zhang in fermented milk samples during fermentation and storage and to understand the difference between soy- and milk-based systems.

  6. Hiina tänapäeva arhitektuur - karmiilmeline, aga põnev / Zhang Ke, Zhang Hong, Xiaodu Liu ; interv. Hanna Läkk ja Ene Läkk

    Zhang Ke

    2006-01-01

    Intervjuu Hiina arhitektuuribüroo Standardarchitecture arhitektide Zhang Ke ja Zhang Hongiga ning arhitektuuribüroo Urbanus arhitekti Xiaodu Liuga Hollandis Hiina tänapäeva tutvustaval näitusel. Hiina arhitektide haridusest, oma arhitektuuribüroode töödest, tänapäeva hiina arhitektuurist, põhiprobleemidest

  7. A Novel Digital Background Calibration Technique for 16 bit SHA-less Multibit Pipelined ADC

    Swina Narula

    2016-01-01

    Full Text Available In this paper, a high resolution of 16 bit and high speed of 125MS/s, multibit Pipelined ADC with digital background calibration is presented. In order to achieve low power, SHA-less front end is used with multibit stages. The first and second stages are used here as a 3.5 bit and the stages from third to seventh are of 2.5 bit and last stage is of 3-bit flash ADC. After bit alignment and truncation of total 19 bits, 16 bits are used as final digital output. To precise the remove linear gain error of the residue amplifier and capacitor mismatching error, a digital background calibration technique is used, which is a combination of signal dependent dithering (SDD and butterfly shuffler. To improve settling time of residue amplifier, a special circuit of voltage separation is used. With the proposed digital background calibration technique, the spurious-free dynamic range (SFDR has been improved to 97.74 dB @30 MHz and 88.9 dB @150 MHz, and the signal-to-noise and distortion ratio (SNDR has been improved to 79.77 dB @ 30 MHz, and 73.5 dB @ 150 MHz. The implementation of the Pipelined ADC has been completed with technology parameters of 0.18μm CMOS process with 1.8 V supply. Total power consumption is 300 mW by the proposed ADC.

  8. Design Approach and Implementation of Application Specific Instruction Set Processor for SHA-3 BLAKE Algorithm

    Zhang, Yuli; Han, Jun; Weng, Xinqian; He, Zhongzhu; Zeng, Xiaoyang

    This paper presents an Application Specific Instruction-set Processor (ASIP) for the SHA-3 BLAKE algorithm family by instruction set extensions (ISE) from an RISC (reduced instruction set computer) processor. With a design space exploration for this ASIP to increase the performance and reduce the area cost, we accomplish an efficient hardware and software implementation of BLAKE algorithm. The special instructions and their well-matched hardware function unit improve the calculation of the key section of the algorithm, namely G-functions. Also, relaxing the time constraint of the special function unit can decrease its hardware cost, while keeping the high data throughput of the processor. Evaluation results reveal the ASIP achieves 335Mbps and 176Mbps for BLAKE-256 and BLAKE-512. The extra area cost is only 8.06k equivalent gates. The proposed ASIP outperforms several software approaches on various platforms in cycle per byte. In fact, both high throughput and low hardware cost achieved by this programmable processor are comparable to that of ASIC implementations.

  9. Orbital Mechanics near a Rotating Asteroid Yu Jiang1,2,∗ & Hexi ...

    The Hamilton function can then be written as (Yu & Baoyin 2012a). H = 1. 2 .... The symplectic structure is a differential exterior 2-form defined on a ..... The disadvantage of Poisson-bracket, Poisson and cohomology forms is unavailable for ...

  10. Robustness analysis of the Zhang neural network for online time-varying quadratic optimization

    Zhang Yunong; Ruan Gongqin; Li Kene; Yang Yiwen

    2010-01-01

    A general type of recurrent neural network (termed as Zhang neural network, ZNN) has recently been proposed by Zhang et al for the online solution of time-varying quadratic-minimization (QM) and quadratic-programming (QP) problems. Global exponential convergence of the ZNN could be achieved theoretically in an ideal error-free situation. In this paper, with the normal differentiation and dynamics-implementation errors considered, the robustness properties of the ZNN model are investigated for solving these time-varying problems. In addition, linear activation functions and power-sigmoid activation functions could be applied to such a perturbed ZNN model. Both theoretical-analysis and computer-simulation results demonstrate the good ZNN robustness and superior performance for online time-varying QM and QP problem solving, especially when using power-sigmoid activation functions.

  11. A note on Wang et al's attack on Zhang et al's multiparty quantum secret sharing

    Gao Gan

    2012-01-01

    Recently, Wang et al (2008 Phys. Lett. A 373 65) proposed an attack on Zhang et al's (2007 Opt. Commun. 269 418) multiparty quantum secret sharing scheme, in which the first and the last agent are reported to be able to cooperatively eavesdrop on all the secret messages without being detected. In this paper, we show that in Wang et al's attack, on average no more than half the secret messages can be eavesdropped. (paper)

  12. Capturing Parent-Child Interactions With Social Media: Comment on Zhang et al. (2015).

    Leung, Ricky; Dong, Guanghui; Qin, Xiaoxia; Lin, Shao

    2016-06-01

    Zhang et al. conducted a qualitative study of children presented with 19 parental structuring behaviors of parental control and were asked to attribute the parent's intent behind the behaviors. The authors developed several conceptual categories, "parent-centered," "child-centered," or "social" interests. Here, we describe how their 12 propositions could be empirically tested in further studies using social media. © The Author(s) 2016.

  13. Many particle approximation of the Aw-Rascle-Zhang second order model for vehicular traffic.

    Francesco, Marco Di; Fagioli, Simone; Rosini, Massimiliano D

    2017-02-01

    We consider the follow-the-leader approximation of the Aw-Rascle-Zhang (ARZ) model for traffic flow in a multi population formulation. We prove rigorous convergence to weak solutions of the ARZ system in the many particle limit in presence of vacuum. The result is based on uniform BV estimates on the discrete particle velocity. We complement our result with numerical simulations of the particle method compared with some exact solutions to the Riemann problem of the ARZ system.

  14. A bandwidth correction to the Allegri-Zhang solution for accelerated random vibration testing

    Benasciutti Denis

    2018-01-01

    Full Text Available In 2008, Allegri and Zhang published a study [Int. J. Fatigue. 2008, 30(6:967-977] in which they provided an exact analytical solution to the inverse scaling law for accelerated vibration tests of linear systems submitted to stationary Gaussian excitations By combining finite element analysis with multiaxial spectral methods defined in the frequency-domain, their solution generalised the simple inverse power law model suggested in some standards. The solution adopted the “equivalent von Mises stress” multiaxial criterion combined with the narrow-band damage expression. This work aims to propose a bandwidth correction to the original Allegri-Zhang solution to account for the actual spectral banwidth of the local multiaxial stress. The corrected Allegri-Zhang solution is also extended to another multiaxial spectral method, namely the “Projection-by-Projection” criterion. A numerical example is finally discussed, in which the corrected solution is applied to an L-shaped beam submitted to random accelerations.

  15. Adaptation of Lactobacillus casei Zhang to Gentamycin Involves an Alkaline Shock Protein

    Wenyi Zhang

    2017-11-01

    Full Text Available Lactobacillus (L. casei Zhang is a koumiss-originated probiotic strain, which was used as a model in a long-term antibiotics-driven evolution experiment to reveal bacterial evolutionary dynamics; and we isolated gentamycin-resistant L. casei Zhang descendents. To decipher the gentamycin resistance mechanism, here we cultivated the parental L. casei Zhang and its descendent cells in an antibiotics-containing environment to compare their global protein expression profiles using the iTRAQ-based proteomic approach. A total of 72 proteins were significantly up-regulated (>2.0-fold, P < 0.05, whilst 32 proteins were significantly down-regulated <−2.0-fold, P < 0.05 in the descendent line. The gentamycin-resistant descendent line showed elevated expression in some carbohydrates, amino acids, and purine metabolic pathways. Several stress-related proteins were also differentially expressed. Among them, one alkaline shock protein, asp23, was up-regulated most in the gentamycin-resistant strain (21.9-fold increase compared with the parental strain. The asp23 gene disruption mutant was significantly more sensitive to gentamycin compared with the wild type, suggesting an important role of this gene in developing the gentamycin-resistant phenotype in L. casei. Our report has described the adaptation of a probiotic strain that has acquired antibiotics resistance through long-term antibiotics exposure at the proteome level, and we revealed a novel mechanism of gentamycin resistance.

  16. Comprehensive geological report on Yu Hsien mining area, Yu Hsien coalfield, Hopeh Province in the People's Republic of China

    NONE

    2001-03-01

    This is a detailed geological survey report on Yu Hsien coalfield for the period beginning in 1987 and ending in March, 2001. The survey elucidated the structures, beds, coal seams, coal property, hydro-geological features, and other mining technological conditions in Beiyang Zhuang mining area. In addition, as a result of coal reserves calculation, the total of A, B and C class coal reserves was 328.34 million tons, of which No.1 and No.5 coal seams were 259.79 million tons, taking 79.1% of the entire reserves. The average coal seam thickness of the No.1 and No.5 coal seams, which are the principal minable coal seams, are each 3.10 m and 2.66 m, with the existing depth usually 300-711 m; the coal properties are classified into low-medium ash, low sulfur, low phosphorus, and medium heating value. The coal category is long flame coal, with the use applicable to cement, electric power, gasification, etc. As the infrastructure, Beiyang Zhuang mining area is one of the three mines for which development has been decided in Yu Hsien coalfield. with the planned coal output scheduled for 1.8 million tons, and with a road or a dedicated railroad for coal maintained leading to large and medium cities such as Changkiakow, Suanhwa and Beijing. Further, railway construction is in progress, so that transportation conditions are extremely favorable. Preliminary investigation of industries and construction of coal pits should be considered. (NEDO)

  17. BioShaDock: a community driven bioinformatics shared Docker-based tools registry [version 1; referees: 2 approved

    François Moreews

    2015-12-01

    Full Text Available Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  18. A geochemical evaluation of the Ash Sha'ib mineral prospect, Asir quadrangle, Kingdom of Saudi Arabia

    Allcott, Glenn H.

    1970-01-01

    The mineralized zone at the remotely located Ash Sha'ib ancient mine contains only a small tonnage of moderately low grade sulfide- bearing rock. Based on present data the gross value of the deposit, with a value of $25.00 or more per ton, is $20,000,000. A belt of metasedimentary rocks, intruded by gabbro to the south and granite to the north, was the host for fissure vein-replacement type mineralization. Most of the mineralization is in a siliceous dolomite transected by fissures. The main sulfide mineral is sphalerite, but minor amounts of chalcopyrlte and argentlferous galena contribute to the value of the mineralized sections.

  19. Development of the SONIX software for the YuMO instrument at the IBR-2 reactor

    Kirilov, A.S.; Litvinenko, E.I.; Astakhova, N.V.; Murashevich, S.M.; Petukhova, T.B.; Yudin, V.E.; Gordelij, V.I.; Islamov, A.Kh.; Kuklin, A.I.

    2003-01-01

    The main results of the modernization of the software complex of the YuMO spectrometer are described. The comparison of the previous MS-DOS based software and new OS-9 based one is carried out. The advantages and disadvantages of each program are described. The main features of the new software complex and the results of its long-term operation are presented. It is shown that the software upgrade essentially improved the spectrometer control. (author)

  20. Nonequilibrium steady state of a weakly-driven Kardar–Parisi–Zhang equation

    Meerson, Baruch; Sasorov, Pavel V.; Vilenkin, Arkady

    2018-05-01

    We consider an infinite interface of d  >  2 dimensions, governed by the Kardar–Parisi–Zhang (KPZ) equation with a weak Gaussian noise which is delta-correlated in time and has short-range spatial correlations. We study the probability distribution of the interface height H at a point of the substrate, when the interface is initially flat. We show that, in stark contrast with the KPZ equation in d  statistics of directed polymers in random potential.

  1. Security analysis of boolean algebra based on Zhang-Wang digital signature scheme

    Zheng, Jinbin

    2014-01-01

    In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software

  2. Air pollution in China, with Junfeng (Jim) Zhang by Ashley Ahearn.

    Zhang, Junfeng Jim

    2011-06-01

    Air pollution in China, one of the world’s oldest civilizations, reflects a combination of traditional and modern-day factors. Severe air pollution in Chinese cities is the result of rapid industrialization, urbanization, and growth in vehicle use. At the same time, traditional indoor burning of solid fuels such as coal and dung presents acute, severe exposures to pollutants including particulate matter, carbon monoxide, arsenic, and mercury. In this podcast, Junfeng (Jim) Zhang tells host Ashley Ahearn about some of the factors that make air pollution a significant problem in China.

  3. Reply to comment by Ma and Zhang on "Rescaling the complementary relationship for land surface evaporation"

    Crago, Richard; Qualls, Russell; Szilagyi, Jozsef; Huntington, Justin

    2017-07-01

    Ma and Zhang (2017) note a concern they have with our rescaled Complementary Relationship (CR) for land surface evaporation when daily average wind speeds are very low (perhaps less than 1 m/s). We discuss conditions and specific formulations that lead to this concern, but ultimately argue that under these conditions, a key assumption behind the CR itself may not be satisfied at the daily time scale. Thus, careful consideration of the reliability of the CR is needed when wind speeds are very low.

  4. Security analysis of boolean algebra based on Zhang-Wang digital signature scheme

    Zheng, Jinbin, E-mail: jbzheng518@163.com [School of Mathematics and Computer Science, Long Yan University, Longyan 364012 (China)

    2014-10-06

    In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software.

  5. Short communication: Protection of lyophilized milk starter Lactobacillus casei Zhang by glutathione.

    Zhang, Juan; Liu, Qian; Chen, Wei; Du, Guocheng; Chen, Jian

    2016-03-01

    Lyophilization is considered an effective way to preserve the activity of milk starters, such as lactic acid bacteria, in which proper protective agents play key roles. In this study, Lactobacillus casei Zhang, a probiotic bacterium applied as a milk starter in China, was used to investigate the effects of various cryoprotectants according to cell survival rate and physiological characteristics. The result showed a significant survival improvement to 86.6% when glutathione (GSH) was added as an ideal cryoprotectant. Further study revealed that GSH plays a key role on maintaining higher unsaturation ratio of cell membrane and shorter chain length of saturated fatty acids. In this case, the intact cell structure can be obtained. These findings will contribute not only to deepen the understanding of cells during lyophilization but also to improve the industrial performance of certain milk starters such as L. casei Zhang by application of GSH as cryoprotectant. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  6. Space and Intermediality in Jia Zhang-ke’s Still Life

    Cecília Mello

    2014-07-01

    Full Text Available This article is dedicated to an analysis of Chinese director Jia Zhang-ke’s film Still Life (San Xia Hao Ren 三峡好人, 2006 from the point of view of its intermedial relationship with Chinese landscape painting. As I will suggest, Jia’s discovery of a real landscape and a vanishing cityscape in this film, shot on location in the region of the Three Gorges of the Yangtze River, springs from a realist impulse and from an original aesthetic response to a new historical and social conjuncture. But while it seems firmly located in the landscape of contemporary China, the film also shares aesthetic qualities with the tradition of Chinese landscape painting, mounted on hanging or hand scrolls. A focus on this particular instance of intermediality leads to a reflection on cinema’s spatial organization in light of current revisions in film and audiovisual theory, which suggest that filmic space and its spectatorial experience should be considered above all from the point of view of touch and movement. It also allows for a broader understanding of the political implications of intermediality in Jia Zhang-ke’s oeuvre, fruit of an organic link between form and content that brings a historical resonance to a contemporary perspective.

  7. The Near-Earth Encounter of Asteroid 308635 (2005 YU55): Thermal IR Observations

    Lim, Lucy F.; Emery, J. P.; Moskovitz, N. A.; Busch, M. W.; Yang, B.; Granvik, M.

    2012-10-01

    The near-Earth approach (0.00217 AU, or 0.845 lunar distances) of the C-type asteroid 308635 (2005 YU55) in November 2011 presented a rare opportunity for detailed observations of a low-albedo NEA in this size range. As part of a multi-telescope campaign to measure visible and infrared spectra and photometry, we obtained mid-infrared ( 8 to 22 micron) photometry and spectroscopy of 2005 YU55 using Michelle [1] on the Gemini North telescope on UT November 9 and 10, 2011. An extensive radar campaign [2] together with optical lightcurves [3,4] established the rotation state of YU55. In addition, the radar imaging resulted in a shape model for the asteroid, detection of numerous boulders on its surface, and a preliminary estimate of its equatorial diameter at 380 +/- 20 m. In a preliminary analysis, applying the radar and lightcurve-derived parameters to a rough-surface thermophysical model fit to the Gemini/Michelle thermal emission photometry results in a thermal inertia range of approximately 500 to 1500 J m-2 s-1/2 K-1, with the low-thermal-inertia solution corresponding to the small end of the radar size range and vice versa. Updates to these results will be presented and modeling of the thermal contribution to the measured near-infrared spectra from Palomar/Triplespec and IRTF/SpeX will also be discussed. The authors gratefully acknowledge the assistance of observatory staff and the support of the NASA NEOO program (LFL and JPE), the Carnegie fellowship (NAM), and NASA AES, NSF, and the NRAO Jansky Fellowship (MWB). [1] De Buizer, J. and R. Fisher, Proc. Hris (2005), pp. 84-87. [2] Busch, M.W. et al., ACM (2012), abstract #6179. [3] Warner, B., MPBull 39 (2), 84 [4] Pravec, P.

  8. ‘A Special Zone for Confucianism’? Theses of the Academician Zhang Xianglong on Traditional Chinese Culture”

    Monika GÄNßBAUER

    2014-05-01

    Full Text Available This article introduces the work of the academician Zhang Xianglong (b. 1949, focussing on his idea of establishing a “special zone for Confucianism” in China. Zhang argues that special protection is needed for Confucian traditions which he perceives as the leading culture of China. Confucian culture should find its way out of the museum, says Zhang. He also refers to the political concept of “one country, two systems” that was implemented when Hongkong was restored to Chinese rule. Zhang applies this to his idea of a “special zone for Confucianism”, suggesting that this political concept could be extended to “one country, three systems”. In my view Zhang is developing new, creative ideas for possible experimental fields dealing with Confucianism in the context of the People’s Republic of China. In the end it is my argument that it would be helpful to conduct in-depth research on the possible role of Confucianism in today’s China.

  9. S.Yu. Witte's Customs Policy and Regulation of State Import of Industrial Equipment

    Антон Юрьевич Петров

    2013-12-01

    Full Text Available The article considers state import of industrial equipment in the context of the customs regulation of Russia’s foreign trade under S.Yu. Witte as the Minister of Finance (1892–1903. The analysis of archival data reveals the motives which drove various ministries of the Russian empire when they gave preference to foreign producers rather than domestic ones. In the 1890s the Ministry of Finance, on the one hand, and other ministries, on the other hand, were debating the necessity of orders for foreign industrial equipment made by the Russian governmental bodies. The article studies the course and results of this interdepartmental struggle.

  10. Theatre as a Vortex of Behaviour in Dutch Multicultural Society: A Discourse Analysis of "Aïsha" in the Public Sphere

    van Heugten, L.

    2013-01-01

    In 2001, a music theatre production exploring Islam’s early history from a female perspective was shut down before it reached the stage. The cancellation of Aïsha and the Women of Madina by Rotterdam’s Independent Theatre (O.T.) generated a media storm as speculations about censorship mounted. To

  11. RANCANG BANGUN APLIKASI ANTIVIRUS KOMPUTER DENGAN MENGGUNAKAN METODE SECURE HASH ALGORITHM 1 (SHA1 DAN HEURISTIC STRING

    I Gusti Made Panji Indrawinatha

    2016-12-01

    Full Text Available Virus komputer merupakan perangkat lunak berbahaya yang dapat merusak data dan menggandakan diri pada sistem komputer. Untuk mendeteksi dan membersihkan virus dari sistem komputer, maka dibuatlah aplikasi antivirus. Dalam mendeteksi berbagai jenis virus sebuah aplikasi antivirus biasanya menggunakan beberapa metode. Pada penelitian ini akan membahas perancangan sebuah aplikasi antivirus menggunakan metode Secure Hash Algorithm 1 (SHA1 dan heuristic string sebagai metode pendeteksian virus. Dari pengujian yang dilakukan diperoleh hasil dimana saat tidak menggunakan heuristic, antivirus hanya mendeteksi 12 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 35%. sedangkan saat menggunakan heuristic, antivirus berhasil mendeteksi 31 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 91%.

  12. Generalized One-Band Model Based on Zhang-Rice Singlets for Tetragonal CuO

    Hamad, I. J.; Manuel, L. O.; Aligia, A. A.

    2018-04-01

    Tetragonal CuO (T-CuO) has attracted attention because of its structure similar to that of the cuprates. It has been recently proposed as a compound whose study can give an end to the long debate about the proper microscopic modeling for cuprates. In this work, we rigorously derive an effective one-band generalized t -J model for T-CuO, based on orthogonalized Zhang-Rice singlets, and make an estimative calculation of its parameters, based on previous ab initio calculations. By means of the self-consistent Born approximation, we then evaluate the spectral function and the quasiparticle dispersion for a single hole doped in antiferromagnetically ordered half filled T-CuO. Our predictions show very good agreement with angle-resolved photoemission spectra and with theoretical multiband results. We conclude that a generalized t -J model remains the minimal Hamiltonian for a correct description of single-hole dynamics in cuprates.

  13. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  14. Comparison of congener profiles of polychlorinated biphenyls between Yu-cheng children and a potential food source

    Lung Shih-Chun Candice [Research Center for Environmental Changes, Academia Sinica, Taipei (Taiwan); Guo Yu-Liang Leon; Chang Ho-Yuan [Dept. of Environmental and Occupational Health, Coll. of Medicine, National Cheng Kung Univ., Tainan (Taiwan)

    2004-09-15

    In 1979, about two thousand people in central Taiwan were intoxicated by consumption of the rice oil that was contaminated with polychlorinated biphenyls (PCBs). This ''Yu-cheng'' incident was one of the two human tragedies which people ingested substantial amounts of PCBs within a short period of time. Some of the follow-up epidemiological studies focused on the children born to the exposed mothers, the Yu-cheng children, since they could be exposed to PCBs via breast-feeding or transplacental transfer. This report presents the results of the serum PCB levels of the 21 Yu-cheng children with a congener-specific analysis. On the other hand, fish consumption is thought to be the single most important exposure route to PCBs to the general public; thus, it is crucial to understand PCB exposure from fish consumption. In a separated study to assess PCB contamination in fish, PCB congener concentrations in tilapia (Oreochromis hybrids), the most popular fish in Taiwan, were evaluated. The consumption quantity of tilapia is the highest throughout the Island. It is mostly farmed in fresh water but can also be bred in saltwater. This report presents the concentrations and profiles in the serums of the Yu-cheng children. The congener profile is compared with PCB profile in the serum of Yu-cheng women reported previously and that in one of the potentially significant exposure source, tilapia, conducted in a separated work. Remarkable similarity between the profile of Yu-cheng children and that of the tilapia is revealed and discussed.

  15. ZHANG Ting-dong (张亭栋)—— A Pioneer in Treating Leukemia with Arsenous Acid

    2006-01-01

    @@ Prof. ZHANG Ting-dong, male, was born in Wuqiao County, He-bei Province on Nov. 8,1932, and in 1950 graduated from Harbin Medical University. And from 1960 to 1963 he studied in and then graduated from Western Doctors'class for Learning Traditional Chinese Medicine(TCM).

  16. Review of the genus Neotetricodes Zhang et Chen (Hemiptera: Fulgoromorpha: Issidae) with description of two new species.

    Chang, Zhi-Min; Yang, Lin; Zhang, Zheng-Guang; Chen, Xiang-Sheng

    2015-12-11

    Two new species of the issid genus Neotetricodes Zhang et Chen (Hemiptera: Fulgoromorpha: Issidae): Neotetricodes longispinus Chang et Chen sp. nov. (China: Yunnan) and Neotetricodes xiphoideus Chang et Chen sp. nov. (China: Yunnan) are described and illustrated. The generic characteristic is redefined. A checklist and key to the species of the genus are provided. The female genitalia of the genus are firstly described.

  17. Lactobacillus casei Zhang and vitamin K2 prevent intestinal tumorigenesis in mice via adiponectin-elevated different signaling pathways.

    Zhang, Yong; Ma, Chen; Zhao, Jie; Xu, Haiyan; Hou, Qiangchuan; Zhang, Heping

    2017-04-11

    The incidence of colon cancer has increased considerably and the intestinal microbiota participate in the development of colon cancer. We showed that the L. casei Zhang or vitamin K2 (Menaquinone-7) intervention significantly alleviated intestinal tumor burden in mice. This was associated with increased serum adiponectin levels in both treatments. But osteocalcin level was only increased by L. casei Zhang. Furthermore, the anti-carcinogenic actions of L. casei Zhang were mediated by hepatic Chloride channel-3(CLCN3)/Nuclear Factor Kappa B(NF-κB) and intestinal Claudin15/Chloride intracellular channel 4(CLIC4)/Transforming Growth Factor Beta(TGF-β) signaling, while the vitamin K2 effect involved a hepatic Vitamin D Receptor(VDR)-phosphorylated AMPK signaling pathway. Fecal DNA sequencing by the Pacbio RSII method revealed there was significantly lower Helicobacter apodemus, Helicobacter mesocricetorum, Allobaculum stercoricanis and Adlercreutzia equolifaciens following both interventions compared to the model group. Moreover, different caecum acetic acid and butyric acid levels and enrichment of other specific microbes also determined the activity of the different regulatory pathways. Together these data show that L. casei Zhang and Vitamin K2 can suppress gut risk microbes and promote beneficial microbial metabolites to reduce colonic tumor development in mice.

  18. La fuerza expresiva del deseo en Lan Yu de Stanley Kwan .

    David L. Eng

    2007-12-01

    Full Text Available Stanley Kwan's Lan Yu configures the emergence of homosexuality in contemporary China far beyond its validation in recognizably Western identitarian terms: the affirmation of an existing but misrecognized minority population; the defense of sexual "perversion"; the positing of sexual freedom, legal recognition, and political rights; the justification of a bourgeois consumer lifestyle, or even the expression of a universalizing and bindingtove bringing togethertwo abstract individuáis. Instead, in Kwan's film, homosexuality and its expressive desire mark the emergence of a new humanism in (postsocialist China under the shadows of global capitalism and neoliberal development. Gays and lesbians, that is, are harbingers of a new modernity, helping to situate China in its proper place within a cosmopolitan globalized world. From this perspective, homosexuality functions as a critical tool for organizing and evaluating the historical continuities and ruptures among China's (semicolonial past, its revolutionary aspirations for a socialist modernity, and its present investments in a neoliberal capitalist world order.

  19. Shen-Qi-Jie-Yu-Fang exerts effects on a rat model of postpartum depression by regulating inflammatory cytokines and CD4+CD25+ regulatory T cells

    Li JY

    2016-04-01

    Full Text Available Jingya Li,1,* Ruizhen Zhao,1,* Xiaoli Li,1 Wenjun Sun,1 Miao Qu,1 Qisheng Tang,1 Xinke Yang,1 Shujing Zhang2 1Third Affiliated Hospital, 2School of Basic Medical Sciences, Beijing University of Chinese Medicine, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Shen-Qi-Jie-Yu-Fang (SJF is composed of eight Chinese medicinal herbs. It is widely used in traditional Chinese medicine for treating postpartum depression (PPD. Previous studies have shown that SJF treats PPD through the neuroendocrine mechanism. Aim: To further investigate the effect of SJF on the immune system, including the inflammatory response system and CD4+CD25+ regulatory T (Treg cells. Materials and methods: Sprague Dawley rats were used to create an animal model of PPD by inducing hormone-simulated pregnancy followed by hormone withdrawal. After hormone withdrawal, the PPD rats were treated with SJF or fluoxetine for 1, 2, and 4 weeks. Levels of Treg cells in peripheral blood were measured by flow cytometry analysis. Serum interleukin (IL-1β and IL-6 were evaluated by enzyme-linked immunosorbent assay, and gene and protein expressions of IL-1RI, IL-6Rα, and gp130 in the hippocampus were observed by reverse-transcription polymerase chain reaction and Western blot. Results: Serum IL-1β in PPD rats increased at 2 weeks and declined from then on, while serum IL-6 increased at 1, 2, and 4 weeks. Both IL-1β and IL-6 were downregulated by SJF and fluoxetine. Changes in gene and protein expressions of IL-1RI and gp130 in PPD rats were consistent with changes in serum IL-1β, and were able to be regulated by SJF and fluoxetine. The levels of Treg cells were negatively correlated with serum IL-1β and IL-6, and were decreased in PPD rats. The levels of Treg cells were increased by SJF and fluoxetine. Conclusion: Dysfunction of proinflammatory cytokines and Tregs in different stages of PPD was attenuated by SJF and fluoxetine through

  20. Formation of the oil composition of the Yu0 Bazhenov formation, Salym oil field

    E.V. Soboleva

    2017-05-01

    Full Text Available The Bazhenov horizon of Western Siberia has been studied in considerable detail from different perspectives and different methods, a large number of studies have been devoted to a wide range of issues related to the lithological composition of rocks, their reservoir properties, the study of organic matter, properties and composition of oil at various analytical levels, and many others. This work is devoted to restoring conditions for the formation of oil properties and composition of the Yu0 Salym oil field, based mainly on the geochemical aspects of the study of oil changes both in area and in the section within the productive layer of Salym structure, using some geological data, such as structural plan for the reflecting horizon B (the roof of the Bazhenov formation, having a complex configuration, reservoir temperatures and pressure, well flow rates, and others. There is no single reservoir at the Salym field in the Yu0 formation. For the conclusions of the geological-geochemical interpretation, a sampling of 61 samples of oil from exploration, appraisal and production wells of the initial stages of production was used, since in the future when oil is extracted, the ecology in the deposits changes, and 21 samples of oil from other fields in the West Siberian oil and gas basin. Conventionally, three types of oils are distinguished, differing in their physicochemical parameters, group hydrocarbon and molecular composition. It was suggested that in addition to the own organic matter of the Bazhenov formation, hydrocarbon fluids of the Vasyugan, Tyumen formations and possibly Paleozoic rocks were involved in the formation of the oil composition. The flow of light liquid hydrocarbons and gases occurred along the zones of faults of different genesis and duration of existence.

  1. PREFACE: SANS-YuMO User Meeting at the Start-up of Scientific Experiments on the IBR-2M Reactor: Devoted to the 75th anniversary of Yu M Ostanevich's birth

    Gordely, Valentin; Kuklin, Alexander; Balasoiu, Maria

    2012-03-01

    The Second International Workshop 'SANS-YuMO User Meeting at the Start-up of Scientific Experiments on the IBR-2M Reactor', devoted to the 75th anniversary of the birth of Professor Yu M Ostanevich (1936-1992), an outstanding neutron physicist and the founder of small-angle neutron scattering (field, group, and instrument) at JINR FLNPh, was held on 27-30 May at the Frank Laboratory of Neutron Physics. The first Workshop was held in October 2006. Research groups from different neutron centers, universities and research institutes across Europe presented more than 35 oral and poster presentations describing scientific and methodological results. Most of them were obtained with the help of the YuMO instrument before the IBR-2 shutdown in 2006. For the last four years the IBR-2 reactor has been shut down for refurbishment. At the end of 2010 the physical launch of the IBR-2M reactor was finally realized. Nowadays the small-angle neutron scattering (SANS) technique is applied to a wide range of scientific problems in condensed matter, soft condensed matter, biology and nanotechnology, and despite the fact that there are currently over 30 SANS instruments in operation worldwide at both reactor and spallation sources, the demand for beam-time is considerably higher than the time available. It must be remembered, however, that as the first SANS machine on a steady-state reactor was constructed at the Institute Laue Langevin, Grenoble, the first SANS instrument on a 'white' neutron pulsed beam was accomplished at the Joint Institute for Nuclear Research at the IBR-30 reactor, beamline N5. During the meeting Yu M Ostanevich's determinative and crucial contribution to the construction of spectrometers at the IBR-2 high-pulsed reactor was presented, as well as his contribution to the development of the time-of-flight (TOF) small-angle scattering technique, and a selection of other scientific areas. His leadership and outstanding scientific achievements in applications of the

  2. Thinning Zhang-Suen dan Stentiford untuk Menentukan Ekstraksi Ciri (Minutiae Sebagai Identifikasi Pola Sidik Jari

    Faiza Alif Fakhrina

    2016-11-01

    Full Text Available Fingerprint is the skin on the palms of the hands and feet that are covered with small ridge lines. Fingerprint pattern belonging to every human is being unique. There are fingerprint on the ridge pattern will not change during human life. Ridge pattern is characteristic of the fingrprint that can be used for biometric identification. Based on fingerprint ridge pattern into four, namely whorl, ulnar loop, radial loop, and arch. Minutiae Extraction (Crossing Number, Core and Delta, Center Point Location can be used for fingerprint pattern recognition. Some of the methods used in the fingerprint pattern recognition is Minutiae Extraction, and Thinning Zhang-Suen and Stentiford. Croosing Number is used for process Minutiae Extraction, example termination and bifurcation. The classification method used Linear Discriminant Analysis. The result fingerprint pattern recognition is system can recognize fingerprint patter as much as 20 images and system can not recognize fingerprint pattern as much as 10 images. Accuracy of fingerprint pattern recognition is 66%.

  3. Book Review ~ Advancing Online Learning in Asia. Editors: David Murphy, Namin Shin, and Weiyuan Zhang

    Insung Jung

    2004-08-01

    Full Text Available The Internet, high-speed electronic communications, and computers have transformed the way we teach and learn. With the development of these new information and communication technologies, the idea of online education has been adopted in many developed, and more recently in developing countries, to bring wider opportunities to people in the form of increased access to flexible and interactive, open and distance learning systems. As stated in the Introduction of “Advancing Online Learning in Asia” edited by Murphy, Shin, and Zhang, online education is now everywhere and it “is changing the ways in which educational institutions interact with their students, for both traditional and distance education universities.” By examining recent developments of online education in Asia from multiple perspectives, this book has a potential to be an invaluable resource to educators. Taking cases from the Asian region in which online learning was introduced, implemented, and experienced, this book presents the cases from a number of perspectives, especially from student perspectives, and addresses pedagogical and technical issues faced by online educators. The breadth of the articles in this book provides a wide range of online learning cases and varied perspectives, which should clearly appeal to educators, researchers, administrators, and policy makers in online education.

  4. Recent developments on the Kardar-Parisi-Zhang surface-growth equation.

    Wio, Horacio S; Escudero, Carlos; Revelli, Jorge A; Deza, Roberto R; de la Lama, Marta S

    2011-01-28

    The stochastic nonlinear partial differential equation known as the Kardar-Parisi-Zhang (KPZ) equation is a highly successful phenomenological mesoscopic model of surface and interface growth processes. Its suitability for analytical work, its explicit symmetries and its prediction of an exact dynamic scaling relation for a one-dimensional substratum led people to adopt it as a 'standard' model in the field during the last quarter of a century. At the same time, several conjectures deserving closer scrutiny were established as dogmas throughout the community. Among these, we find the beliefs that 'genuine' non-equilibrium processes are non-variational in essence, and that the exactness of the dynamic scaling relation owes its existence to a Galilean symmetry. Additionally, the equivalence among planar and radial interface profiles has been generally assumed in the literature throughout the years. Here--among other topics--we introduce a variational formulation of the KPZ equation, remark on the importance of consistency in discretization and challenge the mainstream view on the necessity for scaling of both Galilean symmetry and the one-dimensional fluctuation-dissipation theorem. We also derive the KPZ equation on a growing domain as a first approximation to radial growth, and outline the differences with respect to the classical case that arises in this new situation.

  5. Height distribution tails in the Kardar-Parisi-Zhang equation with Brownian initial conditions

    Meerson, Baruch; Schmidt, Johannes

    2017-10-01

    For stationary interface growth, governed by the Kardar-Parisi-Zhang (KPZ) equation in 1 + 1 dimensions, typical fluctuations of the interface height at long times are described by the Baik-Rains distribution. Recently Chhita et al (2016 arXiv:1611.06690) used the totally asymmetric simple exclusion process (TASEP) to study the height fluctuations in systems of the KPZ universality class for Brownian interfaces with arbitrary diffusion constant. They showed that there is a one-parameter family of long-time distributions, parameterized by the diffusion constant of the initial random height profile. They also computed these distributions numerically by using Monte Carlo (MC) simulations. Here we address this problem analytically and focus on the distribution tails at short times. We determine the (stretched exponential) tails of the height distribution by applying the optimal fluctuation method (OFM) to the KPZ equation. We argue that, by analogy with other initial conditions, the ‘slow’ tail holds at arbitrary times and therefore provides a proper asymptotic to the family of long-time distributions studied in Chhita et al (2016 arXiv:1611.06690). We verify this hypothesis by performing large-scale MC simulations of a TASEP with a parallel-update rule. The ‘fast’ tail, predicted by the OFM, is also expected to hold at arbitrary times, at sufficiently large heights.

  6. Teachers' Use of a Pedagogical Framework for Improvement in Mathematics Teaching: Case Studies from YuMi Deadly Maths

    Carter, Merilyn; Cooper, Tom; Anderson, Robyn

    2016-01-01

    This paper describes the pedagogical framework used by YuMi Deadly Maths, a school change process used to improve mathematics teaching and thus enhance employment and life chances for socially disadvantaged students. The framework, called the RAMR cycle, is capable of being used by mathematics teachers for planning and delivering lessons and units…

  7. Serum concentrations and profiles of polychlorinated biphenyls in Taiwan Yu-cheng victims twenty years after the incident

    Lung, S.-C. Candice [Research Center for Environmental Changes, Academia Sinica, Nankang, Taipei, Taiwan 115 (China); Guo, Y.-L.L. [Department of Environmental and Occupational Health, College of Medicine, National Cheng Kung University, 138 Sheng-Li Rd., Tainan, Taiwan 70428 (China); Chang, H.-Y.[Department of Environmental and Occupational Health, College of Medicine, National Cheng Kung University, 138 Sheng-Li Rd., Tainan, Taiwan 70428 (China)]. E-mail: h7154@mail.ncku.edu.tw

    2005-07-15

    In 1979, about 2000 people in central Taiwan were intoxicated via rice oil consumption that was contaminated with polychlorinated biphenyls (PCBs). This 'Yu-cheng' incident was one of the two known major human PCB intoxication episodes. Twenty years after the intoxication, serum samples of 435 Yu-cheng victims, 414 adults and 21 children, were collected. Sixteen PCB congeners were analyzed with a gas chromatograph-electron capture detector. We found the median concentration of total PCBs in the adult serum was 1500 ng/g lipid, still substantially higher than that of the general population in Taiwan (3.7-fold) and most seafood consumers in the world. Most of analyzed PCB congeners in children were below or around the detection limits. Congener no. 138, however, had the highest concentrations, approximately accounting for 55% and 29% in the child and adult groups, respectively. Given that PCBs are persistent organic pollutants and endocrine disruptors, the concentrations and congener-specific profiles regarding the Yu-cheng victims provide valuable information for the investigation of such chemicals in humans. - Total serum PCBs in the Yu-cheng adult victims twenty years after the incident were still higher than that of the general population in Taiwan.

  8. The genome and structural proteome of YuA, a new Pseudomonas aeruginosa phage resembling M6.

    Ceyssens, Pieter-Jan; Mesyanzhinov, Vadim; Sykilinda, Nina; Briers, Yves; Roucourt, Bart; Lavigne, Rob; Robben, Johan; Domashin, Artem; Miroshnikov, Konstantin; Volckaert, Guido; Hertveldt, Kirsten

    2008-02-01

    Pseudomonas aeruginosa phage YuA (Siphoviridae) was isolated from a pond near Moscow, Russia. It has an elongated head, encapsulating a circularly permuted genome of 58,663 bp, and a flexible, noncontractile tail, which is terminally and subterminally decorated with short fibers. The YuA genome is neither Mu- nor lambda-like and encodes 78 gene products that cluster in three major regions involved in (i) DNA metabolism and replication, (ii) host interaction, and (iii) phage particle formation and host lysis. At the protein level, YuA displays significant homology with phages M6, phiJL001, 73, B3, DMS3, and D3112. Eighteen YuA proteins were identified as part of the phage particle by mass spectrometry analysis. Five different bacterial promoters were experimentally identified using a promoter trap assay, three of which have a sigma54-specific binding site and regulate transcription in the genome region involved in phage particle formation and host lysis. The dependency of these promoters on the host sigma54 factor was confirmed by analysis of an rpoN mutant strain of P. aeruginosa PAO1. At the DNA level, YuA is 91% identical to the recently (July 2007) annotated phage M6 of the Lindberg typing set. Despite this level of DNA homology throughout the genome, both phages combined have 15 unique genes that do not occur in the other phage. The genome organization of both phages differs substantially from those of the other known Pseudomonas-infecting Siphoviridae, delineating them as a distinct genus within this family.

  9. A New Probiotic Cheddar Cheese with High ACE-Inhibitory Activity and γ-Aminobutyric Acid Content Produced with Koumiss-Derived Lactobacillus casei Zhang

    Hai Kuan Wang

    2010-01-01

    Full Text Available Cheddar cheese has been manufactured with Lactobacillus casei Zhang as the dairy starter adjunct. L. casei Zhang had previously been isolated from koumiss collected from Xilin Guole in Inner Mongolia and characterized in detail with regard to their probiotic potential. The addition of L. casei Zhang to Cheddar cheese had no adverse effects on sensory criteria. The cheese made with 0.1, 1 and 2 % of the probiotic strain L. casei Zhang adjuncts contained high levels of the Lactobacillus after 6 months of ripening with final counts of 9.6·10^7, 7.7·10^7 and 1.02·10^8 CFU/g, respectively. In the ripe control cheese, without the addition of probiotic strain L. casei Zhang, the number of Lactobacillus reached 5.7·107 CFU/g. Enterobacterial repetitive intergenic consensus PCR (ERIC-PCR analysis was used to distinguish the added L. casei Zhang from the natural flora of the cheese and to determine whether L. casei Zhang grew in the cheese. ACE-inhibitory activity and γ-aminobutyric acid (GABA concentrations in the cheese were measured. Compared with control cheese, experimental cheese with 0.1, 1 and 2 % of probiotic strain L. casei Zhang revealed some increase in ACE-inhibitory activity and GABA mass fraction. In the present study, the production of both ACE-inhibitory activity and GABA in the probiotic cheese with the L. casei Zhang adjunct isolated from koumiss has been found for the first time. The results suggest that cheese with the probiotic strain L. casei Zhang showed good potential for application in the management of hypertension.

  10. Application of the ReNuMa model in the Sha He river watershed: tools for watershed environmental management.

    Sha, Jian; Liu, Min; Wang, Dong; Swaney, Dennis P; Wang, Yuqiu

    2013-07-30

    Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen (DN) and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River (SHR) watershed in China. The Regional Nutrient Management model (ReNuMa) was used to infer the primary sources of DN in the SHR watershed. This model is based on the Generalized Watershed Loading Functions (GWLF) and the Net Anthropogenic Nutrient Input (NANI) framework, modified to improve the characterization of subsurface hydrology and septic system loads. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  11. An herbal medicine, Go-sha-jinki-gan (GJG, increases muscle weight in severe muscle dystrophy model mice

    Yusei Takemoto

    2017-12-01

    Full Text Available Go-sha-jinki-gan (GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. Using a newly established mouse model for Duchenne muscular dystrophy (DMD, DBA/2-mdx, we showed that GJG significantly increased the body and skeletal muscle weights in comparison to the control DBA/2-mdx mice, regardless of gender. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Both the skeletal muscle regenerative ability and the accumulation of fibrosis (the dystrophic pathology in GJG-fed DBA/2-mdx mice were comparable to those in control DBA/2-mdx mice, suggesting that the cellular target of GJG is myofibers, with no contribution from the muscle satellite cells neither in an direct nor in an indirect manner. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.

  12. Maximum of an Airy process plus Brownian motion and memory in Kardar-Parisi-Zhang growth

    Le Doussal, Pierre

    2017-12-01

    We obtain several exact results for universal distributions involving the maximum of the Airy2 process minus a parabola and plus a Brownian motion, with applications to the one-dimensional Kardar-Parisi-Zhang (KPZ) stochastic growth universality class. This allows one to obtain (i) the universal limit, for large time separation, of the two-time height correlation for droplet initial conditions, e.g., C∞=limt2/t1→+∞h(t1) h (t2)¯c/h(t1)2¯c, with C∞≈0.623 , as well as conditional moments, which quantify ergodicity breaking in the time evolution; (ii) in the same limit, the distribution of the midpoint position x (t1) of a directed polymer of length t2; and (iii) the height distribution in stationary KPZ with a step. These results are derived from the replica Bethe ansatz for the KPZ continuum equation, with a "decoupling assumption" in the large time limit. They agree and confirm, whenever they can be compared, with (i) our recent tail results for two-time KPZ with the work by de Nardis and Le Doussal [J. Stat. Mech. (2017) 053212, 10.1088/1742-5468/aa6bce], checked in experiments with the work by Takeuchi and co-workers [De Nardis et al., Phys. Rev. Lett. 118, 125701 (2017), 10.1103/PhysRevLett.118.125701] and (ii) a recent result of Maes and Thiery [J. Stat. Phys. 168, 937 (2017), 10.1007/s10955-017-1839-2] on midpoint position.

  13. [The academic characteristics of acupuncture and moxibustion of professor ZHANG Yongshu:a famous acupuncturist in Southern Fujian].

    Xu, Weiwei; Meng, Xianjun; Zhu, Anning; Wang, Yu; Luo, Wuyougumo; Kuang, Zifang

    2017-01-12

    Professor ZHANG Yongshu , who studied from professor LIU Zhangjie , is a famous acupuncturist in Quanzhou of Southern Fujian. The publications authored by professor ZHANG Yongshu were collected in this study to summarize his academic characteristics of acupuncture and moxibustion. The result indicated he highly valued the regulation of yang qi , and established the theory of "developing yang to nourish yin ", which proposes to develop yang qi to achieve the effect of culturing yin ; he summarized eight methods to regulate the governor vessel and conception vessel, which can condition the body's yin and yang ; he paid attention to moxibustion therapy and its dosage, and made the best of direct moxibustion. In addition, he focused on meridian theory with effective application of meridian syndrome differentiation; in clinical treatment, he regulated the hand- yangming meridian to treat diseases by nourishing yang , generating yin and regulating fu .

  14. Maps of Relocation and Poems of Tang Dynasty Poets: Li Bai, Du Fu, and Han Yu

    羅鳳珠、白璧玲、廖泫銘、范毅軍 、鄭錦全 Feng-Ju Lo,Pi-Ling Pai,Hsiung-Ming Liao,I-Chun Fan,Chin-Chuan Cheng

    2014-04-01

    Full Text Available Geographic environments affect literary contents and genre and thus, since ancient times, geographical area has been used to classify Chinese literature. In 1936 Liang Qichao was keenly aware of the relationship between literature and geography and brought up the idea of “literarygeography”. In 1979 Professor Chen Zhengxiang produced maps of birthplaces of Tang and Song poets to show the shift of Chinese cultural center from north to south. Furthermore, in the pastdecade, the attention to research in literary geography and geographical distribution of writersgradually increased. However, most studies focused on geographical distribution of birthplaces of writers and very few focused on the relationship between poets’ journey and the contents of their writings and their geographic environment. Meanwhile, geographic information system and aerialphotography have developed quickly and have become useful tools for the study of literary geography.Since then, the academic circles in Taiwan have built a solid foundation in this area. While Li Baiand Du Fu were called poetic immortal and poetic sage of the middle and end periods of the heydayof Tang Dynasty, respectively, Han Yu advocated the classical Chinese movement and becameone of the eight great authors of Tang and Song dynasties. Han Yu was also the best representative of Middle Tang poets. While the styles of these three poets differed from each other, they held key positions in the development and evolution of Tang poetry. Their footprints spread all over the countryand greatly affected later developments and contemporary of poetry. This project makes use of the digital Tang Dynasty maps by Tan Qixiang, Tang Dynasty transportation route maps by Yan Gengwang,aerial maps, the All Tang Poems, and chronicles of the poets to build the three poets’ relocation maps and study their poetic literature, language, geography, and interactions with others, in hopesof opening a new research direction

  15. Fabrication of welded pipes of the KhN45Yu alloy

    Lyapunov, A.I.; Krichevskij, E.M.; L'vov, V.N.; Kozlov, N.N.; Kireeva, T.S.

    1977-01-01

    A highly heat-resistant KhN45Yu (EP 747) alloy has been developed; the alloy is designed to withstand prolonged service in the temperature range of 1000-1300 deg C, or short-term service at 1300-1400 deg C. The satisfactory ductility and good weldability of the alloy have made it possible to obtain sheets and pipes (32 x 2.0 mm) by argon arc welding. The ductility of pipes from EP 747 alloy exceeds that of pipes from KhN78T (EI 435) alloy by 5.10%, the strength being approximately equal. In regard to strength the welded joint differs little from the base metal. The ductility characteristics up to 900 deg C are also equal, since failure occurs in the base metal. At higher temperatures the welded joint fails in the metal of the weld, and its ductility drops sharply. The grain size of the base metal corresponds to No. 3-4. The welded joint has a cast structure with a grain size larger than No. 1, but its ductility characteristics are satisfactory. This structure ensures an increased long-term strength of the material at 1000-1200 deg C

  16. Kondo Effect of U Impurities in Dilute (YU)2Zn17

    Takagi, Shigeru; Suzuki, Hiroyuki; Anzai, Kousuke

    2001-10-01

    Extending previous work on single-site properties of U ions in (LaU)2Zn17, we have investigated, from ρ(T), χ(T) and Cp(T) on single crystals, (Y1-xUx)2Zn17 with x=0.025 and 0.050, which has almost the same unit-cell volume as an antiferromagnetic heavy-electron compound U2Zn17. Remarkable features in the dilute-impurity limit have been clarified, which include Kondo behavior of ρ(T), large and almost isotropic χimp(T), and strongly enhanced Cimp(T)/T with gigantic γimp=2.02 2.05 J/K2·mole-U as T→0 due to a low characteristic energy-scale of the system. It is shown that gross features of the data are explained in terms of the conventional Kondo effect in the presence of the crystal field with the U3+ \\varGamma6 doublet ground state. It is also shown that the variation of γ with the unit-cell volume in related systems is not explained as a volume effect on TK and that even the behavior of fictitious “paramagnetic” U2Zn17 is not described as a collection of U impurities in dilute (YU)2Zn17.

  17. FY 1999 Report on overseas geological structure surveys. Joint Japan-China Yu Xian exploitation project; 1999 nendo kaigai chishitsu kozo nado chosa hokokusho. Nippon Chugoku sekitan kyodo tansa Yu Xian project

    NONE

    2000-03-01

    This project is based on the (agreement of the joint exploitation project for Yu Xian block in Yu Xian coal mine, Province of Hepei by Japan's NEDO and China's Coal Geological Bureau), signed on October 4, 1996. The joint project mainly comprises seismic exploitation and test drilling, Japan being mainly responsible for the former and China for the latter. The final report will be drawn jointly for the geological survey results necessary for designing coal mines. The Yu Xian block contains the Jurassic coal seams, which are covered by the Quaternary bed and not exposed to the surface. The Quaternary bed base is 50 to 400 m deep from the surface, and coal seams are 300 to 700 m deep also from the surface. A total of 11 coal seams are located in the Xiahuayuan strata as the coal-bearing strata. The first and fifth seams are most promising ones. In particular, the fifth seam is thick (0.2 to 6.91 m thick) and distributed throughout the block. It is estimated that 8 coal seams have a total coal quantity of approximately 346 million tons. (NEDO)

  18. Changes in urinary Cu, Zn, and Se levels in cancer patients after treatment with Sha Shen Mai Men Dong Tang

    Tung-Yuan Lai

    2016-04-01

    Full Text Available Sha Shen Mai Men Dong Tang (SMD-2; 沙參麥冬湯 shā shēn mài dōng tāng is a Chinese medicinal herb (CMH; 中草藥 zhōng cǎo yào used to treat symptoms associated with cancer therapy. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper (Cu, zinc (Zn, and selenium (Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy. Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial. Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment. Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations (GEEs. After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly. Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. Urinary Zn and Se levels and the ratios of Zn to Cu and Se to Cu, but not urinary Cu levels, increased significantly during and after treatment when assessed using the GEE model. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system.

  19. Language Personality of the Publicist: Rhetorical and Stylistic Canon (Yu. Senkevich “To “Ra” Across the Atlantic”

    Olga V. Shatalova

    2017-10-01

    Full Text Available In article the communicative and linguistic parameters of the speech of the publicist of the XX century Yu. Senkevich which are declared as a sample for formation of the language personality in the conditions of development of the modern information and communicative environment are designated. On the example of the analysis of the book «On “Ra” through Atlantic» locates the fact of that Yu.N. Senkevich’s creativity corresponds to the main criteria of popular scientific journalism: high degree of reliability, authoritativeness of the publicist; dynamism, dramatic nature, intelligence of a statement. The unostentatious enlightenment based on updating of scientific knowledge for the addressee and a dialogization of a publicistic discourse, the high level of psychological and philosophical generality, the declaration of humanistic values form specific rhetoric which is supported by the formal and grammatical organization of the speech of the publicist. Priority of syntactic designs of a certain type, stylistic ladders and figures – dynamism of a statement and scale of representation of material define. The humour and easy self-irony as significant characteristics of the language personality define a basis of the rhetorical and stylistic canon realized in publicistic works Yu.N. Senkevich – «the human view of people and society» that in the modern information and communicative environment becomes a necessary reference point.

  20. M.Yu. Lermontov’s linguistic/literary personality through perspective of linguistic personality perception by philologist V.V. Vinogrado

    Larisa N. Kuznetsova

    2011-04-01

    Full Text Available The article considers M.Yu. Lermontov’s linguistic / literary personality through perspective of linguistic personality perception by Great Russian scientist-philologist and linguist, Academician V.V. Vinogradov.

  1. A Chinese View on the Cultural Conditionality of Logic and Epistemology: Zhang Dongsun’s Intercultural Methodology

    Jana Rošker

    2010-12-01

    Full Text Available Recognizing the fact that comprehension, analysis and transmission of reality are based on diversely structured socio-political contexts as well as on different categorical and essential postulates, offers a prospect of enrichment. Thus, this article presents an analysis and interpretation of one of the first Chinese theoreticians, working in the field of intercultural methodology. Although Zhang Dongsun (1886–1973 can be considered as one of the leading Chinese philosophers of the 20th Century, his criticism of Sinicized Marxist ideologies marked him as a political dissident and he was consequently consigned to oblivion for several decades; only recently has his work been rediscovered by a number of younger Chinese theorists, who have shown a growing interest in his ideas. Although he is still relatively unknown in the West, Zhang definitely deserves to be recognized for his contributions to Chinese and comparative philosophy. The present article focuses on his extraordinary ability to introduce Western thought in a way which was compatible with the specific methodology of traditional Chinese thought. According to such presumptions, culture is viewed as an entity composed of a number of specific discourses and relations. The article shows how the interweaving and interdependence of these discourses form different cultural backgrounds, which manifest themselves in the specific, culturally determined structures of language and logic. It also explains the role of traditional elements in his cultural epistemology.

  2. A Theta lift representation for the Kawazumi-Zhang and Faltings invariants of genus-two Riemann surfaces

    Pioline, Boris

    2016-01-01

    The Kawazumi-Zhang invariant $\\varphi$ for compact genus-two Riemann surfaces was recently shown to be a eigenmode of the Laplacian on the Siegel upper half-plane, away from the separating degeneration divisor. Using this fact and the known behavior of $\\varphi$ in the non-separating degeneration limit, it is shown that $\\varphi$ is equal to the Theta lift of the unique (up to normalization) weak Jacobi form of weight $-2$. This identification provides the complete Fourier-Jacobi expansion of $\\varphi$ near the non-separating node, gives full control on the asymptotics of $\\varphi$ in the various degeneration limits, and provides a efficient numerical procedure to evaluate $\\varphi$ to arbitrary accuracy. It also reveals a mock-type holomorphic Siegel modular form of weight $-2$ underlying $\\varphi$. From the general relation between the Faltings invariant, the Kawazumi-Zhang invariant and the discriminant for hyperelliptic Riemann surfaces, a Theta lift representation for the Faltings invariant in genus two ...

  3. Explicit and exact nontraveling wave solutions of the (3+1)-dimensional potential Yu-Toda-Sasa-Fukuyama equation

    Yuan, Na

    2018-04-01

    With the aid of the symbolic computation, we present an improved ( G ‧ / G ) -expansion method, which can be applied to seek more types of exact solutions for certain nonlinear evolution equations. In illustration, we choose the (3 + 1)-dimensional potential Yu-Toda-Sasa-Fukuyama equation to demonstrate the validity and advantages of the method. As a result, abundant explicit and exact nontraveling wave solutions are obtained including two solitary waves solutions, nontraveling wave solutions and dromion soliton solutions. Some particular localized excitations and the interactions between two solitary waves are researched. The method can be also applied to other nonlinear partial differential equations.

  4. Supercavitation Advances and Perspectives A collection dedicated to the 70th jubilee of YuN Savchenko

    2012-01-01

    This collection is dedicated to the 70th jubilee of Yu. N. Savchenko, and presents experimental, theoretical, and numerical investigations written by an international group of well-known authors. The contributions solve very important problems of the high-speed hydrodynamics, such as supersonic motion in water, drag diminishing, dynamics and stability of supercavitating vehicles, water entry and hydrodynamic performances of hydrofoils, ventilated cavities after a disc and under the ship bottom. The  book is written for researches, scientists, engineers, and students interested in problems of hydromechanics.

  5. Association between MDM2 SNP309 T>G polymorphism and the risk of bladder cancer: new data in a Chinese population and an updated meta-analysis

    Xie, Linguo; Sun, Yan; Chen, Tao; Tian, Dawei; Li, Yujuan; Zhang, Yu; Ding, Na; Shen, Zhonghua; Xu, Hao; Nian, Xuewu; Sha, Nan; Han, Ruifa; Hu, Hailong; Wu, Changli

    2015-01-01

    Linguo Xie,1,2,* Yan Sun,2,* Tao Chen,1,2,* Dawei Tian,1,2 Yujuan Li,3 Yu Zhang,1,2 Na Ding,2 Zhonghua Shen,1,2 Hao Xu,1,2 Xuewu Nian,4 Nan Sha,1,2 Ruifa Han,1,2 Hailong Hu,1,2 Changli Wu1,2 Objective: Human murine double minute 2 protein (MDM2) is mainly a negative regulator of p53 tumor suppressor pathway. We aimed to investigate the association between MDM2 SNP309 polymorphism and bladder cancer risk. Methods: A total of 535 bladder cancer patients and 649 health controls were recruited f...

  6. FY 2000 report on the survey of the overseas geological structure. Japan-China joint coal exploration - Yu Xian project; 2000 nendo kaigai chishitsu kozo nado chosa hokokusho. Nippon Chugoku sekitan kyodo tansa Yu Xian project

    NONE

    2001-03-01

    The geological survey was carried out which is needed for coal mine design in the Yu Xian coal mine area, Yu Xian coal field, Hebei province, China. The term of survey was 5 years from 1996 to 2000. Activities are mainly for seismic survey and boring survey. Japan was in charge of the seismic survey, and China in charge of the boring survey. Both attained the goal. The results of the activities were summed up in the following 7 items: 1) outline of the survey; 2) general investigation; 3) state of the exploration related materials/machinery; 4) field survey; 5) items of survey; 6) results of the survey; 7) conclusion. In 6), the geological analysis, coal quality survey and coal amount survey were conducted. In the geological analysis, analyzed were the succession of strata, geological structure, and the situation of existence of coal seams. In 7), the following were made clear: geological structure of the survey area, coal seam, coal quality, hydrological geology, other conditions of drilling technology, and coal amount. The coal amount was 328.34 million tons in a total of A/B/C class coals. The total coal amount of Nos. 1 and 5 coal seams was 259.79 million tons, which was 79.1% of the total coal amount in all area. The average thickness of Nos. 1 and 5 coal seams, which are the main minable coal seams, was 3.10m and 2.66m, respectively. (NEDO)

  7. Yuánmíng Yuán en el siglo XVIII: Arte entre la diplomacia y la filosofía; entre Europa y Pekín

    Pedro Luengo

    2016-01-01

    Full Text Available Este estudio pretende probar que el Yuánmíng Yuán fue diseñado como una representación del macrocosmos imperial a partir de la filosofía de la China de Qianlong. Para ello se valorará la función simbólica de los palacios de estilo europeo a partir de las descripciones de embajadas orientales y occidentales. Esta información se pondrá en relación con las diferentes representaciones pictóricas del jardín, conservadas tanto en grabados o acuarelas como en pinturas murales. A partir de toda esta información se pretende valorar su utilización en las visitas de diferentes legados diplomáticos extranjeros. En concreto, se intenta comprobar que los palacios europeos se utilizaron eminentemente para impresionar a las misiones orientales, y no tanto a las occidentales.

  8. Comparative analysis of the gene expression profile of probiotic Lactobacillus casei Zhang with and without fermented milk as a vehicle during transit in a simulated gastrointestinal tract.

    Wang, Jicheng; Zhong, Zhi; Zhang, Wenyi; Bao, Qiuhua; Wei, Aibin; Meng, He; Zhang, Heping

    2012-06-01

    Studies have found that the survival of probiotics could be strongly enhanced with dairy products as delivery vehicles, but the molecular mechanism by which this might occur has seldom been mentioned. In this study, microarray technology was used to detect the gene expression profile of Lactobacillus casei Zhang with and without fermented milk used as a delivery vehicle during transit in simulated gastrointestinal juice. Numerous genes of L. casei Zhang in strain suspension were upregulated compared to those from L. casei Zhang in fermented milk. These data might indicate that L. casei Zhang is stimulated directly without the protection of fermented milk, and the high-level gene expression observed here may be a stress response at the transcriptional level. A large proportion of genes involved in translation and cell division were downregulated in the bacteria that were in strain suspension during transit in simulated intestinal juice. This may impede protein biosynthesis and cell division and partially explain the lower viability of L. casei Zhang during transit in the gastrointestinal tract without the delivery vehicle. Copyright © 2012 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  9. Review on the Book: Pochekaev R.Yu. The Golden Horde Law (Kazan, 2009. 260 p. » 231

    E.G. Sayfetdinova

    2015-06-01

    Full Text Available This paper contains a review of the R.Yu. Pochekaev’s book “The Golden Horde Law”. The reviewer points out that the Pochekaev’s book is a significant academic research in both the study of the Golden Horde history and the law system of the Eurasian Turkic-Mongol peoples. This book is published by the Center for Research on the Golden Horde Civilization at the Sh.Marjani Institute of History of the Academy of Sciences of the Republic of Tatarstan. For several years, the author of this book, R.Yu. Pochekaev, has been concerned with the the history of the Golden Horde State and its law system. He has published a number of works on this topic, the main conclusions of which are reflected in this generalizing work. The study is based on a wide range of sources (annals and chronicles, memoirs of contemporaries, bureaucratic and numismatic materials and numerous studies including the works of foreign specialists in the original language. In his book, the author organically combines the latest achievements of research on both the Golden Horde history and theory and history of law. The book will be of interest to experts of the Golden Horde history and Orientalists, who are often faced with the legal aspects of the material under study.

  10. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    Lin, Wen-Yang; Lin, Feng-Huei; Sadhasivam, S.; Savitha, S.

    2010-01-01

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  11. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    Lin, Wen-Yang; Lin, Feng-Huei [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Sadhasivam, S., E-mail: rahulsbio@yahoo.co.in [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Savitha, S. [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China)

    2010-05-10

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  12. Transcriptomic Profiling Reveals Complex Molecular Regulation in Cotton Genic Male Sterile Mutant Yu98-8A.

    Weiping Fang

    Full Text Available Although cotton genic male sterility (GMS plays an important role in the utilization of hybrid vigor, its precise molecular mechanism remains unclear. To characterize the molecular events of pollen abortion, transcriptome analysis, combined with histological observations, was conducted in the cotton GMS line, Yu98-8A. A total of 2,412 genes were identified as significant differentially expressed genes (DEGs before and during the critical pollen abortion stages. Bioinformatics and biochemical analysis showed that the DEGs mainly associated with sugars and starch metabolism, oxidative phosphorylation, and plant endogenous hormones play a critical and complicated role in pollen abortion. These findings extend a better understanding of the molecular events involved in the regulation of pollen abortion in genic male sterile cotton, which may provide a foundation for further research studies on cotton heterosis breeding.

  13. Effect of Yi-nao-jie-yu decoction on γ-aminobutyric acid type A receptor in the hippocampus and serum inflammatory factors in a rat model of poststroke anxiety

    Zhang W

    2016-11-01

    Full Text Available Wen Zhang,1 Ruizhen Zhao,1 Xiaoli Li,1 Xia Cui,1 Zijun Zhao,1 Yingqiu Mao,2 Fengzhi Wu,3 Qisheng Tang1 1Department of Encephalopathy, The Third Affiliated Hospital, 2Center of Scientific Research, 3Center of Journals, Beijing University of Chinese Medicine, Chaoyang District, Beijing, People’s Republic of China Background: The Yi-nao-jie-yu decoction (YNJYD is a herbal preparation widely used in the clinics of traditional Chinese medicine and has been recently used as an important new therapeutic agent in poststroke anxiety (PSA. The neuroendocrine–immune system plays an important role in PSA mechanisms, although the modulating effects of YNJYD remain unknown. This study investigated the potential effects of YNJYD on the neuroendocrine–immune system in a rat model of PSA.Materials and methods: The PSA model was induced by injecting collagenase (type VII into the right globus pallidus, accompanied by empty water bottle stimulation for 2 weeks. The sham group and the PSA model group were gavaged with saline, while the treatment groups received buspirone (BuSpar or YNJYD. Behavior was evaluated with the open field test and elevated plus maze once a week. Pathological changes were observed by hematoxylin and eosin staining. Serum levels of tumor necrosis factor, interleukin (IL-6, adrenocorticotropic hormone, thyroid stimulating hormone, free triiodothyronine, free thyroxine, IL-1α, and cortisol were detected by radioimmunoassay. Expression of the γ-aminobutyric acid type A receptor (GABAAR α2 subunit was examined by Western blot and real-time polymerase chain reaction.Results: YNJYD-treated rats exhibited significantly better recovery than BuSpar-treated rats at 21 days and 28 days in the open field test and elevated plus maze. Hematoxylin and eosin staining revealed neural repair in the hippocampus in the treatment groups. Serum levels of IL-1α in the YNJYD group were significantly less than those in the model group and the Bu

  14. III International Conference on Small Angle Neutron Scattering dedicated to the 80 anniversary of Yu.M. Ostanevich

    2017-01-01

    Preface “Among the many well-known fundamental and applied consequences of neutron discovery, one of the first was the emergence of structural neutron diffraction - one of the methods for studying the spatial structure of condensed matter at the atomic level. Investigating the dynamics of biological macromolecules by neutron diffraction methods is an area that is almost untouched. We believe that also in this direction one should expect rapid progress.” Yu.M.Ostanevich and I.N.Serdyuk Uspekhi Fizicheskih Nauk (1982) More than 30 years after Ostanevich and Serdyuk reviewed the then 50 years from the neutron discovery, we are happy to support their statement and prediction by reporting on the further progress in the field of neutron scattering research. Frank Laboratory of Neutron Physics has organized the III International Conference on Small Angle Neutron Scattering (YuMO2016) that was – not coincidently – dedicated to the 80th anniversary of Ostanevich. Yuriy Mechislavovich Ostanevich (1936–1992) has had a determinative and crucial contribution to the construction of spectrometers at the pulsed reactor IBR in Dubna, Russia. He contributed in particular to the development of time-of-flight small-angle neutron scattering (SANS) technique, and the selection of advanced scientific areas for its application. The SANS instrument at the IBR-2 reactor is called YuMO in his honour. The Ostanevich’s leadership and outstanding scientific achievements in SANS studies of polyelectrolytes, small molecules, fractals, metallic glasses, macromolecules, polymers, etc., were recognized also by a number of awards including the State Prize of the Russian Federation in 2000. To this end of course, we should not forget mentioning the contribution of close collaborators of Ostanevich: Laszlo Cser, Josef Plestil as well as Alexander Kunchenko, Vadim Bezzabotnov and Nikolay Gorski. The YuMO2016 conference focused on providing opportunities to discuss various possibilities of

  15. Dissipation dynamics of clothianidin and its control efficacy against Bradysia odoriphaga Yang and Zhang in Chinese chive ecosystems.

    Zhang, Peng; He, Min; Zhao, Yunhe; Ren, Yupeng; Wei, Yan; Mu, Wei; Liu, Feng

    2016-07-01

    Clothianidin is a second-generation neonicotinoid insecticide that is quite effective against Bradysia odoriphaga Yang and Zhang, the major insect pest affecting Chinese chive in northern China. In this study, the dissipation of clothianidin in soil and its residue in leaves and pseudostems/bulbs as well as its control efficacy against B. odoriphaga and two other secondary pests were investigated in Chinese chive fields after soil application of clothianidin by the directional spray-washing method. The half-life of clothianidin was 35.73-36.10 days, and it could be detected in Chinese chive plants in both treatment plots up to 240 days after a single soil application. Clothianidin applied at 3.0 and 6.0 kg AI ha(-1) could suppress B. odoriphaga population growth, achieve satisfactory levels of pest control for almost 10 months and reduce the losses of the yield in winter. Moreover, the treatments also significantly reduced Thrips alliorum and Acrolepia alliella populations up to nearly 180 days after one application. Clothianidin can be considered to show long-lasting efficacy against B. odoriphaga and to be safe for use in Chinese chive at 3.0 and 6.0 kg AI ha(-1) once in the early root-rearing period to control B. odoriphaga in these cultivation ecosystems. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  16. Mg2+ improves the thermotolerance of probiotic Lactobacillus rhamnosus GG, Lactobacillus casei Zhang and Lactobacillus plantarum P-8.

    Yang, Y; Huang, S; Wang, J; Jan, G; Jeantet, R; Chen, X D

    2017-04-01

    Food-related carbohydrates and proteins are often used as thermoprotectants for probiotic lactobacilli during industrial production and processing. However, the effect of inorganic salts is rarely reported. Magnesium is the second-most abundant cation in bacteria, and commonly found in various foods. Mg 2+ homeostasis is important in Salmonella and has been reported to play a critical role in their thermotolerance. However, the role of Mg 2+ in thermotolerance of other bacteria, in particular probiotic bacteria, still remains a hypothesis. In this study, the effect of Mg 2+ on thermotolerance of probiotic lactobacilli was investigated in three well-documented probiotic strains, Lactobacillus rhamnosus GG, Lactobacillus casei Zhang and Lactobacillus plantarum P-8, in comparison with Zn 2+ and Na + . Concentrations of Mg 2+ between 10 and 50 mmol l -1 were found to increase the bacterial survival upon heat challenge. Remarkably, Mg 2+ addition at 20 mmol l -1 led to a 100-fold higher survival of L. rhamnosus GG upon heat challenge. This preliminary study also showed that Mg 2+ shortened the heat-induced extended lag time of bacteria, which indicated the improvement in bacterial recovery from thermal injury. In order to improve the productivity and stability of live probiotics, extensive investigations have been carried out to improve thermotolerance of probiotics. However, most of these studies focused on the effects of carbohydrates, proteins or amino acids. The roles of inorganic salts in various food materials, which have rarely been reported, should be considered when incorporating probiotics into these foods. In this study, Mg 2+ was found to play a significant role in the thermotolerance of probiotic lactobacilli. A novel strategy may be available in the near future by employing magnesium salts as protective agents of probiotics during manufacturing process. © 2017 The Society for Applied Microbiology.

  17. FY 2000 survey of the geological structure overseas, etc. Japan-China joint coal exploration - Yu Xian project; 2000 nendo kaigai chishitsu kozo nado chosa - futai shiryoshu. Nippon Chugoku sekitan kyodo tansa Yu Xian project

    NONE

    2001-03-01

    This data book summarized the proceedings and the technical report of the management committee on the Japan-China geological structure survey based on the consultation concluded between NEDO and China's bureau of coal field geology and a report meeting on the Yu Xian project. In the exploration, conducted were the boring survey of 10 boreholes, seismic survey of 2D (71 traverse lines, 180.105km) and 3D (1.5km{sup 2}), VSP (6 holes (345 shots)) and the low velocity band survey (2,072 shots). The geological structure of the area presented the syncline structure with a gentle line associated with foldings and a number of faults and was classified into the medium class or the class of a little complication in the Chinese standard. The number of the faults confirmed in this exploration totaled 57. Coal reserves by coal seam were 157.22 million tons at No. 5 seam and 102.57 million tons at No. 1 seam. The total amount of the two seams was 79.1% of the total coal amount in all area. The coal quality of Nos. 1 and 5 was brown coal - flame coal in the Chinese classification, and subbituminous coal B - subbituminous coal C in the ASTM classification. The coal, however, cannot be used for process raw coal. There is a technical potentiality of the fixed bed pressurized gasification. (NEDO)

  18. Preliminary analysis of the sandstone accumulation situation at Sha-3 of the Paleogene Series Shakhetsze in the Khekou basin of the Tsziyan region

    Chen, S

    1984-01-01

    The Khekou basin of the second order which is located in the Eastern part of the Tsziyan basin in the oil and gas Bokhayvan'skiy pool has an area of about 900 km/sup 2/. The main productive level occurs in sandstone beds in the Sha-3 subseries (reaching thickness of about 400 m) of the Shakhetsze series. The Bonan oil field was discovered in this region in 1975. The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels. Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields.

  19. Zhang neural network for online solution of time-varying convex quadratic program subject to time-varying linear-equality constraints

    Zhang Yunong; Li Zhan

    2009-01-01

    In this Letter, by following Zhang et al.'s method, a recurrent neural network (termed as Zhang neural network, ZNN) is developed and analyzed for solving online the time-varying convex quadratic-programming problem subject to time-varying linear-equality constraints. Different from conventional gradient-based neural networks (GNN), such a ZNN model makes full use of the time-derivative information of time-varying coefficient. The resultant ZNN model is theoretically proved to have global exponential convergence to the time-varying theoretical optimal solution of the investigated time-varying convex quadratic program. Computer-simulation results further substantiate the effectiveness, efficiency and novelty of such ZNN model and method.

  20. Real space mapping of Yu-Shiba-Rusinov states of an extended magnetic scatterer on a conventional superconductor

    Etzkorn, Markus; Eltschka, Matthias; Jaeck, Berthold; Topp, Andreas; Ast, Christian R. [Max-Planck-Institute for Solid State Research, 70569 Stuttgart (Germany); Kern, Klaus [Max-Planck-Institute for Solid State Research, 70569 Stuttgart (Germany); Ecole Polytechnique Federale de Lausanne, 1015 Lausanne (Switzerland)

    2016-07-01

    The interaction of a local magnetic impurity with a superconductor causes the formation of Yu-Shiba-Rusinov (YSR)states in the vicinity of the impurity. These have recently received increasing attention in the context of Majorana Fermions and other exotic states that might be created from the mutual interplay. YSR states have been extensively studied by scanning tunneling microscopy and so far have been discussed mainly in the limit of point scattering impurities. Here we present our investigations of the local properties of single magnetic Copper-Phthalocynane molecules on the (5x1) reconstructed, superconducting V(100) surface measured at 15 mK temperature. We find very intense YSR states with energies that depend on the precise absorbtion geometry of the molecule. At the same time we find no indication of a local suppression of the superconducting gap around the impurity. We follow the state evolution in real space for about 3 nm corresponding to about three orders of magnitude in spectral intensity. The spectra display rich structure with local variations in the electron-hole asymmetries. The observed intensity changes in the spectra can not be described on the basis of a single point like scattering potential.

  1. BOOKPLATES, OWNERS’ RECORDINGS AND DEDICATORY INSCRIPTIONS ON THE BOOKS FROM THE BOOK COLLECTION OF THE MATHEMATICIAN I. YU. TIMTCHENKO

    О. В. Полевщикова

    2015-09-01

    Full Text Available The professor of Novorossiysky (Odessa University I. Yu. Timchenko (1863-1939 managed to collect a remarkable library on the history of Mathematics which contained primarily antiquarian books including incunabula and 16th century editions. Various aspects of this valuabe book collection have been studied lately. Books from this dispersed collection have been revealed and examined de visu. Their cataloguing incudes the description of individual book copies in view of their provenance. The purpose of the article is to provide the information on a complex of owners’ recordings and dedicatory inscriptions as well as bookplates left on the books making an attempt to trace the fate of the copies incorporated in the library of the Odessa mathematician. The information collected is considered in the context of the history of Mathematics. Many may characterise both direct and indirect expressions of the readers’ interests in books and reading. The study of provenance records demonstrate that the copies acquired by professor Timchenko used to be in the libraries of a number of men of science – mathematicians, physicists, philologists, etc. The findings of this article enable to enlarge the database of provenance making the practical value and results of the research.

  2. Finite-size effects in the short-time height distribution of the Kardar-Parisi-Zhang equation

    Smith, Naftali R.; Meerson, Baruch; Sasorov, Pavel

    2018-02-01

    We use the optimal fluctuation method to evaluate the short-time probability distribution P(H, L, t) of height at a single point, H=h(x=0, t) , of the evolving Kardar-Parisi-Zhang (KPZ) interface h(x, t) on a ring of length 2L. The process starts from a flat interface. At short times typical (small) height fluctuations are unaffected by the KPZ nonlinearity and belong to the Edwards-Wilkinson universality class. The nonlinearity, however, strongly affects the (asymmetric) tails of P(H) . At large L/\\sqrt{t} the faster-decaying tail has a double structure: it is L-independent, -\\lnP˜≤ft\\vert H\\right\\vert 5/2/t1/2 , at intermediately large \\vert H\\vert , and L-dependent, -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , at very large \\vert H\\vert . The transition between these two regimes is sharp and, in the large L/\\sqrt{t} limit, behaves as a fractional-order phase transition. The transition point H=Hc+ depends on L/\\sqrt{t} . At small L/\\sqrt{t} , the double structure of the faster tail disappears, and only the very large-H tail, -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , is observed. The slower-decaying tail does not show any L-dependence at large L/\\sqrt{t} , where it coincides with the slower tail of the GOE Tracy-Widom distribution. At small L/\\sqrt{t} this tail also has a double structure. The transition between the two regimes occurs at a value of height H=Hc- which depends on L/\\sqrt{t} . At L/\\sqrt{t} \\to 0 the transition behaves as a mean-field-like second-order phase transition. At \\vert H\\vert c-\\vert the slower tail behaves as -\\lnP˜ ≤ft\\vert H\\right\\vert 2L/t , whereas at \\vert H\\vert >\\vert H_c-\\vert it coincides with the slower tail of the GOE Tracy-Widom distribution.

  3. Book review of “Imaging in Cellular and Tissue Engineering” edited by Y Hanry Yu and Nur Aida Abdul Rahim

    Brey, Eric Michael

    2014-01-01

    This article is a review of the book “Imaging in Cellular and Tissue Engineering” (ISBN-13: 978-1439848036, $149.95, 298 Pages, 114 Illustrations) edited by Y Hanry Yu and Nur Aida Abdul Rahim published by the CRC Press (Taylor&Francis) in 2013. The contents of the book and its relevance to tissue engineering and regenerative medicine are discussed in this invited review.

  4. Acknowledgements [3. international conference on small angle neutron scattering dedicated to the 80 anniversary of Yu.M. Ostanevich, Dubna (Russian Federation), 6-9 June 2016

    2017-01-01

    The Organizers of the III International Conference on Small Angle Neutron Scattering dedicated to the 80-th anniversary of Yu. M. Ostanevich, acknowledge the financial support from the Grants of the Governmental Plenipotentiary Representatives of Romania, Slovakia, Czech Republic, scientific projects of the Cooperation Programmes JINR-Romania. Special gratitude to the JINR and FLNP administration and staff is expressed. The conference is also dedicated to the 60th Anniversary of the Joint Institute for Nuclear Research, Dubna. (paper)

  5. The evaluation of marine traffic noise and its effect on the Chinese White Dolphins in Sha Chau and Lung Kwu Chau Marine Park, Hong Kong

    Chan, T.

    2016-12-01

    The Hong Kong International Airport (HKIA) handles a large amount of air traffic, at 68.5 million passengers per year (approx. 40.1 million flights per year). Given that flight demand is forecast to reach 97 million passengers per year (approx 60.2 million flights per year) by 2030, the HKIA must optimise runway capacity in order to meet growing demand. Hence, the Airport Authority Hong Kong (AAHK) has put forward a proposal to expand the airport into a three-runway system by building a third runway. However, this presents many environmental constraints. These include major impacts on marine ecology; especially the Chinese White Dolphins (Sousa chinensis) that live around the Sha Chau and Lung Kwu Chau Marine Park north to the airport. Due to that the third runway will reclaim approximately 650 hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park. This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation (often discerned by a "click" sound) to communicate and navigate, increasing marine traffic (re-routing) causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries. Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years (2013-2016) has shown that noise pollution is increasing (as indicated by the increase of frequencies around 100 125 kHz) and that it has caused disruption in regular dolphin movement (irregular clicking sequence) .

  6. Market Feasibility of Burberry and Gucci in Zhang Jiagang City, P.R China : Case: Introduce a New Luxury Brand into Kelly Mall

    Wang, Ning; Wu, Youran

    2012-01-01

    With the rapid development of Chinese economy, wealth has spread from largest coastal cities to smaller cities and luxury stores have started to follow. Kelly Mall is the largest high-end department store situated in Zhang Jiagang City, Jiangsu Province, P.R China. This research aims to figure out if Kelly Mall should introduce a new luxury brand, help-ing Kelly Mall’s board members make decision on taking either Burberry or Gucci or both of them into its luxury department. Theoretical framew...

  7. Identifying the candidate genes involved in the calyx abscission process of 'Kuerlexiangli' (Pyrus sinkiangensis Yu) by digital transcript abundance measurements.

    Qi, Xiaoxiao; Wu, Jun; Wang, Lifen; Li, Leiting; Cao, Yufen; Tian, Luming; Dong, Xingguang; Zhang, Shaoling

    2013-10-23

    'Kuerlexiangli' (Pyrus sinkiangensis Yu), a native pear of Xinjiang, China, is an important agricultural fruit and primary export to the international market. However, fruit with persistent calyxes affect fruit shape and quality. Although several studies have looked into the physiological aspects of the calyx abscission process, the underlying molecular mechanisms remain unknown. In order to better understand the molecular basis of the process of calyx abscission, materials at three critical stages of regulation, with 6000 × Flusilazole plus 300 × PBO treatment (calyx abscising treatment) and 50 mg.L-1GA3 treatment (calyx persisting treatment), were collected and cDNA fragments were sequenced using digital transcript abundance measurements to identify candidate genes. Digital transcript abundance measurements was performed using high-throughput Illumina GAII sequencing on seven samples that were collected at three important stages of the calyx abscission process with chemical agent treatments promoting calyx abscission and persistence. Altogether more than 251,123,845 high quality reads were obtained with approximately 8.0 M raw data for each library. The values of 69.85%-71.90% of clean data in the digital transcript abundance measurements could be mapped to the pear genome database. There were 12,054 differentially expressed genes having Gene Ontology (GO) terms and associating with 251 Kyoto Encyclopedia of Genes and Genomes (KEGG) defined pathways. The differentially expressed genes correlated with calyx abscission were mainly involved in photosynthesis, plant hormone signal transduction, cell wall modification, transcriptional regulation, and carbohydrate metabolism. Furthermore, candidate calyx abscission-specific genes, e.g. Inflorescence deficient in abscission gene, were identified. Quantitative real-time PCR was used to confirm the digital transcript abundance measurements results. We identified candidate genes that showed highly dynamic changes in

  8. When fast and slow interfaces grow together: Connection to the half-space problem of the Kardar-Parisi-Zhang class

    Ito, Yasufumi; Takeuchi, Kazumasa A.

    2018-04-01

    We study height fluctuations of interfaces in the (1 +1 ) -dimensional Kardar-Parisi-Zhang (KPZ) class, growing at different speeds in the left half and the right half of space. Carrying out simulations of the discrete polynuclear growth model with two different growth rates, combined with the standard setting for the droplet, flat, and stationary geometries, we find that the fluctuation properties at and near the boundary are described by the KPZ half-space problem developed in the theoretical literature. In particular, in the droplet case, the distribution at the boundary is given by the largest-eigenvalue distribution of random matrices in the Gaussian symplectic ensemble, often called the GSE Tracy-Widom distribution. We also characterize crossover from the full-space statistics to the half-space one, which arises when the difference between the two growth speeds is small.

  9. 论张洁小说女性三种形态的身体%On the Three Forms of Female Body in Zhang Jie’s Novels

    黄晓娟; 邱慧婷

    2016-01-01

    Zhang Jie,the only female writer having been twice awarded the Mao Dun Literature Awards, has been focusing on the destiny of female character and broadening the way of portraying females. Different forms of female body presented in her novel represented her reflection on female destiny and patriarchal culture in different dimensions.Her exploring,constructing and pursuing of the ideal female personality can be found in her analysis of different forms of female body such as the feminized body,the suffering body and the masculinized body,which can also be contributed to the understanding of Zhang Jie’s literary world and her reflections on the harmony between the sexes.%张洁是中国文坛唯一两次获得“茅盾文学奖”的女作家,一直致力于女性命运的关照和女性写作视野的开拓。她小说中的女性呈现出不同的身体形态,代表着作者对女性命运和男权文化不同维度的思考。通过雌化的身体、承受的身体和雄化的身体等不同形态身体的探析,可以发现张洁对理想女性人格积极探寻和建构追求的过程,有助于深入认知张洁的文学世界及其对两性和谐的思考。

  10. Influence of Magnetic Ordering between Cr Adatoms on the Yu-Shiba-Rusinov States of the β -Bi2Pd Superconductor

    Choi, Deung-Jang; Fernández, Carlos García; Herrera, Edwin; Rubio-Verdú, Carmen; Ugeda, Miguel M.; Guillamón, Isabel; Suderow, Hermann; Pascual, José Ignacio; Lorente, Nicolás

    2018-04-01

    We show that the magnetic ordering of coupled atomic dimers on a superconductor is revealed by their intragap spectral features. Chromium atoms on the superconductor β -Bi2Pd surface display Yu-Shiba-Rusinov bound states, detected as pairs of intragap excitations in tunneling spectra. By means of atomic manipulation with a scanning tunneling microscope's tip, we form Cr dimers with different arrangements and find that their intragap features appear either shifted or split with respect to single atoms. These spectral variations are associated with the magnetic coupling, ferromagnetic or antiferromagnetic, of the dimer, as confirmed by density functional theory simulations. The striking qualitative differences between the observed tunneling spectra prove that intragap Shiba states are extremely sensitive to the magnetic ordering on the atomic scale.

  11. Retraction RETRACTION of "Tumor necrosis factor alpha gene -308G>A polymorphism association with the risk of esophageal cancer in a Han Chinese population" by H. Zhao, H.W. Zhang, T. Zhang and X.M. Gu - Genet. Mol. Res. 15 (2): gmr.15025866 DOI: http://dx.doi.org/10.4238/gmr.15025866.

    Zhao, H; Zhang, H W; Zhang, T; Gu, X M

    2016-10-07

    The retracted article is: Zhao H, Zhang HW, Zhang T and Gu XM (2016). Tumor necrosis factor alpha gene -308G>A polymorphism association with the risk of esophageal cancer in a Han Chinese population. Genet. Mol. Res. 15: gmr.15025866. Two major concerns were found in this article. Firstly, it was found to be substantially equal to the article "Tumor necrosis factor-alpha gene -308G > A polymorphism alters the risk of hepatocellular carcinoma in a Han Chinese population" published in the Diagnostic Pathology Diagnostic Pathology (2014) 9: 199, by Feng et al.; licensee BioMed Central. 2014 - DOI: 10.1186/s13000-014-0199-3. Secondly, the authors do not discuss limitations of their approaches in the discussion. The discussion is largely an elaboration of the literature in the introduction part. However, even in that context, the discussion does not appropriately review the literature and there are frequent references to conclusions that are not supported by the cited literature. The GMR editorial staff was alerted and after a thorough investigation, there is strong reason to believe that the peer review process was failure. Also, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract this article in accordance with the recommendations of the Committee on Publication Ethics (COPE). The authors and their institutions were advised of this serious breach of ethics.

  12. Effects of heavy metals and light levels on the biosynthesis of carotenoids and fatty acids in the macroalgae Gracilaria tenuistipitata (var. liui Zhang & Xia

    Ernani Pinto

    2011-04-01

    Full Text Available We present here the effect of heavy metals and of different light intensities on the biosynthesis of fatty acids and pigments in the macroalga Gracilaria tenuistipitata (var. liui Zhang & Xia. In order to verify the fatty acid content, gas chromatography with flame ionization detection (GC-FID was employed. Pigments (major carotenoids and chlorophyl-a were monitored by liquid chromatography with diode array detection (HPLC-DAD. Cultures of G. tenuistipitata were exposed to cadmium (Cd2+, 200 ppb and copper (Cu2+, 200 ppb, as well as to different light conditions (low light: 100 µmol.photons.m-2.s-1, or high light: 1000 µmol.photons.m-2.s-1. Cd2+ and Cu2+ increased the saturated and monounsaturated fatty acid content [14:0, 16:0, 18:0, 18:1 (n-7 and 18:1 (n-9] and all major pigments (violaxanthin, antheraxanthin, lutein, zeaxanthin, chlorophyll-a and β-carotene. Both heavy metals decreased the levels of polyunsaturated fatty acids (PUFA [18:2 (n-6, 18:3 (n-6, 18:5 (n-4, 20:4 (n-6, 20:5 (n-3, 22:6 (n-3]. G. tenuistipitata cultures were exposed to high light intensity for five days and no statistically significant differences were observed in the content of fatty acids. On the other hand, the levels of pigments rose markedly for chlorophyll-a and all of the carotenoids studied.

  13. Zhang Enzhao: A Fallen Banker

    Xiao Long

    2006-01-01

    @@ In China, bank governors belong to one of the celebrity business,men clubs that enjoy great power.Entrepreneurs are always happy to know them, as a good relationship with the bankers can normally bring advantages when applying for loans. The close ties between entrepreneurs and bankers also generate risks, however, and the banking industry has proven to be one of the most risk-laden places in terms of corruptions and fund embezzlements.

  14. Aasia: missioon "Hiina" / Xiaotian Zhang

    Zhang, Xiaotian

    2011-01-01

    Hiina ja Põhjamaade ärisuhete pikk ajalugu. Eesti, Soome, Rootsi ja Hiina koostööprogramm BENCH (Beneficial Business Relations between the Central Baltic Region and China, 2007-2013). Diagramm "Soome, Rootsi ja Eesti Kaubavahetus Hiinaga"

  15. Influence of Partial Dam Removal on Change of Channel Morphology and Physical Habitats: A Case Study of Yu-Sheng River

    Hao Weng, Chung; Yeh, Chao Hsien

    2017-04-01

    The rivers in Taiwan have the characteristic of large slope gradient and fast flow velocity caused by rugged terrain. And Taiwan often aces many typhoons which will bring large rainfall in the summer. In early Taiwan, river management was more focus on flood control, flood protection and disaster reduction. In recent years, the rise of ecological conservation awareness for the precious fish species brings spotlight on the Taiwan salmon (Oncorhynchus masou formosanus) which lives in the river section of this study. In order to make sure ecological corridor continuing, dam removal is the frequently discussed measure in recent years and its impact on environmental is also highly concerned. Since the dam removal may causes severe changes to the river channel, the action of dam removal needs careful evaluation. As one of the endangered species, Taiwan salmon is considered a national treasure of Taiwan and it was originally an offshore migration of the Pacific salmon. After the ice age and geographical isolation, it becomes as an unique subspecies of Taiwan and evolved into landlocked salmon. Now the Taiwan salmon habitats only exists in few upstream creeks and the total number of wild Taiwan salmon in 2015 was about 4,300. In order to expand the connectivity of the fish habitats in Chi-Jia-Wan creek basin, several dam removal projects had completed with good results. Therefore, this paper focuses on the dam removal of Yu-Sheng creek dam. In this paper, a digital elevation model (DEM) of about 1 kilometer channel of the Yu-Sheng creek dam is obtained by unmanned aerial vehicle (UAV). Using CCHE2D model, the simulation of dam removal will reveal the impact on channel morphology. After model parameter identification and verification, this study simulated the scenarios of three historical typhoon events with recurrence interval of two years, fifteen years, and three decades under four different patterns of dam removal to identify the the head erosion, flow pattern, and

  16. Assessing the Resolution Adaptability of the Zhang-McFarlane Cumulus Parameterization With Spatial and Temporal Averaging: RESOLUTION ADAPTABILITY OF ZM SCHEME

    Yun, Yuxing [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; State Key Laboratory of Severe Weather, Chinese Academy of Meteorological Sciences, Beijing China; Fan, Jiwen [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Xiao, Heng [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Zhang, Guang J. [Scripps Institution of Oceanography, University of California, San Diego CA USA; Ghan, Steven J. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Xu, Kuan-Man [NASA Langley Research Center, Hampton VA USA; Ma, Po-Lun [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA; Gustafson, William I. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland WA USA

    2017-11-01

    Realistic modeling of cumulus convection at fine model resolutions (a few to a few tens of km) is problematic since it requires the cumulus scheme to adapt to higher resolution than they were originally designed for (~100 km). To solve this problem, we implement the spatial averaging method proposed in Xiao et al. (2015) and also propose a temporal averaging method for the large-scale convective available potential energy (CAPE) tendency in the Zhang-McFarlane (ZM) cumulus parameterization. The resolution adaptability of the original ZM scheme, the scheme with spatial averaging, and the scheme with both spatial and temporal averaging at 4-32 km resolution is assessed using the Weather Research and Forecasting (WRF) model, by comparing with Cloud Resolving Model (CRM) results. We find that the original ZM scheme has very poor resolution adaptability, with sub-grid convective transport and precipitation increasing significantly as the resolution increases. The spatial averaging method improves the resolution adaptability of the ZM scheme and better conserves the total transport of moist static energy and total precipitation. With the temporal averaging method, the resolution adaptability of the scheme is further improved, with sub-grid convective precipitation becoming smaller than resolved precipitation for resolution higher than 8 km, which is consistent with the results from the CRM simulation. Both the spatial distribution and time series of precipitation are improved with the spatial and temporal averaging methods. The results may be helpful for developing resolution adaptability for other cumulus parameterizations that are based on quasi-equilibrium assumption.

  17. A combined physiological and proteomic approach to reveal lactic-acid-induced alterations in Lactobacillus casei Zhang and its mutant with enhanced lactic acid tolerance.

    Wu, Chongde; Zhang, Juan; Chen, Wei; Wang, Miao; Du, Guocheng; Chen, Jian

    2012-01-01

    Lactobacillus casei has traditionally been recognized as a probiotic and frequently used as an adjunct culture in fermented dairy products, where acid stress is an environmental condition commonly encountered. In the present study, we carried out a comparative physiological and proteomic study to investigate lactic-acid-induced alterations in Lactobacillus casei Zhang (WT) and its acid-resistant mutant. Analysis of the physiological data showed that the mutant exhibited 33.8% higher glucose phosphoenolpyruvate:sugar phosphotransferase system activity and lower glycolytic pH compared with the WT under acidic conditions. In addition, significant differences were detected in both cells during acid stress between intracellular physiological state, including intracellular pH, H(+)-ATPase activity, and intracellular ATP pool. Comparison of the proteomic data based on 2D-DIGE and i-TRAQ indicated that acid stress invoked a global change in both strains. The mutant protected the cells against acid damage by regulating the expression of key proteins involved in cellular metabolism, DNA replication, RNA synthesis, translation, and some chaperones. Proteome results were validated by Lactobacillus casei displaying higher intracellular aspartate and arginine levels, and the survival at pH 3.3 was improved 1.36- and 2.10-fold by the addition of 50-mM aspartate and arginine, respectively. To our knowledge, this is the first demonstration that aspartate may be involved in acid tolerance in Lactobacillus casei. Results presented here may help us understand acid resistance mechanisms and help formulate new strategies to enhance the industrial applications of this species.

  18. Identification and Functional Analysis of microRNAs Involved in the Anther Development in Cotton Genic Male Sterile Line Yu98-8A

    Xiaojie Yang

    2016-10-01

    Full Text Available Hybrid vigor contributes in a large way to the yield and quality of cotton (Gossypium hirsutum fiber. Although microRNAs play essential regulatory roles in flower induction and development, it is still unclear if microRNAs are involved in male sterility, as the regulatory molecular mechanisms of male sterility in cotton need to be better defined. In this study, two independent small RNA libraries were constructed and sequenced from the young buds collected from the sporogenous cell formation to the meiosis stage of the male sterile line Yu98-8A and the near-isogenic line. Sequencing revealed 1588 and 1536 known microRNAs and 347 and 351 novel miRNAs from male sterile and male fertile libraries, respectively. MicroRNA expression profiles revealed that 49 conserved and 51 novel miRNAs were differentially expressed. Bioinformatic and degradome analysis indicated the regulatory complexity of microRNAs during flower induction and development. Further RT-qPCR and physiological analysis indicated that, among the different Kyoto Encyclopedia Gene and Genomes pathways, indole-3-acetic acid and gibberellic acid signaling transduction pathways may play pivotal regulatory functions in male sterility.

  19. Surface-enhanced Raman scattering study of the healing of radial fractures treated with or without Huo-Xue-Hua-Yu decoction therapy

    Chen, Weiwei; Huang, Hao; Chen, Rong; Feng, Shangyuan; Yu, Yun; Lin, Duo; Lin, Jia

    2014-11-01

    This study aimed to assess, through surface-enhanced Raman scattering (SERS) spectroscopy, the incorporation of calcium hydroxyapatite (CHA ~960 cm-1) and other biochemical substances in the repair of complete radial fractures in rabbits treated with or without Huo-Xue-Hua-Yu decoction (HXHYD) therapy. A total of 18 rabbits with complete radial fractures were randomly divided into two groups; one group was treated with HXHYD therapy and the other without therapy acted as a control. The animals were sacrificed at 15, 30 and 45 d after surgery. Specimens were routinely prepared for SERS measurement and high quality SERS spectra from a mixture of bone tissues and silver nanoparticles were obtained. The mineral-to-matrix ratios from the control and treated groups were calculated. Results showed that both deposition content of CHA measured by SERS spectroscopy and the mineral-to-matrix ratio in the treated group were always greater than those of the control group during the experiment, demonstrating that HXHYD therapy is effective in improving fracture healing and that SERS spectroscopy might be a novel tool to assess fracture healing.

  20. Surface-enhanced Raman scattering study of the healing of radial fractures treated with or without Huo–Xue–Hua–Yu decoction therapy

    Chen, Weiwei; Huang, Hao; Yu, Yun; Lin, Duo; Chen, Rong; Feng, Shangyuan; Lin, Jia

    2014-01-01

    This study aimed to assess, through surface-enhanced Raman scattering (SERS) spectroscopy, the incorporation of calcium hydroxyapatite (CHA ∼960 cm −1 ) and other biochemical substances in the repair of complete radial fractures in rabbits treated with or without Huo–Xue–Hua–Yu decoction (HXHYD) therapy. A total of 18 rabbits with complete radial fractures were randomly divided into two groups; one group was treated with HXHYD therapy and the other without therapy acted as a control. The animals were sacrificed at 15, 30 and 45 d after surgery. Specimens were routinely prepared for SERS measurement and high quality SERS spectra from a mixture of bone tissues and silver nanoparticles were obtained. The mineral-to-matrix ratios from the control and treated groups were calculated. Results showed that both deposition content of CHA measured by SERS spectroscopy and the mineral-to-matrix ratio in the treated group were always greater than those of the control group during the experiment, demonstrating that HXHYD therapy is effective in improving fracture healing and that SERS spectroscopy might be a novel tool to assess fracture healing. (letter)

  1. Analysis of Liu Zhiji Theory of Historians' and Zhang Xuecheng' s Cultivation Comparison%刘知几与章学诚的史家修养理论比较研究

    董传岭

    2012-01-01

    Liu Zhiji and Zhang Xuecheng are famous for their historical theory in ancient China. They all put forward the theory of historian historians' cultivation which has important sense to improve historian self-cultivation and historical development. Liu Zhiji argued that historians should have "ability, learning, knowledge", Zhang Xuecheng further put forward historian moral on the basis of the Liu Zhiji~s theory,enriched and developed the theory of the historians~ cultiva- tion. They all emphasize "ability,learning, knowledge", Liu Zhiji emphasize "knowledge" mostly, but Zhang Xuecheng relied heavily on "moral". Comparison and analysis on Liu Zhiji and Zhang Xuecheng's theory of self-cultivation,not only enable us to find their theories difference, under- standing the theory deeply, but also has certain enlightenment function on the contemporary historiography development.%我国古代史学理论大家刘知几、章学诚均提出了有关史家修养的理论,刘知几认为史家应具备"才、学、识",章学诚在继承刘知几史家修养理论的基础上,进一步提出"史德",丰富和发展了史家修养理论。刘知几、章学诚均重视"才、学、识",但刘知几最重"史识",章学诚尤重"史德"。比较和分析二者的史家修养理论,不仅能使我们发现他们理论的异同,深刻理解史家修养理论,而且对当今史学发展也具有一定的启示功用。

  2. A response to Yu et al. "A forward-backward fragment assembling algorithm for the identification of genomic amplification and deletion breakpoints using high-density single nucleotide polymorphism (SNP) array", BMC Bioinformatics 2007, 8: 145.

    Rueda, Oscar M; Diaz-Uriarte, Ramon

    2007-10-16

    Yu et al. (BMC Bioinformatics 2007,8: 145+) have recently compared the performance of several methods for the detection of genomic amplification and deletion breakpoints using data from high-density single nucleotide polymorphism arrays. One of the methods compared is our non-homogenous Hidden Markov Model approach. Our approach uses Markov Chain Monte Carlo for inference, but Yu et al. ran the sampler for a severely insufficient number of iterations for a Markov Chain Monte Carlo-based method. Moreover, they did not use the appropriate reference level for the non-altered state. We rerun the analysis in Yu et al. using appropriate settings for both the Markov Chain Monte Carlo iterations and the reference level. Additionally, to show how easy it is to obtain answers to additional specific questions, we have added a new analysis targeted specifically to the detection of breakpoints. The reanalysis shows that the performance of our method is comparable to that of the other methods analyzed. In addition, we can provide probabilities of a given spot being a breakpoint, something unique among the methods examined. Markov Chain Monte Carlo methods require using a sufficient number of iterations before they can be assumed to yield samples from the distribution of interest. Running our method with too small a number of iterations cannot be representative of its performance. Moreover, our analysis shows how our original approach can be easily adapted to answer specific additional questions (e.g., identify edges).

  3. Qing-Xin-Jie-Yu Granules in addition to conventional treatment for patients with stable coronary artery disease (QUEST Trial): study protocol for a randomized controlled trial.

    Li, Shengyao; Guo, Ming; Mao, Huimin; Gao, Zhuye; Xu, Hao; Shi, Dazhuo

    2016-09-15

    Recurrent cardiovascular event remains high in stable coronary artery disease (SCAD), especially in patients with multiple risk factors, despite a high rate of use conventional treatment. Traditional Chinese Medicine (TCM) is a promising complementary and alternative medicine for treating SCAD, while evidence for its effect on long-term survival is limited. This study was designed to test if Chinese herbal medicine in addition to conventional treatment is more effective than conventional treatment alone in reducing major adverse cardiac event (MACE) for SCAD patients with multiple risk factors during a 1-year follow-up. This is a multicenter, placebo-controlled, double-blinded, randomized controlled clinical trial. A total of 1500 patients are randomized in a 1:1 ratio to receive the Qing-Xin-Jie-Yu Granules (QXJYG) or the placebo granules, twice daily for 6 months. The primary outcome is the combined outcomes including cardiac death, nonfatal myocardial infarction and revascularization. The secondary outcome is the combined outcomes including all-cause mortality, re-admission for acute coronary syndrome (ACS), heart failure, malignant supraventricular and ventricular arrhythmia influencing hemodynamics, ischemic stroke, and other thromboembolic events during 1-year follow-up. The assessment is performed at baseline (before randomization), 1, 3, 6, 9, and 12 months after randomization. This is the first multicenter trial sponsored by the national funding of China to evaluate TCM in combination with conventional treatment on 1-year survival in high-risk SCAD patients. If successful, it will provide an evidence-based complementary therapeutic approach for reducing MACE from SCAD. The trial was registered in the Chinese Clinical Trial Registry on December 28, 2013. The registration number is ChiCTR-TRC-13004370 .

  4. Xue-fu-Zhu-Yu decoction protects rats against retinal ischemia by downregulation of HIF-1α and VEGF via inhibition of RBP2 and PKM2.

    Tan, Shu-Qiu; Geng, Xue; Liu, Jorn-Hon; Pan, Wynn Hwai-Tzong; Wang, Li-Xiang; Liu, Hui-Kang; Hu, Lei; Chao, Hsiao-Ming

    2017-07-14

    Retinal ischemia-related eye diseases result in visual dysfunction. This study investigates the protective effects and mechanisms of Xue-Fu-Zhu-Yu decoction (XFZYD) with respect to retinal ischemia. Retinal ischemia (I) was induced in Wistar rats by a high intraocular pressure (HIOP) of 120 mmHg for 1 h, which was followed by reperfusion of the ischemic eye; the fellow untreated eye acted as a control. Electroretinogram (ERG), biochemistry and histopathology investigations were performed. Significant ischemic changes occurred after ischemia including decreased ERG b-wave ratios, less numerous retinal ganglion cells (RGCs), reduced inner retinal thickness, fewer choline acetyltransferase (ChAT) labeled amacrine cell bodies, increased glial fibrillary acidic protein (GFAP) immunoreactivity and increased vimentin Müller immunolabeling. These were accompanied by significant increases in the mRNA/protein concentrations of vascular endothelium growth factor, hypoxia-inducible factor-1α, pyruvate kinase M2 and retinoblastoma-binding protein 2. The ischemic changes were concentration-dependently and significantly altered when XFZYD was given for seven consecutive days before or after retina ischemia, compared to vehicle. These alterations included enhanced ERG b-wave amplitudes, more numerous RGCs, enhanced inner retinal thickness, a greater number of ChAT immunolabeled amacrine cell bodies and decreased GFAP/vimentin immunoreactivity. Furthermore, decreased mRNA levels of VEGF, HIF-1α, PKM2, and RBP2 were also found. Reduced protein concentrations of VEGF, HIF-1α, PKM2, and RBP2 were also demonstrated. Furthermore, there was an inhibition of the ischemia-associated increased ratios (target protein/β-actin) in the protein levels of VEGF, HIF-1α, PKM2, and RBP2, which were induced by Shikonin, JIB-04 or Avastin. XFZYD would seem to protect against well-known retinal ischemic changes via a synergistic inhibition of RBP2 and PKM2, as well as down-regulation of HIF-1

  5. Review of the Monograph: Seleznev Yu.V. Russkie knyaz’ya pri dvore khanov Zolotoy Ordy (Russian Princes at the Court of the Golden Horde Khans

    Nesin M.A.

    2017-12-01

    Full Text Available This article contains a review of the monograph by Yu.V. Seleznev published in early 2017 and dedicated to the relations of Russian princes with the Golden Horde’s khans and their status among the Golden Horde’s nobility. This work is the first comprehensive study in the historiography of this issue for all two and a half centuries of the Tartar domination. The monograph was published for the first time in 2013 and served as the basis for a doctoral dissertation, which Seleznev defended in 2015. The book was reprinted with certain changes in 2017. The book commendably contains an abundance of factual material through the use of diverse sources and strands of historiography. Seleznev examines the social terminology of Golden Horde-Russian relations, the structure of the Golden Horde’s nobility and the trips of princes to the Horde, drawing attention not only to the status of the great Vladimir and Moscow princes, but also that of other great and appanage princes. He makes a significant contribution to the resolving the debate regarding the nature of the Golden Horde’s domination in Rus’ by examining in detail the relationship of the Russian princes with the Golden Horde’s authorities in different years. The book’s author proposed to divide the Golden Horde’s “yoke” into seven periods characterized by “changes in the degree of sovereignty and jurisdiction of the khan in relation to Russian principalities”. The author of this review agrees with the main conclusions of the book under review, but at the same time he notes some reservations and criticisms, which do not, however, reduce the academic caliber of the monograph.

  6. Sheng-ji Hua-yu formula promotes diabetic wound healing of re-epithelization via Activin/Follistatin regulation.

    Kuai, Le; Zhang, Jing-Ting; Deng, Yu; Xu, Shun; Xu, Xun-Zhe; Wu, Min-Feng; Guo, Dong-Jie; Chen, Yu; Wu, Ren-Jie; Zhao, Xing-Qiang; Nian, Hua; Li, Bin; Li, Fu-Lun

    2018-01-29

    Sheng-ji Hua-yu(SJHY) formula is one of the most useful Traditional Chinese medicine (TCM) in the treatment of the delayed diabetic wound. However, elucidating the related molecular biological mechanism of how the SJHY Formula affects excessive inflammation in the process of re-epithelialization of diabetic wound healing is a task urgently needed to be fulfilled. The objectives of this study is to evaluate the effect of antagonisic expression of pro-/anti-inflammatory factors on transforming growth factor-β(TGF-β) superfamily (activin and follistatin) in the process of re-epithelialization of diabetic wound healing in vivo, and to characterize the involvement of the activin/follistatin protein expression regulation, phospho-Smad (pSmad2), and Nuclear factor kappa B p50 (NF-kB) p50 in the diabetic wound healing effects of SJHY formula. SJHY Formula was prepared by pharmaceutical preparation room of Yueyang Hospital of Integrated Traditional Chinese and Western Medicine. Diabetic wound healing activity was evaluated by circular excision wound models. Wound healing activity was examined by macroscopic evaluation. Activin/follistatin expression regulation, protein expression of pSmad2 and NF-kB p50 in skin tissue of wounds were analyzed by Real Time PCR, Western blot, immunohistochemistry and hematoxylin and eosin (H&E) staining. Macroscopic evaluation analysis showed that wound healing of diabetic mice was delayed, and SJHY Formula accelerated wound healing time of diabetic mice. Real Time PCR analysis showed higher mRNA expression of activin/follistatin in diabetic delayed wound versus the wound in normal mice. Western Blot immunoassay analysis showed reduction of activin/follistatin proteins levels by SJHY Formula treatment 15 days after injury. Immunohistochemistry investigated the reduction of pSmad2 and NF-kB p50 nuclear staining in the epidermis of diabetic SJHY versus diabetic control mice on day 15 after wounding. H&E staining revealed that SJHY Formula

  7. Therapeutic effects of Qian-Yu decoction and its three extracts on carrageenan-induced chronic prostatitis/chronic pelvic pain syndrome in rats.

    Zhang, Keda; Zeng, Xiaobin; Chen, Yonggang; Zhao, Rong; Wang, Hui; Wu, Jinhu

    2017-01-25

    Qian-Yu decoction (QYD) is a traditional Chinese medicinal recipe composed of Radix astragali (Astragalus membranaceus (Fisch.) Bunge var. mongholicus (Bunge) P.K. Hsiao, Fabaceae ), Herba epimedii (Epimedium brevicornum Maxim., Berberidaceae), Herba leonuri (Leonurus japonicus Houtt., Lamiaceae), Cortex phellodendri (Phellodendron chinense Schneid., Rutaceae) and Radix achyranthis bidentatae (Achyranthes bidentata Bl., Amaranthaceae). This study aimed to evaluate the therapeutic activity of QYD against carrageenan-induced chronic prostatic/chronic pelvic pain syndrome (CP/CPPS) in rats and further elucidate its effective components. Three types of components, total polysaccharides, total flavonoids and total saponins were separately extracted from QYD. Carrageenan-induced CP/CPPS rats were intragastrically administered with lyophilized product of QYD, individual extracts and all the combined forms of extracts for three weeks. Prostatic index (PI) was determined and histopathological analysis was performed. The levels of tumor necrosis factor alpha (TNF-α), interleukin-1 beta (IL-1β), cyclooxygenase-2 (COX-2) and prostaglandin E2 (PEG2) in rat prostate tissues were measured using ELISA. The production of inducible nitric oxide synthase (iNOS) was evaluated by an enzymatic activity assay, and the release of nitric oxide (NO) was determined by a nitrate/nitrite assay. Treatment with QYD significantly ameliorated the histological changes of CP/CPPS rats and reduced the PI by 44.3%, with a marked downregulation of TNF-α (42.8% reduction), IL-1β (45.3%), COX-2 (36.6%), PGE2 (44.2%), iNOS (54.1%) and NO (46.0%). Each of three extracts attenuated the symptom of CP/CPPS, but much more weakly than QYD. The combined administration of three extracts showed efficacy comparable to that of QYD while better than that of any combination of two extracts. A principal component analysis of the six inflammatory mediators as variables indicated that the effects of TS on CP

  8. Potential effectiveness of Chinese herbal medicine Yu ping feng san for adult allergic rhinitis: a systematic review and meta-analysis of randomized controlled trials.

    Luo, Qiulan; Zhang, Claire Shuiqing; Yang, Lihong; Zhang, Anthony Lin; Guo, Xinfeng; Xue, Charlie Changli; Lu, Chuanjian

    2017-11-06

    Chinese herbal medicine formula Yu ping feng san (YPFS) is commonly used for allergic rhinitis (AR). Previous review had summarized the effectiveness and safety of YPFS, however without any subgroup analysis performed to provide detailed evidence for guiding clinical practice. YPFS was recommended for the management of AR by Chinese medicine clinical practice guideline, but the treatment duration of YPFS was also not specified. The aim of this study is to evaluate the effectiveness and safety of YPFS in treating adult AR with the most recent evidence, and attempt to specify the duration of utilisation through subgroup meta-analyses. Seven databases were searched from their inceptions to September 2017. Randomized controlled trials (RCTs) evaluating YPFS for adult AR were included. Methodological quality of studies was assessed using the Cochrane risk of bias tool. Meta-analysis and subgroup meta-analyses were conducted for evaluating the effectiveness of YPFS. The Grading of Recommendations Assessment, Development and Evaluation (GRADE) approach was used for rating the quality of evidence. Twenty-two RCTs involving 23 comparisons were included in this review. YPFS was compared to placebo, pharmacotherapy, and used as an add-on treatment compared to pharmacotherapy. Meta-analyses were feasible for the outcomes of four individual nasal symptom scores and "effective rate". Four individual nasal symptom scores decreased after YPFS' combination treatment: itchy nose (MD-0.46, 95% CI[-0.50, -0.42]), sneezing (MD-0.41, 95% CI[-0.47, -0.35]), blocked nose (MD-0.46, 95% CI[-0.54, -0.39]) and runny nose (MD-0.42, 95% CI[-0.58, -0.26]). Based on "effective rate", meta-analysis showed that YPFS did not achieve better effect than pharmacotherapy (RR1.07, 95%CI [0.94, 1.22), but its combination with pharmacotherapy seemed more effective than pharmacotherapy alone (RR1.27, 95%CI [1.19, 1.34]) (low quality). Subgroup analysis suggested that YPFS was not superior to the second

  9. Validation of the YuWell YE690A upper-arm blood pressure monitor, for clinic use and self-measurement, according to the European Society of Hypertension International Protocol revision 2010.

    Chen, Qi; Lei, Lei; Li, Yan; Wang, Ji-Guang

    2017-10-01

    The present study aimed to evaluate the accuracy of the automated oscillometric upper-arm blood pressure monitor YuWell YE690A for blood pressure measurement according to the International Protocol of the European Society of Hypertension revision 2010. Systolic and diastolic blood pressures were measured sequentially in 33 adult Chinese (12 women, 44.2 years of mean age) using a mercury sphygmomanometer (two observers) and the YE690A device (one supervisor). A total of 99 pairs of comparisons were obtained from 33 participants for judgments in two parts with three grading phases. All the blood pressure requirements were fulfilled. The YuWell YE690A device achieved the targets in part 1 of the validation study. The number of absolute differences between device and observers within 5, 10, and 15 mmHg was 79/99, 96/99, and 97/99, respectively, for systolic blood pressure and 72/99, 95/99, and 98/99, respectively, for diastolic blood pressure. The device also fulfilled the criteria in part 2 of the validation study. Thirty-one and 25 participants for systolic and diastolic blood pressure, respectively, had at least two of the three device-observer differences within 5 mmHg (required ≥24). No participant for systolic and two participants for diastolic blood pressure had all the three device-observer comparisons greater than 5 mmHg. The YuWell blood pressure monitor YE690A has passed the requirements of the International Protocol revision 2010 and hence can be recommended for blood pressure measurement in adults.

  10. 文化漫游与精神家园——当代中国文化散文的公共语境 (Cultural Tours and the Spiritual Home: On Yu Qiuyu and Contemporary Chinese Cultural Essays

    Yi Zheng

    2007-01-01

    Full Text Available The essay explores the public social dimension of the “great cultural essays” as a popular post-socialist genre. It looks into the genre’s emergence and popularity as part of the making of a middleclass taste in contemporary China and its claim to a re-imagined cultural national inheritance. In particular, the discussion focuses on the example of essayist Yu Qiuyu and examines the implications of his successful transformation of an obsolete historical “Culture” into a desirable commodity that offers spiritual home to the aspiring and successful of a “Greater China”.

  11. A New Book on the Law System of the Golden Horde: Pochekaev R.Yu. Legal Culture of the Golden Horde (Historical and Legal Essays) (Moscow: Yurlitinform, 2015. 312 p.)

    D.V. Nefedov

    2016-01-01

    This book is a study at the intersection of such academic disciplines as general history, history of state and law and source study. The subcect of R.Yu. Pochevalev’s book appears very relevant since the interest of the scientific community and readership toward the Golden Horde and its role in the history of the Russian state remains traditionally high for several centuries. However, the author is trying to take a fresh look at this state and refute the stereotype of the Golden Horde as a...

  12. Exotic aspects of black holes: an astronaut near the horizon (on the methodological note by A A Grib and Yu V Pavlov 'Is it possible to see the infinite future of the Universe when falling into a black hole?')

    Cherepashchuk, Anatolii M

    2009-01-01

    We comment on the methodological note by A A Grib and Yu V Pavlov [Phys. Usp. 52 257 (2009)] to show that its authors are incorrect in understanding a passage that they quote from A M Cherepashchuk's book Black Holes in the Universe (Fryazino: Vek-2, 2005, p.7) and which supposes an astronaut to be at rest in the vicinity of the horizon (not to fall freely into a black hole!). With this error corrected, Grib and Pavlov's note is quite useful methodologically. (letters to the editors)

  13. Analysis of neutron spectra and fluxes obtained with cold and thermal moderators at IBR-2 reactor: experimental and computer modeling studies at small-angle scattering YuMO setup

    Kuklin, A.I.; Rogov, A.D.; Gorshkova, Yu.E.; Kovalev, Yu.S.; Kutuzov, S.A.; Utrobin, P.K.; Rogachev, A.V.; Ivan'kov, O.I.; Solov'ev, D.V.; Gordelij, V.I.

    2011-01-01

    Results of experimental and computer modeling investigations of neutron spectra and fluxes obtained with cold and thermal moderators at the IBR-2 reactor (JINR, Dubna) are presented. The studies are done for small-angle neutron scattering (SANS) spectrometer YuMO (beamline number 4 of the IBR-2). The measurements of neutron spectra for two methane cold moderators are done for the standard configuration of the SANS instrument. The data from both moderators under different conditions of their operation are compared. The ratio of experimentally determined neutron fluxes of cold and thermal moderators at different wavelength is shown. Monte Carlo simulations are done to determine spectra for cold methane and thermal moderators. The results of the calculations of the ratio of neutron fluxes of cold and thermal moderators at different wavelength are demonstrated. In addition, the absorption of neutrons in the air gaps on the way from the moderator to the investigated sample is presented. SANS with the protein apoferritin was done in the case of cold methane as well as a thermal moderator and the data were compared. The perspectives for the use of the cold moderator for a SANS spectrometer at the IBR-2 are discussed. The advantages of the YuMO spectrometer with the thermal moderator with respect to the tested cold moderator are shown

  14. Molecular diversity analysis of Tetradium ruticarpum (WuZhuYu) in China based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers.

    Xu, Jing-Yuan; Zhu, Yan; Yi, Ze; Wu, Gang; Xie, Guo-Yong; Qin, Min-Jian

    2018-01-01

    "Wu zhu yu", which is obtained from the dried unripe fruits of Tetradium ruticarpum (A. Jussieu) T. G. Hartley, has been used as a traditional Chinese medicine for treatment of headaches, abdominal colic, and hypertension for thousands of years. The present study was designed to assess the molecular genetic diversity among 25 collected accessions of T. ruticarpum (Wu zhu yu in Chinese) from different areas of China, based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers. Thirteen ISSR primers generated 151 amplification bands, of which 130 were polymorphic. Out of 165 bands that were amplified using 10 iPBS primers, 152 were polymorphic. The iPBS markers displayed a higher proportion of polymorphic loci (PPL = 92.5%) than the ISSR markers (PPL = 84.9%). The results showed that T. ruticarpum possessed high loci polymorphism and genetic differentiation occurred in this plant. The combined data of iPBS and ISSR markers scored on 25 accessions produced five clusters that approximately matched the geographic distribution of the species. The results indicated that both iPBS and ISSR markers were reliable and effective tools for analyzing the genetic diversity in T. ruticarpum. Copyright © 2018 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  15. The extended (G/G)-expansion method and travelling wave ...

    Home; Journals; Pramana – Journal of Physics; Volume 82; Issue 6. The extended (′/)-expansion method and travelling wave solutions for the perturbed nonlinear Schrödinger's equation with Kerr law nonlinearity. Zaiyun Zhang Jianhua Huang Juan Zhong Sha-Sha Dou Jiao Liu Dan Peng Ting Gao. Research Articles ...

  16. 张綖《诗余图谱》词调论刍议%A Elementary Analysis on the Theory of Ci-poetry Tune of Zhang Yan's Shiyu Tupu

    张海涛

    2012-01-01

    Zhang Yan's Shiyu Tupu is the stereotyped works which shows that Ci-poetry started to depend on metrical(closely related to poetry) instead of temperament(closely related to music).One important symbol is his exploration on the tune of ci-poetry.He was not only the first one that divided the tune of Ci-poetry into three types,but also a research pioneer doing on issues such as"one tune but different names"and"one tune but different styles".What Zhangyan did laid a solid foundation for further study of future generationgs.%张綖的《诗余图谱》是词由音律向格律转变的定型之作,其中一个重要标志便是其对于词调的探讨。该书不仅首创了词调三分法,而且对同调异名和一调多体等问题皆有开拓之功,为后人的进一步研究打下了坚实的基础。

  17. A New Book on the Law System of the Golden Horde: Pochekaev R.Yu. Legal Culture of the Golden Horde (Historical and Legal Essays (Moscow: Yurlitinform, 2015. 312 p.

    D.V. Nefedov

    2016-12-01

    Full Text Available This book is a study at the intersection of such academic disciplines as general history, history of state and law and source study. The subcect of R.Yu. Pochevalev’s book appears very relevant since the interest of the scientific community and readership toward the Golden Horde and its role in the history of the Russian state remains traditionally high for several centuries. However, the author is trying to take a fresh look at this state and refute the stereotype of the Golden Horde as a some kind of bunch of nomads who lived only by plundering neighboring sedentary peoples. He succeeds in this by studying such an important part of the Golden Horde history as its law and legal culture. The book examines a number of questions on the history of state and law of the Golden Horde, which have not previously been the subject of a special study (for example, possessions of the Golden Horde in other uluses, dualism of power in different states, relations between authorities and traders, etc.. On some other issues that have already been studied by experts, he proposes new interpretations in the framework of historical and legal approach (for example, the causes of intestine strife in the Golden Horde in the mid-14th century, yarliks of the Golden Horde khans granted to the Russian Chruch, relations of the Golden Horde rulers and Italian colonies in the Northern Black Sea region. The author examines to a great extent the themes of state and legal regulation of economic relations: status of merchants in the Golden Horde and post-Golden Horde states, role of economic sanctions in the resolution of political conflicts. In other essays contained in the book, the author also emphasizes the role of the economic component of the political and legal relations. For example, R.Yu. Pochekaev convincingly shows that relations of the Golden Horde with other states of the Mongol Empire was based on the principle of mutual provision of possessions to the rulers of

  18. FAST Maser Surveys J. S. Zhang

    nese institutions and industries and the first light is expected to be in 2016. FAST ... tem, extragalactic pulsar, high redshift megamasers and radio signals from exoplan- ets (Nan et al. ... Since OH maser emission was detected in galactic molecular clouds in 1960s. (Weaver ... OH maser (other three lines are weak or absent).

  19. DONG JIE Zhang, LIANG Wang, ZHON

    User

    development, hairless nude skin, and short life (Abitbol et al., 2015; Bryson et al., 2013). On the ... Foxn1 maintains TECs to support T-cell development via mcm2 ... were ligated upstream of the firefly luciferase gene in the plasmid pGL3-Basic.

  20. FAST Maser Surveys J. S. Zhang

    are found to be closely associated with ultra-compact HII regions, embedded IR sources, hot molecular cores, Herbig-Haro objects, and outflows etc., which can be used to probe star formation. And OH masers in circumstellar envelopes (cir- cumstellar masers) were found to be related to outflowing and cool winds from the.

  1. Retraction RETRACTION of "Association between polymorphisms in the XRCC1 gene and the risk of non-small cell lung cancer", by Han JC, Zhang YJ and Li XD - Genet. Mol. Res. 14 (4): 12888-12893 (2015).

    Han, J C; Zhang, Y J; Li, X D

    2016-10-07

    The retracted article is: Han JC, Zhang YJ and Li XD (2015). Association between polymorphisms in the XRCC1 gene and the risk of non-small cell lung cancer. Genet. Mol. Res. 14: 12888-12893. The GMR editorial staff was alerted about this article (received on May 3, 2015; accepted on August 18, 2015) published on October 21, 2015 (DOI: 10.4238/2015.October.21.9) that was found to be substantially similar to the publication of "Association of XRCC1 gene polymorphisms with risk of non-small cell lung cancer" (received on January 25, 2015; accepted on March 23, 2015; e-published on April 1, 2015) by Kang et al., published in the International Journal of Clinical Experimental Pathology 8 (4): 4171-4176. The authors were aware of the Kang et al.'s paper, since they cite it several times in the manuscript published in GMR. Some of the language is similar between the two manuscripts, but what is the most concerning is that several of the tables in the papers are nearly identical. Tables 2 and 3 are exactly identical between the two articles, suggesting that the publication in GMR was plagiarized from the publication in the International Journal of Clinical Experimental Pathology. The Publisher and Editor decided to retract these articles in accordance with the recommendations of the Committee on Publication Ethics (COPE). After a thorough investigation, we have strong reason to believe that the peer review process was failure and, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract the article. The authors and their institutions were advised of this serious breach of ethics.

  2. Several Common Grounds of Liu Zhi-ji and Zhang Xue-cheng in Their Historical Criticism%刘知幾与章学诚史学批评理论中的几个共通面向

    张泓林; 毕兵

    2014-01-01

    Liu Zhiji’ s General History and Zhang Xuecheng ’ s General Principles of Literature and History born several common grounds in historical philosophy such as the relationship between history and literature , the principles and the methods of historical criticism and the self-cultivation of historians .They were particularly complementary and rever-berant in terms of recording the truth without fear or favor , viewing history dialectically and having an insight into the society and human being , thus pioneering a wide range of topics on the research of history and historical philosophy . Meanwhile , by putting forward concepts from the “three accomplishments of historians” to“historians ’ morality” and the “duty” of historians themselves , they not only provided the standard for the historians themselves , but also provid-ed a reference standard for later historians to continue to reflect and improve their self -cultivation .%章学诚的《文史通义》与刘知幾的《史通》在史文关系、史学批评原则与方法、史家自身修养上的总结达到了史学理论的共通面向,尤其是双方在秉笔直书、辨证史义、论世知人等方面的史学批评理论的互补与融合,为后世史学、史学理论的发展开辟了广阔的研究领域。同时,二人关于“史学三长”到“史德”概念的发展衍变及对史家自身“天职”问题的探讨,不仅为史家自身批评素养理论提供了准绳,更是为后世史家不断反思和提高自身修养提供了参考标准。

  3. Qian Yang Yu Yin Granule-containing serum inhibits angiotensin II-induced proliferation, reactive oxygen species production, and inflammation in human mesangial cells via an NADPH oxidase 4-dependent pathway.

    Ding, Kang; Wang, Yan; Jiang, Weimin; Zhang, Yu; Yin, Hongping; Fang, Zhuyuan

    2015-03-25

    Qian Yang Yu Yin Granule (QYYYG), a traditional Chinese herbal medicine, has been indicated for renal damage in hypertension for decades in China, but little remains known regarding its underlying molecular mechanism. Therefore, we performed the current study in order to investigate the underlying molecular mechanism of QYYYG in the treatment of hypertensive renal damage. We hypothesize that QYYYG relieves hypertensive renal injury through an angiotensin II (Ang II)-nicotinamide adenine dinucleotide phosphate (NAPDH)-oxidase (NOX)-reactive oxygen species (ROS) pathway. In this study, we investigated the effects of QYYYG-containing serum (QYGS) in human mesangial cells (HMCs) against Ang II-induced cell proliferation, ROS production, and inflammation through the seropharmacological method. We found that QYGS could inhibit cell proliferation in Ang II-treated HMCs. In addition, QYGS considerably suppressed production of ROS, decreased mRNA and protein expression of NAPDH-oxidase 4 (NOX4), p22 (phox) , and activated Ras-related C3 botulinum toxin substrate 1 (GTP-Rac1); as well as counteracted the up-regulation of inflammatory markers including tumor necrosis factor-α (TNF-α), nuclear factor-κB (NF-κB) p65, and interleukin 6 (IL-6). These effects were further confirmed in HMCs transfected with specific small interfering RNA (siRNA) targeting NOX4. Taken together, these results suggest that a NOX4-dependent pathway plays an important role in regulating the inhibitory effect of QYGS. Our findings provide new insights into the molecular mechanisms of QYYYG and their role in the treatment of hypertensive nephropathy.

  4. Magnetic Field Strength Evaluation Yu. S. Yefimov

    physical task is to evaluate the strength and topology of magnetic field in blazars and related ... polarization, spectral index of radiation, ratio of apparent velocity of the motion of matter along .... A detailed analysis of the evaluation of physical.

  5. Laule : [luuletused] / Li Yu ; tlk. Jaan Kaplinski

    Yu, Li

    2002-01-01

    Sisu : "Vahused lained kui kuhjaksid kokku lund..."; "Õhtuks mingitud näo ja ihu valendus..."; "Kirkad lilled, hämus kuu, udu hõljuv loor..."; "Pool kevadet lahkumisest..."; "Sõnatult astun läänekambrisse..."; "metsapuilt on pudenenud kevadevärvid..."; "Vihmasabin kardina taga..."; "Möödunut võib ainult leinata..."; "Öö oli rajune-vihmane...";"Kevadlilled, sügisekuu - kaua veel..."

  6. Chuangzaoli xinlixue yu jiechu rencai peiyang

    Shi, Jiannong; Chen, N.; Du, Xiangyun

    2012-01-01

    as individual’s personal characteristics rather as the results of active interaction of creative individual and the environment. Creativity is a process of accumulation from quantitative changes to qualitative changes during a period of time. Meanwhile the authors discuss issues about individual’s creativity......The authors emphasize the importance of systemic perspectives for understanding human creativity after briefly introducing and commenting different theories or perspectives on creativity. It is emphasized that the manifestation of creativity or excellent achievement should not be treated...

  7. Selected papers of Yu. I. Manin

    Manin, Yu I

    1996-01-01

    The book is a collection of research and review articles in several areas of modern mathematics and mathematical physics published in the span of three decades. The ICM Kyoto talk "Mathematics as Metaphor" summarises the author's view on mathematics as an outgrowth of natural language.

  8. Multichannel time-analyser with an electrostatic memory tube; Analyseur en temps a plusieurs canaux, avec memoire a potentioscopes; Mnogokanal'nye vremennye analizatory s pamyat'yu na potentsialoskopakh; Analizador multicanal de tiempo con tubo de memoria electrostatico

    Ignat' ev, K G; Kirpichnikov, I V; Sukhoruchkin, S I

    1962-04-15

    forma de graficos y de datos numericos en fichas perforadas. (author) [Russian] V ITEHF AN SSSR byli so z d a ny dva mnogokanal'nykh vremennykh analizatora impul'sov s ''pamyat'yu'' na potentsialoskopakh JIH-4. V nastoyashchee vremya oni ISPOL'ZUYUTSYA V razlichnykh izmereniyakh i imeyut sleduyushchie kharakteristiki: chislo kanalov - 1024 i 2048; vremennaya shirina kanalov ot 0,2 mksek. i bol'she; emkost' kanalov - 4096 imp i 1024 imp; chastota zapuska analizatoroa do 1000 raz v sek; velichina zagruzki do 1000 imp/sek. Rezul'taty izmerenij vydayutsya analizatorami v vide grafikov i chislovykh dannykh na perfokartakh. (author)

  9. Effect of XingPiJieYu decoction on spatial learning and memory and cAMP-PKA-CREB-BDNF pathway in rat model of depression through chronic unpredictable stress.

    Wang, Chunye; Guo, Jianyou; Guo, Rongjuan

    2017-01-24

    Depression is a mental disorder characterized by a pervasive low mood and loss of pleasure or interest in usual activities, and often results in cognitive dysfunction. The disturbance of cognitive processes associated with depression, especially the impairment of learning and memory, exacerbates illness and increases recurrence of depression. XingPiJieYu (XPJY) is one of the most widely clinical formulas of traditional Chinese medicine (TCM) and can improve the symptoms of depression, including learning and memory. However, its regulatory effects haven't been comprehensively studied so far. Recently, some animal tests have indicated that the cyclic adenosine monophosphate (cAMP)-protein kinase A (PKA)-cAMP response element-binding protein (CREB)-brain derived neurotrophic factor (BDNF) signaling pathway in hippocampus is closely related to depression and the pathogenesis of cognitive function impairments. The present study was performed to investigate the effect and mechanism of XPJY on depression and learning and memory in animal model. The rat model of depression was established by chronic unpredictable stress (CUS) for 21 days. The rats were randomly divided into six groups: control group, CUS group, CUS + XPJY (1.4 g/kg, 0.7 g/kg and 0.35 g/kg) groups, and CUS + sertraline (10 mg/kg) group. The sucrose preference, open field exploration and Morris water maze (MWM) were tested. The expression of cAMP, CREB, PKA and BDNF protein in hippocampus was examined with Elisa and Western Blot. The mRNA level of CREB and BDNF in hippocampus was measured with PCR. The results demonstrated that rats subjected to CUS exhibited decreases in sucrose preference, total ambulation, percentage of central ambulation, rearing in the open field test and spatial performance in the MWM. CUS reduced the expression of cAMP, PKA, CREB and BDNF in hippocampus of model rats. These effects could be reversed by XPJY. The results indicated that XPJY can improve depression and

  10. Genes involved in sex determination process and the influence of ...

    DR. & MRS. TONY A. NLEWADIM

    2015-02-04

    Feb 4, 2015 ... Key words: Next-generation sequencing, simple sequence repeats, Rhamdia sp. .... individual genotypes were defined according to the standards of the bands. ..... Wang J, Yu X, Zhao K, Zhang Y, Tong J, Peng Z (2012).

  11. LETTERS TO THE EDITORS: Exotic aspects of black holes: an astronaut near the horizon(on the methodological note by A A Grib and Yu V Pavlov "Is it possible to see the infinite future of the Universe when falling into a black hole?")

    Cherepashchuk, Anatolii M.

    2009-08-01

    We comment on the methodological note by A A Grib and Yu V Pavlov [Phys. Usp. 52 257 (2009)] to show that its authors are incorrect in understanding a passage that they quote from A M Cherepashchuk's book Black Holes in the Universe (Fryazino: Vek-2, 2005, p.7) and which supposes an astronaut to be at rest in the vicinity of the horizon (not to fall freely into a black hole!). With this error corrected, Grib and Pavlov's note is quite useful methodologically.

  12. Reply to the comment by Q.Q. Qiao et al. on ;Cenozoic tectonic deformation and uplift of the South Tian Shan: Implications from magnetostratigraphy and balanced cross-section restoration of the Kuqa depression; by Tao Zhang, Xiaomin Fang, Chunhui Song, Erwin Appel, and Yadong Wang [Tectonophysics, 2014, doi:10.1016/j.tecto.2014.04.044

    Zhang, Tao; Fang, Xiaomin; Song, Chunhui; Appel, Erwin; Wang, Yadong

    2017-07-01

    Qiao et al. (2016) commented on our work (Zhang et al., 2014) and rejected our reinterpretation of the magnetostratigraphic results of Huang et al. (2006) and Li et al. (2006), with the results gained using the Dynamic Time Warping Algorithm technique (DTWAT) as their main basis. However, Qiao et al. (2016) did not provide details of their modeling inputs, and, in particular, the parameters they chose for their calculations, where such parameters can have a serious impact upon any results. We therefore performed calculations using the same software (i.e., Qupydon) as Qiao et al. (2016), using reliable parameter settings. The results showed that the ;interesting correlation; of a 6000 minimum cost output completely correlate with the magnetostratigraphic Chrons C18r to C3An.1n ( 40-6 Ma), which is consistent with our reinterpreted magnetostratigraphic results. Furthermore, we summarized previous biostratigraphic studies of nearby areas; the data resulting from this process also supported our reinterpreted magnetostratigraphic correlation. We were therefore able to confirm the revised magnetostratigraphic correlation of Zhang et al. (2014).

  13. Journal of Genetics | Indian Academy of Sciences

    Yu-Song Guo Zhong-Duo Wang Cheng-Zhong Yan Yu-Lan Zhang Jin-Nan Zheng Yuan-Min Xu Tao Du Chu-Wu Liu · More Details Fulltext PDF ... Aifu Yang Dapeng Sun Shikai Liu Ying Dong Zhong Chen Zunchun Zhou · More Details Fulltext ...

  14. Download this PDF file

    pc

    2017-11-10

    Nov 10, 2017 ... ts of alkyl chain length on particles morphology were primarily studied ..... [3] Li Z, Yu L, Zheng L, Li N, Han S, Li G. Characterization studies on the ionic ... [4] Chiang YD, Lian HY, Leo SY, Wang SG, Yamauchi Y, Wu KC. ... [20] Yu YJ, Xing JL, Pang JL, Jiang SH, Lam KF, Yang TQ, Xue QS, Zhang K, Wu P.

  15. DNA pattern recognition using canonical correlation algorithm

    2015-09-28

    Sep 28, 2015 ... were considered as the two views, and statistically significant relationships were established between these two ... Canonical correlation analysis is to find two sets of basis ..... Jing XY, Li S, Lan C, Zhang D, Yang JY and Liu Q 2011 Color ... Yu S, Yu K, Tresp V and Kriegel HP 2006 Multi-output regularized.

  16. Journal of Genetics | Indian Academy of Sciences

    ... Refresher Courses · Symposia · Live Streaming. Home; Journals; Journal of Genetics; Volume 95; Issue 1. Novel NPHS1 gene mutations in a Chinese family with congenital nephrotic syndrome. Fengjie Yang Yaxian Chen Yu Zhang Liru Qiu Yu Chen Jianhua Zhou. Research Note Volume 95 Issue 1 March 2016 pp 161- ...

  17. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences; Volume 122; Issue 6. Theoretical study of nucleophilic halogenalkylation of propylene oxide with halogenmethane and dihalogenmethane anion. Tao Liu Xiang-Chen Yin Guo-Dong Liu Zhang-Yu Yu. Full Papers Volume 122 Issue 6 November 2010 pp 901-909 ...

  18. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences; Volume 128; Issue 6. Triflic Anhydride-Mediated Beckmann Rearrangement Reaction of Β-Oximyl Amides: Access to 5-Iminooxazolines. MANGFEI YU QIAN ZHANG JIA WANG PENG HUANG PENGFEI YAN RUI ZHANG DEWEN DONG. Regular Article Volume 128 Issue 6 ...

  19. Casein kinase 1-Like 3 is required for abscisic acid regulation of ...

    Casein kinase 1-Like 3 is required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis. M Wang, D Yu, X Guo, X Li, J Zhang, L Zhao, H Chang, S Hu, C Zhang, J Shi, X Liu ...

  20. Reference: 356 [Arabidopsis Phenome Database[Archive

    Full Text Available 006 Mar Plant molecular biology Deng Xingwang|Dong Li|Wang Lei|Xue Yongbiao|Zhang Yansheng|Zhang Yu'e ...ein CEGENDUO negatively regulates auxin-mediated lateral root formation in Arabidopsis. 4 599-615 16525894 2

  1. Tropical Journal of Pharmaceutical Research - Vol 14, No 7 (2015)

    Evaluation of Therapeutic Effects of Radiotherapy during Treatment of Lung Adenocarcinoma in Mice with Positron Emission Tomography Imaging ofF-FLT andF-FDG · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B Qu, H Wang, W Yu, J Zhang, H Zhang, J Tian ...

  2. African Journal of Biotechnology - Vol 10, No 65 (2011)

    HQ Lou, Y Hu, L Zhang, YJ Zhang, PG Tu, XT Yu, YJ Jin, L Wang, 14286-14292 ... The effect of osmopriming on germination, seedling growth and phosphatase activities of lettuce under saline ... S Han, TH Zhu, SJ Li, FL Li, 14404-14409.

  3. African Journal of Biotechnology - Vol 10, No 73 (2011)

    Morphological diversity of wild medicinal Paris L. from China and Vietnam · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JY Zhang, J Zhang, WZ Yang, YZ Wang, H Yu, H Jin, 16421-16428 ...

  4. Broad-Band Spectral Indices Variability of BL Lacertae by Wavelet ...

    by Wavelet Method. Hao-Jing Zhang1,2,∗, Jing-Ming Bai1, Yu-Ying Bao3 & Xiong Zhang2. 1Yunnan Astronomical Observatory, National Astronomical Observatory, ... 3Department of Physics, Yuxi Teachers' College, Yuxi, Yunnan 653100, China. ∗ ... broad-band spectral indices—periodic variation—methods: numerical:.

  5. Preparation and characterization of water-absorbing composite ...

    ABCO

    2012-08-16

    Aug 16, 2012 ... 2007; Doorkosh et al., 2000), and natural polymers (Yu et al., 2009; Doorkosh et al., ... Zhang et al., 2007; Lee and Chen, 2005; Neaman et al.,. 2004; Lin et al., 2001). ..... Li A, Zhang JP, Wang AQ (2007). Utilization of starch ...

  6. Dicty_cDB: SHA189 [Dicty_cDB

    Full Text Available 2, mRNA sequence. 80 8e-11 1 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia miltiorrhiza S...alvia miltiorrhiza cDNA 5', mRNA sequence. 54 5e-09 3 CV172465 |CV172465.1 rsmsxl

  7. Dicty_cDB: SHA788 [Dicty_cDB

    Full Text Available . 52 6e-09 5 CV164410 |CV164410.1 rsmsxl_003361.y1.scf cDNA Library of Salvia mil...tiorrhiza Salvia miltiorrhiza cDNA 5', mRNA sequence. 54 6e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf

  8. Dicty_cDB: SHA333 [Dicty_cDB

    Full Text Available SILPIPFKSIIECNGLEEVNQSSKSYKFNDTIKINPFEIKTFR FISN*klkiklinkyknkfn Translated Amino...LQSASVIKEGYSLNNNFYISETPFSLASTTHIDKTFISTNKEAIIVDTIKKAEDGTSFV VRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSYKFNDT...IKINPFEIKTFR FISN*klkiklinkyknkfn Frame C: KDAIQLEYKDTKIGESFGPSWTNYWFKVTIDVPTDWKD

  9. Dicty_cDB: SHA692 [Dicty_cDB

    Full Text Available AATNKSVLSNPTPTPSPNTSSFIPTNKGSTATTTTTTATPTPTPSNNT Translated Amino Acid sequence (All Frames) Frame A: ---sxxxxxxxx...cnsx*xw*xxyxfiixxfnvfxfk*fixxi*xxxxxxxxx*ntxntnn ninndnntinyssgnk*isfiksntntiskyiiihsnk*rihsnnynnnsntn...PNTSSFIPTNKGSTATTTTTTATPTPTPSNNT Frame C: ---xxsxxxxxm*fxlxlvkxislyyxxiqclxf*vihxmxlxxxxxxxx

  10. Dicty_cDB: SHA435 [Dicty_cDB

    Full Text Available iqytlsdrdwksmlpsieaslralikigaieasipis gfkpgnqdtieqyikaiksngyksnqtvilsahqmgscrmgssksnsvvnengeswdvkr lfiadgsvl...llikkikikikis*yy**kk--- ---*lvksikkyyqtvgriqvqswrlpnshialsgsncafmwddsfnfkkrmlkaryysg fisicrdtvpgkirldkdgrspk

  11. Dicty_cDB: SHA257 [Dicty_cDB

    Full Text Available vp*thvqiqpvv*tlqsmlmiiihvl*mlvpnqqvshipq*m*mittnvqlmhvpkkvv* lilqstlmitmpvqlilvhhqxvfptpqsivmikxpvqlihvqiqlv...v*ilqxxvtiiih vlxilamt*lvvxilqsmlmiixhvpsmpvlnqqvxlipqsmxmiitnvqlixvpkkvv* lilhsilmitm

  12. Dicty_cDB: SHA221 [Dicty_cDB

    Full Text Available uence update 2002.10.25 Translated Amino Acid sequence *mittnvqlmhvpkkvv*lilqstlmitmpvqlilvhhqpvfptpqsivmikr...pvqlihv qiqlvv*ilqfpvtiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm *miitnvqlihvpkkvv*lilqsilmitm...CDSKTGKCINKPYNV ITSGSNLISGLIGGLIGGGTGGKGIAKL*kl Frame B: *mittnvqlmhvpkkvv*lilqstlmitmpvqlilvhhqpvfptpqsivmi...krpvqlihv qiqlvv*ilqfpvtiiihvllilamt*lvvailqsmlmiiihvpsmpvlnqqvllipqsm *miitnvqlihvpkkvv*lilqsilmitmpvplipah...mf klnwlckysn*l*r**smyrrlmq*fnwlckhssqc****xmyrrclyqinrcysypxqc x**qqmyn*cmyqrrwg*lipqsilmitmpvqlmhvqxkx---

  13. Dicty_cDB: SHA109 [Dicty_cDB

    Full Text Available *r**smyc*flr*lnwllqysnqchvpsmpvlnqqvllipqsm*miit nvqlihvpkkvv*lilqsilmitmpvplipah...hqlvfpipq*tvmiiinvl*ihvqtqlv v*ilqltvtivihvp*thaiiqlvv*tlqsmlmiiihvpsmpvpnqqvllipqsm*mitt nvqlmhvpkxvv*lipqsilmitm...pvqlmhvqkkvg*lilqsilmitmlvpltscspstw rfphpqltxmixihvpxthvpnstglvxtlpsmvxgxxthxp--- ---sytnqyr***qmyirc

  14. Dicty_cDB: SHA313 [Dicty_cDB

    Full Text Available vpsmpvlnqqvllipqsm*miitnvqlihvpkkvv* lilqsilmitmpvplipahhqlvfpipq*tvmiiinvl*ihvqtqlvv*ilqltvtivih vp*thaxiql...vv*tlqsmlmiiihvpsmpvpnqqvllipqsm*mittnvqlmhvpkkvv* lipqsilmitmpvqlmhvqkkvv*lilqsilmitm

  15. Dicty_cDB: SHA152 [Dicty_cDB

    Full Text Available pdate 2002.10.25 Translated Amino Acid sequence giiihvpsmpvlnqqvllipqsm*miitnvqlihvpkkvv*lilqsilmitmpvplipah...pqsm*mittnvqlmhvpkkvv*lipqsilmitmpvqlmhvq kkvv*lilxsilmitmlvpltpvhhqlafptpqltvmivihvpvdscsnstgccntping g***S...TGGKGIAKL*klntl Translated Amino Acid sequence (All Frames) Frame A: giiihvpsmpvlnqqvllipqsm*miitnvqlihvpkkvv*lilqsilmitm...ittnvqlmhvpkkvv*lipqsilmitmpvqlmhvq kkvv*lilxsilmitmlvpltpvhhqlafptpqltvmivihvpvd...pvplipah hqlvfpipq*tvmiiinvl*ihvqtqlvv*ilqltvtivihvp*thaxiqlvv*tlqsml miiihvpsmpvpnqqvllipqsm*m

  16. Dicty_cDB: SHA805 [Dicty_cDB

    Full Text Available Frame A: fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*CKT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFR...ed Amino Acid sequence fdeeyelakllkiqsfptiigfsngnflkkhtgpfrskshileflnhietehkkky*C...KT LKKKKKKKXXXFXXK--- ---FDXEYELAKLLKIQSFPXIIGFSNGNFLKKHRGPFRSKN Translated Amino Acid sequence (All Frames)

  17. Dicty_cDB: SHA389 [Dicty_cDB

    Full Text Available equence. 34 0.12 3 CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...PRT insertion targeting and chromosome engineering clone MHPP142o16. 50 0.13 1 CR...034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering

  18. Dicty_cDB: SHA814 [Dicty_cDB

    Full Text Available rt in 5'HPRT insertion targeting and chromosome engineering clone MHPN313j15. 44 3.6 1 AG419904 |AG419904.1 ...1 CR220170 |CR220170.1 Forward strand read from insert in 5'HPRT insertion targeting and chromosome engine...ering clone MHPN355o20. 44 3.6 1 CR028932 |CR028932.1 Forward strand read from inse

  19. Dicty_cDB: SHA655 [Dicty_cDB

    Full Text Available qqiknsikk*ncylfyylff*yfqywynlkqpilv*kpmvtimilfsn*q ipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfltqiqshflpwllkfvm...lql fm*kitlmrpvvlssqvasgahglqn*qeklkfkl*e*n*ithd*i*sn*ILKYLIIKFI KQKFL--- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilf...me B: iklklkfnykqqiknsikk*ncylfyylff*yfqywynlkqpilv*kpmvtimilfsn*q ipkkfkwpeifclerkamkfm*wvelkrdlkaiiqsfplfl...KQKFL--- ---IKLKLKFNYKQQIKNSIKK*ncylfyylff*yfqywynlkqpilv*kpmvtimilfs n*qipkkfkwpeifclerkamkfm*wvelkrdlkaiiq

  20. Dicty_cDB: SHA396 [Dicty_cDB

    Full Text Available sequence sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqs...C: sknfiql*itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn* liqkkykkpeifclerklkkfm*wvelesqiktiiqsipfiltq

  1. Dicty_cDB: SHA880 [Dicty_cDB

    Full Text Available gdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng* r*qwmvdaqslkeviilltcrka*r*RRSLNVNSSGVVFSADLDGSSKYS...gf*n*iahvq*kigalsgpflv srtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng* r*qwmvdaqslkeviilltcrka*

  2. 从张小夫《诺日朗》的音响变化过程看电子音乐作品中的声音演变方式%The Evolution of Sound in Electronic Music Works by Taking Zhang Xiaofu's Norlong as an Example

    骈韵頔

    2013-01-01

    张小夫以中国深厚的历史文化、传统的声乐、器乐为依托,利用自己丰富的电子音乐技术手段,创作了大量具有强烈中国民族气息的现代电子音乐作品,其中《诺日朗》是其最优秀的作品之一。本文通过仔细分析作品《诺日朗》的音乐发展过程以及作品中主要的三种素材类型,来探讨电子音乐作品中核心素材的演变方式,并以此论证张小夫注重“技术性”与“可听性”、“民族性”三者相结合的创作理念。%With Chinese history and culture , traditional vocal music and instruments as the foundation , Zhang Xiaofu has pro-duced a lot of electronic music works with Chinese style by taking advantage of much electronic music technology .Norlong is one of his best works .The thesis analyses the music developing process and three different material types in this music in detail to discuss the evolution of core material in the works of electronic music and prove Zhang Xiaofu's creative idea of the combination of "technology","audibility"and "nationality"in music.

  3. The Role of SIRT1 In Breast Cancer Stem Cells

    2016-09-01

    2009;9:123-8. 56. Ma W, Xiao GG, Mao J, Lu Y, Song B, Wang L, Fan S, Fan P, Hou Z, Li J, Yu X, 20 Wang B, Wang H, Wang H, Xu F, Li Y, Liu Q, Li L...Int J Biol Sci. 2010;6:599-612. 63. Zhang Y, Zhang M, Dong H, Yong S, Li X, Olashaw N, Kruk PA, Cheng JQ, Bai W, Chen J, Nicosia SV, Zhang X

  4. Identification of sugarcane interspecies hybrids with RAPDs | Zhang ...

    African Journal of Biotechnology. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 7, No 8 (2008) >. Log in or Register to get access to full text downloads.

  5. Scheduling irrigation for jujube ( Ziziphus jujuba Mill. ) | Zhang ...

    This study was performed to select suitable indicator for scheduling the irrigation of jujube (Ziziphus jujuba Mill.) grown in the Loess Plateau. The relationships between plant-based indicators and soil matrix potential as well as meteorological factors of jujube under deficit irrigation compared with well irrigation were ...

  6. Why Tu Youyou Makes Less Money Than Zhang Ziyi?

    Suo, Qinghui; Liu, Yang; Zhang, Daming

    2017-08-01

    Scientists normally earn less money than many other professions which require a similar amount of training and qualification. The economic theory of marginal utility and cost-benefit analysis can be applied to explain this phenomenon. Although scientists make less money than entertainment stars, the scientists do research work out of their interest and they also enjoy a much higher reputation and social status in some countries.

  7. Canonical Ensemble Model for Black Hole Radiation Jingyi Zhang

    Canonical Ensemble Model for Black Hole Radiation. 575. For entropy, there is no corresponding thermodynamical quantity, without loss of generalization. Let us define an entropy operator. ˆS = −KB ln ˆρ. (11). Then, the mean value of entropy is. S ≡〈ˆS〉 = tr( ˆρ ˆS) = −KBtr( ˆρ ln ˆρ). (12). For ideal gases, let y = V , then the ...

  8. By: Kenny Zhang Report Type: Final Technical Report *Date

    Kenny Zhang

    2014-05-30

    May 30, 2014 ... Dr. David Zweig, Chair Professor, Division of Social Science, Hong Kong ... Keith Godin, Director, BC Ministry of Jobs, Tourism and Innovation, Keith. ..... 23) Media reports often quoted researchers of the project on stories ...

  9. Biological advances in Bergenia genus plant | Zhang | African ...

    Bergenia, a genus belonging to Saxifragaceae family, is one of the most important medicinal plants, has high application values for human. Currently, wild Bergenia is becoming lacking, due to destruction of ecological environment and excessive excavation; furthermore, the study on it is not deep enough, many related ...

  10. Factors affecting soil erosion in Beijing mountain forestlands | Zhang ...

    The role of regions, vegetation types and forest stand density in controlling soil erosion were investigated in Beijing mountain forest, China. The main objective was to develop some models to estimate soil erosion under different forest conditions including regions, vegetation type, and stand density as influenced by artificial ...

  11. C. Huang , G. Zhao , HW Zhang & YQ Chen

    the host stars' birth cloud with higher abundance of Si will make the cloud ... with the metallicity distribution of nearby field F, G, or K stars which are known to .... In the early stage of planetesimal accumulation, the rate of growth of planetesimal.

  12. A Framework and Specific Operation of Chinese Indigenous Leadership Research Based on the Research about ZHANG Ruimin%中国本土领导研究的一种框架及操作:基于张瑞敏个案的研究过程示例

    徐立国; 席酉民; 葛京; 宋合义

    2012-01-01

    基于对中国本土领导的界定与分析,提出中国本土领导研究的一种框架及操作,即从“领导如何成长、如何发挥作用及领导的本质”3个开放性问题出发,基于质性研究策略,采用以问题导向的探索性建构主义扎根理论方法,对中国本土领导数据进行搜集与整理.借鉴POPPER的4段式科学研究逻辑,对数据进行分析,不断地对问题进行诠释,并发现新的问题,从不断的循环中建构构念,发掘潜在的扎根理论,与现有领导理论进行对比,最终形成中国本土领导理论.%Chinese unique history and culture determine that practice and research of Chinese indigenous leadership are unique. Based on the definition and analysis of Chinese indigenous leadership research, we propose a framework and specific operation of Chinese indigenous leadership research. From three open-ended questions, based on qualitative research, using problem-oriented exploratory constructive grounded theory, we collect and sort out the data of Chinese indigenous leadership research. Following Popper's Four-scientific logic, we analyze the data, and interpret problems continuously, find new problems, construct constructs from the continuous interpreting circle, explore the potential of grounded theory, and compare with the existing leadership theories to form Chinese indigenous leadership theories. Based on the case of ZHANG Ruimin, we use the framework and specific operation and present the specific research venation of Chinese indigenous leadership research.

  13. The production of radioisotopes with a betatron using an internal bombarding technique; Production de radioisotopes par bombardement interne dans un betatron; Proizvodstvo radioizotopov s pomoshch'yu betatrona s ispol'zovaniem metoda vnutrennej bombardirovki; Obtencion de radioisotopos por bombardeo interno en el betatron

    Morinaga, H [Department of Physics, Tohoku University, Sendai (Japan)

    1962-01-15

    pueden servir para la obtencion de isotopos. Con frecuencia es conveniente emplear isotopos de periodo corto debido a su rapida desintegracion, al hecho de que emitan radiaciones de alta energia y a la facilidad con que pueden obtenerse incluso sin necesidad de poseer conocimientos especiales. (author) [Russian] Razrabotan i uspeshno ispol'zuetsya novyj metod proizvodstva radioizotopov s vysokoj udel'noj aktivnost'yu s pomoshch'yu betatrona. Podvergaemye aktivatsii materialy pomeshchayutsya vnutr' vakuumnoj kamery betatrona v kontse slepogo tsilindra, ustanovlennogo izvne; takim obrazom, proby podvergayutsya bombardirovke pri odnoj atmosfere neposredstvenno za mishen'yu tormoznogo izlucheniya, gde intensivnost' radiatsii chrezvychajno vysoka. Aktivnost' pri nasyshchenii Cu{sup 62}, vyzvannaya v nebol'shoj chastitse medi, prevyshala 1 millikyuri, i poluchaemaya naivysshaya udel'naya aktivnost' priblizitel'no v 500 raz prevyshala aktivnost', vyzvannuyu v obychnom ustrojstve. Do sikh por ehtot metod vnutrennej misheni ispol'zuetsya tol'ko dlya rabot v oblasti yadernoj spektroskopii; bylo ustanovleno vosem' novykh vidov radioaktivnykh izotopov (Co{sup 63}, Ga{sup 75}, As{sup 81}, In{sup 121}, In{sup 123}, Tm{sup 173}, Tm{sup 175} i Ac{sup 231}). Gibkost' takogo metoda bombardirovki otkryvaet novye vozmozhnosti, t.k. meditsinskij, promyshlennyj, a takzhe issledovatel'skij betatrony mogut ispol'zovat'sya dlya proizvodstva izotopov. Korotkozhivushchie izotopy, kotorye chasto yavlyayutsya bolee udobnymi pri razlichnykh vidakh primeneniya vsledstvie ikh bystrogo raspada i obychno vysokoj ehnergii radiatsii, mogut byt' bystro polucheny bez kakogo-libo dopolnitel'nogo umeniya. (author)

  14. Ertong Zaoqi Jingxi Dongzuo Jineng yu Renzhi Fazhan de Guanxi

    Geng, Da; Zhang, Xingli; Shi, Jiannong

    2015-01-01

    Fine motor skills refer to any movement where an individual uses the small muscles or muscle areas of the hands and fingers; these movements serve to development of muscle while also improving the cognitive recognition of the object. Automatic fine motor skills can save limited attention resources...... for advanced cognition tasks as required by an individual; in the development of fine motor skills and cognition, the two abilities interact, some motor skills are the prerequisite for some cognition and the practice of cognition. Fine motor skills also can predict the academic performance of young students....... The two abilities are inter-related because they share common areas of the brain: the prefrontal lobe and the cerebellum. As a result, some cognition disorders could be treated through fine motor skill training and exercises....

  15. Meet Paris in Yu Xi's Documentaries

    SuSan

    2004-01-01

    "This is a documenfary porlrayal of cultural celebrities.All the 60 interviewees have devoted themselves to the greal cause of China-France cultural exchange.Today,it is highly important to stress the preservation and promotion of cultural diversity and make

  16. Pseudo-istorija/arheologija i globalizacija: primer ex Yu prostora

    Vesna Manojlović Nikolić

    2017-01-01

    Full Text Available U radu se diskutuje povezanost procesa globalizacije i pseudonaučnih tumačenja prošlosti. Istaknuta je dvostruka veza između efekata procesa globalizacije i pseudoistorijskog/pseudoarheološkog izmišljanja prošlosti. Prva je tendencija da se nezadovoljstvo kulturnom globalizacijom kompenzuje verovanjem u drugačiju i lepšu prošlost, dok se druga odnosi na upotrebu savremenih sredstava komunikacije u prenošenju pseudonaučnih tumačenja prošlosti širokoj javnosti. Pomoću primera sa područja bivše SFR Jugoslavije ukazano je da proces tranzicije ka globalnom društvu, koji se desio posle perioda eskalacije nacionalizama, doprinosi osećaju krize nacionalnih, regionalnih i lokalnih identiteta i prouzrokuje težnju ka stvaranju izmišljenih prošlosti. Takođe, skrenuta je pažnja da pseudoistoričari i pseudoarheolozi obilato koriste globalna sredstva masovne komunikacije, pre svega internet, čime njihova tumačenja postaju dostupna velikom broju ljudi i prete da postanu jedan od glavnih (iako zabludnih izvora za oblikovanje stavova o prošlosti i sadašnjosti.

  17. Hydrothermal growth of ZnO nanoflowers and their photocatalyst ...

    JINCHENG FAN1,∗, TENGFEI LI1 and HANG HENG2,3. 1School of Materials ... In this paper, the fabrication of ZnO nanoflowers on Si substrate by the ..... [21] Bae J, Han J B, Zhang X-M, Wei M, Duan X, Zhang Y and. Wang Z L 2009 J. ... 142 570. [31] Sun Y J, Wang L, Yu X G and Chen K Z 2012 CrystEngComm. 14 3199.

  18. Synthesis and photoluminescence study of narrow-band UVB ...

    [7] Guo C, Ding X, Seo H J, Ren Z and Bai J 2011 J. Alloys. Compd. 509 4871. [8] Zhang X, Lang H and Seo H 2011 J. Fluoresc. 21 1111. [9] Zhang Z W 2013 Ceram. Int. 39 1723. [10] Yu H 2012 J. Lumin. 132 2553. [11] Wang Q 2012 J. Lumin. 132 434. [12] Palan C, Bajaj N and Omanwar S 2016 Mater. Res. Bull. 76 216.

  19. Manufacture of Wood-Plastic Combinations by Use of Gamma Radiation; Fabrication de combinaisons bois-matiere plastique a l'aide des rayons gamma; Proizvodstvo drevesno-plastmassovykh sostavov s pomoshch'yu gamma-izlucheniya; Impregnacion de maderas con materiales plasticos en presencia de radiaciones gamma

    Kent, J. A.; Winston, A.; Boyle, W.; Updyke, L. [Engineering Experiment Station, West Virginia University, Morgantown, West Virginia (United States)

    1963-11-15

    maderas de pino albar, encina blanca, encina roja, alamo, abedul, haya, abeto y arce sacarino. Se indica el efecto de la intensidad de dosis sobre las velocidades de polimerizacion en esas combinaciones, algunas de las cuales son incompatibles. Por ejemplo, la secoya no permite la polimerizacion del acetato de vinilo o del metacrilato de metilo, en tanto que el pino albar imposibilita la polimerizacion del acetato de vinilo. Los autores estudiaron diversos agentes de reticulacion con miras a determinar su eficacia para acelerar la polimerizacion y, con ello, conseguir ciclos mas breves, y exponen los resultados obtenidos para el acrilato de alilo, el dimetacrilato de etilenglicol, el dimetacrilato de polietilenglicol, el titanato de tetra-isopropilo, el metacrilato de alilo y (en el caso del estireno) el divinilbenceno. Los ensayos mecanicos realizados con maderas impregnadas ponen de manifiesto una mejora de propiedades tales como la dureza, el limite de elasticidad en la compresion y la estabilidad dimensional. Por lo general, se registra un aurpento de la fragilidad respecto de la madera natural. En la memoria se incluyen datos sobre la dureza, el limite de elasticidad en la compresion, la estabilidad en la compresion, la estabilidad dimensional, asi como la resistencia a la flexion y al cizallamiento. (author) [Russian] Opisan promyshlennyj metod polucheniya drevesno-plastmassovykh ''splavov'' s pomoshch'yu gamma-izlucheniya. Protsess sostoit iz dvukh chastej: propitki otobrannoj drevesiny neobkhodimym monomerom i polimerizatsii monomera v meste nakhozhdeniya .s pomoshch'yu gamma-luchej. Izucheno vliyanie razlichnykh faktorov na proniknovenie monomera v drevesinu. Provedennye ispytaniya pokazali, chto na praktike osushchestvimo khoroshee raspredelenie polimera v konechnom produkte. Odnu chast' obraztsov tolshchinoj 10 cm i dlinoj 150 cm podvergli propitke i issledovali na pronikanie monomera, v to vremya kak druguyu chast' obraztsov takoj zhe tolshchiny uspeshno

  20. The Radiation Induced Graft Copolymerization of Methacrylic Acid to Nylon; Copolymerisation par greffe de l'acide methacrylique sur le nylon, provoquee par irradiation; Obluchenie vyzyvaet graft-kopolimerizats yu metakrilovoj kisloty v nejlone; Injerto del acido metacrilico en el nylon por copolimerizacion radioinducida

    Roberts, R; Thomas, J K

    1960-07-15

    metakrilovoj kisloty v nejlon putem podgotovki k oblucheniyu. Skorost' prosachivaniya otnositel'no bol'she, chem skorost' komopolimerizatsii. Ne sushchestvuet prostoj svyazi mezhdu skorost'yu reaktsii i vsej dozoj. Temperaturnaya zavisimost' skorosti prosachivaniya v volokno, podgotovlennoe k oblucheniyu v vozdukhe, ukazyvaet, chto nachalo prosachivaniya, po-vidimomu, proiskhodit putem razlozheniya peroksidnykh grupp, obrazovannykh posle oblucheniya. Izmereniya ehlektricheskogo soprotivleniya na obluchennom volokne ukazyvayut, chto razlozhenie umen'shaetsya na koehffitsient 10. (author)

  1. Ultra-high performance liquid chromatography coupled with photo-diode array and quadrupole/time-of-flight mass spectrometry based chemical profiling approach to evaluate the influence of preparation methods on the holistic quality of Qiong-Yu-Gao, a traditional complex herbal medicine.

    Xu, Jin-Di; Mao, Qian; Shen, Hong; Zhu, Ling-Ying; Li, Song-Lin; Yan, Ru

    2013-08-23

    Qiong-Yu-Gao (QYG), consisting of Rehmanniae Radix (RR), Poriae (PO) and Ginseng Radix (GR), is a commonly used tonic traditional complex herbal medicine (CHM). So far, three different methods have been documented for preparation of QYG, i.e. method 1 (M1): mixing powders of GR and PO with decoction of RR; method 2 (M2): combining the decoction of RR and PO with the decoction of GR; method 3 (M3): decocting the mixture of RR, GR and PO. In present study, an ultra-high performance liquid chromatography coupled with photo-diode array and quadrupole/time-of-flight mass spectrometry (UHPLC-PDA-QTOF-MS/MS) based chemical profiling approach was developed to investigate the influence of the three preparation methods on the holistic quality of QYG. All detected peaks were unambiguously identified by comparing UV spectra, accurate mass data/characteristic mass fragments and retention times with those of reference compounds, and/or tentatively assigned by matching empirical molecular formula with that of known compounds, and/or elucidating quasi-molecular ions and fragment ions referring to information available in literature. A total of 103 components, mainly belonging to ginsenosides, phenethylalcohol glycosides, iridoid glycosides and triterpenoid acids, were identified, of which 5 degraded ginsenosides were putatively determined to be newly generated during preparation procedures of QYG samples. Triterpenoid acids and malonyl-ginsenosides were detected only in M1 samples, while degraded ginsenosides were merely detectable in M2/M3 samples. The possible reasons for the difference among chemical profiles of QYG samples prepared with three methods were also discussed. It could be concluded that preparation method do significantly affect the holistic quality of QYG. The influence of the altered chemical profiles on the bioactivity of QYG needs further investigation. The present study demonstrated that UHPLC-PDA-QTOF-MS/MS based chemical profiling approach is efficient and

  2. Tracer Experiments on Food Exchange in Ants and Termites; Emploi des radioindicateurs dans l'etude de la trophallaxis chez les fourmis et les termites; Izuchenie s pomoshch'yu indikatorov obmena pishchej u murav'ev i termitov; Empleo de indicadores radiactivos para estudiar la trofalaxia en las hormigas y los termites

    Gosswald, K.; Kloft, W. [Institute of Applied Zoology, University of Wurzburg, Federal Republic of Germany (Germany)

    1963-09-15

    murav'i, medonosnye pchely i termity yavlyaetsya ikh stremlenie k trofollakticheskomu obmenu pishchej, kotoryj mokhet byt' khorosho izuchen s pomoshch'yu mechennoj radioaktivnymi veshchestvami pishchi. Pri sravnitel'nom izuchenii samaya vysokaya skorost' obmena byla obnaruzhena u medonosnykh pchel, v to vremya kak u razlichnykh podsemejstv murav'ev ona byla chrezvychajno raznoobraznoj, chto dolkhvo byt' uchteno pri provedenii polevykh ehksperimentov s primeneniem indikatorov. Samoe sil'noe stremlenie k trofollakticheskomu obmenu my obnaruzhili u podsemejstva Camponotlnae. Usilenno izuchalis' murav'i Genus Formica.osobenno Formica polyctena (Forst.), i rodstvennye poligennye i polycalous vidy, kotorye igrayut vakhnuyu rol' v predupreditel'noj biologicheskoj bor'be s nasekomymi-vreditelyami lesa. Ustanovleno, chto skorost' obmena pishchej v odnom muravejnike obuslovlena temperaturoj, vremenem, kolichestvom osobej i nasyshcheniem. Drugoj problemoj yavlyaetsya vopros o tom, sushchestvuet li obmen pishchej mekhdu razlichnymi muravejnikami kolonii murav'ev odnogo vida. Pometiv otdel'nye muravejniki s pomoshch'yu vneseniya radioaktivnoj pishchi, my smogli obnaruzhit' intensivnyj obmen pishchej mekhdu razlichnymi muravejnikami kolonii, otstoyashchimi drug ot druga na rasstoyanie do 200 m. Analogichnye rezul'taty my poluchili dlya trekh razlichnykh kolonij v razlichnye gody. Sushchestvovanie takogo dal'nego obmena pishchej yavlyaetsya ochen' vakhnym dlya otsenki reguliruptsego dejstviya poleznykh vidov murav'ev v otnoshenii nasekomykhvreditelej. Lelo v tom, chto obmen prepyatstvuet bystromu nasyshcheniyu populyatsii lyubogo muravejnika vsledstvie mestnoj massovoj invazii nasekomykh v ikh predydushchem gnezde. Kak pokazali ehksperimenty s primeneniem indikatorov, sobrannaya pishcha popadaet v bol'shinstvo okruzhayushchikh muravejnikov kolonii murav'ev. Poehtomu kolonii ehtikh poleznykh lesnykh murav'ev dejstvuyut kak slokhnaya sistema s vysokoj ehkologicheskoj ehffektivnost'yu. S

  3. Impact of Obesity on Tamoxifen Chemoprevention in a Model of Ductal Carcinoma in Situ

    2012-10-01

    Sarah M. Smith. McDonald JM*, Dunlap SM*, Cogdell D, Dunmire V, Wei Q, Starzinski-Powitz A, Sawaya R, Bruner J, Fuller GN, Aldape K, and Zhang W...Sciences 104(28):11736-41, July 2007. Moore LM, Holmes KM, Smith SM, Wu Y, Tchougounova E, Uhrbom L, Sawaya R, Bruner JM, Fuller GN, and Zhang W... Bruner JM Kuang J, Yu H, Fuller GN and Zhang W. Inhibition of gliomagenesis and attenuation of mitotic transition by MIIP. Oncogene 29(24):3501-8, June

  4. 原住民完全中學的實施現況與挑戰:以蘭嶼高級中學為例 The Implementation and the Challenges Involved in Indigenous Integrated Secondary Schools in Taiwan: A Case Study of Lan-Yu High School

    張如慧Ju-Hui Chang

    2012-09-01

    Full Text Available 建立以原住民為主體,符合原住民需求的教育體系,是原住民社區本位教育的重要理念,而此理念亦納入我國的《原住民族教育法》中。本研究以全國第一所原住民完全中學―蘭嶼高級中學為例,進行個案研究,希望由原住民社區本位教育的理論觀點出發,瞭解在地師生及居民的經驗和想法,重新解讀該校在完全中學原訂目標上的實施現況,及其面臨的挑戰。研究時間為2007年8月至2008 年7月,蒐集資料的方法以師生和社區人士的訪談為主,並輔以部分時間的田野觀察。研究結果發現,蘭嶼成立完全中學的成效包括:提供最弱勢學生的升學和學習機會;透過完全中學經費的溢注,提高城鄉高中教育均衡發展的可能性;以及透過文化融入課程與相關活動,促進學校社區化等。然而因為社區和在地參與 仍有限,所以官方的政策或經費運用,無法完全符合當地真正的需求,更遑論激發社區對教育的主體性和能動性。 Indigenous community-based education argues that indigenous peoples are the subject of educational systems and institutions whose needs should be fulfilled. This concept is also reflected in Indigenous Education Law in Taiwan. This case study is based on the theory of indigenous community-based education and focuses on the first indigenous integrated secondary school in Taiwan, Lan-Yu High School, trying to understand the implementation of the school and the challenges it faced. The research was conducted from August 2007 to July 2008. Its data was collected through interviews with teachers, students, and community members, as well as by participant observation. The findings showed that the integrated secondary school improved educational equality for the most disadvantaged students, that the financial subsidies helped to promote balanced development of secondary education, and that

  5. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics; Volume 95; Issue 1. Distribution and linkage disequilibrium analysis of polymorphisms of GH1 gene in different populations of pigs associated with body size. Yunyun Cheng Songcai Liu Dan Su Chao Lu Xin Zhang Qingyan Wu Siming Li Haoyu Fu Hao Yu Linlin Hao. Research Article ...

  6. Bioactive components of Gynura divaricata and its potential use in ...

    Bioactive components of Gynura divaricata and its potential use in health, food and medicine:a mini-review. Bing-Qing Xu, Yu-Qing Zhang. Abstract. Background: G. divaricata (L.) DC belongs to genus the Gynura Cass which is a kind of perennial herb that has good health protection efficacy and is especially used widely in ...

  7. Isolation of Stilbenoids and Lignans from Dendrobium hongdie

    Chen YG, Xu JJ, Yu H, Qing C, Zhang YL, Wang LQ, Liu. Y, Wang JH. Cytotoxic phenolics from Bulbophyllum odoratissimum. Food Chem, 2008; 107: 169–173. 17. Hernández-Romero Y, Acevedo L, Sánchez MLÁ, Shier. WT, Abbas HK, Mata R. Phytotoxic activity of bibenzyl derivatives from the Orchid Epidendrum rigidum.

  8. Analysis of Free-floating Bike Sharing and Insights on System Operations : or Analyzing Mobility Patterns and Imbalance of Free Floating Bike Sharing Systems

    2018-01-31

    Aritra Pal (ORCID ID 0000-0002-2256-2464) Yu Zhang (ORCID ID 0000-0003-1202-626X) Changhyun Kwon (ORCID ID 0000-0001-8455-6396) Bike Sharing is a sustainable mode of urban mobility, not only for regular commuters but also for casual users and tourist...

  9. A Study of GaAsSb Nanowires by Molecular Beam Epitaxy for Near IR Applications

    2015-09-18

    Mosca, S. Franchi , P. Frigeri, E. Gombia, A. Carnera, M. Peroni, Mater. Science and Eng. B 80, 32 (2001). 1 Appendix C Pavan...Hossain N, Hild K, Jin S R, Sweeney S J, Yu S Q, Johnson S R, Ding D and Zhang Y H 2010 Photonics Global Conference IEEE 1 14 [3] Hwang J S, Tsai J T, Su

  10. A potential explanation for the effect of carbon source on the ...

    USER

    2010-08-16

    Aug 16, 2010 ... structure, mixed liquor suspended solids (MLSS), sludge volume index (SVI) .... Fine air bubbles for aeration were supplied through an air sparger at the ..... Ren TT, Liu L, Sheng GP, Liu XW, Yu HQ, Zhang MC, Zhu JR (2008).

  11. Morphology and anatomical structure of the larval salt gland of ...

    Ezedom Theresa

    2013-10-09

    Oct 9, 2013 ... the morphology and fine structure of the ion transporting epithelium ... The general structure of the salt gland of nauplii cultured at 180 g/L disappeared. ...... Wu G, Zhang H, Sun J, Liu F, Ge X, Chen WH, Yu, J, Wang W (2011).

  12. SYNTHESIS AND CHARACTERISATION OF Ni0.25Co0.75Fe2O4 ...

    characterised for their size and structure using X-ray diffraction (XRD), high .... the sample shows broad peaks, indicating the fine crystalline nature of the particles. ... Zhao, L.J.; Zhang, H.J.; Xing,Y.; Song, S.Y.; Yu, S.Y.; Shi, W.D.; Guo, X.M.; ...

  13. http://dx.doi.org/10.4314/ajtcam.v9i2.1

    AJTCAM

    UHCC (Chen, 2009; Tong, 2010; Zhang et al., 2006; Zhu and Li, 2006). .... 2006; Yu and Kang, 2009) were identified for further study (726 patients), but without a .... inhibit its transition from G2 phase to M phase in vitro. .... Venook, A. P., Stagg, R. J., Lewis, B. J., Chase, J. L., Ring, E. J., Maroney, T. P., Hohn, D. C., (1990).

  14. Fulltext PDF

    965–971. Quantum Mechanics, Field Theories and Special Relativity ... Li Zhang, Shutang Liu and Chenglong Yu ... Probing of complete and incomplete fusion dynamics in heavy-ion collision ... Summary of the National Conference on Nuclear Physics 2013 ... High-power Yb-doped continuous-wave and pulsed fibre lasers.

  15. Untitled

    antibodies to egg drop syndrome. 1976 (EDS-76) and infectious bursal disease viruses. Avian Pathology, 12: 35 - 39. YUAN, X., WANG, Y., LI, J., YU, K.,. YANG, J., XU, H., ZHANG, Y., AI,. H. and WANG, J. (2013). Surveillance and molecular characterization of Newcastle disease virus in seafowl from coastal areas of China ...

  16. 4 gene expression in hepatocellular carcinoma (HCC)

    Gamalat El Gedawy

    2016-06-06

    Jun 6, 2016 ... Subjects and methods: This study was conducted on 30 HCC patients, 20 chronic liver disease ...... [26] Huang CS, Yu W, Cui H, Wang YJ, Zhang L, Han F, et al. ... Y. Involvement of programmed cell death 4 in transforming.

  17. Journal of Chemical Sciences | Indian Academy of Sciences

    ... YU1 JUAN QIN2 JIAQI ZHANG1 FULIN CHENG1 WENLIANG WU1. College of Chemical Engineering, Nanjing Tech University, Nanjing 210009, People's Republic of China; Technology and Finance Service Center of Jiangsu Province, Productivity Center of Jiangsu Province, Nanjing 210042, People's Republic of China ...

  18. and gallium-doped zinc oxide transparent conducting sol–gel thin films

    Administrator

    and 1∙76 × 10–2 Ω cm for GZO, when five multilayer coatings are made. The origin of ... indium source make its price increasing every day. On the other hand, zinc ..... Zhao Q, Xu X Y, Song X F, Zhang X Z, Yu D P, Li C P and. Guo L 2006 Appl.

  19. Igavese armastuse sõdalane : mitte just klassika, aga ajaloo verstapost küll / Ilmar Raag

    Raag, Ilmar, 1968-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi, Eesti ühistöö) : stsenarist Iiro Küttner, režissöör Antti-Jussi Annila, võitluskunstide koreograaf Yu Yan Kai, osades - Tommi Eronen, Zhang Jingchu, Markku Peltola, Elle Kull

  20. Üllatav seiklusfantaasia Soomest / Alar Niineväli

    Niineväli, Alar

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Elle Kull. Lisa "Soome film sai Hiinas hea lepingu

  1. Fassaadikunstist ja teesklusest / Margit Tõnson

    Tõnson, Margit, 1978-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola

  2. Supplementary data: A complete mitochondrial genome of wheat ...

    Supplementary data: A complete mitochondrial genome of wheat (Triticum aestivum cv. Chinese Yumai), and fast evolving mitochondrial genes in higher plants. Peng Cui, Huitao Liu, Qiang Lin, Feng Ding, Guoyin Zhuo, Songnian Hu, Dongcheng Liu, Wenlong Yang, Kehui Zhan,. Aimin Zhang and Jun Yu. J. Genet.

  3. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences. Yuanming Zhang. Articles written in Journal of Chemical Sciences. Volume 118 Issue 3 May 2006 pp 281-285. Temperature effects on surface activity and application in oxidation of toluene derivatives of CTAB-SDS with KMnO4 · Yu Tang Biying Du Jun Yang Yuanming ...

  4. A novel missense mutation in collagenous domain of EDA gene in a ...

    Supplementary data: A novel missense mutation in collagenous domain of EDA gene in a. Chinese family with X-linked hypohidrotic ectodermal dysplasia. Daxu Li, Ran Xu, Fumeng Huang, Biyuan Wang, Yu Tao, Zijian Jiang, Hairui Li, Jianfeng Yao,. Peng Xu, Xiaokang Wu, Le Ren, Rui Zhang, John R. Kelsoe and Jie Ma.

  5. Download this PDF file

    cadewumi

    24. Yu, S., Zhang, Xen., Chen, G, and W. Liu. (2012). Compromised cellular responses to DNA damage accelerate chronological aging by incurring cell wall fragility in Saccharomyces cerevisiae. Mol Biol Rep. 39: 3573–3583. 25. Zoreky, N.S.A. (2009). Antimicrobial activity of pomegranate (Punica granatum L.) fruit peels.

  6. Electric Vehicle Sharing Planning and Operations

    2018-02-01

    Dongfang Zhao (ORCID ID 0000-0002-5424-9915); Xiaopeng (Shaw) Li (ORCID ID 0000-0002-5264-3775); Yu Zhang (ORCID ID 0000-0003-1202-626X) This project includes literature review and proposing a model for EV planning and operations. We first conducted ...

  7. Behaviour of Spinner Dolphin at Sha\\'ab Samadai, Marsa Alam, Red ...

    . Samadai, Marsa Alam, Red Sea. The data were collected from October 2005 until. September 2006 using surface observations. Four objectives were studied: arrival and departure time of dolphins, distribution of dolphin movements within the ...

  8. Ambient air pollution, traffic noise and adult asthma prevalence : A BioSHaRE approach

    Cai, Yutong; Zijlema, Wilma L.; Doiron, Dany; Blangiardo, Marta; Burton, Paul R.; Fortier, Isabel; Gaye, Amadou; Gulliver, John; de Hoogh, Kees; Hveem, Kristian; Mbatchou, Stephane; Morley, David W; Stolk, Ronald P.; Elliott, Paul; Hansell, Anna L.; Hodgson, Susan

    2017-01-01

    We investigated the effects of both ambient air pollution and traffic noise on adult asthma prevalence, using harmonised data from three European cohort studies established in 2006-2013 (HUNT3, Lifelines and UK Biobank). Residential exposures to ambient air pollution (particulate matter with

  9. Ambient air pollution, traffic noise and adult asthma prevalence: a BioSHaRE approach.

    Cai, Yutong; Zijlema, Wilma L; Doiron, Dany; Blangiardo, Marta; Burton, Paul R; Fortier, Isabel; Gaye, Amadou; Gulliver, John; de Hoogh, Kees; Hveem, Kristian; Mbatchou, Stéphane; Morley, David W; Stolk, Ronald P; Elliott, Paul; Hansell, Anna L; Hodgson, Susan

    2017-01-01

    We investigated the effects of both ambient air pollution and traffic noise on adult asthma prevalence, using harmonised data from three European cohort studies established in 2006-2013 (HUNT3, Lifelines and UK Biobank).Residential exposures to ambient air pollution (particulate matter with aerodynamic diameter ≤10 µm (PM 10 ) and nitrogen dioxide (NO 2 )) were estimated by a pan-European Land Use Regression model for 2007. Traffic noise for 2009 was modelled at home addresses by adapting a standardised noise assessment framework (CNOSSOS-EU). A cross-sectional analysis of 646 731 participants aged ≥20 years was undertaken using DataSHIELD to pool data for individual-level analysis via a "compute to the data" approach. Multivariate logistic regression models were fitted to assess the effects of each exposure on lifetime and current asthma prevalence.PM 10 or NO 2 higher by 10 µg·m -3 was associated with 12.8% (95% CI 9.5-16.3%) and 1.9% (95% CI 1.1-2.8%) higher lifetime asthma prevalence, respectively, independent of confounders. Effects were larger in those aged ≥50 years, ever-smokers and less educated. Noise exposure was not significantly associated with asthma prevalence.This study suggests that long-term ambient PM 10 exposure is associated with asthma prevalence in western European adults. Traffic noise is not associated with asthma prevalence, but its potential to impact on asthma exacerbations needs further investigation. Copyright ©ERS 2017.

  10. Speeding up detection of SHA-1 collision attacks using unavoidable attack conditions

    M.M.J. Stevens (Marc); D. Shumow

    2017-01-01

    textabstractCounter-cryptanalysis, the concept of using cryptanalytic techniques to detect cryptanalytic attacks, was introduced by Stevens at CRYPTO 2013 [22] with a hash collision detection algorithm. That is, an algorithm that detects whether a given single message is part of a colliding message

  11. Fatigue Resistant Design Criteria for MD SHA Cantilevered Mast Arm Signal Structure

    2017-12-01

    The fatigue design of the mast arm structures and connections vary significantly based on the Category of Importance factor adopted and the load cases for fatigue design loads. Consideration should include the cost and size of the structures for both...

  12. A contribution to the SHA of Eastern Thessaly, Central Greece: archaeological and historical evidences

    Helly, B.; Caputo, R.; Tsafalias, A.

    2003-04-01

    Eastern Thessaly region (Central Greece) shows numerous evidences of seismic activity ranging from structural, morphological, palaeoseismological, archaeological and historical. In the present note, we focus on the latter two aspects. A fundamental source of historic data are the "Chronicles" of the monasteries of the area. Doubtless, the most important ones are those located in the Meteora region (western Thessaly). In the "Chronicles" of these monasteries few events are reported relative to the investigated region and particularly the August 1668, occurred in the area of Larissa, the 1731, the November 9, 1766 and the August 28, 1781. Maximum inferred intensity of the three latter earthquakes has been estimated of the VIII degree. Based on the tectonic setting of the possible seismogenic structures, these events are tentatively located in the Tyrnavos Basin, while no other events are known in this sector neither before the 16th century nor in more recent times, except the March 1941 earthquake occurred East of Larissa. Archaeological information from the broader area concerns several sectors. i) Along the Rodià Fault, which is the major antithetic structure bordering to the north the Tyrnavos Basin, near the Arghyropouli village, the ancient site of Leimoné has been occupied since Neolithic times but it also represents an important Mycenaean site (13th-10th century BC). According to the historian Rhianos (3rd century BC), the town was still there during the Classical Period (5th-4th century BC) but according to Strabo it was disappeared at the end of the 1st century BC. ii) In Larissa, an inscription of the end of the 3rd century BC ascertain the bad conditions of a certain number of shrines and public buildings, reporting several damages like fallen columns. iii) Along the Tyrnavos Fault, the ancient settlement and ruins found on the rocky hill of the present-day Damasi village has been correlated to the ancient town of Phalanna and the alluvial plain extending to the north with its exploitable territory bordered by the western segment of the Tyrnavos Fault that generates a damming effect. As a consequence, frequent flooding events have continuously enriched the soil and probably enhanced the productivity of the area thus making it particularly appealing for farming. iv) At Pythion, 50 km N of Tyrnavos at the foothills of the Mount Olympus, the temple of Apollo Pythios has been rebuilt during the middle Imperial Epoch (Roman times 1st-4th century AD), probably at the beginning of the 2nd century AD. The first excavations revealed that many blocks belonging to former buildings and stones with inscriptions were chaotically accumulated in hollows. On the other hand, the existence of this temple is documented during the third Macedonian War (first half of the 2nd century BC) without any doubt and consequently the destruction of the buildings must have occurred during this time window and they were rebuilt at some distance from its original location. v) In Larissa, some blocks belonging to former buildings have been used as grave-steles during the second half of the 1st century BC thus suggesting the probable destruction of these buildings and the consequent dereliction. vi) The more important evidences of historical seismic activity producing important damaging effects have been obtained from the excavations of the great theatre of Larissa. The theatre was built at the beginning of the 3rd century BC during the Early Hellenistic times but following the traditional plan and architecture of the Classical time (koilon, orchestra and scenic building). During the 2nd century BC was added a Doric style proscenium in front of the scenic building. During the Imperial time (last 10 years of the 1st century BC), the theatre underwent a deep re-handling due to a different use as arena. In particular, a new and larger proscenium was built as a monumental decoration holding three frontispice with dedications of the Larissa people to the Emperor August, to Tiberius as "benefactor and founder". During the excavations of the theatre, several evidences of damages of the building have been observed. Probably the most important and more impressive damages are represented by the displacement of some of the blocks of the walls and the rupture of some of the blocks. For example, some of the blocks show a typical concoid fracture clearly induced by a strong mechanical shock occurred in one of its corners. These rupture conditions are likely to be associated to the dynamic motion of the overlying block which acted as a hammer due to a strong acceleration. Numerous blocks are also dislocated and rotated. According to the size of the shifted blocks, their weight and the amount of displacement they suffered, we can tentatively estimate the peak acceleration occurred in the area and possibly the direction of the seismic waves. The collected archaeological and historical data, have been also compared with the available palaeoseismological data, while possible inferences for the seismic hazard of the region will be discussed.

  13. Fatigue Resistant Design Criteria for MD SHA Cantilevered Mast Arm Signal Structure : Research Summary

    2017-12-01

    Over the past two decades, wind induced fatigue cracking of highway signs, luminaires, and traffic signal support structures have been increasingly reported all over the United States. While fatalities associated with these failures have been limited...

  14. Chi Ka Sha Goes to Washington: Chickasaw Narratives on the NMAI

    Hinson, Joshua Don

    2005-01-01

    This narrative describes the author's visit to Washington DC to attend the opening of the National Museum of the American Indian (NMAI). As a member of the Chickasaw, the author pondered what he would find in the museum that would represent the Chickasaw Nation. Would the museum reflect his people in all their diversity? Would he see something of…

  15. Bicliques for Preimages: Attacks on Skein-512 and the SHA-2 Family

    Khovratovich, Dmitry; Rechberger, Christian; Savelieva, Alexandra

    2012-01-01

    We present a new concept of biclique as a tool for preimage attacks, which employs many powerful techniques from differential cryptanalysis of block ciphers and hash functions. The new tool has proved to be widely applicable by inspiring many authors to publish new results of the full versions...

  16. Superlitio, Aterciopelados, La Pestilencia, Ultrágeno, Ión, Sha

    José Ernesto Ramírez

    2004-09-01

    Full Text Available Rock al Parque 1995-2000. Varios autores. Alcaldía Mayor de Bogotá, Instituto Distrital de Cultura y Turismo, Observatorio de Cultura Urbana, Museo de Desarrollo Urbano, Prensa Moderna, Bogotá, 2001, 120 págs, il.

  17. Association between MDM2 SNP309 T>G polymorphism and the risk of bladder cancer: new data in a Chinese population and an updated meta-analysis

    Xie LG

    2015-12-01

    Full Text Available Linguo Xie,1,2,* Yan Sun,2,* Tao Chen,1,2,* Dawei Tian,1,2 Yujuan Li,3 Yu Zhang,1,2 Na Ding,2 Zhonghua Shen,1,2 Hao Xu,1,2 Xuewu Nian,4 Nan Sha,1,2 Ruifa Han,1,2 Hailong Hu,1,2 Changli Wu1,2 Objective: Human murine double minute 2 protein (MDM2 is mainly a negative regulator of p53 tumor suppressor pathway. We aimed to investigate the association between MDM2 SNP309 polymorphism and bladder cancer risk. Methods: A total of 535 bladder cancer patients and 649 health controls were recruited for our study. MDM2 SNP309 T>G polymorphism was genotyped by polymerase chain reaction-ligase detection reaction method. Logistic regression was used to analyze the relationship between the genotype and susceptibility of bladder cancer. Kaplan–Meier estimates and log-rank test were obtained to analyze the association between the genotype and risk of recrudesce in nonmuscle-invasive bladder cancer patients. A multivariable Cox proportional hazards model was fitted to identify independent prognostic factors. To further investigate the association, we conducted a meta-analysis including six studies. Results: The frequency of the MDM2 SNP309 T>G polymorphism showed no significant difference between cases and controls (all P>0.05. In the stratification analysis, the results showed that G allele carriers were prone to have a significant decrease in risk of low-grade bladder cancer (adjusted odds ratio: 0.613, 95% confidence interval: 0.427–0.881, and G variant was associated with a significantly reduced risk of recurrence in nonmuscle-invasive bladder cancer patients with or without chemotherapy (P<0.05. The results of the meta-analysis showed that G allele and GG genotype of MDM2 SNP309 polymorphism were significantly associated with increased risk of bladder cancer in Caucasians (both P<0.05, and no association was observed in total populations and Asians (P>0.05. Conclusion: MDM2 SNP309 T>G polymorphism has no influence on bladder cancer risk in Asians, but

  18. Intravenous chemotherapy combined with intravesical chemotherapy to treat T1G3 bladder urothelial carcinoma after transurethral resection of bladder tumor: results of a retrospective study

    Zhang Y

    2016-01-01

    Full Text Available Yu Zhang,1,* Linguo Xie,1,* Tao Chen,1,* Wanqin Xie,2 Zhouliang Wu,1 Hao Xu,1 Chen Xing,1 Nan Sha,1 Zhonghua Shen,1 Yunkai Qie,1 Xiaoteng Liu,1 Hailong Hu,1 Changli Wu1 1Department of Urology, The Second Hospital of Tianjin Medical University, Tianjin Institute of Urology, Tianjin, 2Key Laboratory of Genetics and Birth Health of Hunan Province, The Family Planning Research Institute of Hunan Province, Changsha, People’s Republic of China *These authors contributed equally to this work Objective: The management of stage 1 and grade 3 (T1G3 bladder cancer continues to be controversial. Although the transurethral resection of bladder tumor (TURBT followed by intravesical chemotherapy is a conservative strategy for treatment of T1G3 bladder cancer, a relatively high risk of tumor recurrence and progression remains regarding the therapy. This study aimed to compare the efficacy of intravenous chemotherapy combined with intravesical chemotherapy versus intravesical chemotherapy alone for T1G3 bladder cancer after TURBT surgery. Methods: We retrospectively reviewed the cases of 457 patients who were newly diagnosed with T1G3 bladder urothelial carcinoma between January 2009 and March 2014. After TURBT, 281 patients received intravesical chemotherapy alone, whereas 176 patients underwent intravesical chemotherapy in combination with intravenous chemotherapy. Tumor recurrence and progression were monitored periodically by urine cytology and cystoscopy in follow-up. Recurrence-free survival and progression-free survival of the two chemotherapy strategies following TURBT were analyzed. Univariable and multivariable Cox hazards analyses were performed to predict the prognostic factors for tumor recurrence and progression. Results: The tumor recurrence rate was 36.7% for patients who received intravesical chemotherapy alone after TURBT, compared with 19.9% for patients who received intravenous chemotherapy combined with intravesical chemotherapy after

  19. Impact of lymphovascular invasion on recurrence and progression rates in patients with pT1 urothelial carcinoma of bladder after transurethral resection

    Sha N

    2015-11-01

    Full Text Available Nan Sha,* Linguo Xie,* Tao Chen,* Chen Xing, Xiaoteng Liu, Yu Zhang, Zhonghua Shen, Hao Xu, Zhouliang Wu, Hailong Hu, Changli Wu Department of Urology, Tianjin Key Laboratory of Urology, Tianjin Institute of Urology, Second Hospital of Tianjin Medical University, Tianjin, People’s Republic of China *These authors contributed equally to this work Objective: To evaluate the clinical significance of lymphovascular invasion (LVI on recurrence and progression rates in patients with pT1 urothelial carcinoma of bladder after transurethral resection.Methods: This retrospective study was performed with 155 patients with newly diagnosed pT1 urothelial carcinoma of bladder who were treated with transurethral resection of bladder tumor at our institution from January 2006 to January 2010. The presence or absence of LVI was examined by pathologists. Chi-square test was performed to identify the correlations between LVI and other clinical and pathological features. Kaplan–Meier method was used to estimate the recurrence-free survival (RFS and progression-free survival curves and difference was determined by the log-rank test. Univariate and multivariate analyses were performed to determine the predictive factors through a Cox proportional hazards analysis model.Results: LVI was detected in a total of 34 patients (21.9%. While LVI was associated with high-grade tumors (P<0.001 and intravesical therapy (P=0.009. Correlations with age (P=0.227, sex (P=0.376, tumor size (P=0.969, tumor multiplicity (P=0.196, carcinoma in situ (P=0.321, and smoking (P=0.438 were not statistically significant. There was a statistically significant tendency toward higher recurrence rate and shorter RFS time in LVI-positive patients. However, no statistically significant differences were observed in progression rate between the two groups. Moreover, multivariate Cox proportional hazards analysis revealed that LVI, tumor size, and smoking were independent prognostic predictors of

  20. Imprecise intron losses are less frequent than precise intron losses but are not rare in plants.

    Ma, Ming-Yue; Zhu, Tao; Li, Xue-Nan; Lan, Xin-Ran; Liu, Heng-Yuan; Yang, Yu-Fei; Niu, Deng-Ke

    2015-05-27

    In this study, we identified 19 intron losses, including 11 precise intron losses (PILs), six imprecise intron losses (IILs), one de-exonization, and one exon deletion in tomato and potato, and 17 IILs in Arabidopsis thaliana. Comparative analysis of related genomes confirmed that all of the IILs have been fixed during evolution. Consistent with previous studies, our results indicate that PILs are a major type of intron loss. However, at least in plants, IILs are unlikely to be as rare as previously reported. This article was reviewed by Jun Yu and Zhang Zhang. For complete reviews, see the Reviewers' Reports section.

  1. Enhanced immunization via dissolving microneedle array-based delivery system incorporating subunit vaccine and saponin adjuvant

    Zhao,JiHui; Zhang,Qi-Bo; Liu,Bao; Piao,Xiang-Hua; Yan,Yu-Lu; Hu,Xiao-Ge; Zhou,Kuan; Zhang,Yong-Tai; Feng,Nian-Ping

    2017-01-01

    Ji-Hui Zhao,1,* Qi-Bo Zhang,1,* Bao Liu,2 Xiang-Hua Piao,1 Yu-Lu Yan,1 Xiao-Ge Hu,1 Kuan Zhou,1 Yong-Tai Zhang,1 Nian-Ping Feng1 1School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People’s Republic of China; 2Anethesiology Department, Augusta University, Augusta, GA, USA *These authors contributed equally to this work Purpose: To enhance the immunogenicity of the model subunit vaccine, ovalbumin (OVA) was combined with platycodin (PD), a ...

  2. Chuancheng yu gengxin: Liu Mei sheng yu Minguo shiqi de shixue%传承与更新:留美生与民国时期的史学

    李春雷

    2008-01-01

    @@ As it has long been acknowledged that historians do not simply write objectivehistories, but are themselves products of Specific times and places, there is littlequestion that histories of historiography can provide important insights. ProfessorLi Chunlei, of Tianjin Polytechnic University, contributes to our understandingof the origins of the modem discipline of history in China by focusing on theimportant role of returned students from the U.S. in fostering its developmentand shaping its direction.

  3. Technology Education and Technology Teacher Education in Taiwan, R.O.C. = Zhong Hua Min Guo Ke Ji Jiao Yu Ji qi shi zi Jiao Yu.

    Lee, Lung-Sheng Steven; Wang, Cheng-Pin Peter; Wang, Yen-chao; Shih, Neng-Mu; Yeh, Chung-ching

    Technology education in Taiwan begins with craft work at the elementary school level, and the most important point is the practical application. All junior high school students are required to take the Living Technology course. Content includes technology and life, information and communication, construction and manufacturing, and energy and…

  4. Feng xian tai du yu jiao yu he zhi ye xuan ze xing wei: yi ge shi yan fang fa de yan jiu an li

    Ding, X.; Sun, Y.; Hartog, J.

    2009-01-01

    An experimental study on risk attitude and choice behavior of education and career This paper introduces a research on risk attitude and choice behavior of education and career. Using the experimental methods, this study focuses on testing the reliability and validity of risk attitude measurement.

  5. Computer‐Assisted Library Instruction and Face‐to‐Face Library Instruction Prove Equally Effective for Teaching Basic Library Skills in Academic Libraries. A review of: Zhang, Li, Watson, Erin M. and Banfield, Laura. ʺThe Efficacy of Computer‐Assisted Instruction Versus Face‐to‐Face Instruction in Academic Libraries: A Systematic Review.ʺ The Journal of Academic Librarianship 33.4 (July 2007: 478‐484.

    Stephanie Walker

    2008-03-01

    , and case studies, with a sample size greater than one and with pre‐ and post‐test measurements;study participants had to be academic library patrons; the study needed to compare CAI and face‐to‐face instruction; and both the students’ information skills and reactions to the instruction had to be measured. This left 40 unique studies, which were then retrieved in full text. Next, studies were selected to meet the inclusion criteria further using the QUOROM format, a reporting structure used for improving the quality of reports of meta‐analyses of randomised trials (Moher et al 1896‐1900. Evaluation of methodological quality was then done using a dual method: authors Watson and Zhang assessed the studies independently, each using the “Checklist for Study Quality” developed by Downs and Black (Downs and Black 377‐384, adapted slightly to remove non‐relevant questions. After analysis, when additional information was needed, original study authors werecontacted. Finally, ten studies were included in the analysis.The instruction sessions covered many topics, such as catalog use, reading citations, awareness of library services and collections, basic searching of bibliographic databases, and more. But all could qualify as basic, rather than advanced, library instruction. All studies did pre‐ and posttests of students’ skills – some immediatelyafter instruction, and others with a time lapse of up to six weeks. Most authors created their own tests, though one adapted an existing scale. Individual performance improvement was not studied in many cases due to privacy concerns.Main Results ‐ Nine of the ten studies found CAI and face‐to‐face instruction equally effective; the tenth study found face to‐face instruction more effective. The students’ reaction to instruction methods varied – some students felt more satisfied with face‐to‐face instruction and felt that they learned better, while other studies found that students receiving CAI

  6. Zhang et al., Afr J Tradit Complement Altern Med. (2014) 11(6):66-76

    cadewumi

    So DNA barcodes for identifying herbal materials should have great usability and variation. Previous data suggested that ITS2 represented the most suitable region for DNA barcoding applications so it was proposed as a novel universal barcode for herbal materials (Chen et al.,. 2010, 2013; Yao et al., 2010). Until now, the ...

  7. Different Luminosity Correlation of GRBs ZB Zhang1,2,∗, HC Liu1,2

    Abstract. We report our recent understanding about a tight correlation between relative spectral lag and luminosity (or redshift) for γ-ray bursts. The latest investigations indicate that the empirical correlations got from. BATSE bursts also exist for Swift/BAT ones. The special luminosity- lag correlation is much similar to that of ...

  8. On the Superluminal Motion of Radio-Loud AGNs Zhi-Bin Zhang1,2 ...

    xies—radiation mechanisms: non-thermal—quasars: general. 1. Introduction. Rees (1966) predicted that the transverse velocity of an object moving relativistically in some special directions may appear to exceed the speed of light. The apparent superluminal motion (SM) is essentially a geometric effect or a light travel-time.

  9. Zhang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):258 ...

    AJTCAM

    Guangdong Pharmaceutical University, Guangzhou 510006, China. *E-mail: lujia6812@163.com. Abstract. Juglans mandshurica Maxim is a traditional herbal medicines in China, and its anti-tumor bioactivities are of research interest. Bioassay-guided fractionation method was employed to isolate anti-tumor compounds ...

  10. Zhang et al., Afr J Tradit Complement Altern Med. (2014) 11(2):377 ...

    cadewumi

    Background: The Third Month Fair in Dali is a historical festival and fair. ... drawn people's attention owing to its congenital advantages such as fewer side effects and .... of local rhizotomists possessed obvious regional feature and study value.

  11. Techno-Orientalism with Chinese Characteristics: Maureen F. McHugh’s China Mountain Zhang

    Christopher T. Fan

    2015-03-01

    Full Text Available Christopher T. Fan argues that McHugh’s award-winning 1992 science fiction novel perceives the twilight of the American Century by offering a “critical realism,” to use Georg Lukács’s phrase, of postsocialist US–China interdependency. In other words, it offers a form in which we perceive ourselves as subjects and objects of the twenty-first century world-system’s most important bilateral relationship. Moreover, as a novel about US–China interdependency, it implicitly critiques the binary Orientalism that structures the rapidly growing body of work on “techno-Orientalist” formations. Fan's analysis thus extends arguments about American Orientalism’s non-Manichean formations (Christina Klein, Melani McAlister, Colleen Lye into the postsocialist era.The novel’s near-future, China-centric world analogizes McHugh’s personal crises of professional desire as a precarious laborer in New York City, with the massive reorientation of desires from Maoist politics to market-directed individuality that she witnessed among her students when she taught in China from 1987–1988. Chinese racial form plays a crucial mediating role in the novel because it reflects the revival of Confucian humanist discourse in reform-era China as a way to focus a national project of rapidly generating capitalist desire. Finally, by describing US–China interdependency, this article also generates a theory of US–China neoliberalism that corrects for universalist, Euro-American accounts of neoliberal subject formation (Lauren Berlant, as well as insufficiently subject-sensitive accounts (Aihwa Ong.

  12. Molecular mapping of MS-cd 1 gene in Chinese kale | Zhang ...

    A dominant male sterility (DGMS) line 79-399-3 was developed from spontaneous mutation in Brassica oleracea var. capitata and has been widely used in the production of hybrid cultivar in China. In this line, male sterility is controlled by a dominant gene Ms-cd1. In the present study, primary mapping of Ms-cd1 was ...

  13. Li and Zhang., Afr J Tradit Complement Altern Med. (2016) 13(3):75 ...

    imbalance of Yin and Yang is the fundamental element leading to diseases. Qi is defined as the most ... All of the dryness symptoms are attributed to insufficiency of body fluid. Lack of tears .... Medsurg nursing : official journal of the Academy of.

  14. Kardar–Parisi–Zhang equation in one dimension and line ensembles

    that the dynamics is defined through a suitable stochastic exchange rule. Thus one arrives at the totally asymmetric simple exclusion process (TASEP), which .... variables and can be viewed as a two-dimensional field theory in infinite volume.

  15. Zhang et al., Afr J Tradit Complement Altern Med. (2016) 13(3):181 ...

    Drugs were administered orally daily for 7 days before modeling. ... this segment, including delivery of nutrients, removal of waste products, and ... cardiology as well as in other end-organ systems, such as cardiac diseases, ... Rats were anesthetized with 0.3% pentobarbital sodium (1ml/100g) by intramuscular injection.

  16. Zhuyi Quexian Duodong Zhang'ai Ertong de Shijian Zhijue Tezheng

    Yin, Huazhan; Sun, Zudi; Li, Dan

    2015-01-01

    To explore the characteristics of time perception of children with attention-deficit /hyperactivity disorder ( ADHD) and its relevant reasons by using a duration discrimination task. Methods: Totally 55 children with ADHD who met the Diagnostic and Statistical Manual of Mental Disorder,Fourth Edi...

  17. Multi-Wavelength Studies on H2O Maser Host Galaxies J. S. Zhang ...

    on two projects: X-ray data analysis of individual maser source using. X-ray penetrability to explore maser host obscured AGN; multi- wavelength ... Figure 1. Adaptively smoothed three-color image in 0.3–8.0keV and spectra with fitting ... It provides a perspective to improve the accuracy of the Hubble constant H0 and to.

  18. JH Fan Y. Liu Y. Li QF Zhang J. Tao O. Kurtanidze

    Astronomy Science and Technology Research Laboratory of Department of Education of Guangdong ... Department of Computer Science, Jinan University, Guangzhou 510632, China. ... Articles are also visible in Web of Science immediately.

  19. Astronomy Education for Physics Students JH Fan1,2,∗ , JS Zhang1

    2Astronomy Science and Technology Research Laboratory of Department of ... University, and how we are teaching astronomy to the students. Astro- physics ... graduate students, middle school students, and even primary school students. We.

  20. Zhang et al., Afr J Tradit Complement Altern Med. (2014) 11(2):367 ...

    cadewumi

    Ninjurin2 (Ninj2), firstly reported in 2000, is a homolog of a homophilic cellular adhesion molecule, which mediates cell-to-cell and cell-to-extracellular matrix interaction during development, differentiation and regeneration of nervous system (Araki and Milbrandt, 2000; Lin et al., 2011). Ninj2 was also reported to be a ...

  1. Q&A with Y.C. Zhang - Bringing Talent and Passion to Power Systems | News

    research community we have many good tools and methods that are published in research papers, but they conversation has been edited for length. While a student of electrical engineering, were you interested in good indication of renewables production and future load conditions. If all the info is being used

  2. VizieR Online Data Catalog: Srg tidal tails red giants properties (Zhang+, 2017)

    Zhang, X.; Shi, W. B.; Chen, Y. Q.; Zhao, G.; Carrell, K.; Zhao, J. K.; Ruan, G. P.; Liang, Y. C.; Zhou, L.; Ren, H. B.; Zhang, Y.; Hou, Y. H.; Wang, Y. F.

    2016-10-01

    The list of 1100 RGB stars in Sgr streams is selected from SDSS DR9 with Law & Majewski (2010ApJ...714..229L) model. For each star equatorial coordinates, [Fe/H], distance, Vgsr, Lambda, X, Y and Z are given. Each star is also marked with L1, L2, T1, T2 to show in which stream it locates. (1 data file).

  3. Zhang et al., Afr J Tradit Complement Altern Med. (2014) 11(1):62-66

    cadewumi

    Background: Vietnamese Sophora Root mainly contains active constituents such as alkaloids, and it has anti-tumour, antibacterial, and anti-inflammatory effects. The objective of the paper was to study the effects of Vietnamese Sophora Root on growth, adhesion, invasion and motility of mouse melanoma B16BL6 cells, and ...

  4. Zhang et al., Afr J Tradit Complement Altern Med. (2014) 11(6):66-76

    cadewumi

    Background: Traditional methods for identifying herbal medicines have many shortcomings. In this study, we aim to test discriminating ability of. DNA barcodes and explore feasible method on evaluating identification results. Materials and Methods: Materials of whole-plant medicines were sampled from herbal market.

  5. Zhang et al., Afr J Tradit Complement Altern Med., (2017) 14 (5): 41 ...

    Moreover, after mechanical injury the rupture of blood vessel activate the cytokines in the region of spinal cord. Inflammation is one of the major factors responsible for secondary injury to spinal cord. Evidences show the inflammatory mediators (TNFα and IL-6) and oxidative stress induces the process of apoptosis by ...

  6. Zhang et al., Afr J Tradit Complement Altern Med. (2013) 10(5):401 ...

    cadewumi

    Stigma maydis polysaccharides can improve the symptoms of weight loss ... convergence activity, zeaxanthin that have vitamin A activity and other nutrient .... 2 d later, blood was sampled from caudal vein to determine the blood ... In comparison, mice in the normal control group had bright fur and hair, good spirit, normal.

  7. Zhang et al., Afr J Tradit Complement Altern Med. (2015) 12(6):151 ...

    Proff.Adewunmi

    The goal of the present study is to test whether Artemisia Capillaris Formula protects ... It has been shown that ACF exhibits significant therapeutic effects on ... The remaining groups were fed a high‐fat diet (HFD) ad libitum for 8 weeks. ... at 4˚C. The primary antibodies used in this study were polyclonal rabbit anti-rat FAS, ...

  8. Future Directions of Nonlinear Dynamics in PhysicaL and Biological Systems,

    1992-01-01

    the Comision Interministerial de Ciencia y Tecnologia (Spain) under Grant No. TIC 73/89. REFERENCES [1] Yu.S. Kivshar, Zhang Fei, and L. Vizquez, Phys...DYNAMICS Controlling Chaos in Hamiltonian Systems ........................... 129 Y .-C. Lai, M. Ding, and C. Grebogi Deterministic Disorder in Two...all Oi satisfy the following linear differential equations for n = 1 2,..- 8 ,0- , = a n ’ ( 5 ) where xi = x, X2 = Y , x3 = t, Here we note that the

  9. Microstructural evolution and mechanical properties of hypereutectic ...

    Administrator

    2013-07-06

    Jul 6, 2013 ... dered (Hekmat-Ardakan et al 2010; Choi and Li 2012). Usually, the .... According to Clapeyron equation (Yu et al 1999) m. 2. 1 m. (. ) d d ,. T V. V. T. P. H. -. = ∆. (1) .... Jung H K, Seo P K and Kang C G 2001 J. Mater. Process. Technol ... Res. 14 141. Zhang H H, Duan H L, Shao G J, Xu L P, Yin J L and Yan B.

  10. Modulation of epithelial sodium channel in human alveolar epithelial ...

    Modulation of epithelial sodium channel in human alveolar epithelial cells by lipoxin A4 through AhR-cAMP-dependent pathway. Bi-Huan Cheng1,2, Li-Wei Pan2, Sheng-Rong Zhang3, Bin-Yu Ying2, Ben-Ji. Wang2, Guo-Liang Lin2 and Shi-Fang Ding1*. 1Department of Critical Care Medicine, Qilu Hospital of Shandong ...

  11. "Jade Warrior" kupatab Soome sampo Hiina / Kätlin Kaldmaa

    Kaldmaa, Kätlin, 1970-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila : võitluskunstide koreograaf Yu Yan Kai : osades Tommi Eronen, Zhang Jingchu, Markku Peltola. Lisatud Ave Randviiru, Elle Kulli ja Antti-Jussi Annila "Esimesed muljed"

  12. Ultrasound molecular imaging of breast cancer in MCF-7 orthotopic mice using gold nanoshelled poly(lactic-co-glycolic acid) nanocapsules: a novel dual-targeted ultrasound contrast agent

    Xu,Li; Du,Jing; Wan,Caifeng; Zhang,Yu; Xie,Shaowei; Li,Hongli; Yang,Hong; Li,Fenghua

    2018-01-01

    Li Xu,1,* Jing Du,1,* Caifeng Wan,1 Yu Zhang,1 Shaowei Xie,1 Hongli Li,1 Hong Yang,2 Fenghua Li1 1Department of Ultrasound, Renji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai, China; 2Department of Chemistry, College of Life and Environmental Science, Shanghai Normal University, Shanghai, China *These authors contributed equally to this work Background: The development of nanoscale molecularly targeted ultrasound contrast agents (UCAs) with high affinity and specif...

  13. Astragalus polysaccharides protect cardiac stem and progenitor cells by the inhibition of oxidative stress-mediated apoptosis in diabetic hearts

    Chen,Wei; Ju,Jing; Yang,Yehong; Wang,Hao; Chen,Wenjie; Zhao,Xuelan; Ye,Hongying; Zhang,Yu

    2018-01-01

    Wei Chen,1 Jing Ju,1 Yehong Yang,2 Hao Wang,3 Wenjie Chen,1 Xuelan Zhao,1 Hongying Ye,2 Yu Zhang1 1Department of Geriatrics, Huashan Hospital, Fudan University, Shanghai, China; 2Department of Endocrinology, Huashan Hospital, Fudan University, Shanghai, China; 3Core Center of Animal Facility, School of Medicine, Fudan University, Shanghai, China Introduction: Diabetic cardiomyopathy is characterized by an imbalance between myocyte death and regeneration mediated by the progressive loss of c...

  14. Regarding "A new method for predicting nonlinear structural vibrations induced by ground impact loading" [Journal of Sound and Vibration, 331/9 (2012) 2129-2140

    Cartmell, Matthew P.

    2016-09-01

    The Editor wishes to make the reader aware that the paper "A new method for predicting nonlinear structural vibrations induced by ground impact loading" by Jun Liu, Yu Zhang, Bin Yun, Journal of Sound and Vibration, 331 (2012) 2129-2140, did not contain a direct citation of the fundamental and original work in this field by Dr. Mark Svinkin. The Editor regrets that this omission was not noted at the time that the above paper was accepted and published.

  15. Bandgap engineered graphene and hexagonal boron nitride for ...

    Hybrid struc- tures containing a .... elements have a meaning of local density of states and car- rier density as a ... ing electric field) is responsible to pull down the poten- tial well (or ..... [11] Damon B F, Roksana G-M, Vasili P, Yu-Ming L, George S T,. James C T et al ... D, Zhang Y,. Dubonos S V et al 2004 Science 306 666.

  16. Design, synthesis, and evaluation of VEGFR-targeted macromolecular MRI contrast agent based on biotin?avidin-specific binding

    Liu, Yongjun; Wu, Xiaoyun; Sun, Xiaohe; Wang, Dan; Zhong, Ying; Jiang, Dandan; Wang, Tianqi; Yu, Dexin; Zhang, Na

    2017-01-01

    Yongjun Liu,1 Xiaoyun Wu,1 Xiaohe Sun,1 Dan Wang,1 Ying Zhong,1 Dandan Jiang,1 Tianqi Wang,1 Dexin Yu,2 Na Zhang1 1School of Pharmaceutical Science, Shandong University, 2Department of Radiology Medicine, Qilu Hospital, Jinan, People’s Republic of China Abstract: Developing magnetic resonance imaging (MRI) contrast agents with high relaxivity and specificity was essential to increase MRI diagnostic sensitivity and accuracy. In this study, the MRI contrast agent, vascular endotheli...

  17. Changing patient safety culture in China: a case study of an experimental Chinese hospital from a comparative perspective

    Xu XP; Deng DN; Gu YH; Ng CS; Cai X; Xu J; Zhang XS; Ke DG; Yu QH; Chan CK

    2018-01-01

    Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing att...

  18. Baicalein improves behavioral dysfunction induced by Alzheimer’s disease in rats

    Zhou L

    2016-12-01

    Full Text Available Li Zhou, Sha Tan, Yi-long Shan, Yu-ge Wang, Wei Cai, Xue-hong Huang, Xi-yuan Liao, Hai-yan Li, Lei Zhang, Bing-jun Zhang, Zheng-qi Lu Department of Neurology, The Third Affiliated Hospital of Sun Yat-sen University, Guangzhou, Guangdong, People’s Republic of China Background: Alzheimer’s disease (AD is considered to be a neurodegenerative disorder that is characterized by increased oxidative stress. Medicinal plants, with their antioxidant properties, have been used to cure several human diseases. The aim of the current study was to explore the protective and therapeutic effect of baicalein on AD-induced rats. Materials and methods: Swiss Wistar rats were used in the study. The rats were divided into five groups. Group I: normal control group treated with water; Group II: disease control treated with AlCl3 to induce the mimicking AD for 4 successive weeks (SW; Group III: normal control group treated with baicalein (5 mg/kg for 2 SW followed by combination of baicalein and AlCl3­ for 4 SW; Group IV: normal control group treated with baicalein (10 mg/kg for 2 SW followed by combination of baicalein and AlCl3 for 4 SW; Group V: normal control group treated with rivastigmine (0.3 mg/kg for 2 SW followed by combination of rivastigmine and AlCl3 for 4 SW. Moreover, the therapeutic groups are as follows: Group VI: AD disease control treated with AlCl3 for 4 SW and serving as the therapeutic positive group; Group VII: AD disease control + baicalein (5 mg/kg for 12 SW; Group VIII: AD disease control + baicalein (10 mg/kg for 12 SW; Group IX: AD disease control + rivastigmine (0.3 mg/kg for 12 SW. Behavioral test, T-maze, and rotarod test were also performed before and after the treatment. At the end of the experimental study, all the rats were sacrificed and their brains were removed and divided into two portions. The first portion was homogenated for estimating the level of acetylcholinesterase (AchE and acetylcholine (Ach. Another portion was used

  19. VizieR Online Data Catalog: Chemical properties of red MSX sources (RMSs) (Yu+, 2016)

    Yu, N.; Xu, J.

    2017-05-01

    Our molecular line data come from the Millimetre Astronomy Legacy Team Survey at 90GHz (MALT90) (e.g., Foster+ 2011, J/ApJS/197/25; Jackson+ 2013PASA...30...57J). This project is performed with Mopra, a 22m single-dish radio telescope located near Coonabarabran in New South Wales, Australia. The angular resolution of Mopra is 38", with a beam efficiency between 0.49 at 86GHz and 0.42 at 115GHz. The pointing accuracy of the main MALT90 maps is about 8", and the absolute flux uncertainty is in the range of 10%-17% depending on the transition in question. The target clumps of this survey are selected from the 870um Atacama Pathfinder Experiment (APEX) Telescope Large Area Survey of the Galaxy (ATLASGAL; Schuller+ 2009A&A...504..415S; Contreras+ 2013, J/A+A/549/A45; superseded by J/A+A/568/A41). Using Australia Telescope Compact Array (ATCA), Urquhart+ (2007, J/A+A/461/11) observed radio emissions of 826 Red Midcourse Space Experiment (MSX) Sources (RMSs) in the southern sky. We also have checked our sources with the data taken from the Sydney University Molonglo Sky Survey (SUMSS) carried out at 843MHz with the Molonglo Observatory Synthesis Telescope (MOST; Mauch+ 2003, VIII/81). See section 2 for further explanations. (5 data files).

  20. Yu-Shiba-Rusinov states in phase-biased superconductor-quantum dot-superconductor junctions

    Kirsanskas, Gediminas; Goldstein, Moshe; Flensberg, Karsten

    2015-01-01

    supercurrent, and the differential conductance as measured by a normal-metal tunnel probe. In absence of a phase difference only one linear combination of the superconductor lead electrons couples to the spin, which gives a single YSR state. With finite phase difference, however, it is effectively a two...

  1. A New Book: Minnegulov Kh.Yu. Kazan-Tatar Turkological School

    A.V. Aksanov

    2016-12-01

    Full Text Available This book describes the history and current state of the Kazan-Tatar Turkological school. Its author analyzes the development of global and domestic Turkology, points out interrelations between various academic centers and specifies the convention of their separation. According to him, the Tatars played a significant role in the development of the Russian Oriental studies, since already from the 18th century, they collaborated with leading Russian Orientalists. The establishment of the University of Kazan in 1804 was a milestone in the development of Kazan School of Turkic Studies. The 1820–50s were a time of the highest development of Oriental studies in the University of Kazan. In addition to personnel training, the University created textbooks, dictionaries, scholarly works, collected manuscripts and established extensive international contacts. Soviet and modern periods were mainly related to the development of the historical and philological direction within the walls of educational institutions and the University of Kazan. In 2011, their Tatar faculties were united into the Institute of Philology and Arts of Kazan Federal University. Formation and development of the history of Tatar literature as an independent branch of literary science became one of the most important achievements of this stage. Great work on the collection, publication and study of Tatar folklore done in the last century was another important achievement.

  2. *Corresponding author. E-mail: m_ghaedi@mail.yu.ac.ir

    a

    content in real samples such as tap water, wastewater and a synthetic water sample ... KEY WORDS: Copper(II), Solid phase extraction, Activated carbon, Flame atomic ... ability to adsorb organic compounds and organic metal complexes as ...

  3. Complete genome sequence of Calditerrivibrio nitroreducens type strain (Yu37-1T)

    Pitluck, Sam [Joint Genome Institute, Walnut Creek, California; Sikorski, Johannes [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Zeytun, Ahmet [Los Alamos National Laboratory (LANL); Lapidus, Alla L. [Joint Genome Institute, Walnut Creek, California; Nolan, Matt [Joint Genome Institute, Walnut Creek, California; Lucas, Susan [Joint Genome Institute, Walnut Creek, California; Hammon, Nancy [Joint Genome Institute, Walnut Creek, California; Deshpande, Shweta [Joint Genome Institute, Walnut Creek, California; Cheng, Jan-Fang [Joint Genome Institute, Walnut Creek, California; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Liolios, Konstantinos [Joint Genome Institute, Walnut Creek, California; Pagani, Ioanna [Joint Genome Institute, Walnut Creek, California; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [Joint Genome Institute, Walnut Creek, California; Palaniappan, Krishna [Joint Genome Institute, Walnut Creek, California; Hauser, Loren John [ORNL; Chang, Yun-Juan [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Detter, J. Chris [Joint Genome Institute, Walnut Creek, California; Brambilla, Evelyne-Marie [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Ngatchou, Olivier Duplex [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Spring, Stefan [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Woyke, Tanja [Joint Genome Institute, Walnut Creek, California; Bristow, James [Joint Genome Institute, Walnut Creek, California; Eisen, Jonathan [Joint Genome Institute, Walnut Creek, California; Markowitz, Victor [Joint Genome Institute, Walnut Creek, California; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [Joint Genome Institute, Walnut Creek, California; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Land, Miriam L [ORNL

    2011-01-01

    Calditerrivibrio nitroreducens Iino et al. 2008 is the type species of the genus Calditerrivibrio. The species is of interest because of its important role in the nitrate cycle as nitrate reducer and for its isolated phylogenetic position in the Tree of Life. Here we describe the features of this organism, together with the complete genome sequence and annotation. This is the third complete genome sequence of a member of the family Deferribacteraceae. The 2,216,552 bp long genome with its 2,128 protein-coding and 50 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  4. Yu šien yuan cha dzu czha t šia lie kutí

    Chen, W.; Křížek, Michal

    2009-01-01

    Roč. 39, č. 15 (2009), s. 159-194 ISSN 1000-0984 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional research plan: CEZ:AV0Z10190503 Keywords : uniform partition * superconvergence * Céa's lemma Subject RIV: BA - General Mathematics

  5. Tong and Yu et al., Afr J Tradit Complement Altern Med. (2016) 13(1 ...

    PROF ADEWUNMI

    Serial dilution was undertaken using sterile distilled water and the inoculated normal saline. ... A multiple disc containing the antibiotics was placed on the surface of the agar. The multi ... sanitary risk there may be by hand contact with patients.

  6. Xinjiang Keji Rencai dui Chuangxin Huanjin de Neiyin Pingjia Moxing Goujian yu Shizheng Yanjiu

    Tan, Chunping; Tang, ChaoYing; Jiannong, Shi

    2015-01-01

    Innovation environment is the key factor to give full play to the dynamic role of the scientific talents. The article has investigated and analyzed the environmental factors and the degree of satisfaction of Xinjiang scientific talents in innovation activities by implicit theory, and structured...

  7. Analysis of Psychological Growth of the Main Character in Chenlun by Yu Dafu

    Xuc Lin

    2008-05-01

    Full Text Available Article discusses the psychological aspect of the main character in the novel “Chen Lun”. The feelings of inferiority and loneliness are his initial mental states. The latter is caused by two factors: the social and personality factors while the former is caused by the political condition in China at that time and the fact that the Japanese underestimate the Chinese people. The writer uses Freud’s theory on the structure of personality and conflict, anxiety, and the defense mechanism to analyze the process of the psychological development of the main character. In the end of the story, the main character commits suicide since “he” cannot only solve the problem of his loneliness and inferiority but also he feels guilty of his wrongdoing which crushes his-ideal-self. The guilty feeling haunts him in such a way that he even denies himself.

  8. Ozhirenie sredi bol'nykh, obrativshikhsya za meditsinskoy pomoshch'yu (dannye krupnogo otechestvennogo epidemiologicheskogo issledovaniya

    2009-06-01

    Full Text Available Research objective: to study obesity among 10541 patients in therapeutic, neurologik and cardiologikal practices in 29 cities of the Russian Federation from St.-Petersburg to Vladivostok (COMPASS program. All patients are divided on two groups: with obesity (average BMI=33,7+4,1 kg/m2, and without this disease (average BMI=24,4+3,0 kg/m2. Groups were compared under demographic characteristics; features of a medical route; somatic and mental state. 20% from all patients in mentioned practices in various cities of Russia have obesity. Patients with obesity are predominantly women (middle age 54,0+12,0 year. For these patients low social and economic status (with low educational level, absence of employment, loneliness etc. are characteristic. Patients with obesity are more often observe in cardiological practice. They suffer from cardiovascular diseases and type 2 diabetes. The hypothesis about obesity formation within mental disorders (depression, food addiction - dependence on food is presented. Possibility of treatment of patients with the help of sibutramine is discussed.

  9. Yu et al., Afr J Tradit Complement Altern Med., (2017) 14 (6): 1-9

    MC SYSTEM

    10.21010/ajtcam.v14i6.1. 1 .... Sigma-Aldrich Chemical Co. (St. Louis, MO, USA). Bornyl acetate ... For the precision of the developed method, the prepared samples were analyzed for six replicates within one day, and calculated relative standard ...

  10. Yu et al., Afr J Tradit Complement Altern Med. (2013) 10(6):551-554 ...

    cadewumi

    the cell survival rate was calculated according to the following formula: Cell survival rate = (OD value of the experimental group - OD value of the blank control group) / (OD value of the control group - OD value of the blank control group) x 100%. Four replicate wells were set up for each concentration at each time point, the ...

  11. An enhanced security solution for electronic medical records based on AES hybrid technique with SOAP/XML and SHA-1.

    Kiah, M L Mat; Nabi, Mohamed S; Zaidan, B B; Zaidan, A A

    2013-10-01

    This study aims to provide security solutions for implementing electronic medical records (EMRs). E-Health organizations could utilize the proposed method and implement recommended solutions in medical/health systems. Majority of the required security features of EMRs were noted. The methods used were tested against each of these security features. In implementing the system, the combination that satisfied all of the security features of EMRs was selected. Secure implementation and management of EMRs facilitate the safeguarding of the confidentiality, integrity, and availability of e-health organization systems. Health practitioners, patients, and visitors can use the information system facilities safely and with confidence anytime and anywhere. After critically reviewing security and data transmission methods, a new hybrid method was proposed to be implemented on EMR systems. This method will enhance the robustness, security, and integration of EMR systems. The hybrid of simple object access protocol/extensible markup language (XML) with advanced encryption standard and secure hash algorithm version 1 has achieved the security requirements of an EMR system with the capability of integrating with other systems through the design of XML messages.

  12. Noise and vibration reduction technology in hybrid vehicle development; Hybrid sha kaihatsu ni okeru shindo soon teigen gijutsu

    Yoshioa, T.; Sugita, H. [Toyota Motor Corp., Aichi (Japan)

    2000-03-01

    Accomplishing both environmental protection and good NVH performance has become a significant task in automotive development The first-in-the-world hybrid passenger car of mass production. 'Prius', has achieved superior NV performance compared with conventional vehicles with a 1.5-liter engine along with 50% reduction of fuel consumption and CO{sub 2} emissions. low HC, CO and NO{sub x} emissions. This paper describes NV reduction technology for solving problems peculiar to the hybrid vehicle such as engine start/stop vibration, drone noise at low engine speed and motor/generator noise and vibration. It also mentions application technology of low rolling resistance tires with light weight wheels and recycled material for sound proofing. (author)

  13. Supply of carbon fiber for a natural gas car tank; Tennen gasu sha tanku muke tanso seni no kyokyu

    NONE

    1998-10-31

    Mitsubishi Rayon shared investment with the Dynatech Company in Canada to produce carbon fiber tanks used in natural gas cars, and attempted to monopolize the supply of carbon fibers for tanks. As for the natural gas automobile with low air pollution and exhaust of carbon oxide compared to gasoline automobile, a heavy CNG tank is the bottleneck of its popularization, and its weight could be reduced to one fourth of a steel tank by using carbon fibers. In Japan, only steel tank has been licensed until now. Selling will be increasing in Japan by the co-operation with the Dynatech Company since this carbon fiber can be used from this April. (translated by NEDO)

  14. Multi-channel recording of a pulse spectrum on the screen of a Williams tube used with a ferrite memory analyser; Enregistrement du spectre d'impulsion sur l'ecran d'un tube de Williams au moyen d'un analyseur multicanal a memoire en ferrite; Zapis' spektra impul'sov na ehkrane ehlektronno-luchevoj trubki mnogokanal'nogo analizatora s ferritovoj pamyat'yu; Registro multicanal del espectro de los impulsos en la pantalla del tubo electronico, en un analizador con memoria de ferrita

    Rumler, Shtirad [Institut Yadernogo Issledovannya Chekhoslovatskoj Akldemii Nauk, Rzhezh Chekhoslovatskaya Sotsialisticheskaya Respublika (Czech Republic)

    1962-04-15

    promedio de impulsos es reducido. La causa reside en el dispositivo descifrador de la informacion leida en el canal directamente a partir de los circuitos sumadores y de los circuitos direccionales con registro inmediato en la pantalla. La ineptitud del registro inmediato es debida al bajo promedio y al tiempo estadistico de distribucion de los impulsos. El dispositivo propuesto resulta mas eficaz en este caso porque la calidad del registro no depende de la forma del espectro ni de la velocidad del recuento de los impulsos. Se utiliza este dispositivo en un analizador de 256 canales con una memoria de ferrita cuyo tiempo muerto es igual a 15 {mu}s. Los ciclos de la representacion oscilografica alternan periodicamente, con una frecuencia de repeticion de 50 Hz, con el ciclo de analisis del espectro medido. El tiempo de inscripcion del oscilografo es aproximadamente igual a 4 ms, es decir, un 20 por ciento de la duracion ordinaria del ciclo de trabajo del analizador. En analizadores cuyo numero de canales es menor y el tiempo muerto de memoria es mas corto, el tiempo del registro oscilografico representa apenas un pequeno porcentaje de la duracion del ciclo de. trabajo del analizador. (author) [Russian] V doklade budet opisana blok-skhema programmnykh tsepej, pozvolyayushchikh osushchestvlyat' mnogokanal'nuyu zapis' vozrastayushchego spektra anali- ziruemykh IMPUL'SOV na ehkrane ehlektronno-luchevoj trubki, v kombinatsii so staticheskoj ferritovoj pamyat'yu. Obshcheprinyatye sposoby neposredstvennoj zapisi na ehlektronno-luchevoj trubke yavlyayutsya v nekotorykh sluchayakh nesovershennymi v analizatorakh ukazannogo tipa. Zapis' okazyvaetsya nedostatochno chetkoj osobenno pri analize vremennykh ''kaskadov'' impul'sov s nizkoj chastotoj povtoreniya i s nizkim srednim chislom impul'sov. Prichinoj yavlyaetsya deshifrovka otchityvaemoj informatsii v kanale pryamo iz summiruyushchikh tsepej i iz adresnykh tsepej s neposredstvennoj zapis'yu na ehkrane. Neprigodnost

  15. Redescription of Paraleptus chiloscyllii Yin et Zhang, 1983 (Nematoda: Physalopteridae) from the Arabian carpetshark Chiloscyllium arabicum (Chondrichthyes: Hemiscylliidae) off Iraq

    González-Solís, David; Ali, A. H.

    2015-01-01

    Roč. 60, č. 4 (2015), s. 759-766 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Arabian Gulf * elasmobranchs * nematode Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.293, year: 2015

  16. Spin-Resolved Photoemission on Anti-Ferromagnets: Direct Observation of Zhang-Rice Singlets in CuO

    Tjeng, L.H.; Sinkovic, B.; Brookes, N.B.; Goedkoop, J.B.; Hesper, R.; Pellegrin, E.; Groot, F.M.F. de; Altieri, S.; Hulbert, S.L.; Shekel, E.; Sawatzky, G.A.

    1997-01-01

    We demonstrate that it is possible to obtain spin-resolved valence band spectra with a very high degree of spin polarization from antiferromagnetic transition metal materials if the excitation light is circularly polarized and has an energy close to the cation 2p3/2 (L3) white line. We are able to

  17. The Eddington Ratio of H2O Maser Host AGN Q. Guo1, J. S. Zhang2 ...

    tion rate and on the efficiency for converting gravitational energy into radiation. The. Eddington ratio, i.e., ratio of the bolometric luminosity and Eddington luminosity, is very important to constrain predictions of theoretical models. Observations demon- strate that most of the H2O maser spots are located in the nuclear region ...

  18. [On the "Brain is the House of Yuanshen" in "Bencao Gangmu"; from Li Shizhen to Zhang Xichun].

    Okuno, Shigeo

    2011-03-01

    The phrase the "Brain is the House of Yuanshen" is used in "Bencao Gangmu" in order to explain the reason why magnolia flower is good for sinus problems; however, the ideas on the relationship between the brain and the nose originate from "Huangdi Neijing" and those on the relationship between the brain and Yuanshen come from Taoism. It was "Bencao Beiyao" that combined the theory with the Western idea that "someone's memory is in the brain". The idea of the brain staying on as memory had great impact on "Leizheng Zhicai" and "Yilin Gaicuo", but again in "Yixue Zhongzhong Sanxilu" it claimed that "Yuanshen is in the brain" from Taoism's point of view, and it criticized the theory of the brain derived from the Western world. In this paper, the meaning of "Brain is the House of Yuanshen" in "Bencao Gangmu" is examined, along with the influence this idea had on the subsequent theories of medicine.

  19. Maintenance of Glucose Homeostasis Through Acetylation of the Metabolic Transcriptional Coactivator PGC1-alpha

    2011-02-01

    Salmenniemi, U., Ruotsalainen, E., Pihlajamaki, J., Vauhkonen, I., Kai - nulainen, S., Punnonen, K., Vanninen, E., and Laakso, M. (2004). Mul- tiple...cancer: a dawn for evolutionary medicine. Annu. Rev. Genet. 39, 359–407. Wang, Y.X., Zhang, C.L., Yu , R.T., Cho, H.K., Nelson, M.C., Bayuga- Ocampo...calorie diet, Nature 444 (2006) 337–342. [19] J.M. Wu, Z.R. Wang, T.C. Hsieh , J.L. Bruder, J.G. Zou, Y.Z. Huang, Mechanism of cardioprotection by

  20. miR-139-5p regulates proliferation, apoptosis, and cell cycle of uterine leiomyoma cells by targeting TPD52

    Chen,Hong; Xu,Hong; Meng,Yugang; Zhang,Yun; Chen,Junying; Wei,Xiaoning

    2016-01-01

    Hong Chen,1 Hong Xu,1 Yu-gang Meng,1 Yun Zhang,2 Jun-ying Chen,1 Xiao-ning Wei1 1Department of Gynaecology, The First Affiliated Hospital of Guangxi Medical University, Nanning, Guangxi, 2Department of Gynaecology, The People’s Hospital of Suzhou High Tech District, Suzhou, Jiangsu, People’s Republic of China Background: Uterine leiomyoma is one of the most common benign tumors in women. It dramatically decreases the quality of life in the affected women. However, there ...

  1. Diet-derived microRNAs: unicorn or silver bullet?

    Witwer, Kenneth W; Zhang, Chen-Yu

    2017-01-01

    In ancient lore, a bullet cast from silver is the only effective weapon against monsters. The uptake of active diet-derived microRNAs (miRNAs) in consumers may be the silver bullet long sought after in nutrition and oral therapeutics. However, the majority of scientists consider the transfer and regulation of consumer's gene activity by these diet-derived miRNAs to be a fantasy akin to spotting a unicorn. Nevertheless, groups like Dr. Chen-Yu Zhang's lab in Nanjing University have stockpiled breathtaking amounts of data to shoot down these naysayers. Meanwhile, Dr. Ken Witwer at John Hopkins has steadfastly cautioned the field to beware of fallacies caused by contamination, technical artifacts, and confirmation bias. Here, Dr. Witwer and Dr. Zhang share their realities of dietary miRNAs by answering five questions related to this controversial field.

  2. FY 1999 Report on overseas geological structure surveys. Joint Japan-China Yu Xian exploitation project (Attachments); 1999 nendo kaigai chishitsu kozo nado chosa futai shiryo. Nippon Chugoku sekitan kyodo tansa Yu Xian project

    NONE

    2000-03-01

    This reports provides the attachments for the report JN0041264. The contents include (1) minutes of the fourth steering committee, (2) technical reports presented to the fourth steering committee (I: report on FY 1998 joint exploitation works, and II: report on FY 1999 joint exploitation works), (3) minutes of the fifth steering committee, and (4) technical reports presented to the fifth steering committee (I: report on FY 1999 joint exploitation works, and II: report on planned FY 2000 joint exploitation works). The item (1) includes approval of the reports on FY 1998 and 1999 joint exploitation works. The item (2)-I report includes seismic exploitation test works, observation work results and quality evaluation thereof; drilling exploitation work results, quality evaluation thereof, exploitation results and evaluation thereof; exploitation results and evaluation thereof; and proposals. The item (2)-II report includes seismic exploitation, drilling exploitation, and man-hours of the workers from the both countries. The item (3) includes approval of the reports on FY 1999 joint exploitation works and planned FY 2000 joint exploitation works. The (4)-I report includes seismic exploitation work results and evaluation thereof, seismic exploitation test works, drilling exploitation work results, quality evaluation thereof, exploitation results and evaluation thereof, and proposals for the future works. The (4)-II report includes seismic and drilling exploitation plans, and numbers and periods of the workers from the both countries. (NEDO)

  3. About the article by M.A. Goncharov, Yu.N. Raznitsin, Yu.V. Barkin «SPECIFIC FEATURES OF DEFORMATION OF THE CONTINENTAL AND OCEANIC LITHOSPHERE AS A RESULT OF THE EARTH CORE NORTHERN DRIFT»

    Yuri G. Leonov

    2012-01-01

    Full Text Available The review summary states that studies of the hierarchical subordination of geodynamic systems is top in the scientific agenda, and researches of orientation of the Earth’s surface deformation structures in relation to the elements of the stress field are important. It is noted that the proposed classification of geological objects by ranks is ambiguous, and there is a need for a geodynamic model to provide a basis for studying relationships between the fields of forces, stresses and strains on the surface and processes which take place deep in the core and mantle of the Earth.

  4. Response to Dr Yu's paper: A survey of radon properties in underground railway stations in Hong Kong

    Frommer, G.

    1996-01-01

    This letter criticizes the results of a radon survey performed in underground railway stations in Hong Kong. The authors of the survey concluded that the radon dose received by the night time maintenance worker is not insignificant. However, it is the opinion of the Mass Transit Railway Corporation that this radon dose value is at best a crude estimate based on a limited number of non-representative short-term radon measurements. (UK)

  5. «The Light Thaw» at times of P.Yu. Shelest: myth or reality?

    V. V. Ivanenko

    2016-06-01

    The central point of the issue is the phenomenon of «ukrainofilstvo» (the utmost love to Ukraine, which this outstanding but controversial official kept to. We specifically study the essence, components and consequences of the historical process known as «the light thaw» of P. Shelest. This process was particularly obvious in very concrete though discrepant steps done by the official towards Ukrainian national interests and rights protection. Among the priorities were the basics of the Ukrainian identity, such as the language, education and culture. As a devoted communist, a supporter of the Soviet Union’s «brotherhood» and a determined bearer of the communist ideas and ideals (especially in the struggle against dissidence, the Ukrainian leader, at the same time, opposed as he could the Kremlin dictatorship in particular segments of humanitarian and economical policy. It partly prevented extensive implementation of the Russian language, which had a tendency to substitute Ukrainian (the process of Russification, as well as resisted to total destruction of the Ukrainian national landscape uniqueness for the sake of Moscow’s political and ideological pressure. Simultaneously we stress, that existing myths about «autonomy», «national communism» or the program of the so called «second Ukrainisation» of P. Shelest are not proved by documents, which means these facts do not correspond to the real state of events at the mentioned historical period.

  6. VizieR Online Data Catalog: UY UMa and EF Boo compiled time of minima (Yu+, 2017)

    Yu, Y.-X.; Zhang, X.-D.; Hu, K.; Xiang, F.-Y.

    2017-11-01

    In order to construct the (O-C) diagram to analyze the period change of UY UMa, we have performed a careful search for all available times of light minima. A total of 76 times of light minima were collected and listed in Table 2. >From the literatures and two well-known databases (i.e., the O-C gateway (http://var.astro.cz/ocgate) and the Lichtenknecker database of the BAV (http://www.bav-astro.de/LkDB/index.php)), we have collected a total of 75 available times of light minima for EF Boo, which are summarized in Table 3. (3 data files).

  7. The Pulkovo Observatory in the last 50 years through the eyes of its Learned Secretary Yu. I. Vitinsky.

    Zhukov, V. Yu.; Soboleva, T. V.

    A solar physicist, a Pulkovo astronomer, Yury Ivanovich Vitinsky (1926-2003) was the author of 210 scientific papers known in both Russia and abroad. He worked in the Observatory for about half a century (1953-2002) and held the office of the Learned Secretary of the Russian Academy of Sciences Main Astronomical Observatory for 35 years (1965-2000). In the last years of his life, Vitinsky brought his recollections that he titled "My Pulkovo" to the Main Astronomical Observatory Archive. His memoirs narrate about problems of the astronomical science, staff members and deeds of Pulkovo, things he thought of an events he was through. This is the half-a-century history of the Pulkovo Observatory in biographies of persons. The writer of the Recollections mentions the names of fifty persons most of whom are the Main Astronomical Observatory staff members that he worked with side by side. The memoirs provide accurate descriptions that are brief yet rather capacious of the author's Pulkovo colleagues, as well as other astronomers. The language of Vitinsky's recollection is good and clear. His memoirs contain moderate balanced views of people and events and provide objective and trustworthy data. "My Pulkovo" is an indispensable biographical source for the historian of the astronomical science, the Pulkovo Observatory and its scholarly staff members of the most recent decades. It is also just an interesting human document. In 2006, Yury Ivanovich would have been eighty.

  8. Crude oil pricing in Asia and future problems; Asia no gen`yu pricing to kongo no kadai

    Kato, T. [The Institute of Energy Economics, Tokyo (Japan)

    1997-01-30

    This paper describes pricing factors of crude oil for Asia and future problems. Price of the Middle East crude oil for Asia is determined by linking the spot price of Dubayy crude oil using as a marker. Factors affecting the pricing of marker crude oil include the information dispatching functions for prices of spot market and paper market of marker crude oil, the presence of competitive crude oil, and the correlation between market of oil products and price of crude oil. The paper market of Dubayy crude oil with a small scale of trading provides poor impact and transparency. In Asia, there is no strong competitive crude oil except the Middle East crude oil. There is only a weak price linking between crude oil and products. These are the background that the price of Middle East crude oil stays at the high level and the price adjusting functions are hard to work. The marker crude oil should be changed to another except Dubayy crude oil, and information should be dispatched from purchasers based on the stable standard crude oil. The real paper market should be created, and the force of speaking to oil producing countries should be enhanced by concentrating forces of major oil consuming countries in Asia. It is necessary to find out competitive crude oils. 5 figs., 6 tabs.

  9. Development of fuel economy 5W-20 gasoline engine oil; Teinenpi 5W-20 gasoline engine yu no kaihatsu

    Akiyama, K; Ueda, F; Kurono, K; Kawai, H; Sugiyama, S [Toyota Motor Corp., Aichi (Japan)

    1997-10-01

    A 5W-20 gasoline engine oil which improves vehicle fuel efficiency by more than 1.5% relative to a conventional 5W-30 gasoline engine oil was newly developed. Its high fuel economy performance lasts 10,000 km. The viscosity was optimized to satisfy both fuel economy and antiwear performances. Thiadiazole was used to retain the initial fuel economy performance provided by MoDTC. 5 refs., 7 figs., 2 tabs.

  10. Evaluation of waste concrete road materials for use in oyster aquaculture : [research summary].

    2013-02-01

    The Maryland State Highway Administration (SHA) has a commitment to : maintaining at least 84 percent of the SHA pavement network in : acceptable overall condition. The SHA also intends to increase the use of : recycled materials and to use products ...

  11. Mental Health Inequalities in Adolescents Growing Up in Post-Apartheid South Africa: Cross-Sectional Survey, SHaW Study.

    Das-Munshi, Jayati; Lund, Crick; Mathews, Catherine; Clark, Charlotte; Rothon, Catherine; Stansfeld, Stephen

    2016-01-01

    South Africa is one of the most 'unequal' societies in the world. Despite apartheid ending more than 20 years ago, material inequalities remain interwoven with ethnic/racial inequalities. There is limited research on the prevalence/predictors of common mental disorders (CMD) among young people. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa. Cross-sectional associations of race/ethnicity and material disadvantage with CMD and Post Traumatic Stress Disorder (PTSD) were assessed in a stratified random sample representative of school-attendees, aged 14-15 years, in a large metropolitan area of Cape Town. Validated instruments assessed mental disorders; these included: Harvard Trauma Questionnaire (PTSD); Short Moods and Feelings Questionnaire (depression); Zung self-rated anxiety scale (anxiety). Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys. Response rate was 88% (1034 of 1169 individuals). Adolescents experienced a high prevalence of depression (41%), anxiety (16%) and PTSD (21%). A gradient between material disadvantage and CMD/ PTSD was evident across all ethnic/racial groups. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk (RR) of CMD in black children was 2.27 (95% CI:1.24, 4.15) and for PTSD was RR: 2.21 (95% CI:1.73, 2.83). Relative risk of CMD was elevated in children self-identifying as 'coloured' (RR: 1.73, 95% CI:1.11, 2.70). Putative mediators (violence, racially motivated bullying, social support, self-esteem) partially accounted for differences in CMD and fully for PTSD. Adolescent mental health inequalities in Cape Town are associated with material disadvantage and self-identification with historically disadvantaged groups.

  12. Presentation of electric motor and motor control technology for electric vehicles and hybrid vehicles; Denki jidosha hybrid sha yo motor oyobi motor seigyo gijutsu no shokai

    Matsudaira, N.; Masakik, R.; Tajima, F. [Hitachi, Ltd., Tokyo (Japan)

    1999-02-01

    The authors have developed a motor drive system for electric vehicles and hybrid vehicles. This system consists of a permanent magnet type synchronous motor, an inverter using insulated gate bipolar transistors (IGBTs) and a controller based on a single-chip microcomputer. To achieve a compact and light weight synchronous motor, an internal permanent magnet type rotor structure was designed. This paper presents motor control technology for electric vehicles, such as an optimization method of field weakening control and a new current control method. (author)

  13. Fa-fa-fa-fa, de doo doo doo, de da da da, sha la la la lee : What is the optimal syllable in improvised singing?

    van Eerten, Laura; Gilbers, Dicky; Lowie, Wander; Kager, René; Grijzenhout, Janet; Sebregts, Koen

    2014-01-01

    The aim of this paper is to describe and account for the optimal syllable structure in improvised singing without lyrics. Improvised singing has an overall relaxed character and it is abstracted from meaning. Furthermore, singing in general involves an exaggerated articulation of speech sounds.

  14. Advanced meet-in-the-middle preimage attacks: First results on full tiger, and improved results on MD4 and SHA-2

    Guo, Jian; Ling, San; Wang, Huaxiong

    2010-01-01

    -specific techniques, we use a number of conceptually new ideas that are applicable to a larger class of constructions. Among them are (1) incorporating multi-target scenarios into the MITM framework, leading to faster preimages from pseudo-preimages, (2) a simple precomputation technique that allows for finding new...

  15. Depressive Symptoms, Falls, and Fear of Falling in Old Korean Adults: The Korean Longitudinal Study on Health and Aging (KLoSHA).

    Park, Y; Paik, N-J; Kim, K W; Jang, H-C; Lim, J-Y

    2017-01-01

    Fall is a common cause of disability and death in old adults, and much research has been focused on identifying risk factors and developing preventive measures. Yet the majority of preceding research has been focused on physical performance. This study aims to evaluate the association between fall and depressive symptoms in community-dwelling elderly. Cross-sectional data of 431 men and 546 women was collected from old Korean adults living in Seongnam, Korea. Geriatric fall assessment was conducted by self-report questionnaires. Depressive symptoms were assessed by the Center for Epidemiologic Studies Depression Scale. Results indicated that depressive symptoms were associated with both fall and fear of falling in old adults. A clear gender difference was newly discovered, as depression played a stronger role in women. These results imply that clinicians should consider the negative affect of geriatric patients when assessing fall risk. Also, measures against depression might be effective in reducing falls.

  16. Mental Health Inequalities in Adolescents Growing Up in Post-Apartheid South Africa: Cross-Sectional Survey, SHaW Study.

    Jayati Das-Munshi

    Full Text Available South Africa is one of the most 'unequal' societies in the world. Despite apartheid ending more than 20 years ago, material inequalities remain interwoven with ethnic/racial inequalities. There is limited research on the prevalence/predictors of common mental disorders (CMD among young people. Adolescence is a unique time-point during which intervention may lead to improved mental health and reduced social problems later. The study objective was to assess mental health disparities in a representative sample of adolescents growing up in South Africa.Cross-sectional associations of race/ethnicity and material disadvantage with CMD and Post Traumatic Stress Disorder (PTSD were assessed in a stratified random sample representative of school-attendees, aged 14-15 years, in a large metropolitan area of Cape Town. Validated instruments assessed mental disorders; these included: Harvard Trauma Questionnaire (PTSD; Short Moods and Feelings Questionnaire (depression; Zung self-rated anxiety scale (anxiety. Self-ascribed ethnicity was determined using procedures similar to the South African census and previous national surveys.Response rate was 88% (1034 of 1169 individuals. Adolescents experienced a high prevalence of depression (41%, anxiety (16% and PTSD (21%. A gradient between material disadvantage and CMD/ PTSD was evident across all ethnic/racial groups. Respondents self-identifying as 'black' or 'coloured' were disadvantaged across most indicators. After adjusting for confounders, relative to white children, relative risk (RR of CMD in black children was 2.27 (95% CI:1.24, 4.15 and for PTSD was RR: 2.21 (95% CI:1.73, 2.83. Relative risk of CMD was elevated in children self-identifying as 'coloured' (RR: 1.73, 95% CI:1.11, 2.70. Putative mediators (violence, racially motivated bullying, social support, self-esteem partially accounted for differences in CMD and fully for PTSD.Adolescent mental health inequalities in Cape Town are associated with material disadvantage and self-identification with historically disadvantaged groups.

  17. Qanun raqam 68 li-sanat 1968 fi sha'n al-ta'lim al-am (Law No. 68 of 1968 Concerning General Education).

    United Arab Republic.

    This document is an English-language abstract (approximately 1,500 words) of a law passed by the UAR legislation covering elementary, preparatory, and secondary education. This law covers general regulations common to all three stages of education, the objectives of which are defined as the general intellectual, physical, moral, civic and national…

  18. DISCOVERY AND RESEARCH ON JIAHU BONE FLUTES IN WUYANG, CHINA.

    JUZHONG, Z.; HARBOTTLE, G.; XINGHUA, X.; CHANGSUI, W.

    2000-11-01

    The site of Jiahu is located in Jiahu village, Wuyang County, Henan province, on the Western edge of the broad plain of Huanhuaihai. On its north the site borders the Sha River, in the upper reaches of the Huai River; its latitude is 33{degree} 36 minutes North, longitude 113{degree} 40 minutes East, and it is 67.5 meters above sea level. Between 1983 and 1987, the Henan Cultural Relics and Archaeology Institute carried out six campaigns of excavation here, revealing an area of 2400 square meters. Except for the trial excavation in the spring of 1983, Zhang Juzhong has been in charge of all the excavations. In early May 1986, while excavating tomb 78, Zhang Juzhong and Yang Zhenwei first discovered two funerary bone flutes. They soon found other, similar bone flutes in tombs 73, 94 and 121 respectively. Mr. Zhang's attention was instantly focused on these remarkable finds. In the campaign of autumn 1986, one or two more bone flutes were discovered in each of tombs 233,273, 263 and 270. Finally, in the spring of 1987, again one or two bone flutes were found in each of the tombs 282, 363,341,411,344 and 387. Up to the end of excavation in June 1987, altogether 25 bone flutes had been found, of which 17 were complete or almost complete, 6 broken or fragmentary and 2 were half-finished examples. Among the 17 complete bone flutes, there were 14 having seven holes, one five-hole, one six-hole and one eight-hole bone flute. In particular, the bone flute M282:20 was exquisitely made, and complete. Zhang Juzhong, the discoverer of the bone flutes, researcher Pei Mingxiang, the. ex-director of the division, who came to the digging site to see the progress of the work, and their coworkers were all understandably very excited.

  19. Passing through the renal clearance barrier: toward ultrasmall sizes with stable ligands for potential clinical applications

    Zhang XD

    2014-04-01

    Full Text Available Xiao-Dong Zhang,1 Jiang Yang,2 Sha-Sha Song,1 Wei Long,1 Jie Chen,1 Xiu Shen,1 Hao Wang,1 Yuan-Ming Sun,1 Pei-Xun Liu,1 Saijun Fan11Tianjin Key Laboratory of Molecular Nuclear Medicine, Institute of Radiation Medicine, Chinese Academy of Medical Sciences and Peking Union Medical College, Tianjin, People's Republic of China; 2Department of Biological Systems Engineering, University of Wisconsin-Madison, Madison, WI, USAAbstract: The use of nanoparticles holds promise for medical applications, such as X-ray imaging, photothermal therapy and radiotherapy. However, the in vivo toxicity of inorganic nanoparticles raises some concern regarding undesirable side effects which prevent their further medical application. Ultrasmall sub-5.5 nm particles can pass through the barrier for renal clearance, minimizing their toxicity. In this letter we address some recent interesting work regarding in vivo toxicity and renal clearance, and discuss the possible strategy of utilizing ultrasmall nanomaterials. We propose that small hydrodynamic sized nanoclusters can achieve both nontoxic and therapeutic clinical features.Keywords: in vivo clearance, gold nanoparticles, small size

  20. Remarks made by Vice Premier Mr. Zhang Dejiang at the opening ceremony of the International Ministerial Conference on Nuclear Energy in the 21st Century

    Zhang Dejiang

    2009-01-01

    Nuclear science and technology is one of the greatest scientific and technological achievements of mankind in the 20th century. Nuclear science and technology is widely applied in various sectors with over 50 years of development, such as energy, industry, agriculture, health, and environment protection, and is playing an important role in prospering economy, improving people's livelihood, and promoting sustainable development. With global economic development and rising energy consumption, supply of traditional energy source is becoming more stretched and climate change is becoming an increasingly severe challenge. It is a common task of the international community to develop and utilize clean and renewable energy sources and properly address growing contradiction among economic development, energy development and environment protection. Given its advantage as clean, safe and could be applied in large scale, more and more countries are placing importance on nuclear energy. Accelerating peaceful uses of nuclear energy is the common wishes and inevitable choice of many countries. China started the development of nuclear energy in the early 1950s, and with the efforts of over half a century, China has established a relatively complete nuclear industry system. The installed capacity of nuclear power reached 9100 MWe, and nuclear power generation accounts for 2% of the national total electricity generated. Nuclear energy is playing an incremental role for China's economic development. However, nuclear energy utilization is rather insufficient in China, its development level is behind countries which are advanced in nuclear energy use such as the United States and France, the rate of nuclear power generation in the total electricity generated still falls behind the world average level. China's energy supply mix is featured by coal dominant and low proportion of clean energy. To achieve sustainable energy and socio-economic development, China has formulated the energy development strategy of active promoting energy conservation and optimizing energy. structure. Accelerating nuclear power development and enhancing the ratio of clean energy such as nuclear power in the aggregate energy supply is the priority of China's energy development strategy. Currently, peaceful use of nuclear energy has entered a stage of rapid development. A batch of new nuclear power projects are starting construction in coastal areas, and preparation for other new projects is going on in orderly manner, demonstration projects of the introduction of third generation nuclear power technology are moving on smoothly. Scientific and research engineering programs such as China experimental fast reactor, high temperature gas-cooled reactor, and thermal nuclear fusion device are in positive progress. Nuclear fuel cycle industry continues its development and the ability of assured supply of nuclear fuel is being enhanced. China has always attached great importance to nuclear safety in its promotion of nuclear energy utilization, and established a fairly complete nuclear safety legal, regulatory and emergency management system which is in line with international best practices. China has issued series of instruments such as nuclear safety regulations, rules, guidelines, standards. Independent, strict, and efficient nuclear safety supervision and management and scientific management of nuclear facility operators have been put in place to ensure safe and secure operation of nuclear facilities. All these efforts have led to sound nuclear safety record and boosted public confidence in nuclear energy

  1. Sociální zabezpečení v Číně: seminář s doc. Zhang Zhimin

    Uhde, Zuzana

    2011-01-01

    Roč. 12, č. 2 (2011), s. 106-108 ISSN 1213-0028 R&D Projects: GA ČR GAP404/10/0021 Institutional research plan: CEZ:AV0Z70280505 Keywords : China * social security * comparative analysis Subject RIV: AO - Sociology, Demography

  2. Between-Groups Study Designs Demand Between-Groups Analyses: A Response to Hernandez-Reif, Shor-Posner, Baez, Soto, Mendoza, Castillo, Quintero, Perez, and Zhang

    Christopher A. Moyer

    2009-01-01

    Full Text Available The most recent massage therapy (MT study by Hernandez-Reif et al. displays flaws persistent in this area of research that are attributable to MT researchers’ frequent mistake of using within-group analyses of dependent variables in studies that are purported to be randomized control trials. This practise violates the logic of using randomization to create treatment and control groups, and thereby fails to control for the validity threats of spontaneous remission, placebo effects, and statistical regression. The result is that a clear understanding of what MT can and cannot do is seriously hampered.

  3. Comment on “Band gaps structure and semi-Dirac point of two-dimensional function photonic crystals” by Si-Qi Zhang et al.

    Zhang, Hai-Feng

    2018-01-01

    Not Available Project supported by the Special Grade of the Financial Support from the China Postdoctoral Science Foundation (Grant No. 2016T90455), the China Postdoctoral Science Foundation (Grant No. 2015M581790), and the Chinese Jiangsu Planned Projects for Postdoctoral Research Funds, China (Grant No. 1501016A).

  4. Final report for LDRD Project 93633 : new hash function for data protection.

    Draelos, Timothy John; Dautenhahn, Nathan; Schroeppel, Richard Crabtree; Tolk, Keith Michael; Orman, Hilarie (PurpleStreak, Inc.); Walker, Andrea Mae; Malone, Sean; Lee, Eric; Neumann, William Douglas; Cordwell, William R.; Torgerson, Mark Dolan; Anderson, Eric; Lanzone, Andrew J.; Collins, Michael Joseph; McDonald, Timothy Scott; Caskey, Susan Adele

    2009-03-01

    The security of the widely-used cryptographic hash function SHA1 has been impugned. We have developed two replacement hash functions. The first, SHA1X, is a drop-in replacement for SHA1. The second, SANDstorm, has been submitted as a candidate to the NIST-sponsored SHA3 Hash Function competition.

  5. Mineralogical and chemical characterization of iron-, manganese-, and copper-containing synthetic hydroxyapatites

    Sutter, B.; Ming, D. W.; Clearfield, A.; Hossner, L. R.

    2003-01-01

    The National Aeronautics and Space Administration's (NASA) Advanced Life Support (ALS) Program is evaluating the use of Fe-, Mn-, and Cu-containing synthetic hydroxyapatite (SHA) as a slow release fertilizer for crops that might be grown on the International Space Station or at Lunar and Martian outposts. Separate Fe-, Mn-, and Cu-containing SHA materials along with a transition-metal free SHA (pure-SHA) were synthesized using a precipitation method. Chemical and mineralogical analyses determined if and how Fe, Mn, and Cu were incorporated into the SHA structure. X-ray diffraction (XRD), Rietveld refinement, and transmission electron microscopy (TEM) confirmed that SHA materials with the apatite structure were produced. Chemical analyses indicated that the metal containing SHA materials were deficient in Ca relative to pure-SHA. The shift in the infrared PO4-mu 3 vibrations, smaller unit cell parameters, smaller particle size, and greater structural strain for Fe-, Mn-, and Cu-containing SHA compared with pure-SHA suggested that Fe, Mn, and Cu were incorporated into SHA structure. Rietveld analyses revealed that Fe, Mn, and Cu substituted into the Ca2 site of SHA. An Fe-rich phase was detected by TEM analyses and backscattered electron microscopy in the Fe-containing SHA material with the greatest Fe content. The substitution of metals into SHA suggests that metal-SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P.

  6. FITTER. The package for fitting experimental data of the YuMO spectrometer by theoretical form factors. Version 1.0. Long write-up and user's guide

    Solov'ev, A.G.; Stadnik, A.V.; Islamov, A.Kh.; Kuklin, A.I.

    2003-01-01

    FITTER is a C++ code aimed to fit a chosen theoretical multi-parameter function through a set of data points. The method of fitting is chi-square minimization. Moreover, the robust fitting method can be applied. FITTER was designed for a small-angle neutron scattering data analysis, using respective theoretical models. Commonly used models (Gaussian and polynomials) are also implemented for wider applicability

  7. Can yu rid guat ay rot? A Developmental Investigation of Cross-Linguistic Spelling Errors among Spanish-English Bilingual Students

    Howard, Elizabeth R.; Green, Jennifer D.; Arteagoitia, Igone

    2012-01-01

    This study contributes to the literature on cross-linguistic literacy relationships for English language learners, and in particular, the Spanish-influenced spelling patterns of Spanish-English bilinguals. English spelling, reading, and vocabulary assessments were administered to 220 students in four TWI programs over a three-year period, from…

  8. TattooYU: Tattooed Souvenirs from the Yugoslav People’s Army and Regimes of Memory of the Body Inscribed with Socialism

    Sandi Abram

    2015-08-01

    Full Text Available The paper focuses on the first mass imprints on the body in the entire region of the former Yugoslavia, which eternally marked members of its armed forces. Through bodies permanently imprinted with socialist history and narrations of tattooed solders from the Yugoslav People’s Army (YPA, I install tattoos from YPA in-between the subversion of power and the incorporation of the dominant ideology, in the antithesis between uniformity and subjectivity. Above all, tattoos from YPA function as a mnemotechnical practice of recollection of the cultural memory, which awakens narrations and the regimes of memory as well as the regimes of memorization of the YPA, socialism and the period of (post transition. Whereas the collected ethnographical material will sustain the claims made above, the situations in which the ethnography was impossible will be discussed further. Rejection, reflex silence or refusals of collaboration are all peculiar modes through which the paper emphasises the importance of the “ethnography of absent” (Telban. In this vein, they represent a fertile springboard to discuss notions of productive oblivion (Kuljić, forgetting (Ricoeur and the “eloquent reticence”. The recollection of negative sentiments (as a way of activating the past did not only materialize in tattooees’ non-responses. Tattoos from YPA also triggered practices of extreme permanent tattoo concealment (e.g. cicatrisation, cauterization that do not fit into the classical anthropological milieu as practices of embellishment, rites of passage, strengthening the pain-tolerance threshold, etc. Instead, I see these practices as a preliminary phase of oblivion and as ways of “deideologization”. Furthermore, the paper supplements Connerton's “habitual memory” preserved in the body and conserving the past in the memory, with its material constitutional side on the body – the tattoo.

  9. The Analysis of Differences and Similarities of Eastern and Western Women’s Images in Liang Sanbo Yu Zhu Yingtai and Romeo and Juliet Novel

    Yenny Yenny

    2010-11-01

    Full Text Available Sanpek Engtay and Romeo Juliet are the two famous classic love novels from Eastern and Western countries. They are liked by many generation of eastern and western readers. Both novels describe the image of women at each decade. Engtay represents the image of women at feudalism era while Juliet represents it Renainsance era. In this article, the writer did research at education, marriage, love, women's personality, and women's position at each decade. Library research was done in this study with the purpose of letting people know the differences and similarities of women's images between those two decades It can be concluded that in both writings, they have some similarities when describing love, mindset, and women's personality. The differences are about education, marriage, and women's position at feudalism and Renainsance decades.

  10. Problems concerning abolishment of the ban on exportation of Alaskan crudeoil. Alaska gen'yu no yushutsu kaikin mondai no yukue

    1994-08-01

    The ban on exhortation of Alaska North Slope (ANS) crude oil is being vigorously discussed on its maintenance or abolishment. The Department of Energy of the U.S. published the report which emphasized merits by abolishing the ban on ANS crude-oil exporting. The American Crew Union asserts that the Union will agree to the abolishment if ANS crude oil is transported by the Johns Act ships, which mean tankers built in the U.S., having the U.S. nationality, and plied by operation of the U.S. crews. The federal government of the U.S. declares that the government will not support the abolishment unless the items to restrict the transportation within Johns Act ships are deleted. It is said that British Petroleum, the largest producer of ANS crude oil, is sounding for the method in which use of the U.S. ships and employment of the U.S. crews for the transportation are guaranteed by direct contracts with the tanker owners and crews of the U.S. In any case, employment of U.S. crews is considered to the point to realize the abolishment of the bat on exportation of ANS crude oil.

  11. Radiation defect production in quartz crystals with various structure perfectness degree; Radiatsionnoe defektoobrazovanie v kristallakh kvartsa s razlichnoj stepen`yu sovershenstva struktury

    Khushvakov, O B

    1992-01-01

    Radiation defects production processes in pure and doped quartz crystals with various structure defectness, caused by preliminary irradiation with neutrons, protons, deuterons and {alpha}-particles, during various electron excitation densities were investigated. The distribution of colour centres along the thickness of irradiated quartz crystals was measured. It was supposed that colour centres are produced on account of inelastic energy losses as the result of collective decay of two or more interacting excitons. It was shown that in quartz crystals under the actions of protons with overthreshold energy 18 MeV and electrons with subthreshold energy 100 keV the same structure defects are formed. It was established that radiation defect production process has two stages. The first stage reveals radiation defects produced by preliminary irradiation. The second one reveals additional intrinsic defects formed under the action of gamma-rays and electrons. The probability dependence of defect production on neutron fluence and masses of incident particles was studied. It was supposed that the creation of additional defects in preliminary irradiated crystals is due to non-radiative decay of electron excitations near radiation-induced defects. It was shown that increase of impurity concentration leads to rate growth of accumulation of radiation induced defects. (A.A.D.) 15 refs. 4 figs.

  12. Radiation Disinfestation of Grain and Seeds; Radiodesinsection des Cereales et des Semences; Obezzarazhivanie zerna i semyan s pomoshch'yu oblucheniya; Desinfestacion de Granos y Semillas por Irradiacion

    Golumbic, C.; Davis, D. F. [Market Quality Research Division, Agricultural Research Service, United States Department of Agriculture, Hyattsville, MD (United States)

    1966-11-15

    Current interest in radiation treatment of grain and seeds mainly revolves about its efficacy for control of insect infestations in these products. The recent literature on this subject is reviewed and gaps still existing in the fundamental and practical knowledge of radiation disinfestation.are pointed out. Research programmes in the United States Department of Agriculture that are under way, or planned for the immediate future, are discussed in detail. Current studies are being directed toward establishing minimum effective doses for sexual sterilization and mortality, influence of environmental factors on dose requirements, and potential for the development of biological resistance. In May 1966 the scope of the work expanded as a new grain products irradiator became operative and applied studies were initiated. An integral part of this, research is a study of the effect of irradiation on the quality of food and feed grains and on cereal products, at the doses for both insect control and fungal disinfection. This paper examines critically the results of research in this area and estimates future research, needs. (author) [French] A'.l'heure actuelle, l'interet que suscite le traitement par les rayonnements des cereales et des semences est du avant tout a son efficacite pour la desinsection. Les auteurs analysent les recentes publications dans ce domaine et. signalent les lacunes, qui subsistent encore dans les connaissances fondamentales ou pratiques relatives a la radiodesinsection, ' Ils examinent en detail les programmes de recherches du Departement de l'agriculture des Etats-Unis qui sont actuellement mis.en oeuvre ou projetes pour l'avenir immediat. Les etudes actuelles concernent la determination de la dose minimale necessaire pour la sterilisation sexuelle et de la dose mortelle, l'influence des facteurs ambiants sur les doses requises, et les possibilites de developpement de la resistance biologique. En mai 1966, les travaux se sont elargis a la suite de la mise en service d'une nouvelle installation d'irradiation des.cereales qui permet d'entreprendre des etudes appliquees. Ce programme comprend l'etude des effets de l'irradiation aux doses insecticides et fongicides sur la qualite des cereales destinees a la consommation humaine et animale et sur celle des produits derives. Le memoire procede a un examen critique des resultats des recherches entreprises et evalue les besoins, futurs a cet egard. (author) [Spanish] El interes que suscita el tratamiento de granos y semillas por irradiacion radica principalmente en su eficacia en la lucha contra la infestacion de esos productos por insectos. Los autores examinan las publicaciones mas recientes sobre esta cuestion y senalan las lagunas que todavia existen en los conocimientos basicos y practicos de la radiodesinfestacion. Exponen detenidamente los programas de investigacion del Departamento de Agricultura de los Estados Unidos que se estan ejecutando o que se proyecta ejecutar en un futuro inmediato. Los estudios actuales estan orientados hacia el establecimiento de valores minimos de dosis eficaces para la esterilizacion sexual y para provocar la muerte de los insectos, la influencia de los factores ambientales sobre las dosis necesarias y las posibilidades de desarrollo de una resistencia biologica. En mayo de 1966 se amplio el alcance de estos trabajos con la entrada en servicio de una nueva instalacion de cereales y derivados y se iniciaron estudios de aplicacion. Como parte integrante de esas investigaciones se lleva a cabo un estudio de los efectos de la irradiacion sobre la calidad del grano destinado a la alimentacion humana o utilizado como pienso, y sobre los productos derivados de los cereales. Esa irradiacion se efectua con las dosis que se precisan en la lucha contra los insectos y con las empleadas para la eliminacion de hongos. Los autores hacen un estudio critico de los resultados de las investigaciones que se realizan en este sector y evaluan las futuras necesidades en materia de investigacion. (author) [Russian] V nastojashhee vremja obrabotka zerna i semjan s pomoshh'ju obluchenija predstavljaet interes glavnym obrazom s tochki zrenija opredelenija ee jeffektivnosti v dele obespechenija kontrolja za zarazheniem jetih produktov parazitami. Rassmatrivaetsja sovremennaja literatura po jetomu voprosu i ukazyvajutsja vse eshhe sushhestvujushhie problemy v oblasti fundamental'nyh i prakticheskih znanij o sposobah obezzarazhivanija s pomoshh'ju obluchenija. Podrobno rassmatrivajutsja nauchno-issledovatel'skie programmy ministerstva sel'skogo'hozjajstva SShA, kotorye nahodjatsja v stadii vypolnenija ili planirujutsja na blizhajshee budushhee. Provodimye v nastojashhee vremja issledovanija napravleny na ustanovlenie minimal'nyh jeffektivnyh doz dlja polovoj sterilizacii i smertnosti, vlijanija okruzhajushhih faktorov na dozovye potrebnosti i vozmozhnosti dlja razvitija biologicheskoj soprotivljaemosti. V mae 1966 goda ob{sup e}m rabot budet rasshiren, tak kak budet vvedena v jekspluataciju novaja ustanovka po oblucheniju zernovyh produktov i nachnutsja prikladnye issledovanija. Sostavnoj chast'ju jetih nauchno-issledovatel'skih rabot javljaetsja izuchenie vlijanija obluchenija na kachestvo pishhi i furazha, a takzhe produktov iz hlebnyh zlakov pri dozah, obespechivajushhih kontrol' za parazitami i unichtozhenie gribkov. V dannom doklade kriticheski rassmatrivajutsja rezul'taty nauchno-issledovatel'skoj raboty v jetoj oblasti i opredeljajutsja potrebnosti v nauchnyh issledovanijah v budushhem. (author)

  13. The radiation age of meteorites; L'age des meteorites; Opredelenie vozrasta meteoritov s pomoshch'yu radiatsii; Edad de los meteoritos

    Goebel, K; Schmidlin, P [European Organisation for Nuclear Research, Geneva (Switzerland)

    1962-01-15

    Radioisotopes produced by cosmic radiation in meteorites while travelling through space can be used to trace the history of these meteorites. The radioisotopes and the accumulated daughter-elements in the meteorite must be determined in order to evaluate how long the meteorite was exposed to cosmic radiation. (It must be assumed for this calculation that the flux of the cosmic radiation is constant with time.) Most often gaseous isotopes have been used for these measurements as they can be easily separated from the meteoric substance. In the reported work tritium and argon have been mainly used. From the ratio H{sup 3}/He{sup 3}, radiation ages from a few millions to several hundred millions of years have been found. The recent measurements made at the European Organisation for Nuclear Research (CERN) agree in principle with results from other sources. The probable errors from diffusion-losses of gas and the influence of shielding in the pre-atmospheric meteorite are discussed in the paper. By taking into consideration the measured cross-section for tritium production in the elements which form the meteorite, the values of the cosmic-ray flux in outer space can be determined. (author) [French] Les radioisotopes produits par les rayonnements cosmiques dans les meteorites circulant dans l'espace peuvent servir a reconstituer l'histoire de ces corps. Il faut mesurer les radioisotopes et les produits de filiation accumules dans la meteorite pour evaluer le temps pendant lequel la meteorite a ete exposee aux rayonnements cosmiques. (On considere alors que le flux des rayonnements cosmiques ne varie pas dans le temps.) Pour ces mesures, on se fonde le plus souvent sur les isotopes gazeux parce qu'il est facile de les separer de la substance meteorique. Dans les recherches qui font l'objet du present memoire, il s'agissait surtout du tritium et de l'argon. En partant du rapport {sup 3}H/{sup 3}He, on a pu evaluer des ages allant de quelques millions a plusieurs centaines de millions d'armees. Les mesures recemment effectuees au C E R N concordent en principe avec les resultats auxquels ont abouti d'autres auteurs. Le memoire traite des erreurs probables qui peuvent resulter des pertes de gaz par diffusion, et de la protection dont la meteorite beneficie dans la preatmosphere. E n tenant compte de la section efficace pour la production de tritium dans les elements qui constituent la meteorite, on peut determiner les valeurs du flux des rayons cosmiques dans l'espace extra-atmospherique. (author) [Spanish] Los radioisotopos formados por la accion de los rayos cosmicos sobre los meteoritos durante el recorrido de estos a traves del espacio pueden utilizarse para reconstruir el historial de estos cuerpos. Para evaluar el tiempo durante el cual el meteorito estuvo expuesto a los rayos cosmicos, es preciso determinar cuantitativamente los radioisotopos y los elementos descendientes que se han acumulado en el mismo. (A fin de poder efectuar el calculo, hay que suponer que el flujo de rayos cosmicos ha permanecido constante en el tiempo.) Estas mediciones se basan con frecuencia en los isotopos gaseosos, y a que estos pueden separase con facilidad del resto de la materia meteoritica. E n los trabajos objeto de este informe, se han empleado principalmente el tritio y el argon. A partir de la razon {sup 3}H/{sup 3}He se han podido calcular edades que abarcan de algunos millones a varios cientos do millones de anos. Las mediciones recientemente efectuadas en el CERN concuerdan esencialmente con los resultados obtenidos por otros investigadores. Los autores discutiran los errores probables debidos a las perdidas de gases por difusion, asi como el efecto de blindaje del meteorito en su recorrido preatmosferico. Si se tienen en cuenta los valores medidos de la seccion eficaz para la produccion de tritio a partir de los elementos de que se compone el meteorito, es posible determinar el flujo de rayos cosmicos en el espacio sideral. (author) [Russian] Radioizotopy, voznikayushchie v rezul'tate kosmicheskoj radiatsii v meteoritakh vo vremya ikh dvizheniya v kosmose, mogut byt' ispol'zovany dlya togo, chtoby prosledit' istoriyu ehtikh tel. Radioizotopy i akkumulirovannye dochernie ehlementy v meteorite dolzhny byt' opredeleny dlya vyrazheniya vremeni, v techenie kotorogo meteorit podvergalsya kosmicheskoj radiatsii. (Dlya vychisleniya neobkhodimo dopustit', chto potok radiatsii yavlyaetsya postoyannym v techenie vsego vremeni). Dlya izmereniya obyknovenno ispol'zuyutsya izotopy gazov, poskol'ku oni mogut byt' legko otdeleny ot samogo meteorita. V dannom issledovanii ispol'zovany, glavnym obrazom, tritij i argon. Po koehffitsientu radiatsii H3{sup /}He{sup 3} opredelyalsya vozrast meteorita ot neskol'kikh millionov let do neskol'kikh soten let. Poslednie izmereniya v TSERNe v printsipe soglasuyutsya s rezul'tatami drugikh issledovanij. V rabote obsuzhdayutsya voprosy vozmozhnykh otklonenij vvidu diffuzionnykh poter' gaza i vliyaniya ehkranirovki v atmosfernom meteorite. Velichina potoka kosmicheskikh luchej vo vneshnem prostranstve mozhet byt' opredelena, esli prinyat' vo vnimanie zamerennoe poperechnoe sechenie produktov tritiya v ehlementakh, kotorye obrazuyut meteorit. (author)

  14. Noel Maurer and Carlos Yu.  The Big Ditch:  How America Took, Built, Ran, and Ultimately Gave Away the Panama Canal

    Joseph Michael Gratale

    2011-03-01

    Full Text Available In 1959, William Appleman Williams published The Tragedy of American Diplomacy.  It was a book that boldly set out to trace the contours of America’s imperial trajectory from the late nineteenth century to the middle of the twentieth century.  Williams’ approach to U.S. foreign policy put him in the vanguard of what would become New Left historical revisionism during the 1960s.  His reassessment of American history which in part involved his deployment of such concepts as imperialism and empi...

  15. Correction: Yu, Q., et al. Narrowband Bio-Indicator Monitoring of Temperate Forest Carbon Fluxes in Northeastern China. Remote Sens. 2014, 6, 8986-9013

    Remote Sensing Editorial Office

    2015-01-01

    Full Text Available Due to a technical error at the Editorial Office, Figure 8 of manuscript [1] is missing in the published paper. The correct version of the figure is reproduced below. We apologize for any inconvenience caused to authors or readers of Remote Sensing.[...

  16. CHARACTERISTICS OF MEI-YU PRECIPITATION AND SVD ANALYSIS OF PRECIPITATION OVER THE YANGTZE-HUAIHE RIVERS VALLEYS AND THE SEA SURFACE TEMPERATURE IN THE NORTHERN PACIFIC OCEAN

    MAO Wen-shu; WANG Qian-qian; PENG Jun; LI Yong-hua

    2008-01-01

    Based on the precipitation data of Meiyu at 37 stations in the valleys of Yangtze and Huaihe Rivers from 1954 to 2001, the temporal-spatial characteristics of Meiyu precipitation and their relationships with the sea surface temperature in northern Pacific are investigated using such methods as harmonic analysis, empirical orthogonal function (EOF), composite analysis and singular value decomposition (SVD). The results show that the temporal evolution and spatial distribution of Meiyu precipitation are not homogeneous in the Yangtze-Huaihe Rivers basins but with prominent inter-annual and inter-decadal variabilities. The key region between the anomalies of Meiyu precipitation and the monthly sea surface temperature anomalies (SSTA) lies in the west wind drift of North Pacific, which influences the precipitation anomaly of Meiyu precipitation over a key period of time from January to March in the same year. When the SST in the North Pacific west wind drift is warmer (colder) than average during these months, Meiyu precipitation anomalously increases (decreases) in the concurrent year. Results of SVD are consistent with those of composite analysis which pass the significance test of Monte-Carlo at 0.05.

  17. 平生足悲吒----論韓愈詩的憂憤悲懷/The Sadness of Life-Han Yu's Poetry of Grief and Sorrow

    Ming-chang LIN

    2012-09-01

    This paper is a study of the element of melancholy apprehension in Han Yu’s poetry. Han’s apprehension of melancholy, which up to now has received very little attention, is discussed in three aspects: (1 the fear of old age and sickness, (2 the fear of hunger and cold, and (3 the fear of death. Against the background of Han Yu’s unstable and uncertain life and career, the new reading and analysis show that melancholy lies at the very heart of his personality and writing.

  18. PRIVERZhENNOST' PROFILAKTIKE OSTEOPOROZA I VLIYaYuShchIE NA NEE FAKTORY U ZhITEL'NITs MOSKOVSKOY OBLASTI

    L A MARChENKOVA

    2014-12-01

    Full Text Available Despite high prevalence and severity of complications, osteoporosis (OP in Russia is still not recognized as a socially significant disease and there are no common standards for prevention of OP and associated fractures. The aim of the study was to investigate the adherence of healthy females to prevention measures of OP and the affecting it factors to develop the principles governing the preventive strategy of OP. Methods. The study is performed in Moscow Region (MR in a form of a questionnaire survey in the population of adult healthy women aged >20 years. The data are obtained using "Questionnaires on osteoporosis prevention" and "The test of knowledge in the field of osteoporosis" developed in Clinical Research Institution of Moscow Region named after M.F. Vladimirsky. Study comprised 1712 female aged from 20 till 87 years (median 55,0 years [45,0; 44,0] living in 16 districts and 11 cities of MR. Taking into account the quality of the filling of questionnaires, data provided by 1631 women were included in the statistical analysis. Results. It is established that 31% of female inhabitants of MR are engaged in OP prevention, using for this purpose mainly calcium-containing drugs (64,3% and increased consumption of calcium in food (59,8%. 93% of these women get preventive therapy at their own expense, spending on them on the average 200 rub a month, and preventive medication has appeared more saving than non-pharmacological preventive measures. Socially active working women at the age of 50-69 years are motivated on prevention of OP better than others. Level of the OP awareness and undertaking densitometry screening also directly influence adherence to OP prevention.

  19. Battling coal and rock dust in mines. Bor'ba s ugol'noi i porodnoi pyl'yu v shakhtakh

    Petrukhin, P.M.; Grodel, G.S.; Korenev, A.P.; Krivokhizha, B.M.; Kul' bachnyi, A.N.; Lyubimova, A.I.; Medvedev, E.N.; Yaremachenko, P.P.; Zhilyaev, N.I.

    1981-01-01

    The problems of comprehensive removal of dust from the atmosphere in mines are discussed. Physical and pnysicochemical properties of mine dust are described, which are important for estimating the processes of its formation, spread, and suppression. Presented are the results of theoretical and natural studies of dust aerodynamics of mines. Modern methods for battling coal and rock dust in mines, as well as means of monitoring the dust level of the air are outlined. Technical descriptions are given for new instruments for changing the dust level of the air. Brief reports are given on the preliminary wetting of coal in the massif, and theoretical and practical problems are discussed concerning hydrological methods of dust removal, dust suppression by foam, and dust trapping during the operation of mining equipment, and also on removal of dust from the air at the surface complex of a mine.

  20. Control of coal-dust in mines. Second edition. Bor'ba s ugol'noi i porodnoi pyl'yu v shakhtakh

    Pemrukhin, P.M.; Grodel, G.S.; Zhilyaev, N.I.; Korenev, A.P.; Krivokhizha, B.M.; Kul' bachnyi, A.N.; Lyubimoba, A.I.; Medvedev, E.N.; Yaremachenko, P.P.

    1981-01-01

    An examination is made of problems concerned with over-all removal of dust from the air in mines. A description is given of physical and physico-chemical properties of ore mine dust that are of importance to evaluating processes in the formation, propagation and suppression of dust. Results are given for theoretical and on-site studies of dust aerodynamics in mines. A presentation is made of contemporary measures for controlling coal and rock dust in mines as well as means and methods of controlling air dust-level. Technical characteristics are given for new instruments for measuring air dust level. Brief data are given on preliminary wetting of coal in a massif, and a discussion is made of theoretical and practical problems related to hydro-dedusting, dust suppression, and dust removal during the operation of mining machinery as well as instruments for dedusting air on the surface complex of a mine. The book is intended for engineering-technical personnel in coal mines, design-planning and scientific-research institutes. 52 references, 61 tables.

  1. Opyt primeneniya ingibitora angiotenzinprevrashchayushchego fermenta spiraprila u bol'nykh gipertonicheskoy bolezn'yu v sochetanii s sakharnym diabetom 2 tipa

    A F Tushova

    2008-06-01

    Full Text Available Цель. Оценка влияния иАПФ спираприла на плазменно-тромбоцитарный гемостаз, углеводный обмен и липидный профиль у больных ГБ, ассоциированной с СД 2. Материалы и методы. Под динамическим наблюдением находилось 33 больных СД 2 и ГБ (1-я ст. ? 2 (6,06%, 2-я ст. ? 9 (27,27%, 3-я ст. ? 22 (66,67% больных. Контрольную группу составили 35 больных гипертонической болезнью (1-я ст. ? 4 (11,43 %, 2-я ст. ? 14 (40 %, 3-я ст. ? 17 (48,57% без СД. Антропометрическое исследование включало измерение массы тела, объема талии (ОТ и бедер (ОБ, расчет ОТ/ОБ, индекса массы тела (ИМТ. Содержание глюкозы в крови определялось глюкозооксидазным методом в капиллярной крови натощак, через 1 и 2 часа в ходе стандартного перорального глюкозотолерантного теста с 75 г глюкозы. Исследовались липидный спект, экскреция альбумина, коагуляцинное звено гемостаза, тромбоцитарное звено гемостаза. Результаты. МАУ (экскреция альбумина >20 мг/л исходно диагностирована у 28 больных (84,85%. Через 4 недели лечения спираприлом у 93,94% больных отмечалось уменьшение уровня экскреции альбумина с мочой. У обследованных больных СД 2 с ГБ отмечены нарушения во всех звеньях гемостаза, но, в отличие от контрольной группы, были менее выражены нарушения спонтанной агрегации тромбоцитов. У больных СД с ГБ гиперкоагуляция наблюдалась преимущественно по внешнему пути свертывания крови. Заключение. У больных СД и ГБ повышен тромбогенный потенциал крови. В результате лечения спираприлом отмечена положительная динамика ? активация фибринолитической системы, снижение спонтанной агрегации тромбоцитов и нормализация в коагуляционном звене гемостаза. На фоне терапии спираприлом наблюдается улучшение показателей углеводного и липидного обмена. Спираприл обладает нефропротективным эффектом, что проявилось снижением уровня МАУ. Лечение спираприлом не влияло на динамику массы тела, ИМТ, отношения ОТ/ОБ.

  2. Study of effects of engine oil additives on the properties of fluorelastomers; Fusso gomu ni oyobosu engine yu tenkazai no eikyo chosa

    Kurono, K; Owaki, M; Suzuki, Y; Akiyama, K; Shionoya, M [Toyota Motor Corp., Aichi (Japan)

    1997-10-01

    Fluoroelastmers are well known for their resistance to heat and fluids and have become major material for crankcase oil sealers. On the other hand new additive formulations are developed for engine lubricants used for fuel economic gasoline engines. In this paper the effects of those additives on properties of fluoroelastmers are investigated. The results of the immersion tests of both test plaques and oil sealer products indicates that dithiocarbamates friction modifier have hardening effects on fluoroelastomers. The fluoroelastmer deterioration mechanism is presumed by analysis of elastmer samples after immersion in oil. 6 refs., 9 figs., 3 tabs.

  3. Comparison of long-term clinical outcome between patients with chronic versus acute type B aortic dissection treated by implantation of a stent graft: a single-center report

    Chen SL

    2013-04-01

    Full Text Available Shao-Liang Chen, Jian-Cheng Zhu, Xiao-Bo Li, Fei Ye, Jun-Jie Zhang, Zhi-Zhong Liu, Nai-Liang Tian, Song Lin, Cheng-Yu Lv Nanjing First Hospital, Nanjing Medical University, Nanjing, People's Republic of China Background: Stent grafting for treatment of type B aortic dissection has been extensively used. However, the difference in the long-term clinical outcome between patients with chronic versus acute type B aortic dissection remains unknown. This study aimed to analyze the difference in long-term clinical outcome after endovascular repair for patients with chronic (93% complete false-lumen thrombosis. Untreated tear and type I endoleak were predictors of clinical events during follow-up. Conclusion: Comparable long-term clinical results were achieved in patients with chronic or acute type B aortic dissection after implantation of a stent graft. Keywords: aortic dissection, endovascular repair, procedure-related events, propensity score matching

  4. History of Neurology in China

    Wang Xinde

    2000-01-01

    @@In 1921, the first independent department of neurology was established in Beijing. Before 1949, all over China only 12 professional doctors lectured neurology in medical colleges. Only 30 medically trained personnel were engaged in the neurological departments. The neurological departments contained roughly 200 beds. The thesis on stroke was written by Zhang Shanlei and published in 1922. Author discussed the cerebral stroke on basis of Chinese traditional medicine and European medicine. The first Textbook of Neurology in China was written by Professor Cheng Yu-lin and was published in 1939. In 1952, the Chinese Society of Neurology and Psychiatry of Chinese Medical Association was established. In 1955, the first issue of the Chinese Journal of Neurology and Psychiatry was published.

  5. Design, synthesis, and biological evaluation of 3-vinyl-quinoxalin-2(1H-one derivatives as novel antitumor inhibitors of FGFR1

    Liu Z

    2016-05-01

    Full Text Available Zhiguo Liu,1,* Shufang Yu,1,* Di Chen,1 Guoliang Shen,1 Yu Wang,1 Leping Hou,2 Dan Lin,1 Jinsan Zhang,1 Faqing Ye1 1School of Pharmaceutical Sciences, Wenzhou Medical University, Wenzhou, 2Second Affiliated Hospital of Zhejiang University School of Medicine, Hangzhou, People’s Republic of China *These authors contributed equally to this work Abstract: FGFR1 is well known as a molecular target in anticancer drug design. TKI258 plays an important role in RTK inhibitors. Utilizing TKI258 as a lead compound that contains a quinazolinone nucleus, we synthesized four series of 3-vinyl-quinoxalin-2(1H-one derivatives, a total of 27 compounds. We further evaluated these compounds for FGFR1 inhibition ability as well as cytotoxicity against four cancer cell lines (H460, B16-F10, Hela229, and Hct116 in vitro. Some compounds displayed good-to-excellent potency against the four tested cancer cell lines compared with TKI258. Structure–activity relationship analyses indicated that small substituents at the side chain of the 3-vinyl-quinoxalin-2(1H-one were more effective than large substituents. Lastly, we used molecular docking to obtain further insight into the interactions between the compounds and FGFR1. Keywords: FGFR1, synthesis, quinoxaline, antitumor activity, kinase inhibitor

  6. Optical Pattern Recognition

    Yu, Francis T. S.; Jutamulia, Suganda

    2008-10-01

    Contributors; Preface; 1. Pattern recognition with optics Francis T. S. Yu and Don A. Gregory; 2. Hybrid neural networks for nonlinear pattern recognition Taiwei Lu; 3. Wavelets, optics, and pattern recognition Yao Li and Yunglong Sheng; 4. Applications of the fractional Fourier transform to optical pattern recognition David Mendlovic, Zeev Zalesky and Haldum M. Oxaktas; 5. Optical implementation of mathematical morphology Tien-Hsin Chao; 6. Nonlinear optical correlators with improved discrimination capability for object location and recognition Leonid P. Yaroslavsky; 7. Distortion-invariant quadratic filters Gregory Gheen; 8. Composite filter synthesis as applied to pattern recognition Shizhou Yin and Guowen Lu; 9. Iterative procedures in electro-optical pattern recognition Joseph Shamir; 10. Optoelectronic hybrid system for three-dimensional object pattern recognition Guoguang Mu, Mingzhe Lu and Ying Sun; 11. Applications of photrefractive devices in optical pattern recognition Ziangyang Yang; 12. Optical pattern recognition with microlasers Eung-Gi Paek; 13. Optical properties and applications of bacteriorhodopsin Q. Wang Song and Yu-He Zhang; 14. Liquid-crystal spatial light modulators Aris Tanone and Suganda Jutamulia; 15. Representations of fully complex functions on real-time spatial light modulators Robert W. Cohn and Laurence G. Hassbrook; Index.

  7. Recent development in clusters of rare earths and actinides. Chemistry and materials

    Zheng, Zhiping

    2017-01-01

    This book contains the following eight contributions: 1. Lanthanide Hydroxide Cluster Complexes via Ligand-Controlled Hydrolysis of the Lanthanide Ions (Zhonghao Zhang, Yanan Zhang, and Zhiping Zheng); 2. Synthesis and Structures of Lanthanide-Transition Metal Clusters (Xiu-Ying Zheng, Xiang-Jian Kong, and La-Sheng Long); 3. Hydrothermal Synthesis of Lanthanide and Lanthanide-Transition-Metal Cluster Organic Frameworks via Synergistic Coordination Strategy (Jian-Wen Cheng and Guo-Yu Yang); 4. Oxo Clusters of 5f Elements (Sarah Hickam and Peter C.); 5. Construction and Luminescence Properties of 4f and d-4f Clusters with Salen-Type Schiff Base Ligands (Xiaoping Yang, Shiqing Wang, Chengri Wang, Shaoming Huang, and Richard A.); 6. 4f-Clusters for Cryogenic Magnetic Cooling (Yan-Cong Chen, Jun-Liang Liu, and Ming-Liang Tong); 7. Lanthanide Clusters Toward Single-Molecule Magnets (Tian Han, You-Song Ding, and Yan-Zhen Zheng); 8. Molecular Rare Earth Hydride Clusters (Takanori Shima and Zhaomin Hou).

  8. Quercetin inhibits epithelial–mesenchymal transition, decreases invasiveness and metastasis, and reverses IL-6 induced epithelial–mesenchymal transition, expression of MMP by inhibiting STAT3 signaling in pancreatic cancer cells

    Yu D

    2017-09-01

    Full Text Available Dinglai Yu,1 Tingting Ye,1 Yukai Xiang,1 Zhehao Shi,1 Jie Zhang,1 Bin Lou,1 Fan Zhang,1 Bicheng Chen,1,2 Mengtao Zhou1 1Department of Surgery, The First Affiliated Hospital, Wenzhou Medical University, Wenzhou, Zhejiang Province, People’s Republic of China; 2Zhejiang Provincial Top Key Discipline in Surgery, Wenzhou Key Laboratory of Surgery, Wenzhou, Zhejiang Province, People’s Republic of China Abstract: Quercetin, a flavone, is multifaceted, having anti-oxidative, anti-inflammatory, and anticancer properties. In the present study, we explored the effects of quercetin on the epithelial–mesenchymal transition (EMT and invasion of pancreatic cancer cells and the underlying mechanisms. We noted that quercetin exerted pronounced inhibitory effects in PANC-1 and PATU-8988 cells. Moreover, quercetin inhibited EMT and decreased the secretion of matrix metalloproteinase (MMP. Meanwhile, we determined the activity of STAT3 after quercetin treatment. STAT3 phosphorylation decreased following treatment with quercetin. We also used activating agent of STAT3, IL-6, to induce an increase in cell malignancy and to observe the effects of treatment with quercetin. As expected, the EMT and MMP secretion increased with activation of the STAT3 signaling pathway, and quercetin reversed IL-6-induced EMT, invasion, and migration. Therefore, our results demonstrate that quercetin triggers inhibition of EMT, invasion, and metastasis by blocking the STAT3 signaling pathway, and thus, quercetin merits further investigation. Keywords: quercetin, EMT, MMPs, STAT3, pancreatic cancer

  9. Modeling compositional dynamics based on GC and purine contents of protein-coding sequences

    Zhang, Zhang; Yu, Jun

    2010-01-01

    Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.

  10. Modeling compositional dynamics based on GC and purine contents of protein-coding sequences

    Zhang, Zhang

    2010-11-08

    Background: Understanding the compositional dynamics of genomes and their coding sequences is of great significance in gaining clues into molecular evolution and a large number of publically-available genome sequences have allowed us to quantitatively predict deviations of empirical data from their theoretical counterparts. However, the quantification of theoretical compositional variations for a wide diversity of genomes remains a major challenge.Results: To model the compositional dynamics of protein-coding sequences, we propose two simple models that take into account both mutation and selection effects, which act differently at the three codon positions, and use both GC and purine contents as compositional parameters. The two models concern the theoretical composition of nucleotides, codons, and amino acids, with no prerequisite of homologous sequences or their alignments. We evaluated the two models by quantifying theoretical compositions of a large collection of protein-coding sequences (including 46 of Archaea, 686 of Bacteria, and 826 of Eukarya), yielding consistent theoretical compositions across all the collected sequences.Conclusions: We show that the compositions of nucleotides, codons, and amino acids are largely determined by both GC and purine contents and suggest that deviations of the observed from the expected compositions may reflect compositional signatures that arise from a complex interplay between mutation and selection via DNA replication and repair mechanisms.Reviewers: This article was reviewed by Zhaolei Zhang (nominated by Mark Gerstein), Guruprasad Ananda (nominated by Kateryna Makova), and Daniel Haft. 2010 Zhang and Yu; licensee BioMed Central Ltd.

  11. Recent development in clusters of rare earths and actinides. Chemistry and materials

    Zheng, Zhiping (ed.) [Arizona Univ., Tucson, AZ (United States). Dept. of Chemistry and Biochemistry

    2017-02-01

    This book contains the following eight contributions: 1. Lanthanide Hydroxide Cluster Complexes via Ligand-Controlled Hydrolysis of the Lanthanide Ions (Zhonghao Zhang, Yanan Zhang, and Zhiping Zheng); 2. Synthesis and Structures of Lanthanide-Transition Metal Clusters (Xiu-Ying Zheng, Xiang-Jian Kong, and La-Sheng Long); 3. Hydrothermal Synthesis of Lanthanide and Lanthanide-Transition-Metal Cluster Organic Frameworks via Synergistic Coordination Strategy (Jian-Wen Cheng and Guo-Yu Yang); 4. Oxo Clusters of 5f Elements (Sarah Hickam and Peter C.); 5. Construction and Luminescence Properties of 4f and d-4f Clusters with Salen-Type Schiff Base Ligands (Xiaoping Yang, Shiqing Wang, Chengri Wang, Shaoming Huang, and Richard A.); 6. 4f-Clusters for Cryogenic Magnetic Cooling (Yan-Cong Chen, Jun-Liang Liu, and Ming-Liang Tong); 7. Lanthanide Clusters Toward Single-Molecule Magnets (Tian Han, You-Song Ding, and Yan-Zhen Zheng); 8. Molecular Rare Earth Hydride Clusters (Takanori Shima and Zhaomin Hou).

  12. The application of hyaluronic acid-derivatized carbon nanotubes in hematoporphyrin monomethyl ether-based photodynamic therapy for in vivo and in vitro cancer treatment

    Shi J

    2013-07-01

    Full Text Available Jinjin Shi,* Rourou Ma,* Lei Wang, Jing Zhang, Ruiyuan Liu, Lulu Li, Yan Liu, Lin Hou, Xiaoyuan Yu, Jun Gao, Zhenzhong Zhang School of Pharmaceutical Sciences, Zhengzhou University, Zhengzhou, Henan, People's Republic of China*These authors contributed equally to this workAbstract: Carbon nanotubes (CNTs have shown great potential in both photothermal therapy and drug delivery. In this study, a CNT derivative, hyaluronic acid-derivatized CNTs (HA-CNTs with high aqueous solubility, neutral pH, and tumor-targeting activity, were synthesized and characterized, and then a new photodynamic therapy agent, hematoporphyrin monomethyl ether (HMME, was adsorbed onto the functionalized CNTs to develop HMME-HA-CNTs. Tumor growth inhibition was investigated both in vivo and in vitro by a combination of photothermal therapy and photodynamic therapy using HMME-HA-CNTs. The ability of HMME-HA-CNT nanoparticles to combine local specific photodynamic therapy with external near-infrared photothermal therapy significantly improved the therapeutic efficacy of cancer treatment. Compared with photodynamic therapy or photothermal therapy alone, the combined treatment demonstrated a synergistic effect, resulting in higher therapeutic efficacy without obvious toxic effects to normal organs. Overall, it was demonstrated that HMME-HA-CNTs could be successfully applied to photodynamic therapy and photothermal therapy simultaneously in future tumor therapy.Keywords: photodynamic therapy, photothermal therapy, HA-derivatized carbon nanotubes, tumor targeting, synergistic effect, hematoporphyrin monomethyl ether

  13. S1P transporter SPNS2 regulates proper postnatal retinal morphogenesis.

    Fang, Chao; Bian, Ganlan; Ren, Pan; Xiang, Jie; Song, Jun; Yu, Caiyong; Zhang, Qian; Liu, Ling; Chen, Kun; Liu, Fangfang; Zhang, Kun; Wu, Chunfeng; Sun, Ruixia; Hu, Dan; Ju, Gong; Wang, Jian

    2018-02-08

    Spinster homolog 2 (SPNS2) is the membrane transporter of sphingosine-1-phosphate (S1P), and it participates in several physiologic processes by activating different S1P receptors (S1PRs). However, its functions in the nervous system remain largely unclear. We explored the important role of SPNS2 in the process of retinal morphogenesis using a spns2-deficient rat model. In the absence of the functional SPNS2 transporter, we observed progressively aggravating laminar disorganization of the epithelium at the postnatal stage of retinal development. Disrupted cell polarity, delayed cell-cycle exit of retinal progenitor cells, and insufficient migration of newborn neurons were proposed in this study as potential mechanisms accounting for this structural disorder. In addition, we analyzed the expression profiles of spns2 and s1prs, and proposed that SPNS2 regulated retinal morphogenesis by establishing the S1P level in the eye and activating S1PR3 signaling. These data indicate that SPNS2 is indispensable for normal retinal morphogenesis and provide new insights on the role of S1P in the developing retina using an established in vivo model.-Fang, C., Bian, G., Ren, P., Xiang, J., Song, J., Yu, C., Zhang, Q., Liu, L., Chen, K., Liu, F., Zhang, K., Wu, C., Sun, R., Hu, D., Ju, G., Wang, J. S1P transporter SPNS2 regulates proper postnatal retinal morphogenesis.

  14. Influence of polyethylene glycol coating on biodistribution and toxicity of nanoscale graphene oxide in mice after intravenous injection

    Li B

    2014-10-01

    Full Text Available Bo Li,1,2 Xiao-Yong Zhang,1 Jian-Zhong Yang,1 Yu-Jie Zhang,1 Wen-Xin Li,1 Chun-Hai Fan,1 Qing Huang1 1Laboratory of Physical Biology, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai, 2Department of Human Anatomy, College of Basic Medical Sciences, Jilin University, Changchun, People’s Republic of China Abstract: In this study, we assessed the in vivo behavior and toxicology of nanoscale graphene oxide (NGO in mice after intravenous injection. The influence of a polyethylene glycol (PEG coating on the distribution and toxicity of the NGO was also investigated. The results show that NGO is mainly retained in the liver, lung, and spleen. Retention in the lung is partially due to NGO aggregation. The PEG coating reduces the retention of NGO in the liver, lung, and spleen and promotes the clearance of NGO from these organs, but NGO and NGO-PEG are still present after 3 months. The PEG coating effectively reduces the early weight loss caused by NGO and alleviates NGO-induced acute tissue injuries, which can include damage to the liver, lung, and kidney, and chronic hepatic and lung fibrosis. Keywords: graphene oxide, biodistribution, toxicity, polyethylene glycol

  15. 真實性與主體性的追求:本土主義和多元文化主義影響下的臺灣原住民儀式展演 (Zhenshixing yu zhutixing de zhuiqiu: bentu zhuyi yu duoyuan wenhua zhuyi yingxiang xia de Taiwan yuanzhumin yishi zhanyan)

    Rudolph, Michael

    2017-01-01

    展演理論的擁護者強調展演對於社會組織和權威的模式存在建設性和變革性的潛在影響。對於他們來說,「儀式不僅意味深長,且具有實際用途,尤其在建構與題寫權力關系方面」(Bell 1997)。本篇論文側重於儀式展演在台灣後殖民意識形成中的角色, 以及在政治權力和社會權威認證(authentication)中的主要作用。自從20世紀90年代中期,原住民的展演開始在島內盛行,政府為了試圖宣揚台灣的本土和多元化文化取向,紛紛慷慨資助,原住民菁英們不僅公開崇拜先祖神靈,在所謂 「復振」的公共儀式中還使用動物祭祀,並在這種場合,向過去的漢族殖民者彰顯原住民的原生力。然而,在許多情況下,這些被復振的儀式與原住...

  16. Selective Neoplasm Localization with Mercury-197 Neohydrin; Localisation Selective de Neoplasmes a l'aide de la Neohydrine Marquee avec {sup 197}hg; Obnaruzhenie opukholej s pomoshch'yu neogidrina, mechennogo rtut'yu-197; Localizacion Selectiva de Neoplasmas con Neohidrina - {sup 197}hg

    Sodee, D. B. [Doctors Hospital and Renner Clinic Foundation, Cleveland Heights, OH (United States)

    1964-10-15

    Hg{sup 197} a low-energy X- and gamma- ray emitter (2.7-d half-life, 69-keV conversion X-rays, 77-keV gamma-rays) was tested as a scanning agent in a large series of patients. Five hundred patients suspected of neuro-surgical disease were scanned with Hg{sup 197}-Neohydrin. Utilizing photoscanning techniques that brought out vascular lesions as well as tumours, this procedure had a 96% correlation with the final diagnostic evaluation. This screening procedure was done before all other diagnostic tests. As an outgrowth of this brain-scanning procedure, we have found localization of Hg{sup 197}-Neohydrin in lymphomas as well as in carcinomas. There seems to be selective deposition of the radioactive substance intercellularly. Areas of increased uptake of radioactivity can easily be delineated with standard commercial scanners. Hg{sup 197}-Neohydrin was also found to be useful as a screening agent in thc differentiation of eye tumours in a series of 88 patients and recently this low-energy radiopharmaceutical was found to concentrate in naso- pharangeal tumours which could then be delineated by photoscanning. The diagnostic dose of Hg{sup 197}-Neohydrin for brain scanning delivers a radiation dose of 3 rad to the kidneys as compared to the 70 rad delivered to the kidneys by that of Hg{sup 203}-Neohydrin. The high counting efficiency and ease of collimation of Hg{sup 197} make this isotope far better for scanning purposes than all other standard diagnostic scanning agents. (author) [French] Le mercure-197, emetteur de rayons X et de rayons gamma de faible energie (periode de 65 h, rayons X de 69 keV, rayons gamma de 77 keV), a ete essaye comme agent d'exploration scintigraphique sur un grand nombre de patients. On a utilise la neohydrine marquee avec {sup 197}Hg pour la scintigraphie de 500 cas de neurochirurgie. Par des procedes de photoscintigraphie qui permettaient la visualisation des lesions vasculaires aussi bien que celle de tumeurs, on a obtenu des resultats confirmes dans 96% des cas par le diagnostic final. La scintigraphie etait toujours faite avant tous les autres tests. L'application de cette methode de scintigraphie du cerveau a permis, en outre, de constater que la neohydrine marquee avec {sup 197}Hg etait localisee aussi bien dans les lymphomes que dans les carcinomes. Il semble y avoir depot selectif de la substance radioactive au niveau intercellulaire. Les zones de fixation accrue de la radioactivite peuvent etre aisement delimitees avec des agents scintigraphiques courants. Des essais sur 88 patients on montre que la neohydrine marquee avec {sup 197}Hg etait egalement utile comme agent de detection pour differencier les tumeurs des yeux; enfin, on a constate tout recemment qu'elle se concentrait dans les tumeurs rhino-pharyngiennes, que l'on pouvait alors delimiter par photoscintigraphie. La quantite de neohydrine marquee avec {sup 197}Hg necessaire a une scintigraphie du cerveau delivre au reins une dose de 3 rad, contre 70 rad pour la neohydrine marquee avec {sup 203}Hg, Du fait de la grande efficacite de comptage et de la facilite de collimation, {sup 197}Hg convient mieux que tous les autres agents classiques de diagnostic par scintigraphie. (author) [Spanish] El autor ensayo como agente de exploracion el {sup 197}Hg, emisor de rayosX y gamma de baja energia (periodo: 2,7 d; rayos X de conversion: 69keV; rayos gamma: 77keV). Quinientos pacientes, que presentaban sintomas de afecciones neuroquirurgicas, fueron examinados mediante neohidrina-{sup 197}Hg. Aplicando tecnicas de fotoexploracion que revelan tanto las lesiones vasculares como los tumores, se comprobo que entre los resultados asi obtenidos y el diagnostico definitivo habla una correlacion del 96%. Ese procedimiento de examen se aplico antes de proceder a las demas pruebas diagnosticas Como resultado de la aplicacion de ese procedimiento de exploracion del cerebro, el autor descubrio localizaciones de neohidrina-{sup 197}Hg en linfomas y carcinomas. Al parecer, la sustancia radiactiva tiende a depositarse selectivamente en regiones intercelulares. Con los aparatos de exploracion de. tipo comercial se pueden delinear facilmente las zonas de mayor absorcion de radiactividad. Tambien se comprobo la utilidad de la neohidrina-{sup 197}Hg para la diferenciacion de tumores oculares en una serie de 88 pacientes - recientemente se ha observado que este compuesto radiofarmaceutico de baja energia se concentra en los tumores nasofaringeos que luego pueden delinearse por fotoexploracion. La dosis diagnostica de neohidrina-{sup 197}Hg administrada para la exploracion del cerebro entrafla la absorcion de 3 rad por el riflon; la de neohidrina-{sup 203}Hg entrafla la absorcion de 70 rad por este ultimo organo. El elevado rendimiento de recuento del {sup 197}Hg y la facilidad con que se coliman las radiaciones que emite, hacen que este isotopo resulte mucho mas util para la exploracion gammagra-fica que cualquier otro de los agentes habitualmente empleados. (author) [Russian] RtuT'-197-izluchatel' rentgenovskih i gamma-luchej maloj jenergii (period poluraspada 2,7 dnja, konversionnoe rentgenovskoe izluchenie moshhnost'ju 69 kjev, gamma-izluchenie 77 kjev) byl oprobovan v kachestve skennirujushego sredstva v bol'shogo kolichestva bol'nyh. U 500 bol'nyh s predpolagaemymi nervohirurgicheskimi zabolevanijami proizvedeno skennirovanie po izlucheniju neogidrina, mechennogo Hg{sup 197}. S pomoshh'ju metoda fotOskennirovanija udalos' vyjavit' porazhenie sosudov i opuholi, prichem jeta metodika v 96% obespechivala korreljaciju s okonchatel'nym diagnozom. Jeta metodika rentgenologicheskogo issledovanija predshestvovala vsem drugim vidam diagnosticheskogo obsledovanija. S pomoshh'ju metoda skennirovanija golovnogo mozga avtory obnaruzhili lokalizaciju Neogidrina-Hg{sup 197} kak v limfomah, tak i v karcinomah. Po-vidimomu, imeet mesto mezhkletochnoe selektivnoe otlozhenie radioaktivnogo veshhestva. Uchastki usilennogo pogloshhenija radioaktivnosti mozhno legko opredelit' s pomoshh'ju standartnyh imejushhihsja v prodazhe skennirujushhih ustrojstv. Neogidrin, mechennyj Hg{sup 197}, okazalsja prigodnym sredstvom dlja radiologicheskogo issledovanija pri ustanovlenii differencial'nogo diagnoza glaznyh opuholej u 88 bol'nyh. Nedavno bylo obnaruzheno, chto jetot radiofarmacevticheskij preparat s mjagkim izlucheniem koncentriruetsja v opuholjah nosoglotki, kontur kotoryh mozhno zatem opredelit' s pomoshh'ju fotoskennirovanija. Diagnosticheskaja doza neogidrina - Hg{sup 197} dlja skennirovanija golovnogo mozga sozdaet dozu obluchenija pochek, ravnuju 3 rad, v to vremja kak diagnosticheskaja doza neogidrina -Hg{sup 203} sozdaet dozu obluchenija v 70 rad. Blagodarja vysokoj jeffektivnosti scheta i legkosti kollimacii Hg{sup 197}, jetot izotop v gorazdo bol'shej stepeni otvechaet celjam skennirovanija, chem vse drugie standartnye sredstva diagnosticheskogo skennirovanija. (author)

  17. Renal Scintiscanning with Hg{sup 209}-Neohydrin in Urologic Diseases; Scintigraphy du Rein dans les Maladies des Voies Urin Aires au Moyen de Neohydrine Marquee avec {sup 203}Hg; Stsintillyatsionnoe skennirovanie pochek s pomoshch'yu neogidrina,mechennogo Rtut'yu-203, pri urologicheskikh zabolevaniyakh; Exploracion Centelleografica del Rinon con Neohydrina - {sup 203}hg en las Afecciones Urologicas

    Bollini, V.; Tori, G. [Radiology Institute of the University of Bologna (Italy)

    1964-10-15

    Renal scintiscanning has been carried out using Hg{sup 203} - labelled Neohydrin. The equipment used is the Nuclear Chicago Isotope Scanner Type 1700 with 2 x 2 - i n crystal and a 7 - cm focal-length honeycomb collimator. Usually the scintigrams are registered both on paper and on photographic film. Hg{sup 203} - labelled Neohydrin is usually employed in doses of 120 - 160 {mu}c (about 2 {mu}c/kg). The scanning examination starts about 2 h after the injection and lasts about 40-50 min. The selective storage of labelled Neohydrin at the level of the renal cortex makes it possible to obtain a graphic representation of the two kidneys and to identify their position, orientation and shape, and the homogeneity of the actively functioning parenchyma. In some cases, autoradiographic investigations have been carried out on diseased kidneys after surgical removal. By this method anomalies in position and orientation, both congenital and acquired, can be ascertained. As regards shape, the limits of the renal patterns are the mote clearly defined as the renal function is better. Technical aspects such as the width of the crystal, type of collimator (whose focal plane should pass through the transverse medial plane of the kidneys), and dose - which should be not too high not too low - are essential conditions for a correct graphic reproduction of the renal patterns. Failure in tabular activity in the parenchyma is shown by a lack in the uptake of radioactivity. The position, extent and shape of such defects in uptake vary according to the entity of the renal structures and their derangement due to various pathological processes: tumours, cysts, hydronephrosis, tuberculosis etc. In normal subjects a homogeneous scintigram is usual, although a clearer hilar region is not a rare occurrence. Any circumscribed decrease of scintigraphic density outside the hilum is the expression of a less actively functioning zone. Among kidney patterns larger than normal, the homogeneous ones which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author) [French] Les auteurs ont procede a des scintigraphies du rein au moyen de neohydrine marquee avec {sup 203}Hg. Ils ont utilise le dispositif de scintigraphie 'NuclearChicago', type 1700, a cristal de 5 x 5 cm et collimateur alveolaire de 7 cm de distance focale. En general, les scintigrammes sont enregistres a la fois sur papier et sur film photographique; la neohydrine marquee avec {sup 203}Hg est administree en doses de 120 a 160 {mu}c (environ 2 {mu}c/kg). L'examen scintigraphique commence deux heures environ apres l'injection et dure de 40 a 50 min. Le fait que la neohydrine marquee se fixe selectivement au niveau du cortex renal permet d'obtenir une representation graphique des deux reins et de determiner leur position, leur orientation et leur forme, ainsi que le degre d'homogeneite du parenchyme normal. Dans certains cas, des examens autobiographiques ont ete effectues sur des reins malades, apres ablation. Cette methode permet de determiner les anomalies, congenitales ou acquises, dans la position et l'orientation des reins. En ce qui concerne la forme de l'organe, les contours de l'image du rein sont d'autant plus nets que la fonction renale est meilleure. Des caracteristiques techniques telles que la largeur du cristal, le type.de collimateur (dont le plan focal doit couper le plan median transversal des reins) et la dose (qui ne doit etre ni trop elevee ni trop faible) representent les conditions determinantes d'une reproduction graphique correcte de la structure renale. Une mauvaise fixation de la radioactivite denote une insuffisance de l'activite tubulaire dans le parenchyme. La position, l'etendue.et la forme des zones de mauvaise fixation varient suivant le degre d'integrite des structures renales et leur alteration sous l'effet de divers processus pathologiques: tumeurs, kystes, hydro- nephrose, tuberculose, etc. Chez des sujets normaux, le scintigramme est generalement homogene, bien qu'il ne soit pas rare d'observer une plus faible densite dans la region du hile. Toute tache plus claire en dehors du hile indique une zone ou la fonction renale n'est pas normale. Parmi les images du rein plus grandes que la normale, il convient d'etablir une distinction entre les images homogenes, qui denotent une hypertrophie compensatoire, et les images non homogenes et irregulieres. Ces dernieres semblent indiquer une forte uronephrose ou la presence de tumeurs ou de kystes multiples. Dans les affections reno-vasculaires, le caractere de la fixation de la radioactivite dans les deux reins peut beaucoup aider a evaluer la diminution de la fonction renale et a etablir si un seul rein ou les deux sont atteints. On peut donc s'attendre que la scintigraphie du rein constituera une methode interessante d'exploration clinique, surtout en association avec l'examen radiologique des reins par les methodes classiques (urographie, pyeiographie ascendante, retropneumoperitoine, tomo- graphie, aortographie, etc.). (author) [Spanish] Los autores han efectuado exploraciones centelleograficas del rinón empleando neohidrina marcada con {sup 203}Hg. Para ello, utilizaron el Nuclear Chicago Isotope Scanner, tipo 1100, con un cristal de 2 x 2 pulg y un colimador alveolar de 7 cm de distancia focal. Los centelleogramas se registran generalmente simultaneamente en papel y pelicula fotografica. La neohidrina marcada con {sup 203}Hg suele administrarse en dosis de 120 a 160 {mu}c (aproximadamente 2 {mu}/kg). La exploracion se empieza unas dos horas despues de la inyeccion y dura de 40 a 50 min. La concentracion selectiva de la neohidrina marcada en la corteza renal permite obtener una representacion grafica de ambos rinones, comprobar su posicion, orientacion y forma, y verificar la homogeneidad del parenquima en actividad. En algunos casos se han efectuado investigaciones autorradiograficas en rifiones despues de extirparlos quirurgicamente. Gracias a ese metodo se pueden determinar anomalias, congenitas o adquiridas, en la posicion y la orientacion. Por lo que respecta a la forma, los limites del diagrama quedan mas claramente definidos cuanto mejor es la funcion renal. Ciertas condiciones tecnicas tales como la anchura del cristal, el tipo de colimador (cuyo plano focal debe cortar el plano transversal mediano de los rinones) y la dosis (que no debe ser ni excesiva ni demasiado baja) son esenciales para obtener un centelleograma correcto. Las deficiencias en la actividad tubular del parenquima dificultan la captacion de radioactividad. La situacion, la extension y la forma de esos defectos de la captacion varian en funcion de las estructuras renales y segun los procesos patologicos que los determinan: tumores, quistes, hidronefrosis, tuberculosis, etc. Para las personas sanas se obtienen centelleogramas homogeneos, aunque no es raro que la region hilar aparezca mas clara. Cualquier disminucion circunscrita de la densidad centelleografica fuera del hilio indica una zcna de actividad atenuada. Cuando los rinones aparecen dilatados hay que distinguir entre los homogeneos, que indican una hipertrofia compensatoria, y los no homogeneos e irregulares. Estos ultimos sugieren la presencia de hidronefrosis extensas, de tumores o de quistes multiples. Cuando se trata de enfermedades vasculares, el caracter de la captacion en ambos rinones puede contribuir considerablemente a determinar una disminucion de la funcion renal y a diferenciar los casos unilaterales de los bilaterales. Asi, la centelleografia del rinon constituye al parecer una tecnica clinica de gran utilidad, especialmente si se combina con el examen radiologico por medios tradicionales (urogtafia, pielografia ascendente, retroneumoperitoneo, tomografia, aorto- grafia, etc.). (author) [Russian] Dlja scintilljacionnogo skenirovanija pochek ispol'zovalsja neogidrin, mechennyj rtut'ju-203. Byl primenen jaderncj Chikagskij izotopnyj skenner tipa 1700 s kristallom 5 h 5 sm i kollimator ''Hanikoum'' s fokusnym rasstojaniem 7 sm. Obychno scintigrammy registrirujutsja odnovremenno na bumage i na fotoplenke. Neogidrin, mechennyj rtut'ju-203, primenjaetsja obychno v dozah 120 - 160 mkkjuri (okolo 2 mkkjuri/kg). Skennirovanie nachinajut spustja 2 chasa posle in{sup e}kcii i prodolzhajut 40 - 50 minut. Selektivnoe skoplenie mechenogo neogidrina v korkovom sloe pochek daet vozmozhnost' poluchit' graficheskoe izobrazhenie obeih pochek i opredelit' ih polozhenie, orientaciju i formu, a takzhe gomogennost' aktivno funkcionirujushhej parenhimy. V nekotoryh sluchajah byli provedeny avtoradiograficheskie issledovanija porazhennyh pochek posle hirurgicheskogo udalenija. S pomoshh'ju takogo metoda mozhno diagnoscirovat' kak vrozhdennye, tak i priobretennye anomalii polozhenija i orientacii. Chto kasaetsja formy, to granicy pochek mozhno opredelit' tem tochnee, chem luchshe funkcioniruet pochka. Takie tehnicheskie aspekty, kak shirina kristalla, tip kollimatora (fokal'naja ploskost' kotorogo dolzhna prohodit' cherez srednjuju poperechnuju ploskost' pochek) i doza, kotoraja ne dolzhna byt' slishkom vysokoj ili slishkom maloj, sostavljajut sushhestvennoe uslovie dlja pravil'nogo graficheskogo vosproizvedenija ochertanij pochek. Narushenie dejatel'nosti kanal'cev v parenhime opredeljaetsja blagodarja narusheniju pogloshhenija radioaktivnosti. Polozhenie, razmery i forma takih defektov pogloshhenija kolebljutsja v sootvetstvii s harakterom pochechnoj struktury i ee narushenij vsledstvie razlichnyh patologicheskih processov: opuholej, kist, gidronefroza, tuberkuleza i t.d. U zdorovyh ljudej obychno poluchajut odnorodnye scintigrammy, hotja poluchenie bolee chetkoj oblasti vorot organa ne javljaetsja redkim sluchaem. Kakoe-libo ogranichennoe umen'shenie scintigraficheskoj plotnosti vne vorot predstavljaet soboj funkcionirujushhuju menee aktivno zonu. Pri bolee krupnyh razmerah pochek, po sravneniju s normal'nymi, sleduet otlichat' odnorodnye skennogrammy, kotorye ukazyvajut na kompensatornuju gipertrofiju, neodnorodnyh i imejushhih nepravil'nuju formu. Izobrazhenija jetih poslednih ukazyvajut na nalichie krupnyh uchastkov gidronefroza, opuholej ili mnozhestvennyh kist. Pri pochechnyh sosudistyh zabolevanijah opredelenie haraktera pogloshhenija v obeih pochkah predstavljaet bol'shuju cennost' dlja ocenki snizhenija ih funkcii i dlja razgranichenija odnostoronnih i dvustoronnih porazhenij. Takim obrazom, scintilljacionnoe skennirovanie pochek obeshhaet dat' poleznye klinicheskie metody, osobenno v sochetanii s radiologicheskim issledovaniem pochek tradicionnymi sredstvami (urografija, voshodjashhaja pijelografija, retropnevmoperitoneum, tomografija, aorto- grafija it.d,),. (author)

  18. AcEST: DK945338 [AcEST

    Full Text Available hul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David...n, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST

  19. AcEST: BP917220 [AcEST

    Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAS...erence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  20. AcEST: DK947581 [AcEST

    Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe

  1. AcEST: BP919457 [AcEST

    Full Text Available chul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi...ejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and P

  2. AcEST: DK944638 [AcEST

    Full Text Available Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST...] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb

  3. AcEST: DK944153 [AcEST

    Full Text Available ul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David ..., Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a

  4. AcEST: DK947778 [AcEST

    Full Text Available Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997)...chaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a

  5. AcEST: BP911646 [AcEST

    Full Text Available .19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web... Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.

  6. AcEST: BP913622 [AcEST

    Full Text Available den, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAS...erence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  7. AcEST: DK946346 [AcEST

    Full Text Available chul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi...en, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST

  8. AcEST: DK946405 [AcEST

    Full Text Available : Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, an.... Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped

  9. AcEST: DK962276 [AcEST

    Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and ...Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped B

  10. AcEST: DK943983 [AcEST

    Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe

  11. AcEST: BP920286 [AcEST

    Full Text Available Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST an...ce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  12. AcEST: DK945792 [AcEST

    Full Text Available e: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, a...L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gappe

  13. AcEST: DK943811 [AcEST

    Full Text Available fer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new ...-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  14. AcEST: DK943549 [AcEST

    Full Text Available A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),... [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  15. AcEST: DK945525 [AcEST

    Full Text Available Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gener...] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb

  16. AcEST: DK956790 [AcEST

    Full Text Available ro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199....19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  17. AcEST: BP913019 [AcEST

    Full Text Available chaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a ...008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  18. AcEST: DK945086 [AcEST

    Full Text Available 02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip

  19. AcEST: DK944197 [AcEST

    Full Text Available rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G

  20. AcEST: DK947358 [AcEST

    Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...hen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma

  1. AcEST: DK944575 [AcEST

    Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman ... 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  2. AcEST: BP921401 [AcEST

    Full Text Available 2-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (19

  3. AcEST: BP921108 [AcEST

    Full Text Available adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL...eference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  4. AcEST: DK946157 [AcEST

    Full Text Available A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997)...9 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  5. AcEST: BP916803 [AcEST

    Full Text Available en, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST...rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  6. AcEST: BP912908 [AcEST

    Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web..., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199

  7. AcEST: DK943569 [AcEST

    Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and ...Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped B

  8. AcEST: BP918928 [AcEST

    Full Text Available nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL

  9. AcEST: DK944304 [AcEST

    Full Text Available ul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David ..., Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a

  10. AcEST: DK946539 [AcEST

    Full Text Available ltschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and D...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL

  11. AcEST: BP921502 [AcEST

    Full Text Available nce: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller,...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL

  12. AcEST: DK947183 [AcEST

    Full Text Available 8] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1

  13. AcEST: DK944599 [AcEST

    Full Text Available er, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new g...2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  14. AcEST: DK951674 [AcEST

    Full Text Available nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST a...Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb M

  15. AcEST: DK946261 [AcEST

    Full Text Available rence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...mas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), G

  16. AcEST: BP915145 [AcEST

    Full Text Available homas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),..., Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new gen

  17. AcEST: DK947501 [AcEST

    Full Text Available Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997...Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a

  18. AcEST: DK945167 [AcEST

    Full Text Available Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and... Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped

  19. AcEST: DK943583 [AcEST

    Full Text Available , Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J....Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and

  20. AcEST: DK945145 [AcEST

    Full Text Available ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip...andro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI

  1. AcEST: DK944742 [AcEST

    Full Text Available inghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST ... Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb

  2. AcEST: DK944429 [AcEST

    Full Text Available homas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),...haffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a n

  3. Basic investigation on promotion of joint implementation in fiscal 2000. Energy conservation and modernization plan for Chhatak Cement Co., Ltd.; 2000 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Chhatak Cement sha shoene, kindaika keikaku

    NONE

    2001-03-01

    With an objective of saving energies and reducing greenhouse gas emission, discussions were given on a modernization plan for the Chhatak cement factory in The People's Republic of Bangladesh. The Chhatak cement factory having a nominal production capability of 267,000 tons a year uses mainly wet-type long kilns of old type, consuming a great amount of natural gas. The present plan has discussed adoption of the Japanese energy saving technologies. The technologies use a vertical roller mill for raw material pulverization, a suspension preheater and a short kiln for clinker sintering, a grate cooler for clinker cooling, and the pre-crushing system. The result of the discussions provided the prospects of reduction in the natural gas consumption at 50%, and reduction of electric power consumption at 16%. This will mean the annual reduction of about 22,000 tons as converted to crude oil. The CO2 reduction amount would reach 51,800 tons a year. The total investment amount would be US$37,327,000. The result of the financial analysis according to the case studies appears severe, wherein reduction of the various expenses is desired possibly by the finance from Japan with generous conditions.(NEDO)

  4. Proceedings of the Joint Meeting of The Fuel Society of Japan (1991). 28th Coal Science Conference/91st Coke Meeting; (Sha) nenryo kyokai godo taikai happyo ronbunshu (1991). Dai 28 kai sekitan kagaku kaigi dai 91 kai cokes tokubetsukai

    1991-11-07

    Relating to coke, studies are made on the rapid coke production method, oven investigation during carbonization, and operational management/control. As to coal science, studies are mainly on the brown coal two-stage liquefaction (BCL) method, and data on the pilot plant and PSU are reported. Concerning bituminous coal liquefaction, PSU data mostly including the NEDOL process, and characteristics of liquefaction residue and its effective utilization by thermal decomposition are reported. Regarding the liquefaction mechanism, an experimentally extensive study on catalyst, solvent and reaction conditions is made using model materials and coal itself on the bench scale and also in the pilot plant. Engineering subjects on residue, solvent deashing, scale attachment and coprocessing are also reported. Relations of decomposition process to coal chemical structure changes and reaction conditions are investigated. As to coal gasification, studies, which are not many, are conducted on material balance, heat balance, and image characteristics of char for gasification and factors controlling reactivity.

  5. Fiscal 1999 research report. Basic research on joint implementations promotion (Feasibility study of modification for Tehran Cement Co., Ltd., Iran); 1999 nendo kyodo jisshi nado suishin kiso chosa hokokusho. Iran koku Teheran cement sha kaizo F/S

    NONE

    2000-03-01

    The feasibility study was started upon a request made by the Iranian Ministry of Energy involving the No. 7 kiln of the above said company. It was then concluded, after assessing the degree of urgency of supply and demand and the magnitude of loss due to reduced production because of the on-site modification work, that it was not practical to begin the project immediately. Under the circumstances, various studies were made about the feasibility of modification of the whole production process of the No. 1 kiln through No. 7 kiln, and a procedure was presented, to be described below. The procedure will consist of Phase I wherein the No. 3 wet kiln is converted into an NSP (new suspension preheater) dry kiln, Phase II wherein the No. 7 SP (suspension preheater) dry kiln is converted in to an NSP kiln, and Phase III wherein the No. 4 SP dry kiln is converted into a clinker cooler. Under this procedure, the modernization of the Tehran Cement Co., Ltd., facilities will be accomplished without causing production loss. After the completion of the project, an annual yield of 3.6-million tons will be achieved, with productivity to be improved by 26.4% over the current theoretical capacity or by 54.8% over the actual average for the past 5 years. There will be a sustained conservation of 25,356 tons/year in terms of oil. Application of CDM (clean development mechanism) to this project will be extremely effective in reducing greenhouse gas and in improving profitability. (NEDO)

  6. FY 1998 annual report on the CO{sub 2} reduction by 30 manufacturing companies (plants) through energy conservation. Thailand; Seizogyo 30 sha (kojo) no sho energy ni yoru CO{sub 2} haishutsuryo sakugen 1998 nendo chosa hokokusho. Taikoku

    NONE

    1999-03-01

    This project is aimed at energy-saving diagnosis of 30 energy-intensive manufacturing plants in Thailand, to draw the project plans and clarify, e.g., greenhouse effect gas reduction and cost-effectiveness effects, on the basis of transferring and applying the energy management and energy-saving equipment technologies now being used by the manufacturing sector in Japan. The 30 plants analyzed are 6 metal-related plants, 3 non-ferrous plants, 5 chemical plants, 6 ceramics plant, 4 textile plants, 4 food processing plants and 2 pulp plants. Two or more feasible energy-saving measures are studied for each plant. A total of 178 improvement measures (approximately 6 on the average for each plant) are identified as the ones related to energy-saving and operation controlling techniques. These measures could reduce CO2 emissions by 145,000 t/y from 1,370,000 t/y released from the 30 plants. The measures of high cost-effectiveness are (use of an appropriate pressure for air compressors) and (resting of transformers on non-working days). (NEDO)

  7. Sustainable practices and related performances at state highway agencies.

    2010-12-01

    This report identifies seven ways in which an SHA can harm the environment: (1) excessive consumption of virgin materials; (2) unnecessary levels or amounts of storm water runoff; (3) release of environmental contaminants by SHA employees and conract...

  8. Assessing the nutritional status of elderly Chinese lung cancer patients using the Mini-Nutritional Assessment (MNA® tool

    Zhang L

    2013-03-01

    Full Text Available Lei Zhang,1,* Yanjun Su,1,* Chen Wang,2 Yongsheng Sha,1 Hong Zhu,3 Shumin Xie,4 Sabrina Kwauk,5 Jing Zhang,2 Yunshou Lin,2 Changli Wang1,*1Department of Thoracic Surgery, Key Laboratory of Cancer Prevention and Therapy, Tianjin Lung Cancer Center, Tianjin Medical University Cancer Institute and Hospital, Tianjin, 2Tianjin Medical University, Tianjin, 3Department of Public Health, Tianjin Medical University, Tianjin, 4Xiangya Medical School of Central-South University, Changsha, People's Republic of China; 5School of Public Health, Harvard University, Boston, Cambridge, MA, USA*These authors contributed equally to this workPurpose: This study assessed the nutritional status of elderly Chinese lung cancer inpatients using a revised version of the Mini-Nutritional Assessment (MNA® tool.Patients and methods: The revised version of the MNA tool was used to assess the nutritional status of 180 elderly Chinese lung cancer inpatients prior to their scheduled surgery between June 2010 and July 2011. Patients' demographic data, anthropometric parameters, and biochemical markers were collected and analyzed.Results: Among the 180 inpatients who underwent the MNA, 9% were malnourished (MNA score < 19, 33% were at risk of malnutrition (MNA score 19–23, and 58% were well nourished (MNA score ≥ 24. There was significant correlation between the MNA scores of patients who were malnourished, at risk of malnutrition, and well nourished (P < 0.001, as well as between total MNA score and most MNA questions. The three patient groups with different nutritional statuses differed significantly in their responses to anthropometrics and global, diet, and subjective assessments.Conclusion: Incidence rates of malnutrition prior to surgery are high among elderly Chinese lung cancer inpatients. The revised MNA is a valid and reliable tool that can be used to assess and prevent malnutrition among these inpatients.Keywords: malnutrition, MNA-SF, nutrition, inpatients, diet

  9. Expert consensus on acute exacerbation of chronic obstructive pulmonary disease in the People's Republic of China

    Cai BQ

    2014-04-01

    Full Text Available Bai-qiang Cai,1 Shao-xi Cai,2 Rong-chang Chen,3 Li-ying Cui,4 Yu-lin Feng,5 Yu-tong Gu,6 Shao-guang Huang,7 Rong-yu Liu,8 Guang-nan Liu,9 Huan-zhong Shi,10 Yi Shi,11 Yuan-lin Song,6 Tie-ying Sun,12 Chang-zheng Wang,13 Jing-lan Wang,1 Fu-qiang Wen,5 Wei Xiao,14 Yong-jian Xu,15 Xi-xin Yan,16 Wan-zhen Yao,17 Qin Yu,18 Jing Zhang,6 Jin-ping Zheng,3 Jie Liu,6 Chun-xue Bai6 1Department of Pulmonary Medicine, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing, 2Southern Medical University South Hospital, Guangzhou, 3The First Affiliated Hospital of Guangzhou Medical College and Guangzhou Institute of Respiratory Diseases, Guangzhou, 4Affiliate Hospital of Inner Mongolia Medical University, Huhehaote, 5Huaxi Hospital of Sichuan University, Chendu, 6Zhongshan Hospital, Shanghai Medical College, Fudan University and Shanghai Respiratory Research Institute, Shanghai, 7Ruijing Hospital of Shanghai Jiaotong University, Shanghai, 8The First Affiliated University of Anhui Medical University, Hefei, 9The First Affiliated University of Guangxi Medical University, Nanning, 10Beijing Chao-Yang Hospital, Capital Medical University, Beijing, 11General Hospital of Nanjing Military Region, Nanjing, 12Beijing Hospital of the Ministry of Health, Beijing, 13Xinqiao Hospital, Third Military Medical University, Chongqing, 14Qilu Hospital of Shandong University, Jinan, 15Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, 16The Second Affiliated Hospital of Hebei Medical University and Hebei Research Institute of Respiratory Medicine, Shijiazhuang, 17The Third Affiliated Hospital of Beijing University, Beijing, 18The First Affiliated University of Lanzhou University, Lanzhou, People's Republic of China Abstract: Chronic obstructive pulmonary disease (COPD is a common disease that severely threatens human health. Acute exacerbation of COPD (AECOPD is a major cause of

  10. JiaZhang Dui ErTong FaZhan TongBan GuanXi De ZuoYong (The Role of Parents in the Development of Peer Group Competence). ERIC Digest.

    Moore, Shirley G.

    Among studies that have examined the relationship between parenting styles and children's development of social skills, the research of Diana Baumrind is noteworthy. In several studies, she has identified authoritarian, permissive, and authoritative parenting styles, which differ on the dimensions of nurturance and parental control. Authoritarian…

  11. Translation into Chinese of: "Changes to publication requirements made at the XVIII International Botanical Congress in Melbourne - what does e-publication mean for you?". Translated by Li-Bing Zhang

    Sandra Knapp

    2011-09-01

    Full Text Available Changes to the International Code of Botanical Nomenclature are decided on every 6 years at Nomenclature Sections associated with International Botanical Congresses (IBC. The XVIII IBC was held in Melbourne, Australia; the Nomenclature Section met on 18-22 July 2011 and its decisions were accepted by the Congress at its plenary session on 30 July. Several important changes were made to the Code as a result of this meeting that will affect publication of new names. Two of these changes will come into effect on 1 January 2012, some months before the Melbourne Code is published. Electronic material published online in Portable Document Format (PDF with an International Standard Serial Number (ISSN or an International Standard Book Number (ISBN will constitute effective publication, and the requirement for a Latin description or diagnosis for names of new taxa will be changed to a requirement for a description or diagnosis in either Latin or English. In addition, effective from 1 January 2013, new names of organisms treated as fungi must, in order to be validly published, include in the protologue (everything associated with a name at its valid publication the citation of an identifier issued by a recognized repository (such as MycoBank. Draft text of the new articles dealing with electronic publication is provided and best practice is outlined.To encourage dissemination of the changes made to the International Code of Nomenclature for algae, fungi, and plants, this article will be published in BMC Evolutionary Biology, Botanical Journal of the Linnean Society, Brittonia, Cladistics, MycoKeys, Mycotaxon, New Phytologist, North American Fungi, Novon, Opuscula Philolichenum, PhytoKeys, Phytoneuron, Phytotaxa, Plant Diversity and Resources, Systematic Botany and Taxon.

  12. O modelo de projeção de lucros de Hou, Dijk e Zhang (2012) e o custo de capital implícito: metodologia para aplicação em empresas brasileiras

    Bruna Losada Pereira

    2016-01-01

    A teoria sobre o custo de capital das empresas estudada desde a década de 1950 trouxe amplas contribuições aos estudos de finanças corporativas, alocação de carteiras de investimento, fusões e aquisições, ciências contábeis, entre outras aplicações. Os modelos clássicos de custo de capital compreendem modelos como o CAPM (Capital Asset Pricing Model), de Sharpe, Lintner e Mossin; o APT (Arbitrage Pricing Theory), de Ross; o modelo de 3-fatores, de Fama e French, e de 4-fatores, de Carhart, en...

  13. Permian Circulipuncturites discinisporis Labaindera, Wang, Zhang, Bek et Pfefferkorn gen. et spec. nov. (formerly Discinispora) from Cina, an ichnotaxon of a punch-and-sucking insect on Noeggerathialean spores

    Wang, J.; Labandeira, C. C.; Zhang, G.; Bek, Jiří; Pfefferkorn, H. W.

    2009-01-01

    Roč. 156, 3/4 (2009), s. 277-282 ISSN 0034-6667 R&D Projects: GA AV ČR IAA301110701 Institutional research plan: CEZ:AV0Z30130516 Keywords : noeggerathiales * in situ spores * insect damage * ichnotaxon * Permian Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  14. Synthesis spherical porous hydroxyapatite/graphene oxide composites by ultrasonic-assisted method for biomedical applications.

    Duan, Peizhen; Shen, Juan; Zou, Guohong; Xia, Xu; Jin, Bo; Yu, Jiaxin

    2018-04-10

    Spherical porous hydroxyapatite (SHA)/graphene oxide (GO) composites with different GO (w/w) content of 16%, 40%, and 71% have been fabricated through a facile and controllable ultrasonic-assisted method at room temperature. The products were characterized by x-ray diffraction, field emission scanning electron microscopy, thermogravimetric analysis, mechanical testing and biomimetic mineralization. Results showed SHA were covered by GO, and SHA/GO composites had an irregular surface with different degrees of wrinkles. The elastic modulus and hardness of SHA/GO-3 composites were up to 12.45 ± 0.33 GPa and 686.67 ± 26.95 MPa, which indicated that the contents of GO had an effect on SHA/GO composites. And the mechanical properties of SHA/GO-2 composites were similar to SHA particles. The biomimetic mineralization in SBF solution showed the bone-like apatite layer on composites surface, which demonstrated that the SHA/GO materials had osseointegration property. Moreover, in vitro cytocompatibility of SHA/GO-2 composites and pure GO were evaluated by cell adhesion and proliferation tests using MC3T3-E1 cells, which demonstrated that the SHA/GO composites can act as a good template for the cells growth and adhesion. These results suggested that the SHA/GO composites will be a promising material for biomedical application.

  15. The 2nd International Conference on Water Resource and Environment (WRE 2016

    Zhouli Liu

    2016-11-01

    Full Text Available Table of contents 01 The eco-toxicological effects of cadmium stress on five ornamental plants Zhouli Liu, Wei Chen, Xingyuan He, Shuai Yu, Weihang Ding 02 Study on the formation and release mechanisms of hydrogen sulfide in Longtan coal mine Jianjun Liu, Yuliang Wu, Kaixiang Fan 03 Coral bleaching in the North Reef of China’s Xisha Islands in 2014 Yuanchao Li, Xinqing Zheng, Shiquan Chen, Haiqun Xie 04 Soil chemical characteristics in a Cunninghamia lanceolata stand suffering from ice-snow damage Jie Li, Zhuomin Wang, Li Xue 05 Diversity of understory vegetation was under a Cunninghamia lanceolata stand suffering from ice-snow damage Zhiyang Lie, Weilong Huang, Tongtong Zhou, Li Xue 06 The effect of water, nitrogen and harvesting time on yield and biomass allocation of Helianthus tuberosus L. Kai Gao, Tiexia Zhu 07 The vertical variation of microbial communities in the sediment of sea cucumber pond Weiteng Mao, Pei Yu, Xinfang Lv, Yunchun Li 08 Indicating significances of alpine plant functional groups to environmental change Peixi Su, Rui Shi 09 Research on the daily CH4 fluxes of soil in summer mangrove community at Yingluogang of Guangxi, China Yong Jiang, Xingbin Chen, Shichu liang 10 Beach protection structures in middle and lower reaches of Yangtze River Junfeng Xu 11 Social responsibility management of large dam project with owner as core: an empirical case in China Jiwei Zhu, Zhao Zhai, Linan Zhou, Yun Le, Li Cao 12 The ecological function value assessment analysis of urban waterfront Jiwei Zhu, Ping Lu, Zhiqian Huang, Bei Zhou 13 Mechanism of diurnal osmotic potential changes and adjustment of three Caragana species in different habitats of the Inner Mongolia Plateau Zhirong Zheng, Shihai Lv, Chaoyang Feng 14 Biodiversity of phytoplankton and environmental influences analysis of Longfeng Wetland, China Nan Song, Yan Liu, Xinxin Lu, Yawen Fan 15 The effect of human activities on culturable soil microbes from Yaoquan Mountain in

  16. Novel flower-shaped albumin particles as controlled-release carriers for drugs to penetrate the round-window membrane

    Yu Z

    2014-07-01

    Full Text Available Zhan Yu,1,* Min Yu,2,* Zhimin Zhou,3 Zhibao Zhang,3 Bo Du,3 Qingqing Xiong3 1Second Artillery General Hospital, Beijing, 2Department of Cell Biology, Key Laboratory of Cell Biology, Ministry of Public Health, College of Basic Medicine, China Medical University, Shenyang, 3Institute of Biomedical Engineering, Chinese Academy of Medical Sciences, Peking Union Medical College, Key Laboratory of Biomedical Material of Tianjin, Tianjin, People’s Republic of China *These authors contributed equallyto this work Abstract: Controlled-release carriers for local drug delivery have attracted increasing attention for inner-ear treatment recently. In this paper, flower-shaped bovine serum albumin (FBSA particles were prepared by a modified desolvation method followed by glutaraldehyde or heat denaturation. The size of the FBSA particles varied from 10 µm to 100 µm, and most were 50–80 µm. Heat-denatured FBSA particles have good cytocompatibility with a prolonged survival time for L929 cells. The FBSA particles were utilized as carriers to investigate the release behaviors of the model drug – rhodamine B. Rhodamine B showed a sustained-release effect and penetrated the round-window membrane of guinea pigs. We also confirmed the attachment of FBSA particles onto the round-window membrane by microscopy. The FBSA particles, with good biocompatibility, drug-loading capacity, adhesive capability, and biodegradability, may have potential applications in the field of local drug delivery for inner-ear disease treatment. Keywords: bovine serum albumin (BSA, controlled release, local delivery, round-window membrane

  17. Different-ligand boron complexes with gluconate-ions and pentaerythritol and gluconatoborates with B-O-B bridge bond. Raznoligandnye kompleksy bora s glyukonat-ionami i pentaehritritom i glyukonatoboraty s mostikovoj V-O-V svyaz'yu

    Tel' zhenskaya, P N; Shvarts, E M; Vitola, I M [AN Latvijskoj SSR, Riga (USSR). Inst. Neorganicheskoj Khimii

    1990-01-01

    Borogluconates differing in structure of the complex dimeric borogluconate ion from the described earlier have been synthesized. The results of physicochemical measurements (chemical and thermal analysis, IR-spectroscopy, titration according to Fisher, conductometry) allowed to propose formulas for the studied compounds.

  18. 胡阿祥:《东晋南朝侨州郡县与侨流人口研究》%Axiang Hu, Dongjin Nanchao Qiao zhoujunxian yu qiaoliu renkou yanjiu

    孔祥军

    2010-01-01

    @@ The epoch of the Wei, Jin and Southern and Northern dynasties was perhaps the most chaotic and complicated era in Chinese history, in terms of regime instability. Except for a short period of unification under the Western Jin, this era was marked by continuous division and confrontation. Accordingly, professional historians and amateur history lovers alike prefer to examine the unified and the powerful Han and Tang dynasties and are often unwilling to deal with this discordant and tumultuous time.However,the furious conflicts of this era actually promoted ethnic amalgamations,territorial exploits,cultural transmission and intellectual communication,therefore,an in-depth study of this period is not only worthwhile,but necessary.

  19. Potential denitrification rates of subsurface soil under paddy fields receiving ground water with high nitrate concentration; Konodo shosantai chisso gan`yu chikasui no ryunyusuru suiden kasodo ni okeru dacchitsu kassei

    Toda, H [Shizuoka Agricultural Experiment Station, Shizuoka (Japan); Hidaka, S [Saitama Agricultural Experiment Station, Saitama (Japan)

    1996-02-10

    It is well known that the concentration of nitrate nitrogen in the surface water decreases as it flows downward in rice paddies irrigated with water high in nitrate nitrogen concentration. The decrease is attributed to absorption by rice plants and algae adherent thereto and denitrification in the reduction layer well developed in the rice paddy surface soil. In paddy fields downstream of the Kushibiki plateau in the northwestern part of Saitama Prefecture, it is occasionally observed that nitrate nitrogen concentration in the ground water decreases as it flows down (farther from the plateau) not only in the flooded period but also in the non-flooded period. This suggests that in the said paddy field denitrification takes place not only in the rice paddy surface layer soil but also in the lower layer soil. Under the circumstances, the denitrification rate in the rice paddy lower layer soil was measured using the acetylene inhibition method under anaerobic and added nitrate conditions. A denitrification rate of 0.4-46ngN/g{sup -1} wet soil/h{sup -1} was obtained from a 40-150cm deep layer soil, smaller by the order of 1-2 than that in the surface layer soil. This suggests that the lower layer soil contributes to denitrification. 17 refs., 3 figs., 1 tab.

  20. Pancreas Scanning with Se{sup 75}-Selenomethionine; Scintigraphie du Pancreas avec de la Selenomethionine Marquee au Selenium-75; Skennirovanie podzheludochnoj zhelezy s pomoshch'yu selenometionina, mechennogo Selenom-75; Exploracion del Pancreas con Selenometionina-{sup 75}Se

    Blau, M. [Department of Nuclear Medicine, Roswell Park Memorial Institute, Buffalo, NY (United States)

    1964-10-15

    Amino-acids show a high degree of localization in the pancreas during the first few hours after administration. This specificity is related to the rapid synthesis and turnover of the digestive enzymes. Since none of the elements in the structure of amino-acids (C,H, N,0 and S) have suitable gamma-emitting isotopes, they cannot be used for scanning. Several I{sup 131} derivatives of amino-acids were prepared and tested, but the pancreas-localizing property of the original amino-acid was lost in every case. The chemical similarity of selenium and sulphur suggested that the selenium analogue of methionine might resemble methionine closely enough to take its place in protein synthesis. Se{sup 75} (halflife, 128 d; principal gamma-ray, 0.27 MeV) is suitable for scanning. Selenium-75-selenomethionine was prepared by yeast biosynthesis. The yeast was grown on a low sulphur medium containing high specific activity Se{sup 75} as selenite. After extraction with ether and hot trichloracetic acid, the protein residue was hydrolysed with hydrochloric acid The resulting amino-acid mixture was separated by column chromatography. Selenium-75-selenomethionine prepared in this manner showed biological properties of a natural aminoacid. The uptake in pancreas was about 7% of the administered dose and the concentration in a gramme of pancreas was seven times that in a gramme of liver. Blood and other organs had even lower uptakes. The clinical usefulness of pancreas scanning is now being evaluated. Tumours of the pancreas have been found as areas of decreased uptake. There is no concentration of selenomethionine in cases of acute pancreatitis. It is too early to give a statistical estimate of our ability to find tumours of the pancreas by this technique. The estimated total body dose from this procedure is less than 1 rad. The selenium dose is only a. few microgrammes and represents no toxicity hazard. (author) [Spanish] Los aminoacidos tienden a localizarse en el pancreas durante las primeras horas que siguen a su administracion. Esta especificidad esta relacionada con la rapidez de la sintesis y de la renovacion de las enzimas digestivas. Como ninguno de los elementos que componen los aminoacidos (C, H, N, O y S) tiene isotopos emisores de rayos gamma apropiados, no es posible recurrir a ellos para la exploracion centelleografica. Los autores prepararon y ensayaron varios derivados de aminoacidos marcados con 131I, pero en todos los casos comprobaron la desaparicion de la propiedad de localizarse en el pancreas caracteristica del aminoacido original. La semejanza qufmica entre el selenio y el azufre sugirio a los autores la posibilidad de que el analogo seleniado de la metionina se pareciese a esta lo suficiente para poder sustituirla en la sintesis proteica. El selenio-75 (periodo: 128 d; rayos gamma principales: 0,27 MeV) es adecuado para la exploracion. La selenometionina-75Se fue preparada biosinteticamente mediante levaduras. Estas levaduras se cultivaron en un medio con poco azufre que contenia de alta actividad especifica, en forma de selenito. El residuo protefnico extraido con eter y acido tricloracetico en caliente, se hidrolizo con acido clorhidrico. La mezcla de aminoacidos obtenida se separo por cromatografia en columna. La selenometionina-{sup 75} asi preparada tiene las propiedades biologicas de un aminoacido natural. El pancreas absorbio el 7%, aproximadamente, de la dosis administrada y la concentracion por gramo de tejido fue siete veces mayor en el pancreas que en el higado. Menor aun que en este fue la concentracion en la sangre y en otros Organos. Los autores estan ahora evaluando la utilidad clinica de la exploracion del pancreas. Han comprobado que los tumores del pancreas constituyen zonas de absorcion disminuida. En los casos de pancreatitis aguda no se produce concentracion de selenometionina. Seria prematuro estimar estadisticamente la posibilidad de aplicar esta tecnica para descubrir tumores del pancreas. Se estima que la dosis corporal total imputable a la aplicacion de este procedimiento es inferior a 1 rad. La dosis de selenio es de algunos microgramos solamente y no entrana ningun riesgo de toxicidad. (author) [Russian] Obnaruzhena vysokaja stepen' koncentracii aminokislot v podzheludochnoj zheleze v techenie pervyh neskol'kih chasov posle vvedenija. Jeta osobennost' svjazana s bystrym sintezom i krugooborotom pishhevaritel'nyh fermentov. Poskol'ku ni odin iz jelementov v strukture aminokislot (C,H,N i S) ne imeet sootvetstvujushhih gamma- izluchajushhih izotopov, ih nel'zja ispol'zovat' dlja skennirovanija. Byli podgotovleny i ispytany neskol'ko proizvodnyh aminokislot -jod-131, no v kazhdom sluchae terjalos' svojstvo ishodnoj aminokisloty sosredotochivat'sja v podzheludochnoj zheleze. Himicheskoe shodstvo selena i sery daet osnovanie schitat', chto selenovyj analog meteonina blizok k metioninu po stroeniju v dostatochnoj stepeni, chtoby zanjat' ego mesto pri sinteze belka. Selen-75 (period poluraspada 128 dnej, osnovnye dannye: gamma-luchi, 0,27 Mjev) prigoden dlja skennirovanija. Prigotavlivalsja selenometionin - selen-75 s pomoshh'ju biosinteza drozhzhej. Drozhzhi vyrashhivali na srede s nizkim soderzhaniem sery i vysokoj udel'noj aktivnost'ju selena-75 v vide selenita. Posle jekstragirovanija jefirom i gorjachej trihloruksusnoj kislotoj belkovyj ostatok podvergali gidrolizu s pomoshh'ju soljanoj kisloty. Rezul'tirujushhuju smes' aminokislot razdeljali metodom hromatografii na kolonke. Selenometionin -selen-75, podgotovlennyj takim obrazom, imel biologicheskie svojstva prirodnyh aminokislot. Pogloshhenie v podzheludochnoj zheleze sostavljalo okolo 7%vvedennoj dozy, a koncentracija na gramm podzheludochnoj zhelezy byla v 7 raz bol'she chem na gramm pecheni. Pogloshhenie v krovi i drugih organah bylo eshhe nizhe, pecheni. Pogloshhenie v krovi i drugih organah bylo eshhe nizhe. V nastojashhee vremja proizvoditsja klinicheskaja ocenka metodov skennirovanija podzheludochnoj zhelezy. Opuholi podzheludochnoj zhelezy predstavljali uchastki s men'shim pogloshheniem. Ne nabljudalos' koncentracii selenometionina v sluchajah ostrogo pankreatita. Eshhe slishkom rano davat' statisticheskuju ocenku jetogo metoda obnaruzhenija opuholej podzheludochnoj zhelezy. Predpolagaemaja obshhaja doza, poluchaemaja organizmom v rezul'tate jetoj procedury, sostavljaet menee 1 rada. Doza selena sostavljaet neskol'ko mikrogramm i ne predstavljaet opasnosti v otnoshenii toksichnosti. (author)

  1. Changed of the working capacity of CMOS integrated circuits under ionizing radiations effect of low and high dose rate; Izmeneniya rabotosposobnosti KMOP integral`nykh mikroskhem pri vozdejstvii ioniziruyushchikh izluchenij s nizkoj i vysokoj intensivnost`yu

    Bogatyrev, Yu V; Korshunov, F P

    1994-12-31

    Results of experimental investigations into the working capacity of different types of integrated CMOS circuits under effect of electron and gamma radiation are presented. Methods for evaluating IC CMOS under low irradiation intensity using the microcircuit testing under hugh intensity or at increased temperature with regard to the processes of parameter reconstruction after irradiation are proposed.

  2. Pochekaev R.Yu. Chinggis Khan’s Great Yasa in the Mongol Empire and Chinggisid States of the 13th–14th centuries: Legal Code or Ideal “Law and Order”?

    R.Yu. Pochekaev

    2016-12-01

    Full Text Available Research objective of the article is clarifying of the nature of the Greta Yasa of Chinggis Khan: was it legal code or set of specific edicts, regulations and principles? Research materials include Arabian and Persian historical sources which already were used by another researchers of the Great Yasa (D. Ayalon, D.O. Morgan, as well as new sources on the history of the Mongol Empire, the Golden Horde, Yuan Empire, Chaghataid state recently introduced into scholarly circulation. Research results of the article consist in getting of arguments that the Great Yasa, in fact, was a set of specific principles and rules established by Chinggis Khan, and their observance provided a harmony in the Mongol Empire and the states of Chinggisids, i.e. the Great Yasa was a kind of “law and order” but not a legal code. Research novelty of the article is represented by analysis of the level of the legal development of the Mongols of the 13th–14th cc. when they didn’t need a special codification to regulate their legal relations, that’s why no one authentic source mentioned the Great Yasa as code of laws and it is characterized in this way only by representatives of the “written legal culture” (European, Caucasus, Arabian, etc..

  3. Relationship between surface structure of silicon containing steel and adhesion of hot dip galvanized coating; Si gan'yu koban no hyomen kozo to yoyu aen mekki micchakuseino kankei

    Tsuchiya, Y.; Hashimoto, S.; Ishibashi, Y. [Kokan Keisoku K.K., Kawasaki (Japan); Inagaki, J. [NKK Corp., Tokyo (Japan); Fukuda, Y. [Shuibuoka University, Shizuoka (Japan)

    2000-06-01

    The surface of the annealed steel and the exfoliated interface of the coating for the hot dip galvanized Si containing steel sheets was characterized by using SEM (Scanning Electron Microscope), AES (Auger Electron Spectroscopy) and TEM (Transmission Electron Microscopy). The adhesion of the coatings have depended on the Si content of the steel. It have been found that MnSiO{sub 3} particles are formed at the surface of the annealed steels having high Si content and that two types of grain having different distribution of the oxide exist in the steels. Large oxide particles have been formed in one type of grain and small particles are formed in the other type of grain. The different type of Fe-Zn alloy are formed on two types of grains. It have been observed that the oxide particles exist at the interface of exfoliated coatings after the adhesion test for the steels with high Si content. The distribution of the oxide particles observed at the bottom of the exfoliated coating is quite similar to that of the surface oxide of the annealed steel. From these results, the exfoliation of the coating has initiated at the oxide particles of the steel surface that has been not reduced during the hot dip galvanizing. (author)

  4. Fitter. The package for fitting a chosen theoretical multi-parameter function through a set of data points. Application to experimental data of the YuMO spectrometer. Version 2.1.0. Long write-up and user's guide

    Solov'ev, A.G.; Stadnik, A.V.; Islamov, A.N.; Kuklin, A.I.

    2008-01-01

    Fitter is a C++ program aimed to fit a chosen theoretical multi-parameter function through a set of data points. The method of fitting is chi-square minimization. Moreover, the robust fitting method can be applied to Fitter. Fitter was designed to be used for a small-angle neutron scattering data analysis. Respective theoretical models are implemented in it. Some commonly used models (Gaussian and polynomials) are also implemented for wider applicability

  5. Problems of the agriculture radiology and radiobiology at the environment contamination by the young mixture of the nuclear fission products; Problemy sel'skokhozyajstvennoj radioehkologii i radiobiologii pri zagryaznenii okruzhayushchej sredy molodoj smes'yu produktov yadernogo deleniya

    Prister, B S

    2008-07-01

    The basic problem on population radiation safety and the farm production at the environment contamination by the young mixture of the nuclear fission products are considered. In the field experiments, the conformities of the out of root plant contamination, kinetics of the irradiation absorbed doses and the biological effect of the NFP on the plants during the different ontogenesis phases are investigated. The kinetics of the nuclear fission product accumulation and drawing out from the cattle organisms of the most movable radionuclides in the biological systems; the distribution and kinetics of the absorbed irradiation doses formation and the nuclear fission products biological effect on the cattle organism is studied. The comparative quantitative assessment of the meaning of the basic formation factors of the radiation situation is produced.

  6. Synthesis of Graft Copolymers by Small Doses of Irradiation; Synthese des copolymeres greffes au moyen de petites doses de rayonnements; Sintez privitykh sopolimerov s pomoshch'yu malykh doz oblucheniya; Sintesis de copolimeros de injerto mediante pequenas dosis de radiacion

    Dobo, J; Somogyi, M; Kiss, L

    1960-07-15

    In addition to grafting, there is often an undesirable alteration in the properties of the original polymer when polymer monomer mixtures are irradiated. As a result of irradiation, grafting occurs not only on the original polymeric backbone, but also on the already grafted side-chains. The result is an acceleration of grafting. The effect is especially pronounced in the case of preformed polymers, if irradiation is carried out intermittently. The grafting of styrene can be accelerated by the addition of some solvents which suppress the protective effect of the styrene on the polymer. Grafting can be accelerated by other additives. The swelling properties of the irradiated films were investigated. (author) [French] Lorsque des melanges de polymeres et de monomeres sont soumis a des rayonnements, il se produit souvent, en meme temps que la greffe, une alteration facheuse des proprietes du polymere original. L'irradiation provoque une reaction de greffage, non seulement sur le polymere original, mais aussi sur les chaines laterales deja greffees. Il en resulte une acceleration du processus de greffage. L'effet est particulierement marque dans le cas des polymeres preformes, lorsque l'irradiation est effectuee par intermittence. On peut accelerer le processus de greffage du styrolene en ajoutant certains solvants qui suppriment l'action protectrice du styrolene sur le polymere. On peut aussi accelerer le processus a l'aide d'autres additifs. Les auteurs ont etudie les proprietes de gonflement des pellicules irradiees. (author) [Spanish] Simultaneamente con el injerto, bajo la accion de las radiaciones se produce frecuentemente una alteracion de las propiedades del polimero original, efecto que convendria evitar. Por lo tanto, quiza ofrezcan interes los elevados grados de injerto obtenidos en nuestros laboratorios con pequenas dosis de radiacion. La irradiacion no solo provoca una reaccion de injerto en la estructura polimerica original, sino tambien en las cadenas laterales injertadas. Ello se traduce en una aceleracion, del proceso de injerto. Este efecto es especialmente pronunciado en el caso de los polimeros preformados, cuando la irradiacion es intermitente. El injerto de las moleculas de estireno puede acelerarse anadiendo algunos solventes que suprimen la accion protectora ejercida por el estireno sobre el polimero. Asimismo, el proceso puede acelerarse agregando otras sustancias. Al injertar moleculas de metacrilato de metilo en el polietileno, hemos conseguido un injerto de 6 400 por ciento con una dosis de 31 400 roentgens. Hemos examinado la estructura de los copolimeros asi obtenidos. (author) [Russian] Grafting (privivanie ) chasto soprovozhdaetsya nezhelatel'nym izmeneniem svojstv pervonachal'nogo polimera pri obluchenii monomernykh smesej polimera. Pod vozdejstviem oblucheniya grafting proiskhodit ne tol'ko v pervonachal'noj polimernoj osnove, no takzhe v bokovoj tsepi, uzhe podvergnuvshejsya graftingu. Grafting v rezul'tate ehtogo uskoryaetsya. EHtot ehffekt osobenno yarko vyrazhen v tverdykh polimerakh, esli obluchenie proizvoditsya periodicheski. Grafting stirola mozhet byt' uskoren dobavleniem nekotorykh rastvoritelej, kotorye blokiruyut zashchitnoe vozdejstvie stirola na dannyj polimer. Grafting mozhet byt' uskoren i drugimi additivami. Issleduyutsya kachestva nabukhaniya obluchennoj plenki. (author)

  7. Disinfestation of Dried Figs by Gamma Radiation; Desinsectation des figues seches par les rayons gamma; Dezinfestatsiya sushenogo inzhira s pomoshch'yu gamma-izlucheniya'; Desinfestacion de higos secos mediante rayos gamma

    Papadopoulou, C. P. [Department of Biology, Democritus Nuclear Research Centre, Aghia Paraskevi, Attica (Greece)

    1963-09-15

    Research has been carried on for many years on the disinfestation of stored agricultural products. Recently gamma radiation has been successfully applied in such investigations. Dried figs are among the main export products of Greece. Serious damage is caused by insect attack each year. The research work aimed at: (1) Determining the doses of radiation required to destroy certain species of insects attacking dried figs at their various stages of development, or to destroy their eggs and thus prevent reproduction; and (2) Determining the physical and chemical changes of the texture of dried figs caused by radiation. Studies have been made on the following species: Plodia interpunctella, Ephestia cautella, Carpophilus hemipterous, Oryzaephilus surinamensis and Lasioderma serricorne. The optimum doses required are discussed. At these doses, irradiation damage does not become apparent in the texture of the figs. (author) [French] Des recherches sur la desinsectation des produits agricoles en magasin sont en cours depuis de nombreuses annees. On a recemment utilise avec succes les rayons gamma dans ces etudes. Les insectes font chaque annee de grands ravages dans les figues seches, qui sont l'un des principaux produits d'exportation de la Grece. L'objet des recherches etait le suivant: 1. Determiner les doses de rayonnements necessaires pour detruire certaines especes d'insectes qui, a differents stades de leur developpement, attaquent les figues, ou detruire leurs oeufs et les empecher ainsi de se reproduire; 2. Determiner les modifications physiques et chimiques que les rayonnements produisent dans la texture de la figue seche. Les travaux ont porte sur les especes suivantes: Plodia interpunctella, Ephestia cautella, Carpophilus hemipterous, Oryzaephilus surinamensis et Lasioderma serricorne. Le memoire etudie les dises optimum d'irradiation, qui ne provoquent aucun dommage visible dans la texture de la figue. (author) [Spanish] Des hace muchos anos se estan efectuando investigaciones sobre la desinfestacion de los productos agricolas almacenados. En esas investigaciones se han utilizado recientemente con exito los rayos gamma. Los higos secos constituyen uno de los principales productos de exportacion de Grecia y los insectos ocasionan perdidas importantes. Las investigaciones tenian las siguientes finalidades: a) determinar las dosis de radiacion necesarias para destruir ciertas especies de insectos que atacan los higos en diversas fases de su desarrollo, o destruir sus huevos impidiendo asi que se reproduzcan; b) determinar las modificaciones fisicas y quimicas que las radiaciones producen en la contextura de los higos secos. Se han estudiado las especies siguientes: Plodia interpunctella, Ephestia cautella, Carpophilushemipterous, Oryzaephilus surinamensis y Lasioderma serricorne. En la memoria se estudian las dosis optimas de radiacion que no producen dafios aparentes en la contextura de los higos. (author) [Russian] V techenie mnogikh let provodyatsya issledovaniya to voprosam dezinfestatsii sel'skokhozyajstvennykh produktov v khranilishchakh. Nedavno gamma-izluchechie bylo uspeshno primeneno pri provedenii takikh issledovanij. Sushenyj inzhir sostavlyaet odin iz osnovnykh produktov ehksporta Gretsii. Ezhegodno nasekomye nanosyat ser'eznyj ushcherb ehtomu produktu. Tsel' issledovaniya: 1) opredelenie doz izlucheniya, neobkhodimykh dlya unichtozheniya nekotorykh vidov nasekomykh, porazhayushchikh sushenyj inzhir, na razlichnykh stadiyakh ikh razvitiya, i dlya unichtozheniya ikh yaits i predotvrashcheniya takim obrazom ikh razmnozheniya; i 2) opredelenie fiziko-khimicheskikh izmenenij tekstury sushenogo inzhira pod dejstviem izlucheniya. Issledovaniya provodilis' so sleduyushchimi vidami: Plodia Interpunctella, Ephestia coutella, Carpophilus hemipterous, Gryzaephllus surinamensis i Lasioderma serricorne. Obsuzhdayutsya neobkhodimye optimal'nye dozy. Pri ehtikh dozakh ne nablyudaetsya vidimogo narusheniya tekstury inzhira pod dejstviem oblucheniya. (author)

  8. Treatment with metformin and a dipeptidyl peptidase-4 inhibitor elevates apelin levels in patients with type 2 diabetes mellitus

    Fan YJ

    2015-08-01

    Full Text Available Yujuan Fan,* Yu Zhang,* Xuesong Li,* Hui Zheng, Yuping Song, Ning Zhang, Chunfang Shen, Xiaofang Fan, Fengdong Ren, Jiayi Shen, Guoguang Ren, Jialin Yang Department of Endocrinology, Central Hospital of Minhang District, Minhang Hospital affiliated to Fudan University, Shanghai, People’s Republic of China *These authors contributed equally to this work Background: The objective of this study was to assess the effects of metformin monotherapy or combined treatment with a dipeptidyl peptidase-4 inhibitor (vildagliptin on apelin levels in patients with type 2 diabetes mellitus. Methods: Twenty-five patients with poor glycemic control (glycosylated hemoglobin >6.5% [48 mmol/mol] taking 1,000 mg of metformin daily and 25 healthy controls matched for age and body mass index were enrolled in this study. Anthropometric parameters, glycemic and lipid profile, insulin resistance (homeostasis model assessment of insulin resistance index, and apelin levels were measured at baseline and at 12-week and 24-week visits. Results: At baseline, apelin levels were higher in the T2DM patients than in the controls (1.93±1.81 ng/mL versus 6.09±4.90 ng/mL; P<0.05. After 12 weeks, when vildagliptin was added, fasting blood glucose and glycosylated hemoglobin decreased, and apelin levels increased further (from 6.09±4.90 ng/mL to 24.23±12.59 ng/mL; P<0.05. Follow-up at 24 weeks showed no further improvement in the glycemic profile and no further increase in apelin levels. Conclusion: Both metformin and vildagliptin favorably changed glycemic indices and apelin levels. For patients inadequately controlled on a low dose of metformin, addition of vildagliptin may be helpful. Keywords: glucagon-like peptides, glucose-dependent insulinotropic polypeptide, antidiabetic drug, adipocytokine

  9. Quantum dot-induced viral capsid assembling in dissociation buffer

    Gao D

    2013-06-01

    Full Text Available Ding Gao,1,2 Zhi-Ping Zhang,1 Feng Li,3 Dong Men,1 Jiao-Yu Deng,1 Hong-Ping Wei,1 Xian-En Zhang,1 Zong-Qiang Cui1 1State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan, 2Graduate University of Chinese Academy of Sciences, Beijing, 3Division of Nanobiomedicine and i-Lab, Suzhou Institute of Nano-Tech and Nano-Bionics, Chinese Academy of Sciences, Suzhou, People's Republic of China Abstract: Viruses encapsulating inorganic nanoparticles are a novel type of nanostructure with applications in biomedicine and biosensors. However, the encapsulation and assembly mechanisms of these hybridized virus-based nanoparticles (VNPs are still unknown. In this article, it was found that quantum dots (QDs can induce simian virus 40 (SV40 capsid assembly in dissociation buffer, where viral capsids should be disassembled. The analysis of the transmission electron microscope, dynamic light scattering, sucrose density gradient centrifugation, and cryo-electron microscopy single particle reconstruction experimental results showed that the SV40 major capsid protein 1 (VP1 can be assembled into ≈25 nm capsids in the dissociation buffer when QDs are present and that the QDs are encapsulated in the SV40 capsids. Moreover, it was determined that there is a strong affinity between QDs and the SV40 VP1 proteins (KD = 2.19E-10 M, which should play an important role in QD encapsulation in the SV40 viral capsids. This study provides a new understanding of the assembly mechanism of SV40 virus-based nanoparticles with QDs, which may help in the design and construction of other similar virus-based nanoparticles. Keywords: quantum dots, simian virus 40, self-assembly, encapsulation, virus-based nanoparticles

  10. High expression of HEF1 is associated with poor prognosis in urinary bladder carcinoma

    Zhang Q

    2014-07-01

    Full Text Available Qi Zhang,1 Hui-Ju Wang,2 Da-Hong Zhang,1 Guo-Qing Ru,3 Xu-Jun He,2 Ying-Yu Ma2 1Department of Urology, 2Key Laboratory of Gastroenterology of Zhejiang Province, 3Department of Pathology, Zhejiang Provincial People's Hospital, Hangzhou, People's Republic of China Abstract: Human enhancer of filamentation 1 (HEF1 is a multidomain scaffolding protein that has been thought to play an important role in the tumor progression of various cancers. HEF1 expression has not previously been reported in urinary bladder carcinoma, and little is known about its prognostic significance. The aim of this study was to evaluate the expression patterns of HEF1 in urinary bladder carcinoma and to investigate its prognostic significance. HEF1 expression was analyzed by immunohistochemistry using tissue microarray. A significant relationship between HEF1 expression and sex, tumor size, number of tumors, invasion depth, lymph node metastasis, and distant metastasis was found, and high expression of HEF1 was associated with worse overall survival when compared to low expression of HEF1. Multivariate analysis showed that HEF1 expression was an independent prognostic factor for overall survival in urinary bladder carcinoma. We investigated HEF1 expression in urinary bladder carcinoma and found that high HEF1 expression was associated with advanced stage, large tumor size, and shortened progression-free survival. Although the biologic function of HEF1 in urinary bladder carcinoma remains unknown, the expression of HEF1 can provide new prognostic information for disease progression. Keywords: human enhancer of filamentation 1, progression-free survival, immunohistochemistry, metastasis, bladder cancer

  11. Comparative effects of different enteral feeding methods in head and neck cancer patients receiving radiotherapy or chemoradiotherapy: a network meta-analysis

    Zhang ZH

    2016-05-01

    Full Text Available Zhihong Zhang,1,2 Yu Zhu,1 Yun Ling,3 Lijuan Zhang,1 Hongwei Wan1 1Department of Nursing, Shanghai Proton and Heavy Ion Center, 2Shanghai First Maternity and Infant Hospital, Tongji University School of Medicine, 3Department of Human Resource, Shanghai Proton and Heavy Ion Center, Shanghai, People’s Republic of China Abstract: Nasogastric tube (NGT and percutaneous endoscopic gastrostomy were frequently used in the head and neck cancer patients when malnutrition was present. Nevertheless, the evidence was inclusive in terms of the choice and the time of tube placement. The aim of this network meta-analysis was to evaluate the comparative effects of prophylactic percutaneous endoscopic gastrostomy (pPEG, reactive percutaneous endoscopic gastrostomy (rPEG, and NGT in the head and neck cancer patients receiving radiotherapy or chemoradiotherapy. Databases of PubMed, Web of Science, and Elsevier were searched from inception to October 2015. Thirteen studies enrolling 1,631 participants were included in this network meta-analysis. The results indicated that both pPEG and NGT were superior to rPEG in the management of weight loss. pPEG was associated with the least rate of treatment interruption and nutrition-related hospital admission among pPEG, rPEG, and NGT. Meanwhile, there was no difference in tube-related complications. Our study suggested that pPEG might be a better choice in malnutrition management in the head and neck cancer patients undergoing radiotherapy or chemoradiotherapy. However, its effects need to be further investigated in more randomized controlled trials. Keywords: malnutrition, tube feeding, weight loss, treatment interruption, readmission, complication

  12. Triazole derivatives with improved in vitro antifungal activity over azole drugs

    Yu S

    2014-04-01

    Full Text Available Shichong Yu,1,* Xiaoyun Chai,1,* Yanwei Wang,1 Yongbing Cao,2 Jun Zhang,3 Qiuye Wu,1 Dazhi Zhang,1 Yuanying Jiang,2 Tianhua Yan,4 Qingyan Sun11Department of Organic Chemistry, School of Pharmacy, Second Military Medical University, Shanghai, People's Republic of China; 2Drug Research Center, School of Pharmacy, Second Military Medical University, Shanghai, People's Republic of China; 3Overseas Education Faculty of the Second Military Medical University, Shanghai, People's Republic of China; 4Department of Pharmacology, School of Pharmacy, China Pharmaceutical University, Nanjing, People's Republic of China*These authors contributed equally to this workAbstract: A series of triazole antifungal agents with piperidine side chains was designed and synthesized. The results of antifungal tests against eight human pathogenic fungi in vitro showed that all the compounds exhibited moderate-to-excellent activities. Molecular docking between 8d and the active site of Candida albicans CYP51 was provided based on the computational docking results. The triazole interacts with the iron of the heme group. The difluorophenyl group is located in the S3 subsite and its fluorine atom (2-F can form H-bonds with Gly307. The side chain is oriented into the S4 subsite and formed hydrophobic and van der Waals interactions with the amino residues. Moreover, the phenyl group in the side chain interacts with the phenol group of Phe380 through the formation of π–π face-to-edge interactions.Keywords: synthesis, CYP51, molecular docking, azole agents

  13. Gene therapy for C-26 colon cancer using heparin-polyethyleneimine nanoparticle-mediated survivin T34A

    Zhang L

    2011-10-01

    Full Text Available Ling Zhang1,*, Xiang Gao1,2,*, Ke Men1, BiLan Wang1, Shuang Zhang1, Jinfeng Qiu1, Meijuan Huang1, MaLing Gou1, Ning Huang2, ZhiYong Qian1, Xia Zhao1, YuQuan Wei11State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medical School, 2Department of Pathophysiology, College of Preclinical and Forensic Medical Sciences, Sichuan University, Chengdu, People’s Republic of China*These authors contributed equally to this workBackground: Gene therapy provides a novel method for the prevention and treatment of cancer, but the clinical application of gene therapy is restricted, mainly because of the absence of an efficient and safe gene delivery system. Recently, we developed a novel nonviral gene carrier, ie, heparin-polyethyleneimine (HPEI nanoparticles for this purpose.Methods and results: HPEI nanoparticles were used to deliver plasmid-expressing mouse survivin-T34A (ms-T34A to treat C-26 carcinoma in vitro and in vivo. According to the in vitro studies, HPEI nanoparticles could efficiently transfect the pGFP report gene into C-26 cells, with a transfection efficiency of 30.5% ± 2%. Moreover, HPEI nanoparticle-mediated ms-T34A could efficiently inhibit the proliferation of C-26 cells by induction of apoptosis in vitro. Based on the in vivo studies, HPEI nanoparticles could transfect the Lac-Z report gene into C-26 cells in vivo. Intratumoral injection of HPEI nanoparticle-mediated ms-T34A significantly inhibited growth of subcutaneous C-26 carcinoma in vivo by induction of apoptosis and inhibition of angiogenesis.Conclusion: This research suggests that HPEI nanoparticle-mediated ms-T34A may have a promising role in C-26 colon carcinoma therapy.Keywords: gene therapy, mouse survivin-T34A, colon cancer, polyethyleneimine, nanoparticles, cancer therapy

  14. Achievement report for fiscal 2000 on development of technology related to new recycled products. Research and development of simultaneous recovery of chlorine contained in waste plastics and alkali contained in waste glass bottles; 2000 nendo shinki recycle seihin nado kanren gijutsu kaihatsu seika hokokusho. Hai plastic gan'yu enso to hai glass bin gan'yu alkali no doji kaishu ni kakawaru kenkyu kaihatsu

    NONE

    2001-03-01

    Researches have been made on a technology to have alkali contained in waste glass bottles reacted with chlorine contained in waste plastics to separate and remove salt, and reuse the residues as a resource for cement raw material. This paper summarizes the achievements in fiscal 2000. In the research, glass powder pulverized to 5 to 10 {mu} m, calcium carbonate, iron oxide, and alumina were used to prepare raw material for the ordinary Portland cement. Vinyl chloride pulverized to 3 mm was added into this cement raw material so that chlorine-alkali equivalent ration will be 1.0, and the material was sintered in a rotary kiln at 800 to 1,400 degrees C. As a result, it was discovered that salt is produced from the alkali in glass and the chlorine in vinyl chloride, whereas the produced salt volatilizes when heated to 1,200 degrees C or higher, and clinker containing low chlorine and alkali can be produced. The test result reveals that the control range of the chlorine and alkali ratio is from 1.0 to 1.1. The remaining problems are measures against carbon monoxide and dioxin contained in the exhaust gas, and treatment of dust containing salt. (NEDO)

  15. Nuclear Materials Management and its Relationship to Nuclear Safety and Criticality Control; La Gestion des Matieres Nucleaires et ses Rapports avec la Securite Nucleaire et le Controle de la Criticite; Obrashchenie s yadernymi materialami i ego svyaz' s yadernoj bezopasnost'yu i kontrolem nad kritichnost'yu; La Administracion de Materiales Nucleares y sus Relaciones con la Seguridad Nuclear y el Control de la Criticidad

    Tingey, F. H. [Phillips Petroleum Company, Idaho Falls, ID (United States)

    1966-02-15

    The preclusion of those conditions which would result in an inadvertent collection of fissionable material in quantity, geometry and environment to produce a neutron chain reaction is of fundamental importance to all those actively engaged in the nuclear industry. It is of particular concern to those individuals who are. responsible for the handling, transfer and storage of the fissionable materials in the performance of their various tasks. These same people are part of the nuclear materials management (NMM) system. They are the individuals who are primarily responsible for generating and receiving the SS accountability data channelled through the NMM office and as such must depend upon that office for valid and timely information in discharging their responsibility. Basically the responsibility for preventing inadvertent criticality in any area of plant operation lies with line supervision. In devising preventative measures at least three different types of problems need be considered. These are: (a) The scientific or technical problems connected with evaluating the hazard presented by a proposed quality of fissile material in a given geometry and environment; (b) The engineering problems presented by the restrictions dictated from the scientific or technical considerations; (c) The purely administrative problems presented in implementing the restrictions and requirements imposed from the technical and engineering considerations. To assist the supervisor in the successful discharge of this responsibility, some organizations provide certain groups or committees specialized in particular areas. Usually the technical problems are submitted to criticality specialists, commonly called a Nuclear Safety Committee, who are familiar with the experimental data of critical systems and can by theoretical calculation extend this experience to the problems at hand. Support in the engineering problems is given by plant engineering groups made cognizant of the requirements dictated by the technical considerations and familiar with the operational limitations. The administrative problems are solved through procedural restrictions placed by the supervisor. The NMM office can be most valuable in further support to the supervisor in these activities. The primary responsibility of this office is to alert responsible supervision to potentially hazardous situations as indicated either from information made available through the routine processing of accountability data or from material balance calculations. Any information pertaining to criticality studies as requested from the NMM office must be accurate and precise. A vigorous inventory management policy must be pursued to lessen the problems presented by accumulation of fissile materials. Internal audit by the NMM staff of inventory holdings can also serve to verify adherence to safeguard procedures. A vigorous orientation programme can be implemented by the NMM staff in its dealing with those individuals handling nuclear materials to make them more aware of the hazards involved. The integration of the NMM group into the general criticality safeguard problems at the NRT and has provided an effective system for assisting the line supervision in discharging this very important responsibility. (author) [French] Il est essentiel pour tous ceux qui travaillent dans l'industrie nucleaire de savoir comment eviter que des matieres nucleaires ne se trouvent rassemblees en quantites, selon une geometrie ou dans un milieu tels qu'elles puissent donner lieu a une reaction neutronique en chaine. Ceci interesse tout particulierement ceux qui, dans l'exercice de leurs fonctions, sont responsables de la manipulation, du transfert et de l'entreposage des matieres fissiles. Ces memes personnes participent au systeme de gestion des matieres nucleaires. Elles ont au premier chef la responsabilite de fournir et de recevoir les donnees comptables par l'intermediaire du service de gestion des matieres nucleaires; elles dependent donc de ce service pour les renseignements precis dont elles ont besoin pour assumer leurs responsabilites. C'est en premier lieu a la personne chargee de la surveillance generale du circuit qu'il incombe de veiller a ce qu'en aucun point les matieres nucleaires ne puissent, par inadvertance, atteindre l'etat critique. Pour mettre au point des mesures preventives, il faut tenir compte d'au moins trois categories de problemes, a savoir: a) Les problemes scientifiques et techniques lies a l'evaluation des risques que presente une certaine quantite de matieres fissiles disposee selon une certaine geometrie dans un certain endroit; b) Les problemes materiels souleves par les restrictions qu'imposent les considerations scientifiques ou techniques; c) Les problemes purement administratifs a resoudre pour respecter les restrictions et les conditions particulieres imposees par les considerations techniques et materielles. Pour aider le responsable de la surveillance a s'acquitter de sa tache, certaines organisations prevoient des groupes ou des comites specialises dans des domaines particuliers. Les problemes techniques sont le plus souvent soumis a des specialistes de la criticite, generalement constitues en comites de securite nucleaire, qui connaissent bien les donnees experimentales des systemes critiques et peuvent, par le calcul, exploiter cette experience pour resoudre les problemes qui se posent. En ce qui concerne les problemes materiels, ils sont soumis a des groupes de techniciens que l'on met au courant des conditions particulieres qu'imposent les facteurs techniques et qui connaissent bien les limites de fonctionnement de l'installation. Quant aux problemes administratifs, le responsable de la surveillance se charge de les resoudre' en reglementant les activites en consequence. Le service de gestion des matieres nucleaires peut apporter une aide precieuse au responsable de la surveillance. C'est tout d'abord a ce service qu'il incombe d'alerter le service de surveillance en lui signalant les conditions presentant un danger potentiel qu'il a pu deceler par l'etude des donnees comptables ou par le bilan matieres. Tous les renseignements demandes au service de gestion des matieres nucleaires au sujet de la criticite doivent etre exacts et precis. Un systeme efficace de controle de l'inventaire doit etre applique pour limiter les problemes que pose l'accumulation de matieres fissiles. En faisant proceder par le personnel du service de gestion des matieres nucleaires a une verification interne des matieres consignees dans l'inventaire, on peut egalement s'assurer que les mesures de securite sont bien appliquees. Le service de gestion des matieres nucleaires peut aussi assurer la formation du personnel charge de la manipulation des matieres nucleaires afin de lui faire prendre devantage conscience des risques encourus. En associant le service de gestion des matieres nucleaires aux specialistes de la prevention des etats critiques, la National Reactor Testing Station (NRTS) dispose d'un systeme efficace pour faciliter la tache du responsable de la surveillance du circuit matieres. (author) [Spanish] Para las personas que desempenan funciones importantes en la industria nuclear es de suma importancia evitar las acumulaciones accidentales de material fisionable en cantidades, medios y disposiciones que puedan ocasionar una reaccion neutronica en cadena. Esto concierne especialmente a los encargados de la manipulacion, la transferencia y el almacenamiento de dichos materiales. Estas personas forman parte del sistema de administracion de materiales nucleares y son fundamentalmente responsables de facilitar y recibir, por conducto de los servicios de administracion, datos contables relativos a los materiales basicos y a los materiales fisionables especiales; para que puedan desempenar satisfactoriamente sus funciones, es preciso que los servicios dispongan de informacion valida en el momento oportuno. Basicamente, la prevencion de los accidentes de criticidad en cualquier etapa del funcionamiento de una planta es una de las funciones inherentes a la inspeccion de las operaciones. Al proyectar las medidas preventivas hay que considerar, por lo menos, tres grupos distintos de problemas: a) Los problemas cientificos y tecnicos relativos a la evaluacion de los riesgos que presenta la acumulacion de materiales fisionables en cantidades, disposiciones y medios determinados; b) Los problemas de ingenieria que plantean las restricciones basadas en consideraciones de caracter cientifico o tecnico; c) Los problemas puramente administrative' que suscitan las limitaciones impuestas por cuestiones tecnicas y de ingenieria. Para facilitar el desempeno de las funciones de los inspectores algunas organizaciones han constituido comites especializados en determinados aspectos de la cuestion. Por lo general, los problemas tecnicos se someten a especialistas en criticidad, comunmente agrupados en un comite de seguridad nuclear, quienes conocen los datos experimentales de los sistemas criticos y pueden por calculo teorico extender ese conocimiento a los problemas especificos de la planta. Para los problemas de ingenieria se cuenta con la cooperacion de los grupos de ingenieros, a los cuales se mantiene informados de las necesidades impuestas por consideraciones tecnicas y de las limitaciones operativas. Los problemas administrativos se resuelven mediante restricciones de procedimiento dictadas por el inspector. Los servicios de administracion de materiales nucleares pueden facilitar en gran medida las tareas de inspeccion. En primer lugar, estos servicios tienen el deber de alertar a los inspectores cuando la informacion de que disponen gracias a la sistematizacion de los datos contables o a calculos basados en el balance de materiales revela la existencia de una situacion que puede resultar peligrosa. Toda la informacion referente a cuestiones de criticidad facilitada por los servicios de administracion de materiales nucleares debe ser exacta y precisa. Es necesario seguir una politica rigida de administracion de existencias a fin de limitar los problemas que suscita la acumulacion de materiales fisionables. La comprobacion interna de las existencias por el personal de los servicios de administracion puede servir tambien para verificar si se aplican los procedimientos de salvaguardia. Este personal puede llevar a cabo una importante labor de orientacion informando a los encargados de manipular los materiales fisionables sobre los peligros que sus actividades implican. La orientacion de los servicios de administracion de materiales nucleares hacia los problemas relativos a la prevencion de la criticidad aumenta considerablemente la eficacia de las inspecciones. (author) [Russian] Dlja vseh, aktivno rabotajushhih v oblasti jadernoj promyshlennosti, chrezvychajno vazhno ne dopuskat' sozdanija takih uslovij, kotorye mogli by privesti k nepredusmotrennomu skopleniju rasshhepljajushhih materialov v takih kolichestvah, geometrii i okruzhenii, kotorye mogut vyzvat' cepnuju reakciju nejtronov. Jeto osobenno vazhno dlja teh, na kom lezhit otvetstvennost' za pogruzochno-razgruzochnye raboty, peremeshhenie i hranenie rasshhepljajushhihsja materialov v hode vypolnenija razlichnyh zadanij. Jeti-zhe lica vhodjat v sistemu administrativno-hozjajstvennogo ucheta jadernyh materialov. Na objazannosti jetih lic lezhit v pervuju ochered' otvetstvennost' za sostavlenie i poluchenie dannyh statisticheskoj otchetnosti, napravljaemyh cherez Upravlenie po administrativnohozjajstvennomu uchetu jadernyh materialov, i v kachestve takovyh pri vypolnenii svoih objazannostej oni dolzhny obrashhat'sja v ukazannoe Upravlenie za predostavleniem im pravil'noj i svoevremennoj informacii. V osnovnom otvetstvennost' za nedopushhenie nepredusmotrennoj kritichnosti v ljuboj zone jekspluatacii ustanovki lezhit na rukovoditele rabot. Pri vyrabotke predupreditel'nyh meroprijatij sleduet uchityvat' po men'shej mere tri razlichnyh vida problem, a imenno: a) problemy nauchnogo ili tehnicheskogo haraktera, svjazannye s opredeleniem stepeni opasnosti, voznikajushhej v rezul'tate sosredotochenija v opredelennoj geometrii i okruzhenii namechaemyh kolichestv rasshhepljajushhihsja materialov; b) tehnologicheskie problemy, vytekajushhie iz diktuemyh nauchnymi i tehnicheskimi soobrazhenijami ogranichenij; v) chisto administrativjaye problemy, voznikajushhie pri osushhestvlenii ogranichenij i trebovanij, nalagaemyh po tehnicheskim i tehnologicheskim soobrazhenijam. Dlja okazanija sodejstvija rukovoditelju v celjah uspeshnogo vypolnenija im jetih funkcij nekotorye organizacii sozdajut opredelennye gruppy ili komitety, specializirovannye v opredelennyh oblastjah. Obychno tehnicheskie problemy predstavljajutsja na rassmotrenie specialistov po kritichnosti, ob{sup e}dinjaemyh v tak nazyvaemye Komitety po jadernoj bezopasnosti, kotorye horosho oznakomleny s jeksperimental'nymi dannymi kriticheskih sistem i v sostojanii raschetnym putem primenit' svoj opyt k dannoj konkretnoj probleme. Pomoshh' v tehnicheskih voprosah predostavljaetsja tehnicheskim personalom predprijatija, oznakomlennym s trebovanijami, diktuemymi tehnicheskimi soobrazhenijami, i horosho osvedomlennym otnositel'no jekspluatacionnyh ogranichenij. Administrativnye problemy razreshajutsja putem nalagaemyh rukovoditelem procedurnyh ogranichenij. Upravlenie po administrativno-hozjajstvennomu uchetu jadernyh materialov mozhet okazyvat' rukovoditelju dal'nejshuju podderzhku v ego rabote v jetoj oblasti. Prezhde vsego i glavnym obrazom na jetom Upravlenii lezhit objazannost' svoevremenno preduprezhdat' rukovodjashhie organy o vozmozhnosti sozdanija opasnyh polozhenij, kotorye mogut vyjasnit'sja libo na osnovanii svedenij, postupajushhih v rezul'tate povsednevnoj obrabotki dannyh otchetnosti, libo na osnovanii material'nyh raschetnyh balansov. Ljubye zaprashivaemye ot Upravlenija po administrativno-hozjajstvennomu uchetu jadernyh materialov svedenija, kasajushhiesja izuchenija kritichnosti, dolzhny byt' pravil'nymi i tochnymi. Dlja oblegchenija polozhenija, voznikajushhego v rezul'tate nakoplenija rashhepljajushhihsja materialov, sleduet strogo osushhestvljat' raspolozhenie material'nymi zapasami. Dlja proverki sobljudenija pravil bezopasnosti mozhet sluzhit' vnutrennjaja revizija inventarnyh zapisej personalom Upravlenija po administrativno-hozjajstvennomu uchetu jadernyh materialov. Dlja lic, imejushhih delo s jadernymi materialami, personal jetogo upravlenija mozhet provodit' intensivnuju programmu obluchenija dlja luchshego ponimanija imi svjazannoj s kritichnost'ju opasnosti. Na nacional'noj reaktornoj ispytatel'noj stancii vkljuchenie personala jetogo Upravlenija v razreshenie obshhih problem kritichnosti privelo k sozdaniju jeffektivnoj organizacii po okazaniju pomoshhi rukovodstvu v vypolnenii otvetstvennoj raboty. (author)

  16. Programmed death-ligand 1 expression correlates with diminished CD8+ T cell infiltration and predicts poor prognosis in anal squamous cell carcinoma patients

    Zhao Y

    2017-12-01

    Full Text Available Yu-Jie Zhao,1 Wei-Peng Sun,2 Jian-Hong Peng,1 Yu-Xiang Deng,1 Yu-Jing Fang,1 Jun Huang,2 Hui-Zhong Zhang,3 De-Sen Wan,1 Jun-Zhong Lin,1,* Zhi-Zhong Pan,1,* 1Department of Colorectal Surgery, State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, Sun Yat-sen University Cancer Center, 2Department of Colorectal Surgery, The Sixth Affiliated Hospital of Sun Yat-sen University, 3Department of Pathology, Sun Yat-sen University Cancer Center, Guangzhou, People’s Republic of China *These authors contributed equally to this work Objective: Increased expression of programmed death-ligand 1 (PD-L1 on tumor cells can be found in various malignancies; however, very limited information is known about its role in anal squamous cell carcinoma (ASCC. This study explored PD-L1 expression in ASCC patients and its association with patients’ clinicopathological features, CD8+ T cell infiltration, and prognosis.Methods: Formalin-fixed paraffin-embedded tumor samples from 26 patients with ASCC were retrieved. The levels of PD-L1 expression on the membrane of both tumor cells and tumor-infiltrating mononuclear cells (TIMCs were evaluated by immunohistochemistry. CD8+ T cell densities, both within tumors and at the tumor–stromal interface, were also analyzed. Baseline clinicopathological characteristics, human papilloma virus (HPV status, and outcome data correlated with PD-L1-positive staining.Results: PD-L1 expression on tumor cells and TIMCs was observed in 46% and 50% of patients, respectively. Nineteen patients (73% were HPV positive, with 7 showing PD-L1-positive staining on tumor cells and 9 showing PD-L1-positive staining on TIMCs. Increasing CD8+ density within tumors, but not immune stroma, was significantly associated with decreased PD-L1 expression by both tumor cells and TIMCs (P=0.0043 and P=0.0007. Patients with negative PD-L1 expression had significantly better progression-free survival (P=0.038 and P

  17. New name, fiaxtion of correct spelling of three leafhopper taxa (Hemiptera: Cicadellidae)

    The leafhopper genus Aspidia Yang & Zhang is a junior homonym and replaced here by Sochinsogonoidea, nomen novum. Nilgiriscopus Viraktamath and Roxasellana stellata Zhang & Zhang are fixed as the correct original spellings....

  18. Isolation and identification of two galangin metabolites from rat urine ...

    Isolation and identification of two galangin metabolites from rat urine and determination of their in vitro hypolipidemic activity. Xuguang Zhang, Shouqian Cheng, Hailong Li, Xiaopo Zhang, Feng Chen, Youbin Li, Junqing Zhang, Yinfeng Tan ...

  19. A functional SNP upstream of the ADRB2 gene is associated with COPD

    Li JX

    2018-03-01

    Full Text Available Jin-Xiu Li,1,2,* Wei-Ping Fu,3,* Jing Zhang,4 Xiao-Hua Zhang,1,2 Chang Sun,1,5 Lu-Ming Dai,3 Li Zhong,1,5,6 Li Yu,1,2 Ya-Ping Zhang1,7 1State Key Laboratory for Conservation and Utilization of Bio-Resource in Yunnan, 2Key Laboratory for Animal Genetic Diversity and Evolution of High Education in Yunnan Province, School of Life Sciences, Yunnan University, 3Department of Respiratory Critical Care Medicine, 4Department of Thoracic Surgery, The First Affiliated Hospital of Kunming Medical University, Kunming, 5College of Life Sciences, 6Provincial Demonstration Center for Experimental Biology Education, Shaanxi Normal University, Xi’an, 7State Key Laboratory of Genetic Resources and Evolution, and Yunnan Laboratory of Molecular Biology of Domestic Animals, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China *These authors contributed equally to this work Background: Previous studies have suggested that β2-adrenergic receptor (ADRB2 is associated with COPD. However, the role of genetic polymorphisms in ADRB2 on COPD has not been evaluated yet. Methods: In this study, SNaPshot genotyping, luciferase assay, chromatin immunoprecipitation and real-time polymerase chain reaction were adopted to investigate the association between ADRB2 genetic polymorphisms and COPD, comprehensively. Results: One single nucleotide polymorphism (rs12654778, located upstream of ADRB2, showed a significant association with COPD by the logistic regression analysis after adjusting for age, sex and smoking history (p=0.04 in 200 COPD patients and 222 controls from southwest Chinese population. Furthermore, the luciferase assay indicated that rs12654778-A allele reduced the relative promoter activity by ~26% compared with rs12654778-G allele (p=0.0034. The chromatin immunoprecipitation analysis demonstrated that rs12654778 modulated the binding affinity of transcription factor neurofibromin 1. In addition, a significantly reduced expression of ADRB

  20. 2. Sino-German workshop on fuel cells. Book of abstracts

    NONE

    2003-07-01

    The CD-ROM contains the content of 13 lectures and 19 proposals for joint projects, which were presented on the second Sino-German Workshop on fuel cells. The topics of the 13 lectures are: Ab-initio calculations of oxygen species on low-index platinum surfaces (Pachenko, M.T.M. Koper, T.E. Shubina, S.J. Mitchell, E. Roduner). Cross-Linked (Composite) Polyaryl Blend Membranes for Membrane Fuel Cells. (J.A. Kerres, A. Ullrich, W. Zhang, M. Hein, V. Gogel, L. Joerissen, Th. Frey, A. Friedrich). Performance and Methanol Permeation of Direct Methanol Fuel Cells: Dependence on Operating Conditions and on Electrode Structure(V. Gogel, Th. Frey, K.A. Friedrich, L. Joerissen, J. Garche, Z. Yongsheng). Experimental Investigation of Flow Bed Configuration Effect on Performance of Liquid Feed Direct Methanol Fuel Cells. (H. Guo, C.F. Ma, M.H. Wang, F. Ye, J. Yu, Y. Wang, C.Y. Wang). Improvement of MEAs for DMFC by a tuned production sequence assisted by mathematical modelling (Lindermeir, G. Rosenthal, U. Kunz, U. Hoffmann). Performance of the self-breathing air DMFC with solution grafted PVDF-g-PSSA membranes (X. Qiu, G. Guo, W. Li, W. Zhu, L. Chen). Modeling the Effects of Methanol Crossover on DMFC (J. Zhang, Y. Wang). The characteristics of 40 kW PEM fuel cell engine for vehicle(M. Hou, P. Ming, H. Zhang). A New and Simple Method for Preparing Biocathode in Biofuel Cells (D. Sun, C. Cai, X. Li, W. Xing, T. Lu). Nonlinear Model Reduction of a Dynamic Two-dimensional Molten Carbonate Fuel Cell Model (M. Mangold, M. Sheng). Recent Advances in Design and Fabrication of Low-Temperature Solid Oxide Fuel Cells (C. Xia, G. Meng). Novel CVD Techniques for Micro- and IT-SOFC Fabrication (G. Meng, H. Song, Q. Dong, D. Peng). Fundamental properties of La{sub 0.6}Sr{sub 0.4}Co{sub 0.8}Fe{sub 0.2}O{sub 3-{delta}} at high temperatures (S. Wang, T.-L. Wen).

  1. Dexmedetomidine attenuates persistent postsurgical pain by upregulating K+–Cl− cotransporter-2 in the spinal dorsal horn in rats

    Dai S

    2018-05-01

    Full Text Available Shuhong Dai,1 Yu Qi,1 Jie Fu,1 Na Li,1 Xu Zhang,1 Juan Zhang,2 Wei Zhang,2 Haijun Xu,1 Hai Zhou,1 Zhengliang Ma2 1Department of Anesthesiology, XuZhou Central Hospital, Xuzhou, China; 2The Affiliated Nanjing Drum Tower Hospital, Medical School, Nanjing University, Nanjing, China Background: Dexmedetomidine (DEX could have an analgesic effect on pain transmission through the modulation of brain-derived neurotrophic factor (BDNF. In addition, KCC2-induced shift in neuronal Cl- homeostasis is crucial for postsynaptic inhibition mediated by GABAA receptors. Accumulating evidence shows that nerve injury, peripheral inflammation and stress activate the spinal BDNF/TrkB signal, which results in the downregulation of KCC2 transport and expression, eventually leads to GAGAergic disinhibition and hyperalgesia. The aim of this experiment was to explore the interaction between DEX and KCC2 at a molecular level in rats in the persistent postsurgical pain (PPSP. Methods: PPSP in rats was evoked by the skin/muscle incision and retraction (SMIR. Mechanical hypersensitivity was assessed with the Dynamic Plantar Aesthesiometer. Western blot and immunofluorescence assay were used to assess the expressions of related proteins. Results: In the first part of our experiment, the results revealed that the BDNF/TrkB-KCC2 signal plays a critical role in the development of SMIR-evoked PPSP; the second part showed that intraperitoneal administrations of 40 µg/kg DEX at 15 min presurgery and 1 to 3 days post-surgery significantly attenuated SMIR-evoked PPSP. Simultaneously, SMIR-induced KCC2 downregulation was partly reversed, which coincided with the inhibition of the BDNF/TrkB signal in the spinal dorsal horn. Moreover, intrathecal administrations of KCC2 inhibitor VU0240551 significantly reduced the analgesic effect of DEX on SMIR-evoked PPSP. Conclusion: The results of our study indicated that DEX attenuated PPSP by restoring KCC2 function through reducing BDNF

  2. PREFACE: XXVIII International Conference on Photonic, Electronic and Atomic Collisions (ICPEAC 2013)

    Xiao, Guoqing; Cai, Xiaohong; Ding, Dajun; Ma, Xinwen; Zhao, Yongtao

    2014-04-01

    express its great appreciation to National Natural Science Foundation of China (NSFC), Chinese Academy of Sciences (CAS), International Union of Pure and Applied Physics (IUPAP), IMP, and IMP-YIPA for financial support, to Fangfang Ruan, Qiang Liang, Dacheng Zhang, Shukai Tian, Yuyu Wang, Wenping Zhu, Wei Liang, Mingwu Zhang, Haibo Yuan, Shan Sha, Jieru Ren, Jie Yang and Zhenhai Chen for their contributions to the organization, and to the volunteer group from Lanzhou University, the High School Attached Northwest Normal University and IMP for their excellent volunteer work. The Local Organizing Committee would like to thank all of the participants and the authors of the proceedings for their supports and contributions to the conference. Guoqing Xiao Director of Institute of Modern Physics, Chinese Academy of Sciences

  3. A network biology approach evaluating the anticancer effects of bortezomib identifies SPARC as a therapeutic target in adult T-cell leukemia cells

    Yu Zhang

    2008-10-01

    Full Text Available Junko H Ohyashiki1, Ryoko Hamamura2, Chiaki Kobayashi2, Yu Zhang2, Kazuma Ohyashiki21Intractable Immune System Disease Research Center, Tokyo Medical University, Tokyo, Japan; 2First Department of Internal Medicine, Tokyo Medical University, Tokyo, JapanAbstract: There is a need to identify the regulatory gene interaction of anticancer drugs on target cancer cells. Whole genome expression profiling offers promise in this regard, but can be complicated by the challenge of identifying the genes affected by hundreds to thousands of genes that induce changes in expression. A proteasome inhibitor, bortezomib, could be a potential therapeutic agent in treating adult T-cell leukemia (ATL patients, however, the underlying mechanism by which bortezomib induces cell death in ATL cells via gene regulatory network has not been fully elucidated. Here we show that a Bayesian statistical framework by VoyaGene® identified a secreted protein acidic and rich in cysteine (SPARC gene, a tumor-invasiveness related gene, as a possible modulator of bortezomib-induced cell death in ATL cells. Functional analysis using RNAi experiments revealed that inhibition of the expression SPARC by siRNA enhanced the apoptotic effect of bortezomib on ATL cells in accordance with an increase of cleaved caspase 3. Targeting SPARC may help to treat ATL patients in combination with bortezomib. This work shows that a network biology approach can be used advantageously to identify the genetic interaction related to anticancer effects.Keywords: network biology, adult T cell leukemia, bortezomib, SPARC

  4. The Living Goddess of Mercy at the Rape of Nanking: Minnie Vautrin and the Ginling Refugee Camp in World War II (1937–1938 †

    Sheng-Ping Guo

    2016-12-01

    Full Text Available During the infamous Nanking Atrocity, some Western businesspersons and missionaries established the Nanking Safety Zone to protect about 250,000 refugees. When the Japanese army was pressing on Nanking, Minnie Vautrin, an educational missionary from the United Christian Missionary Society, took charge of the Ginling College campus. As one of the 25 refugee camps, Ginling provided shelter to about 10,000 women and children in late December 1937—the hardest time during World War II in China. With her neutral identity of American nationality, Vautrin seriously struggled with Japanese soldiers when they were seizing Chinese women for rape from the campus; thus, she helped many women avoid the possible fate of sexual violence and slaughter. The Chinese people promoted her as a “Goddess of Mercy”, in the Chinese language a “Living Buddha” (Huo pu sa or “Guanyin Buddha” (Guan Yin pu sa. The Chinese central government awarded her the Order of Jade (Cai Yu xun zhang. Drawing from Vautrin’s diaries and other original materials, this paper narrates this Christian female missionary’s moving story in humanism, evangelism, and internationalism. Her devotion to the Chinese refugee women and children made her an eyewitness to the Nanking Massacre, a rehabilitator of refugee sufferings, and a mental and bodily victim of disastrous war.

  5. Two days of films

    2011-01-01

    The Chinese community at CERN and the CERN CineClub, on the occasion of the Chinese New Year, invite everyone to two days of films Thursday 3 February 2011 at 20:30 - CERN Council Chamber Eat drink man woman Directed by Ang LEE (Taiwan, 1994) 122 min. With Sihung Lung, Yu-Wen Wang, Chien-Lien Wu, Kuei-Mei Yang Senior Master Chef Chu lives in a large house in Taipei with his three unmarried daughters, Jia-Jen, a chemistry teacher converted to Christianity, Jia-Chien, an airline executive, and Jia-Ning, a student who also works in a fast food restaurant. Life in the house revolves around the ritual of an elaborate dinner each Sunday, and the love lives of all the family members. Original version Mandarin with English subtitles Friday 4 February 2011 at 19:30 - CERN Council Chamber Adieu, ma concubine Directed by Chen KAIGE (China / Hong Kong, 1993) 171 min. With Leslie Cheung, Fengyi Zhang, Li Gong "Farewell, My Concubine" is a movie with two parallel, intertwined stories. It is the story of two performers in t...

  6. Proximity hybridization-mediated isothermal exponential amplification for ultrasensitive electrochemical protein detection

    Yu Y

    2017-08-01

    Full Text Available Yanyan Yu, Gaoxing Su, Hongyan Zhu, Qing Zhu, Yong Chen, Bohui Xu, Yuqin Li, Wei Zhang School of Pharmacy, Nantong University, Nantong, People’s Republic of China Abstract: In this study, we fabricated a novel electrochemical biosensing platform on the basis of target-triggered proximity hybridization-mediated isothermal exponential amplification reaction (EXPAR for ultrasensitive protein analysis. Through rational design, the aptamers for protein recognition were integrated within two DNA probes. Via proximity hybridization principle, the affinity protein-binding event was converted into DNA assembly process. The recognition of protein by aptamers can trigger the strand displacement through the increase of the local concentrations of the involved probes. As a consequence, the output DNA was displaced, which can hybridize with the duplex probes immobilized on the electrode surface subsequently, leading to the initiation of the EXPAR as well as the cleavage of duplex probes. Each cleavage will release the gold nanoparticles (AuNPs binding sequence. With the modification of G-quadruplex sequence, electrochemical signals were yielded by the AuNPs through oxidizing 3,3',5,5'-tetramethylbenzidine in the presence of H2O2. The study we proposed exhibited high sensitivity toward platelet-derived growth factor BB (PDGF-BB with the detection limit of 52 fM. And, this method also showed great selectivity among the PDGF isoforms and performed well in spiked human serum samples. Keywords: electrochemical biosensor, proximity hybridization, PDGF-BB, isothermal exponential amplification, G-quadruplex 

  7. The negative cell cycle regulator, Tob (transducer of ErbB-2), is involved in motor skill learning

    Wang Xinming; Gao Xiang; Zhang Xuehan; Tu Yanyang; Jin Meilei; Zhao Guoping; Yu Lei; Jing Naihe; Li Baoming

    2006-01-01

    Tob (transducer of ErbB-2) is a negative cell cycle regulator with anti-proliferative activity in peripheral tissues. Our previous study identified Tob as a protein involved in hippocampus-dependent memory consolidation (M.L. Jin, X.M. Wang, Y.Y. Tu, X.H. Zhang, X. Gao, N. Guo, Z.Q. Xie, G.P. Zhao, N.H. Jing, B.M. Li, Y.Yu, The negative cell cycle regulator, Tob (Transducer of ErbB-2), is a multifunctional protein involved in hippocampus-dependent learning and memory, Neuroscience 131 (2005) 647-659). Here, we provide evidence that Tob in the central nervous system is engaged in acquisition of motor skill. Tob has a relatively high expression in the cerebellum. Tob expression is up-regulated in the cerebellum after rats receive training on a rotarod-running task. Rats infused with Tob antisense oligonucleotides into the 4th ventricle exhibit a severe deficit in running on a rotating rod or walking across a horizontally elevated beam

  8. Advances in the targeted therapy of liposarcoma

    Guan Z

    2015-01-01

    Full Text Available Zhonghai Guan,1 Xiongfei Yu,1 Haohao Wang,1 Haiyong Wang,1 Jing Zhang,1 Guangliang Li,2 Jiang Cao,3 Lisong Teng1 1Department of Surgical Oncology, First Affiliated Hospital, College of Medicine, Zhejiang University, 2Department of Medicine Oncology, Zhejiang Cancer Hospital, 3Clinical Research Center, The 2nd Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang, People’s Republic of China Abstract: Liposarcoma (LPS is the most common type of soft-tissue sarcoma. Complete surgical resection is the only curative means for localized disease; however, both radiation and conventional cytotoxic chemotherapy remain controversial for metastatic or unresectable disease. An increasing number of trials with novel targeted therapy of LPS have provided encouraging data during recent years. This review will provide an overview of the advances in our understanding of LPS and summarize the results of recent trials with novel therapies targeting different genetic and molecular aberrations for different subtypes of LPS. Keywords: well-/dedifferentiated, myxoid/round cell, pleomorphic, soft-tissue sarcoma

  9. Probabilistic Flexural Fatigue in Plain and Fiber-Reinforced Concrete.

    Ríos, José D; Cifuentes, Héctor; Yu, Rena C; Ruiz, Gonzalo

    2017-07-07

    The objective of this work is two-fold. First, we attempt to fit the experimental data on the flexural fatigue of plain and fiber-reinforced concrete with a probabilistic model (Saucedo, Yu, Medeiros, Zhang and Ruiz, Int. J. Fatigue, 2013, 48, 308-318). This model was validated for compressive fatigue at various loading frequencies, but not for flexural fatigue. Since the model is probabilistic, it is not necessarily related to the specific mechanism of fatigue damage, but rather generically explains the fatigue distribution in concrete (plain or reinforced with fibers) for damage under compression, tension or flexion. In this work, more than 100 series of flexural fatigue tests in the literature are fit with excellent results. Since the distribution of monotonic tests was not available in the majority of cases, a two-step procedure is established to estimate the model parameters based solely on fatigue tests. The coefficient of regression was more than 0.90 except for particular cases where not all tests were strictly performed under the same loading conditions, which confirms the applicability of the model to flexural fatigue data analysis. Moreover, the model parameters are closely related to fatigue performance, which demonstrates the predictive capacity of the model. For instance, the scale parameter is related to flexural strength, which improves with the addition of fibers. Similarly, fiber increases the scattering of fatigue life, which is reflected by the decreasing shape parameter.

  10. MRI-guided targeting delivery of doxorubicin with reduction-responsive lipid-polymer hybrid nanoparticles

    Wu B

    2017-09-01

    Full Text Available Bo Wu,1,2 Shu-Ting Lu,1 Kai Deng,2 Hui Yu,2 Can Cui,2 Yang Zhang,2 Ming Wu,2 Ren-Xi Zhuo,2 Hai-Bo Xu,1 Shi-Wen Huang2 1Department of Radiology, Zhongnan Hospital of Wuhan University, 2Key Laboratory of Biomedical Polymers, Ministry of Education, Department of Chemistry, Wuhan University, Wuhan, People’s Republic of China Abstract: In recent years, there has been increasing interest in developing a multifunctional nanoscale platform for cancer monitoring and chemotherapy. However, there is still a big challenge for current clinic contrast agents to improve their poor tumor selectivity and response. Herein, we report a new kind of Gd complex and folate-coated redox-sensitive lipid-polymer hybrid nanoparticle (Gd-FLPNP for tumor-targeted magnetic resonance imaging and therapy. Gd-FLPNPs can simultaneously accomplish diagnostic imaging, and specific targeting and controlled release of doxorubicin (DOX. They exhibit good monodispersity, excellent size stability, and a well-defined core-shell structure. Paramagnetic nanoparticles based on gadolinium-diethylenetriaminepentaacetic acid-bis-cetylamine have paramagnetic properties with an approximately two-fold enhancement in the longitudinal relaxivity compared to clinical used Magnevist. For targeted and reduction-sensitive drug delivery, Gd-FLPNPs released DOX faster and enhanced cell uptake in vitro, and exhibited better antitumor effect both in vitro and in vivo. Keywords: redox-sensitive, tumor-targeted, gadolinium, contrast agents, PLGA

  11. Oncogene mutational profile in nasopharyngeal carcinoma

    Zhang ZC

    2014-03-01

    Full Text Available Zi-Chen Zhang,1,* Sha Fu,1,* Fang Wang,1 Hai-Yun Wang,1 Yi-Xin Zeng,2 Jian-Yong Shao11Department of Molecular Diagnostics, 2Department of Experimental Research, Sun Yat-sen University Cancer Center, State Key Laboratory of Oncology in South China, Collaborative Innovation Center of Cancer Medicine, Guangzhou, People's Republic of China *These authors contributed equally to this work Abstract: Nasopharyngeal carcinoma (NPC is a common tumor in Southern China, but the oncogene mutational status of NPC patients has not been clarified. Using time-of-flight mass spectrometry, 238 mutation hotspots in 19 oncogenes were examined in 123 NPC patients. The relationships between mutational status and clinical data were assessed with a χ2 or Fisher's exact test. Survival analysis was performed using the Kaplan–Meier method with the log-rank test. In 123 patients, 21 (17.1% NPC tumors were positive for mutations in eight oncogenes: six patients had PIK3CA mutations (4.9%, five NRAS mutations (4.1%, four KIT mutations (3.3%, two PDGFRA mutations (1.6%, two ABL mutations (1.6%, and one with simultaneous mutations in HRAS, EGFR, and BRAF (1%. Patients with mutations were more likely to relapse or develop metastasis than those with wild-type alleles (P=0.019. No differences or correlations were found in other clinical characteristics or in patient survival. No mutations were detected in oncogenes AKT1, AKT2, CDK, ERBB2, FGFR1, FGFR3, FLT3, JAK2, KRAS, MET, and RET. These results demonstrate an association between NPC and mutations in NRAS, KIT, PIK3CA, PDGFRA, and ABL, which are associated with patient relapse and metastasis. Keywords: NPC, oncogene, mutation

  12. Computació distribuïda sobre dispositius mòbils

    Marugán Calles, Jose Carlos

    2015-01-01

    En aquest projecte, s'ha desenvolupat una plataforma que ajuda a la paral·lelització d’aplicacions utilitzant dispositius mòbils com a nodes o processadors. Per al seu desenvolupament, el projecte s'ha dividit en tres subprojectes (client, servidor i proveïdor). La plataforma de computació distribuïda i paral·lelització es compon dels subprojectes client i servidor. El subprojecte proveïdor s'ha desenvolupat per utilitzar la plataforma de computació distribuïda creada, i concretament, s'ha de...

  13. The 2nd International Conference on Agricultural and Biological Sciences (ABS 2016

    Lei Pei

    2016-10-01

    Salvia of Labiatae in China Xiaojuan Li, Ning Xu, Guofu Zhou, Ming Wan, Qi Lin, Fanyun Meng, Jianxiu Li 15 Three pulling resistance models of pioneer plant in landslide area Yichang Chen, Koayung Yu, Chunpin Chang 16 The comparison of physiological and biochemical mechanisms of Reaumuria soongorica and Salsola passerine in different growth pattern Zijuan Zhou, Peixi Su, Rui Shi, Tingting Xie 17 Resources use efficiency of the cosmopolitan plant Potentilla anserina L. in different alpine habitats in China Rui Shi, Peixi Su, Zijuan Zhou 18 Cloning of PPDK gene from Red Amaranand transformation of Alfalfa Xuelan Liu, Yan Zhang, Xiangfa Wei 19 Variation and cluster analysis of morphological characters and nutrient content of Chucrasia tabularis seed Chong Wu, Yanlei Yin, Lijuan Feng, Xuemei Yang, Fei Wang 20 Effect of the planting density of the areca nut on the growth of intercropped Vanilla Hua Wang, Huifa Zhuang, Zihui Zhu, Hui Wang

  14. Fluorescence response of hypocrellin B to the environmental changes in a mimic biological membrane--liposome

    JIN; Xuanye; ZHAO; Yuewei; XIE; Jie; ZHAO; Jingquan

    2004-01-01

    [1]Diwu, Z. J., Novel therapeutic and diagnostic application of hypocrellins and hypericins Photochem, Photobiol., 1995, 61(6):529-539.[2]Zhang, Z. Y., Wang, N. H., EPR studies of singlet oxygen and free radicals generated during photosensitization of hypocrellin B,Free Radical Biol. Med., 1993 14: 1-9.[3]Chowdhury, P. K., Das, K., Datta, A. et al., A comparison of the excited-state processes of nearly symmetrical perylene quinones:hypocrellin A and hypomycin B, J. Photochem. Photobiol. A:Chem., 2002, 154: 107-116.[4]Hudson, J. B., Zhou, J., Chen, J. et al., Hypocrellin, from Hypocrella bambusae, is phototoxic to human immunodeficiency virus, Photochem. Photobiol., 1994, 60: 253-255.[5]Xu, S. J., Chen, S., Zhang, M. H. et al., First synthesis of methylated Hypocrellin and its fluorescent excited state: A cautionary tale, J. Org. Chem., 2003, 68: 2048-2050.[6]Zhang, K. H., Zhang, Z. Y., Molecular thermodynamics of the configuration of perylenequinonoid pigments, Sci. Sin. (B), 1997,27: 357-360.[7]Kawakami, M., Koya, K., Ukai, T. et al., Structure-activity of novel rhodacyanine dyes as antitumor agents, J. Med. Chem.,1998, 41(1): 130-142.[8]Vaupel, P., Kallinowski, F., Okunieff, P., Blood flow, oxygen and nutrient supply, and metabolic microenvironment of human tumors: A review, Cancer Res., 1989, 49: 6449-6465.[9]Patel, A. A., Gawlinski, E. T., Lemieux, S. K. et al., A cellular automaton model of early tumor growth and invasion, J. Theor.Biol., 2001, 213(3): 315-331.[10]Vorpai, E. S., Samtso, M. P., Chalov, V. N. et al., Fluorescence of the polymethine dyes, TIKS and diagnostics of cancer, J. Appl.Spectrosc., 2001, 68(3): 468-472.[11]Zadnia, A., Campbell, R., Sharma, M., The scope of dansyl vs.fluorescein label in fluorescence postlabeling assay for DNA damage, Anal. Biochem., 1994, 218: 444-448.[12]Yu, C. L., Chen, S., Zhang, M. H. et al., Spectroscopic studies and photodynamic actions of hypocrellin B in liposome

  15. Taxonomic review on the subgenus Tripodura Townes (Diptera: Chironomidae: Polypedilum) from China with eleven new species and a supplementary world checklist.

    Zhang, Ruilei; Song, Chao; Qi, Xin; Wang, Xinhua

    2016-07-05

    The subgenus Tripodura Townes of Polypedilum Kieffer from China including 26 species is reviewed. Eleven new species, named P. (T.) absensilobum Zhang & Wang sp. n., P. (T.) apiculusetosum Zhang & Wang sp. n., P. (T.) arcuatum Zhang & Wang sp. n., P. (T.) bilamella Zhang & Wang sp. n., P. (T.) conghuaense Zhang & Wang sp. n., P. (T.) dengae Zhang & Wang sp. n., P. (T.) mengmanense Zhang & Wang sp. n., P. (T.) napahaiense Zhang & Wang sp. n., P. (T.) parallelum Zhang & Wang sp. n., P. (T.) pollicium Zhang & Wang sp. n. and P. (T.) trapezium Zhang & Wang sp. n. are described and illustrated based on male imagines. Three species, P. (T.) quadriguttatum Kieffer, P. (T.) unifascia (Tokunaga) and P. (T.) udominutum Niitsuma are firstly recorded in China. A key to known male imagines of Chinese species and an updated world checklist of subgenus Tripodura are presented.

  16. Dementia-specific quality of life instruments and their appropriateness in shared-housing arrangements--a literature study.

    Gräske, Johannes; Fischer, Thomas; Kuhlmey, Adelheid; Wolf-Ostermann, Karin

    2012-01-01

    Shared-housing arrangements (SHA) in Germany are a specific type of housing arrangement that belongs to the global concept of small-scale living arrangements. This caring approach comprises characteristics of both home and institutional care for persons with dementia. To evaluate the impact of SHA on the quality of life (QoL) of residents, an appropriate setting- and dementia-specific QoL instrument is needed. This article aims to identify QoL instruments that relate to the core domains of SHA. After a comprehensive literature review, existing dementia-specific QoL instruments were evaluated to determine whether any have been specifically designed for or applied in SHA. Additionally, each domain of the instruments was matched with the core domains of SHA. None of the existing instruments was identified as having been developed for SHA. Matching of the instrument domains with the SHA core domains leads to the conclusion that Quality of Life-Alzheimer's Disease, Dementia Quality of Life, Alzheimer Disease-Related Quality of Life, and QUALIDEM are adequate instruments for measuring the dementia-specific QoL of persons living in SHA. For the first time, a basis has been created for valid QoL evaluations of residents with dementia living in SHA. The 4 identified instruments are considered applicable in SHA. Conducting a performance test and evaluating further attributes according to the Scientific Advisory Committee of the Medical Outcomes Trust (e.g., reliability and validity) will further elucidation of the appropriateness of the instruments for SHA. Copyright © 2012 Mosby, Inc. All rights reserved.

  17. Effect of nitrates on embryo induction efficiency in cotton (Gossypium ...

    Fred

    cotton species (Zhang, 1994b). Somatic embryogenesis and plant regeneration systems have been established from cotton tissue, protoplasts and ovules (Zhang and Li,. 1992; Feng and Zhang, 1994; Zhang, 1995). Regeneration procedures have been used to obtain genetically modified plants after Agrobacterium- ...

  18. AcEST: DK947295 [AcEST

    Full Text Available lejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipma...TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  19. AcEST: BP915851 [AcEST

    Full Text Available as L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Ga...inghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new genera

  20. AcEST: DK947606 [AcEST

    Full Text Available 2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...tschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Da