York, Robert A.; Stephenson, Nathan L.; Meyer, Marc; Hanna, Steve; Tadashi, Moody; Caprio, Anthony C.; Battles, John J.
2013-01-01
For natural resource managers in the southern Sierra Nevada, giant sequoia requires very little introduction. It receives great attention as an icon of western forests and as a common namesake with the areas where it occurs. While it is a single component of a very complex system, its attention in this assessment and in general is well deserved. Giant sequoia is one of the few "destination species" that attracts a wide swath of the public by nature of it simply being present. It draws people, who otherwise may not travel, to a natural environment. The result is an expansion of the public’s sense of natural resource stewardship. Because park managers could not achieve their mission without public support, this fostering role of giant sequoia is critical for park natural resources and is important for natural resources in general. Despite its social relevance and physical size, we re-emphasize here that the giant sequoia resource is a relatively small component of the ecosystems of the southern Sierra Nevada. As is the case with all of the resources assessed in the NRCA, we focus on giant sequoia with the understanding that other resources will be considered simultaneously when evaluating management decisions that impact giant sequoia. While we attempt to explicitly address the interaction of giant sequoia with other resources and stressors, we also realize that ultimately managers will integrate much more information than is presented here when making decisions that influence giant sequoia. The autecology and management issues surrounding giant sequoia have been thoroughly reviewed elsewhere (Harvey et al. 1980, Aune 1994, Stephenson 1996). Stephenson (1996), in particular, should be reviewed when considering any management decisions that potentially impact giant sequoia. For those who may not be familiar with giant sequoia ecology, a summary of basic information is provided in a table below. In some parts of this assessment, we reproduce text from Stephensonâ
Subbotin, S A; Vierstraete, A; De Ley, P; Rowe, J; Waeyenberge, L; Moens, M; Vanfleteren, J R
2001-10-01
The ITS1, ITS2, and 5.8S gene sequences of nuclear ribosomal DNA from 40 taxa of the family Heteroderidae (including the genera Afenestrata, Cactodera, Heterodera, Globodera, Punctodera, Meloidodera, Cryphodera, and Thecavermiculatus) were sequenced and analyzed. The ITS regions displayed high levels of sequence divergence within Heteroderinae and compared to outgroup taxa. Unlike recent findings in root knot nematodes, ITS sequence polymorphism does not appear to complicate phylogenetic analysis of cyst nematodes. Phylogenetic analyses with maximum-parsimony, minimum-evolution, and maximum-likelihood methods were performed with a range of computer alignments, including elision and culled alignments. All multiple alignments and phylogenetic methods yielded similar basic structure for phylogenetic relationships of Heteroderidae. The cyst-forming nematodes are represented by six main clades corresponding to morphological characters and host specialization, with certain clades assuming different positions depending on alignment procedure and/or method of phylogenetic inference. Hypotheses of monophyly of Punctoderinae and Heteroderinae are, respectively, strongly and moderately supported by the ITS data across most alignments. Close relationships were revealed between the Avenae and the Sacchari groups and between the Humuli group and the species H. salixophila within Heteroderinae. The Goettingiana group occupies a basal position within this subfamily. The validity of the genera Afenestrata and Bidera was tested and is discussed based on molecular data. We conclude that ITS sequence data are appropriate for studies of relationships within the different species groups and less so for recovery of more ancient speciations within Heteroderidae. Copyright 2001 Academic Press.
Landscape-scale variation in canopy water content of giant sequoias during drought
Paz-Kagan, Tarin; Vaughn, Nicolas R.; Martin, Roberta E.; Brodrick, Philip G.; Stephenson, Nathan L.; Das, Adrian; Nydick, Koren R.; Asner, Gregory P.
2018-01-01
Recent drought (2012–2016) caused unprecedented foliage dieback in giant sequoias (Sequoiadendron giganteum), a species endemic to the western slope of the southern Sierra Nevada in central California. As part of an effort to understand and map sequoia response to droughts, we studied the patterns of remotely sensed canopy water content (CWC), both within and among sequoia groves in two successive years during the drought period (2015 and 2016). Our aims were: (1) to quantify giant sequoia responses to severe drought stress at a landscape scale using CWC as an indicator of crown foliage status, and (2) to estimate the effect of environmental correlates that mediate CWC change within and among giant sequoia groves. We utilized airborne high fidelity imaging spectroscopy (HiFIS) and light detection and ranging (LiDAR) data from the Carnegie Airborne Observatory to assess giant sequoia foliage status during 2015 and 2016 of the 2012–2016 droughts. A series of statistical models were generated to classify giant sequoias and to map their location in Sequoia and Kings Canyon National Parks (SEKI) and vicinity. We explored the environmental correlates and the spatial patterns of CWC change at the landscape scale. The mapped CWC was highly variable throughout the landscape during the two observation years, and proved to be most closely related to geological substrates, topography, and site-specific water balance. While there was an overall net gain in sequoia CWC between 2015 and 2016, certain locations (lower elevations, steeper slopes, areas more distant from surface water sources, and areas with greater climate water deficit) showed CWC losses. In addition, we found greater CWC loss in shorter sequoias and those growing in areas with lower sequoia stem densities. Our results suggest that CWC change indicates sequoia response to droughts across landscapes. Long-term monitoring of giant sequoia CWC will likely be useful for modeling and predicting their population
Martin, Roberta E.; Asner, Gregory P.; Francis, Emily; Ambrose, Anthony; Baxter, Wendy; Das, Adrian J.; Vaughn, Nicolas R.; Paz-Kagan, Tarin; Dawson, Todd E.; Nydick, Koren R.; Stephenson, Nathan L.
2018-01-01
California experienced severe drought from 2012 to 2016, and there were visible changes in the forest canopy throughout the State. In 2014, unprecedented foliage dieback was recorded in giant sequoia (Sequoiadendron giganteum) trees in Sequoia National Park, in the southern California Sierra Nevada mountains. Although visible changes in sequoia canopies can be recorded, biochemical and physiological responses to drought stress in giant sequoia canopies are not well understood. Ground-based measurements provide insight into the mechanisms of drought responses in trees, but are often limited to few individuals, especially in trees of tall stature such as giant sequoia. Recent studies demonstrate that remotely measured forest canopy water content (CWC) is a general indicator of canopy response to drought, but the underpinning leaf- to canopy-level causes of observed variation in CWC remain poorly understood. We combined field and airborne remote sensing measurements taken in 2015 and 2016 to assess the biophysical responses of giant sequoias to drought. In 49 study trees, CWC was related to leaf water potential, but not to the other foliar traits, suggesting that changes in CWC were made at whole-canopy rather than leaf scales. We found a non-random, spatially varying pattern in mapped CWC, with lower CWC values at lower elevation and along the outer edges of the groves. This pattern was also observed in empirical measurements of foliage dieback from the ground, and in mapped CWC across multiple sequoia groves in this region, supporting the hypothesis that drought stress is expressed in canopy-level changes in giant sequoias. The fact that we can clearly detect a relationship between CWC and foliage dieback, even without taking into account prior variability or new leaf growth, strongly suggests that remotely sensed CWC, and changes in CWC, are a useful measure of water stress in giant sequoia, and valuable for assessing and managing these iconic forests in drought.
Knoetze, Rinus; Swart, Antoinette
2014-12-09
A survey was performed to detect the presence of cyst nematodes in the Cape Floristic Region of South Africa. Soil was collected in the rhizosphere of the dominant plant species within blocks of indigenous vegetation and cysts were extracted from them. A total of 81 blocks of indigenous vegetation were sampled as described. Cysts were detected in 7 of these samples, representing 6 different vegetation types. One set of primers was used to amplify the ITS regions from these cysts, including the 5.8S ribosomal gene, as well as short parts of the 18S and 28S ribosomal genes. ITS-rDNA sequences from the indigenous isolates were aligned with selected sequences of other species from the Heteroderidae. Phylogenetic analyses to resolve the relationships between indigenous isolates and selected representatives of the Heteroderidae were conducted using the Maximum Parsimony method. The consensus tree resulting from alignment of the circumfenestrate cysts revealed that isolates SK18, WK1 and WK26 are included in a clade of Globodera species that parasitise non-solanaceous plants, forming a monophyletic group with G. millefolii, G. artemisiae, and an unidentified Globodera sp. from Portugal. In a tree resulting from the alignment of the Heterodera spp., isolates OK14 and WK2 are included in the Afenestrata group, forming a monophyletic group with H. orientalis.This survey unearthed at least four potentially new species of cyst nematodes, which may prove invaluable for the study of the evolution and biogeography of the group.
Aspen Characteristics - Sequoia National Forest [ds377
California Natural Resource Agency — The database represents point locations and associated stand assessment data collected within aspen stands in the Cannell Meadows Ranger District, Sequoia National...
Aspen Delineation - Sequoia National Forest [ds378
California Natural Resource Agency — The database represents delineations of aspen stands associated with stand assessment data (SEQUOIA_NF_PTS) collected in aspen stands in the Cannell Meadows Ranger...
Visual Impacts of Prescribed Burning on Mixed Conifer and Giant Sequoia Forests
Lin Cotton; Joe R. McBride
1987-01-01
Prescribed burning programs have evolved with little concern for the visual impact of burning and the potential prescribed burning can have in managing the forest scene. Recent criticisms by the public of the prescribed burning program at Sequoia National Park resulted in an outside review of the National Park fire management programs in Sequoia, Kings Canyon, and...
Biological and Management Implications of Fire-Pathogen Interactions in the Giant Sequoia Ecosystem
Douglas D. Piirto; John R. Parmeter; Fields W. Cobb; Kevin L. Piper; Amy C. Workinger; William J. Otrosina
1998-01-01
An overriding management goal for national parks is the maintenance or, where necessary, the restoration of natural ecological processes. In Sequoia-Kings Canyon and Yosemite National Parks, there is concern about the effects of fire suppression on the giant sequoia-mixed conifer forest ecosystem. The National Park Service is currently using prescribed fire management...
Air pollution effects on giant sequoia ecosystems.
P.R. Miller; Nancy Grulke; K.W. Stolte
1994-01-01
Giant sequoia [Sequoiadendron giganteum (Lindl.) Buchholz] groves are found entirely within the Sierra Nevada mixed-conifer type. Several of its companion tree species, mainly ponderosa pine (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (P. jeffreyi Grev. & Balf.), show foliar injury after...
2013-11-05
... sequoia habitat, wetlands, and soundscapes within the Mariposa Grove, this alternative would relocate... for restoration of wetlands, soundscapes, and giant sequoia habitat within the Mariposa Grove by...
Estimating Leaf Water Potential of Giant Sequoia Trees from Airborne Hyperspectral Imagery
Francis, E. J.; Asner, G. P.
2015-12-01
Recent drought-induced forest dieback events have motivated research on the mechanisms of tree survival and mortality during drought. Leaf water potential, a measure of the force exerted by the evaporation of water from the leaf surface, is an indicator of plant water stress and can help predict tree mortality in response to drought. Scientists have traditionally measured water potentials on a tree-by-tree basis, but have not been able to produce maps of tree water potential at the scale of a whole forest, leaving forest managers unaware of forest drought stress patterns and their ecosystem-level consequences. Imaging spectroscopy, a technique for remote measurement of chemical properties, has been used to successfully estimate leaf water potentials in wheat and maize crops and pinyon-pine and juniper trees, but these estimates have never been scaled to the canopy level. We used hyperspectral reflectance data collected by the Carnegie Airborne Observatory (CAO) to map leaf water potentials of giant sequoia trees (Sequoiadendron giganteum) in an 800-hectare grove in Sequoia National Park. During the current severe drought in California, we measured predawn and midday leaf water potentials of 48 giant sequoia trees, using the pressure bomb method on treetop foliage samples collected with tree-climbing techniques. The CAO collected hyperspectral reflectance data at 1-meter resolution from the same grove within 1-2 weeks of the tree-level measurements. A partial least squares regression was used to correlate reflectance data extracted from the 48 focal trees with their water potentials, producing a model that predicts water potential of giant sequoia trees. Results show that giant sequoia trees can be mapped in the imagery with a classification accuracy of 0.94, and we predicted the water potential of the mapped trees to assess 1) similarities and differences between a leaf water potential map and a canopy water content map produced from airborne hyperspectral data, 2
Directory of Open Access Journals (Sweden)
Chen Yu-Ting
2010-12-01
Full Text Available Abstract Background Restoration of rooting competence is important for rejuvenation in Sequoia sempervirens (D. Don Endl and is achieved by repeatedly grafting Sequoia shoots after 16 and 30 years of cultivation in vitro. Results Mass spectrometry-based proteomic analysis revealed three proteins that differentially accumulated in different rejuvenation stages, including oxygen-evolving enhancer protein 2 (OEE2, glycine-rich RNA-binding protein (RNP, and a thaumatin-like protein. OEE2 was found to be phosphorylated and a phosphopeptide (YEDNFDGNSNVSVMVpTPpTDK was identified. Specifically, the protein levels of OEE2 increased as a result of grafting and displayed a higher abundance in plants during the juvenile and rejuvenated stages. Additionally, SsOEE2 displayed the highest expression levels in Sequoia shoots during the juvenile stage and less expression during the adult stage. The expression levels also steadily increased during grafting. Conclusion Our results indicate a positive correlation between the gene and protein expression patterns of SsOEE2 and the rejuvenation process, suggesting that this gene is involved in the rejuvenation of Sequoia sempervirens.
Coping with gravity: the foliar water relations of giant sequoia.
Williams, Cameron B; Reese Næsborg, Rikke; Dawson, Todd E
2017-10-01
In tall trees, the mechanisms by which foliage maintains sufficient turgor pressure and water content against height-related constraints remain poorly understood. Pressure-volume curves generated from leafy shoots collected crown-wide from 12 large Sequoiadendron giganteum (Lindley) J. Buchholz (giant sequoia) trees provided mechanistic insights into how the components of water potential vary with height in tree and over time. The turgor loss point (TLP) decreased with height at a rate indistinguishable from the gravitational potential gradient and was controlled by changes in tissue osmotica. For all measured shoots, total relative water content at the TLP remained above 75%. This high value has been suggested to help leaves avoid precipitous declines in leaf-level physiological function, and in giant sequoia was controlled by both tissue elasticity and the balance of water between apoplasm and symplasm. Hydraulic capacitance decreased only slightly with height, but importantly this parameter was nearly double in value to that reported for other tree species. Total water storage capacity also decreased with height, but this trend essentially disappeared when considering only water available within the typical range of water potentials experienced by giant sequoia. From summer to fall measurement periods we did not observe osmotic adjustment that would depress the TLP. Instead we observed a proportional shift of water into less mobile apoplastic compartments leading to a reduction in hydraulic capacitance. This collection of foliar traits allows giant sequoia to routinely, but safely, operate close to its TLP, and suggests that gravity plays a major role in the water relations of Earth's largest tree species. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Stephenson, Nathan L.; Das, Adrian J.; Ampersee, Nicholas J.; Cahill, Kathleen G.; Caprio, Anthony C.; Sanders, John E.; Williams, A. Park
2018-01-01
Hotter droughts – droughts in which unusually high temperatures exacerbate the effects of low precipitation – are expected to increase in frequency and severity in coming decades, challenging scientists and managers to identify which parts of forested landscapes may be most vulnerable. In 2014, in the middle of California’s historically unprecedented 2012–2016 hotter drought, we noticed apparently drought-induced foliage dieback in giant sequoias (Sequoiadendron giganteum Lindl. [Buchholz]) in Sequoia and Kings Canyon national parks, California. Characteristics of the dieback were consistent with a controlled process of drought-induced senescence: younger (distal) shoots remained green while older (proximal) shoots were preferentially shed. As part of an ongoing interdisciplinary effort to understand and map sequoia vulnerability to hotter droughts, we reviewed historical records for evidence of previous foliage dieback events, surveyed dieback along trail corridors in eight sequoia groves, and analyzed tree-ring data from a high- and a low-foliage-dieback area. In sharp contrast to the greatly elevated mortality of other coniferous species found at low and middle elevations, we estimate that <1% of sequoias died during the drought. Foliage dieback was notably elevated in 2014 – the most severe single drought year in our 122-year record – but much lower in subsequent years. We found no historical records of similar foliage dieback during previous droughts. Dieback in 2014 was highly variable both within and among groves, ranging from virtually no dieback in some areas to nearly 50% in others. Dieback was highest (1) at low elevations, probably due to higher temperatures, reduced snowpack, and earlier snowmelt; (2) in areas of low adult sequoia densities, which likely reflect intrinsically more stressful sites; and (3) on steep slopes, probably reflecting reduced water availability. Average sequoia ring widths were narrower at the high-dieback than the
2013-03-14
... Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite National Park, Madera, and Mariposa Counties, CA AGENCY: National Park Service, Interior. ACTION: Notice of availability... the Mariposa Grove of giant sequoias in Yosemite National Park. This Draft EIS presents three...
Nydick, Koren R.; Stephenson, Nathan L.; Ambrose, Anthony R.; Asner, Gregory P.; Baxter, Wendy L.; Das, Adrian J.; Dawson, Todd E.; Martin, Roberta E.; Paz-Kagan, Tarin
2018-01-01
Hotter droughts are becoming more common as climate change progresses, and they may already have caused instances of forest dieback on all forested continents. Learning from hotter droughts, including where on the landscape forests are more or less vulnerable to these events, is critical to help resource managers proactively prepare for the future. As part of our Leaf to Landscape Project, we measured the response of giant sequoia, the world’s largest tree species, to the extreme 2012–2016 hotter drought in California. The project integrated leaf-level physiology measurements, crown-level foliage dieback surveys, and remotely sensed canopy water content (CWC) to shed light on mechanisms and spatial patterns in drought response. Here we summarize initial findings, present a conceptual model of drought response, and discuss management implications; details are presented in the other four articles of the special section on Giant Sequoias and Drought. Giant sequoias exhibited both leaf- and canopy-level responses that were effective in protecting whole-tree hydraulic integrity for the vast majority of individual sequoias. Very few giant sequoias died during the drought compared to other mixed conifer tree species; however, the magnitude of sequoia drought response varied across the landscape. This variability was partially explained by local site characteristics, including variables related to site water balance. We found that low CWC is an indicator of recent foliage dieback, which occurs when stress levels are high enough that leaf-level adjustments alone are insufficient for giant sequoias to maintain hydraulic integrity. CWC or change in CWC may be useful indicators of drought stress that reveal patterns of vulnerability to future hotter droughts. Future work will measure recovery from the drought and strengthen our ability to interpret CWC maps. Our ultimate goal is to produce giant sequoia vulnerability maps to help target management actions, such as
Management of Giant Sequoia on Mountain Home Demonstration State Forest
Norman J. Benson
1986-01-01
Established in 1946, the Mountain Home Demonstration State Forest, Tulare County, California, is managed by the California Department of Forestry. It is a multiple-use forest with recreation as its primary focus, although timber management has always played an important role. Giant sequoia (Sequoiadendron giganteum [Lindl. ] Buchholz) occurs in...
Communicating the role of science in managing giant sequoia groves
Douglas D. Pilrto; Robert R. Rogers; Mary Chislock Bethke
1997-01-01
Management of giant sequoia groves has been and continues to be a hotly debated issue. The debate has reached Congress, with all parties seeking resolution as to what constitutes an ecologically and publicly acceptable management approach. Determining the correct management approach and communicating that approach to the general public is the crux of the problem....
High-resolution 3D simulations of NIF ignition targets performed on Sequoia with HYDRA
Marinak, M. M.; Clark, D. S.; Jones, O. S.; Kerbel, G. D.; Sepke, S.; Patel, M. V.; Koning, J. M.; Schroeder, C. R.
2015-11-01
Developments in the multiphysics ICF code HYDRA enable it to perform large-scale simulations on the Sequoia machine at LLNL. With an aggregate computing power of 20 Petaflops, Sequoia offers an unprecedented capability to resolve the physical processes in NIF ignition targets for a more complete, consistent treatment of the sources of asymmetry. We describe modifications to HYDRA that enable it to scale to over one million processes on Sequoia. These include new options for replicating parts of the mesh over a subset of the processes, to avoid strong scaling limits. We consider results from a 3D full ignition capsule-only simulation performed using over one billion zones run on 262,000 processors which resolves surface perturbations through modes l = 200. We also report progress towards a high-resolution 3D integrated hohlraum simulation performed using 262,000 processors which resolves surface perturbations on the ignition capsule through modes l = 70. These aim for the most complete calculations yet of the interactions and overall impact of the various sources of asymmetry for NIF ignition targets. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.
Clonal Spread in Second Growth Stands of Coast Redwood, Sequoia sempervirens
Vladimir Douhovnikoff; Richard S. Dodd
2007-01-01
Coast redwood (Sequoia sempervirens) is one of the rare conifers to reproduce successfully through clonal spread. The importance of this mode of reproduction in stand development is largely unknown. Understanding the importance of clonal spread and the spatial structure of clones is crucial for stand management strategies that would aim to maximize...
Energy Technology Data Exchange (ETDEWEB)
Grulke, N.E.; Miller, P.R. (USDA Forest Service, Riverside, CA (United States))
Native stands of giant sequoia are being exposed to relatively high concentrations of atmospheric ozone produced in urban and agricultural areas upwind. The expected change in environmental conditions over the next 100 y is likely to be unprecendented in the life span (ca 2,500 y) of giant sequoia. Changes in the physiological responses of three age classes of giant sequoia (current year, 12 y and 25 y) to different concentrations of ozone were determined, and age-related differences in sensitivity to pollutants were assessed by examining physiological changes (gas exchange, water use efficiency) across the life span of giant sequoia. The CO[sub 2] exchange rate (CER) was greater in current year (12.1 [mu]mol CO[sub 2]/m[sup 2]s) and 2 year old seedlings (4.8 [mu]mol CO[sub 2]/m[sup 2]s) than in all older trees (average of 3.0 [mu]mol CO[sub 2]/m[sup 2]s). Dark respiration was highest for current year seedlings and was increased twofold in symptotic individuals exposed to elevated ozone concentrations. Stomatal conductance was greater in current-year and 2 year old seedlings (335 and 200 mmol H[sub 2]O/m[sup 2]s), respectively, than in all older trees (50 mmol H[sub 2]O/m[sup 2]s), indicating that the ozone concentration in substomatol cavities is higher in young seedlings than in older trees. Significant changes in water use efficiency occurred in trees between ages 5 and 20 years. It is concluded that giant sequoia seedlings are sensitive to atmospheric ozone until they are ca 5 y old. Low conductance, high water use efficiency, and compact mesophyll all contribute to a natural ozone tolerance, or defense, or both, in foliage of older trees. 11 refs., 1 fig., 1 tab.
2011-12-02
... tree. Fire plays an important role in giant sequoia ecology, creating canopy openings and releasing soil nutrients needed for seedling establishment. Fire scars on the trees indicate that fires occurred... and sites within the Grove include the parking areas, gift shop, ticket booth, tram staging area...
Monte Carlo simulation of the resolution volume for the SEQUOIA spectrometer
Directory of Open Access Journals (Sweden)
Granroth G.E.
2015-01-01
Full Text Available Monte Carlo ray tracing simulations, of direct geometry spectrometers, have been particularly useful in instrument design and characterization. However, these tools can also be useful for experiment planning and analysis. To this end, the McStas Monte Carlo ray tracing model of SEQUOIA, the fine resolution fermi chopper spectrometer at the Spallation Neutron Source (SNS of Oak Ridge National Laboratory (ORNL, has been modified to include the time of flight resolution sample and detector components. With these components, the resolution ellipsoid can be calculated for any detector pixel and energy bin of the instrument. The simulation is split in two pieces. First, the incident beamline up to the sample is simulated for 1 × 1011 neutron packets (4 days on 30 cores. This provides a virtual source for the backend that includes the resolution sample and monitor components. Next, a series of detector and energy pixels are computed in parallel. It takes on the order of 30 s to calculate a single resolution ellipsoid on a single core. Python scripts have been written to transform the ellipsoid into the space of an oriented single crystal, and to characterize the ellipsoid in various ways. Though this tool is under development as a planning tool, we have successfully used it to provide the resolution function for convolution with theoretical models. Specifically, theoretical calculations of the spin waves in YFeO3 were compared to measurements taken on SEQUOIA. Though the overall features of the spectra can be explained while neglecting resolution effects, the variation in intensity of the modes is well described once the resolution is included. As this was a single sharp mode, the simulated half intensity value of the resolution ellipsoid was used to provide the resolution width. A description of the simulation, its use, and paths forward for this technique will be discussed.
George N. Steger; Thomas E. Munton; Kenneth D. Johnson; Gary P. Eberlein
2002-01-01
Nine years (1990–1998) of demographic data on California spotted owls (Strix occidentalis occidentalis) in two study areas on the western slopes of the Sierra Nevada—one in the Sierra National Forest (SNF), the other in Sequoia/Kings Canyon National Parks (SNP)—are summarized. Numbers of territorial owls fluctuated from 85 to 50 in SNF and 80 to 58...
Halmagyi, A; Surducan, E; Surducan, V
2017-09-01
Two distinct microwave power levels and techniques have been studied in two cases: low-power microwave (LPM) irradiation on in vitro Sequoia plants and high-power microwave (HPM) exposure on recovery rates of cryostored (-196°C) Sequoia shoot apices. Experimental variants for LPM exposure included: (a) in vitro plants grown in regular conditions (at 24 ± 1°C during a 16-h light photoperiod with a light intensity of 39.06 μEm -2 s -1 photosynthetically active radiation), (b) in vitro plants grown in the anechoic chamber with controlled environment without microwave irradiation, and (c) in vitro plants grown in the anechoic chamber with LPM irradiation for various times (5, 15, 30, 40 days). In comparison to control plants, significant differences in shoot multiplication and growth parameters (length of shoots and roots) were observed after 40 days of LPM exposure. An opposite effect was achieved regarding the content of total soluble proteins, which decreased with increasing exposure time to LPM. HPM irradiation was tested as a novel rewarming method following storage in liquid nitrogen. To our knowledge, this is the first report using this type of rewarming method. Although, shoot tips subjected to HPM exposure showed 28% recovery following cryostorage compared to 44% for shoot tips rewarmed in liquid medium at 22 ± 1 °C, we consider that the method represent a basis and can be further improved. The results lead to the overall conclusion that LPM had a stimulating effect on growth and multiplication of in vitro Sequoia plants, while the HPM used for rewarming of cryopreserved apices was not effective to achieve high rates of regrowth after liquid nitrogen exposure.
Directory of Open Access Journals (Sweden)
Anelise Fonseca
2011-10-01
Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20
Laboratory evaluation of the Sequoia Scientific LISST-ABS acoustic backscatter sediment sensor
Snazelle, Teri T.
2017-12-18
Sequoia Scientific’s LISST-ABS is an acoustic backscatter sensor designed to measure suspended-sediment concentration at a point source. Three LISST-ABS were evaluated at the U.S. Geological Survey (USGS) Hydrologic Instrumentation Facility (HIF). Serial numbers 6010, 6039, and 6058 were assessed for accuracy in solutions with varying particle-size distributions and for the effect of temperature on sensor accuracy. Certified sediment samples composed of different ranges of particle size were purchased from Powder Technology Inc. These sediment samples were 30–80-micron (µm) Arizona Test Dust; less than 22-µm ISO 12103-1, A1 Ultrafine Test Dust; and 149-µm MIL-STD 810E Silica Dust. The sensor was able to accurately measure suspended-sediment concentration when calibrated with sediment of the same particle-size distribution as the measured. Overall testing demonstrated that sensors calibrated with finer sized sediments overdetect sediment concentrations with coarser sized sediments, and sensors calibrated with coarser sized sediments do not detect increases in sediment concentrations from small and fine sediments. These test results are not unexpected for an acoustic-backscatter device and stress the need for using accurate site-specific particle-size distributions during sensor calibration. When calibrated for ultrafine dust with a less than 22-µm particle size (silt) and with the Arizona Test Dust with a 30–80-µm range, the data from sensor 6039 were biased high when fractions of the coarser (149-µm) Silica Dust were added. Data from sensor 6058 showed similar results with an elevated response to coarser material when calibrated with a finer particle-size distribution and a lack of detection when subjected to finer particle-size sediment. Sensor 6010 was also tested for the effect of dissimilar particle size during the calibration and showed little effect. Subsequent testing revealed problems with this sensor, including an inadequate temperature
Directory of Open Access Journals (Sweden)
Anelise Fonseca
2011-10-01
Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20
Modeling mountain pine beetle habitat suitability within Sequoia National Park
Nguyen, Andrew
Understanding significant changes in climate and their effects on timber resources can help forest managers make better decisions regarding the preservation of natural resources and land management. These changes may to alter natural ecosystems dependent on historical and current climate conditions. Increasing mountain pine beetle (MBP) outbreaks within the southern Sierra Nevada are the result of these alterations. This study better understands MPB behavior within Sequoia National Park (SNP) and model its current and future habitat distribution. Variables contributing to MPB spread are vegetation stress, soil moisture, temperature, precipitation, disturbance, and presence of Ponderosa (Pinus ponderosa) and Lodgepole (Pinus contorta) pine trees. These variables were obtained using various modeled, insitu, and remotely sensed sources. The generalized additive model (GAM) was used to calculate the statistical significance of each variable contributing to MPB spread and also created maps identifying habitat suitability. Results indicate vegetation stress and forest disturbance to be variables most indicative of MPB spread. Additionally, the model was able to detect habitat suitability of MPB with a 45% accuracy concluding that a geospatial driven modeling approach can be used to delineate potential MPB spread within SNP.
Matchett, John R.; Lutz, James A.; Tarnay, Leland W.; Smith, Douglas G.; Becker, Kendall M.L.; Brooks, Matthew L.
2015-01-01
Forest biomass on Sierra Nevada landscapes constitutes one of the largest carbon stocks in California, and its stability is tightly linked to the factors driving fire regimes. Research suggests that fire suppression, logging, climate change, and present management practices in Sierra Nevada forests have altered historic patterns of landscape carbon storage, and over a century of fire suppression and the resulting accumulation in surface fuels have been implicated in contributing to recent increases in high severity, stand-replacing fires. For over 30 years, fire management at Yosemite (YOSE) and Sequoia & Kings Canyon (SEKI) national parks has led the nation in restoring fire to park landscapes; however, the impacts on the stability and magnitude of carbon stocks have not been thoroughly examined.
Produção de painéis compensados fenólicos com lâminas de madeira de Sequoia sempervirens
Directory of Open Access Journals (Sweden)
Setsuo Iwakiri
Full Text Available Esta pesquisa teve como objetivo avaliar a qualidade dos painéis compensados multilaminados produzidos com lâminas de madeira de Sequoia sempervirens. Foram produzidos em laboratório compensados com cinco lâminas de 2,0 mm de espessura, coladas com resina fenol-formaldeÃdo, com duas diferentes formulações: (A FF = 100; E = 5; CC = 5; A = 5, e (B FF = 100; E = 15; CC = 15; A = 15, e duas gramaturas: 280g/m² e 320 g/m². Os painéis foram prensados com pressão especÃfica de 10 kgf/cm², temperatura de 130 ºC e tempo de prensagem de dez minutos. Foram avaliadas as propriedades de resistência da linha de cola aos esforços de cisalhamento e de flexão estática (módulo de elasticidade e módulo de ruptura, paralelo e perpendicular à s fibras. De uma forma geral, as diferentes formulações de cola e gramaturas não afetaram significativamente as propriedades dos painéis, o que representa um aspecto importante sob o ponto de vista econômico. A resistência ao cisalhamento e a percentagem de falhas na madeira dos painéis produzidos com a formulação (B atenderam aos requisitos mÃnimos da norma EN 314-2 (1993 para painéis de uso externo. Os resultados indicam que as lâminas de Sequoia sempervirens podem ser utilizadas para compor o miolo de painéis compensados para uso externo.
Directory of Open Access Journals (Sweden)
Simone Kartsiotis
2018-01-01
Full Text Available This report presents a comparison via field-testing between Parrot Sequoia and Mapir Survey2 multispectral cameras. Both sensors are commonly used in precision farming activities conducted by micro-RPAS (drones, thanks to their small size and light weight. The experimental activity was performed in summer on the vineyards of the Savignola Paolina agricultural holding in Tuscany. The sensors were taken on board the EXOS drone, a hexacopter developed by Zephyr S.r.l. company and specifically designed for precision farming operations. Good and bad qualities for each cameras are examined by a comprehensive approach, starting from technical specifications and continuing with a comparison of the results obtained on field. All the activity was performed by a partnership between the companies DroneBee and Zephyr S.r.l. .
Huber, Ann; Das, Adrian; Wenk, Rebecca; Haultain, Sylvia
2013-01-01
Sequoia and Kings Canyon National Parks are located in the California Floristic Province, which has been named one of world‘s hotspots of endemic biodiversity (Myers et al. 2000). The California Floristic Province is the largest and most important geographic floristic unit in California and extends from the Klamath Mountains of southwestern Oregon to the northwestern portion of Baja California (Hickman 1993). The Sierra Nevada, one of six regions that make up the California Floristic Province, covers nearly 20% of the land in California yet contains over 50% of its flora. Within the Sierra Nevada, the southern Sierra supports more Sierran endemic and rare plant taxa than the central and northern portions of the region (Shevock 1996). Sequoia and Kings Canyon National Parks (SEKI) encompass roughly 20% of the southern Sierra Nevada region. The parks overlap three floristic subregions (central Sierra Nevada High, southern Sierra Nevada High, and southern Sierra Nevada Foothills), and border the Great Basin Floristic Province. The parks support a rich and diverse vascular flora composed of over 1,560 taxa. Of these, 150 taxa are identified as having special status. The term special status is applied here to include taxa that are state or federally listed, rare in California, or at risk because they have a limited distribution. Only one species from these parks is listed under the state or federal Endangered Species Acts (Carex tompkinsii, Tompkins‘ sedge, is listed as a rare species under the California Endangered Species Act), and one species is under review for federal endangered listing (Pinus albicaulis, whitebark pine). However, an absence of threatened and endangered species recognized by Endangered Species Acts is not equivalent to an absence of species at risk. There are 83 plant taxa documented as occurring in SEKI that are considered imperiled or vulnerable in the state by the California Department of Fish and Game‘s California Natural Diversity
A lightning multiple casualty incident in Sequoia and Kings Canyon National Parks.
Spano, Susanne J; Campagne, Danielle; Stroh, Geoff; Shalit, Marc
2015-03-01
Multiple casualty incidents (MCIs) are uncommon in remote wilderness settings. This is a case report of a lightning strike on a Boy Scout troop hiking through Sequoia and Kings Canyon National Parks (SEKI), in which the lightning storm hindered rescue efforts. The purpose of this study was to review the response to a lightning-caused MCI in a wilderness setting, address lightning injury as it relates to field management, and discuss evacuation options in inclement weather incidents occurring in remote locations. An analysis of SEKI search and rescue data and a review of current literature were performed. A lightning strike at 10,600 feet elevation in the Sierra Nevada Mountains affected a party of 5 adults and 7 Boy Scouts (age range 12 to 17 years old). Resources mobilized for the rescue included 5 helicopters, 2 ambulances, 2 hospitals, and 15 field and 14 logistical support personnel. The incident was managed from strike to scene clearance in 4 hours and 20 minutes. There were 2 fatalities, 1 on scene and 1 in the hospital. Storm conditions complicated on-scene communication and evacuation efforts. Exposure to ongoing lightning and a remote wilderness location affected both victims and rescuers in a lightning MCI. Helicopters, the main vehicles of wilderness rescue in SEKI, can be limited by weather, daylight, and terrain. Redundancies in communication systems are vital for episodes of radio failure. Reverse triage should be implemented in lightning injury MCIs. Education of both wilderness travelers and rescuers regarding these issues should be pursued. Copyright © 2015 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.
Nanus, L.; Clow, D. W.; Sickman, J. O.
2016-12-01
High-elevation aquatic ecosystems in Yosemite (YOSE) and Sequoia and Kings Canyon (SEKI) National Parks are impacted by atmospheric nitrogen (N) deposition associated with local and regional air pollution. Documented effects include elevated surface water nitrate concentrations, increased algal productivity, and changes in diatom species assemblages. Annual wet inorganic N deposition maps, developed at 1-km resolution for YOSE and SEKI to quantify N deposition to sensitive high-elevation ecosystems, range from 1.0 to over 5.0 kg N ha-1 yr-1. Critical loads of N deposition for nutrient enrichment of aquatic ecosystems were quantified and mapped using a geostatistical approach, with N deposition, topography, vegetation, geology, and climate as potential explanatory variables. Multiple predictive models were created using various combinations of explanatory variables; this approach allowed us to better quantify uncertainty and more accurately identify the areas most sensitive to atmospherically deposited N. The lowest critical loads estimates and highest exceedances identified within YOSE and SEKI occurred in high-elevation basins with steep slopes, sparse vegetation, and areas of neoglacial till and talus. These results are consistent with previous analyses in the Rocky Mountains, and highlight the sensitivity of alpine ecosystems to atmospheric N deposition.
International Nuclear Information System (INIS)
Staszak, J.; Grulke, N.E.; Marrett, M.J.; Prus-Glowacki, W.
2007-01-01
Effects of canopy ozone (O 3 ) exposure and signatures of genetic structure using isozyme markers associated with O 3 tolerance were analyzed in ∼20-, ∼80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O 3 exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O 3 exposure, and to higher O 3 exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine
Directory of Open Access Journals (Sweden)
Steve Wathen
Full Text Available Evidence for significant losses of species richness or biodiversity, even within protected natural areas, is mounting. Managers are increasingly being asked to monitor biodiversity, yet estimating biodiversity is often prohibitively expensive. As a cost-effective option, we estimated the spatial and temporal distribution of species richness for four taxonomic groups (birds, mammals, herpetofauna (reptiles and amphibians, and plants within Sequoia and Kings Canyon National Parks using only existing biological studies undertaken within the Parks and the Parks' long-term wildlife observation database. We used a rarefaction approach to model species richness for the four taxonomic groups and analyzed those groups by habitat type, elevation zone, and time period. We then mapped the spatial distributions of species richness values for the four taxonomic groups, as well as total species richness, for the Parks. We also estimated changes in species richness for birds, mammals, and herpetofauna since 1980. The modeled patterns of species richness either peaked at mid elevations (mammals, plants, and total species richness or declined consistently with increasing elevation (herpetofauna and birds. Plants reached maximum species richness values at much higher elevations than did vertebrate taxa, and non-flying mammals reached maximum species richness values at higher elevations than did birds. Alpine plant communities, including sagebrush, had higher species richness values than did subalpine plant communities located below them in elevation. These results are supported by other papers published in the scientific literature. Perhaps reflecting climate change: birds and herpetofauna displayed declines in species richness since 1980 at low and middle elevations and mammals displayed declines in species richness since 1980 at all elevations.
Energy Technology Data Exchange (ETDEWEB)
Staszak, J. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland); Grulke, N.E. [USDA Forest Service, 4955 Canyon Crest Drive, Riverside, CA 92507 (United States)], E-mail: ngrulke@fs.fed.us; Marrett, M.J. [5184 Tower Road, Riverside, CA 92506 (United States); Prus-Glowacki, W. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland)
2007-10-15
Effects of canopy ozone (O{sub 3}) exposure and signatures of genetic structure using isozyme markers associated with O{sub 3} tolerance were analyzed in {approx}20-, {approx}80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O{sub 3} exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O{sub 3} exposure, and to higher O{sub 3} exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine.
Nesmith, C.B.; Caprio, Anthony C.; Pfaff, Anne H.; McGinnis, Thomas W.; Keeley, Jon E.
2011-01-01
Current goals for prescription burning are focused on measures of fuel consumption and changes in forest density. These benchmarks, however, do not address the extent to which prescription burning meets perceived ecosystem needs of heterogeneity in burning, both for overstory trees and understory herbs and shrubs. There are still questions about how closely prescribed fires mimic these patterns compared to natural wildfires. This study compared burn patterns of prescribed fires and managed unplanned wildfires to understand how the differing burning regimes affect ecosystem properties. Measures of forest structure and fire severity were sampled in three recent prescribed fires and three wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks. Fine scale patterns of fire severity and heterogeneity were compared between fire types using ground-based measures of fire effects on fuels and overstory and understory vegetation. Prescribed fires and wildfires managed for resource objectives displayed similar patterns of overstory and understory fire severity, heterogeneity, and seedling and sapling survival. Variation among plots within the same fire was always greater than between fire types. Prescribed fires can provide burned landscapes that approximate natural fires in many ways. It is recognized that constraints placed on when wildfires managed for resource objectives are allowed to burn freely may bias the range of conditions that might have been experienced under more natural conditions. Therefore they may not exactly mimic natural wildfires. Overall, the similarity in fire effects that we observed between prescribed fires and managed wildfires indicate that despite the restrictions that are often placed on prescribed fires, they appear to be creating post-fire conditions that approximate natural fires when assessed on a fine spatial scale.
Clow, David W.; Forrester, Harrison; Miller, Benjamin; Roop, Heidi; Sickman, James O.; Ryu, Hodon; Santo Domingo, Jorge
2013-01-01
During 2010-2011, a study was conducted in Sequoia and Kings Canyon National Parks (SEKI) to evaluate the influence of pack animals (stock) and backpackers on water quality in wilderness lakes and streams. The study had three main components: (1) a synoptic survey of water quality in wilderness areas of the parks, (2) paired water-quality sampling above and below several areas with differing types and amounts of visitor use, and (3) intensive monitoring at six sites to document temporal variations in water quality. Data from the synoptic water-quality survey indicated that wilderness lakes and streams are dilute and have low nutrient and Escherichia coli (E. coli) concentrations. The synoptic survey sites were categorized as minimal use, backpacker use, or mixed use (stock and backpackers), depending on the most prevalent type of use upstream from the sampling locations. Sites with mixed use tended to have higher concentrations of most constituents (including E.coli) than those categorized as minimal-use (p≤0.05); concentrations at backpacker-use sites were intermediate. Data from paired-site sampling indicated that E.coli, total coliform, and particulate phosphorus concentrations were greater in streams downstream from mixed-use areas than upstream from those areas (p≤0.05). Paired-site data also indicated few statistically significant differences in nutrient, E. coli, or total coliform concentrations in streams upstream and downstream from backpacker-use areas. The intensive-monitoring data indicated that nutrient and E. coli concentrations normally were low, except during storms, when notable increases in concentrations of E.coli, nutrients, dissolved organic carbon, and turbidity occurred. In summary, results from this study indicate that water quality in SEKI wilderness generally is good, except during storms; and visitor use appears to have a small, but statistically significant influence on stream water quality.
Nesmith, Jonathan C. B.; Das, Adrian J.; O'Hara, Kevin L.; van Mantgem, Phillip J.
2015-01-01
Tree mortality is a vital component of forest management in the context of prescribed fires; however, few studies have examined the effect of prefire tree health on postfire mortality. This is especially relevant for sugar pine (Pinus lambertiana Douglas), a species experiencing population declines due to a suite of anthropogenic factors. Using data from an old-growth mixed-conifer forest in Sequoia National Park, we evaluated the effects of fire, tree size, prefire radial growth, and crown condition on postfire mortality. Models based only on tree size and measures of fire damage were compared with models that included tree size, fire damage, and prefire tree health (e.g., measures of prefire tree radial growth or crown condition). Immediately following the fire, the inclusion of different metrics of prefire tree health produced variable improvements over the models that included only tree size and measures of fire damage, as models that included measures of crown condition performed better than fire-only models, but models that included measures of prefire radial growth did not perform better. However, 5 years following the fire, sugar pine mortality was best predicted by models that included measures of both fire damage and prefire tree health, specifically, diameter at breast height (DBH, 1.37 m), crown scorch, 30-year mean growth, and the number of sharp declines in growth over a 30-year period. This suggests that factors that influence prefire tree health (e.g., drought, competition, pathogens, etc.) may partially determine postfire mortality, especially when accounting for delayed mortality following fire.
Klinger, Robert C.; Few, Alexandra P.; Knox, Kathleen A.; Hatfield, Brian E.; Clark, Jonathan; German, David W.; Stephenson, Thomas R.
2015-01-01
Pack stock (horses, mules, burros, llamas, and goats) are frequently assumed to have negative effects on public lands, but there is a general lack of data to be able to quantify the degree to which this is actually the case. Sequoia and Kings Canyon National Parks have received complaints that pack stock may affect Sierra Nevada bighorn sheep (Ovis canadensis sierrae; SNBS), a federally endangered subspecies that occurs in largely disjunct herds in the Sierra Nevada Range of California. The potential effects are thought to be displacement of SNBS from meadows on their summer range (altered habitat use) or, more indirectly, through changes in SNBS habitat or forage quality. Our goals were to conduct an association analysis to quantify the degree of potential spatial overlap in meadow use between SNBS and pack stock and to compare differences in vegetation community composition, structure, and diversity among meadows with different levels of use by bighorn sheep and pack stock. For the association analysis, we used two approaches: (1) we quantified the proportion of meadows that were within the herd home ranges of bighorn sheep and were potentially open to pack stock, and, (2) we used Monte Carlo simulations and use-availability analyses to compare the proportion of meadows used by bighorn sheep relative to the proportional occurrence or area of meadows available to bighorn sheep that were used by pack stock. To evaluate potential effects of pack stock on meadow plant communities and SNBS forage, we sampled vegetation in 2011 and 2012 at 100 plots to generate data that allowed us to compare:
Kinoshita, A. M.; Hale, B.; Hogue, T. S.
2012-12-01
Post-fire management decisions are guided by rainfall-runoff predictions, which ultimately influence downstream treatment and mitigation costs. The current study investigates evolving rainfall-runoff partitioning at the watershed scale over a two-year period after the 2010 Bull Fire which occurred in the southern Sequoia National Forest in California. Stage height was measured at five-minute intervals using pressure transducers, tipping buckets were installed for rainfall duration and intensity, and channel cross-sections were measured approximately every two months to detail sediment deposition or scour. We also utilize remotely sensed vegetation data to evaluate vegetation recovery in the studied watersheds and the corresponding relationship to storm runoff. Normalized Difference Vegetation Index (NDVI), a measure of vegetation greenness, is evaluated for its potential use as a key recovery indicator. Preliminary results focus on alterations in annual and seasonal precipitation and discharge relationships using in-situ data and Landsat NDVI values for the period of study. NDVI values are consistent with a comprehensive burn, with an acute decrease observed in the initial post-fire period. However, vegetation recovery is highly variable in the studied systems and influenced by shorter-term biomass pulses (grasses) while longer-term recovery of other species (chaparral and pine) is ongoing. Runoff ratios are elevated during early storms and show some recovery in the later part of the study period. The ability to accurately and confidently predict post-fire runoff and longer-term recovery is critical for monitoring values-at-risk, reducing mitigation costs, and improving warnings to downstream public communities.
Ruso, Gabrielle; Meyer, Erik; Das, Adrian J.
2017-01-01
Managers making decisions may benefit from a well-informed understanding of a species' population size and trends. Given the cryptic nature and habitat characteristics of the western pond turtle (Emys marmorata), however, imperfect detection may be high and population estimates are frequently varied and unreliable. As a case study to investigate this issue, we used temperature dataloggers to examine turtle behavior at 2 long-term monitoring sites with different hydrological characteristics in Sequoia National Park, California, to determine if common stream-survey techniques are consistent with site-specific turtle behavior. Sycamore Creek is an intermittent stream that dries up every summer while the North Fork Kaweah River flows year-round. We found that while turtles spent most of the recorded time in the water (55% in Sycamore Creek and 82% in the North Fork Kaweah River), the timing of traditional surveys only coincided with the turtles' aquatic activity in the North Fork Kaweah River. At Sycamore Creek, turtles were most likely to be in the water at night. In contrast, failure to detect turtles in North Fork Kaweah River is likely owing to the larger size and complexity of the underwater habitat. In both streams, turtles were also more likely to be in the water in the weeks leading up to important changes in hydroperiods. Our findings illustrate the effects that differences in water permanence can have on turtle behavior within the same watershed and how phenotypic plasticity may then affect detection during surveys. Our study highlights the importance of tailoring survey practices to the site-specific behavioral traits of the target species.
International Nuclear Information System (INIS)
Hooper, R.P.; West, C.T.; Peters, N.E.
1990-01-01
A sparsely parameterized hydrochemical model has been developed by using data from Emerald Lake watershed, which is a 120-ha alpine catchment in Sequoia National Park, California. Greater than 90% of the precipitation to this watershed is snow; hence, snowmelt is the dominant hydrologic event. A model which uses a single alkalinity-generating mechanism, primary mineral weathering, was able to capture the pattern of solute concentrations in surface waters during snowmelt. An empirical representation of the weathering reaction, which is based on rock weathering stoichiometry and which uses discharge as a measure of residence time, was included in the model. Results of the model indicate that current deposition levels would have to be increased between three-fold and eight-fold to exhaust the alkalinity of the lake during snowmelt if their is a mild acidic pulse in the stream at the beginning of snowmelt as was observed during the study period. The acidic pulse in the inflow stream at the onset of snowmelt was less pronounced than acidic pulses observed in the meltwater draining the snowpack at a point using snow lysimeters or in the laboratory. Sulfate concentrations in the stream water were the most constant; chloride and nitrate concentrations increased slightly at the beginning of snowmelt. Additional field work is required to resolve whether an acidic meltwater pulse occurs over a large area as well as at a point or whether, due to physical and chemical processes within the snowpack, the acidic meltwater pulse is attenuated at the catchment scale. The modest data requirements of the model permit its applications to other alpine watersheds that are much less intensively studied than Emerald Lake watershed
International Nuclear Information System (INIS)
Hooper, R.P.; West, C.T.; Peters, N.E.
1990-01-01
A simple process-oriented model, called the Alpine Lake Forecaster (ALF), was constructed using data collected from the Integrated Watershed Study of Emerald Lake, Sequoia National Park, California. ALF is able to capture the basic solute patterns during snowmelt in this alpine catchment where groundwater is a minor contributor to streamflow. It includes an empirical representation of primary mineral weathering as the only alkalinity generating mechanism. During a heavy snow year, such as the one used for calibrating the model, the model accurately simulated the surface water chemical change in response to the initial ionic pulse from the snowpack and to the dilution that occurs at peak snowmelt. Because the model does not consider cation exchange, it over-predicts the acidification during the initial period of snowmelt, and therefore is a conservative predictor. However, the minimum alkalinity observed in the main inflows to Emerald Lake and in the lake outflow is accurately simulated by the model. The representation of the lake as simply a missing volume with no additional chemical reactions is supported by the observation. The model predicts a change of 2 to 5 microequiv/L in the minimum alkalinity of the lake outflow during snowmelt if the deposition would have to increase between two and 18 times the current load-alkalinity of the lake; the precise increase depends on hydrologic conditions and on the pattern of solute release from the snowpack. An acidic rainstorm that exhausted the alkalinity of the lake was observed during summer 1984 after the lake had stratified, and is the likely cause of the acidification of Emerald Lake
Nesmith, Jonathan C. B.; O'Hara, Kevin L.; van Mantgem, Phillip J.; de Valpine, Perry
2010-01-01
Prescribed fire is an important tool for fuel reduction, the control of competing vegetation, and forest restoration. The accumulated fuels associated with historical fire exclusion can cause undesirably high tree mortality rates following prescribed fires and wildfires. This is especially true for sugar pine (Pinus lambertiana Douglas), which is already negatively affected by the introduced pathogen white pine blister rust (Cronartium ribicola J.C. Fisch. ex Rabenh). We tested the efficacy of raking away fuels around the base of sugar pine to reduce mortality following prescribed fire in Sequoia and Kings Canyon national parks, California, USA. This study was conducted in three prescribed fires and included 457 trees, half of which had the fuels around their bases raked away to mineral soil to 0.5 m away from the stem. Fire effects were assessed and tree mortality was recorded for three years after prescribed fires. Overall, raking had no detectable effect on mortality: raked trees averaged 30% mortality compared to 36% for unraked trees. There was a significant effect, however, between the interaction of raking and average pre-treatment forest floor fuel depth: the predicted probability of survival of a 50 cm dbh tree was 0.94 vs. 0.96 when average pre-treatment fuel depth was 0 cm for a raked and unraked tree, respectively. When average pre-treatment forest floor fuel depth was 30 cm, the predicted probability of survival for a raked 50 cm dbh tree was 0.60 compared to only 0.07 for an unraked tree. Raking did not affect mortality when fire intensity, measured as percent crown volume scorched, was very low (0% scorch) or very high (>80% scorch), but the raking treatment significantly increased the proportion of trees that survived by 9.6% for trees that burned under moderate fire intensity (1% to 80% scorch). Raking significantly reduced the likelihood of bole charring and bark beetle activity three years post fire. Fuel depth and anticipated fire intensity need
Nematodes Parasites of Teiid Lizards from the Brazilian Amazon Rainforest.
Macedo, L C; Gardner, S L; Melo, F T V; Giese, E G; Santos, J N
2017-04-01
This study presents the helminth composition and parameters of infection by several species of nematodes in teiid lizards, Ameiva ameiva ameiva (Linnaeus, 1758), Cnemidophorus cryptus Cole and Dessauer, 1993, and Kentropyx calcarata Spix, 1825 from the Brazilian Amazonian Rainforest. The population of lizards studied were parasitized by 6 species of Phylum Nemata including: Spinicauda spinicauda (Olfers, 1919), Parapharyngodon alvarengai Freitas, 1957, Physaloptera sp. (adults), Physaloptera sp. (larvae), Piratuba digiticauda Lent and Freitas, 1941, and Anisakidae (larvae). The overall prevalence was 66.17% and the mean intensity of infection was 19.40 ± 25.48. The association between the body-length of lizards and the abundance and richness of parasitic nematodes was statistically significant only in Ameiva a. ameiva. A new host record is reported here with 1 specimen of the family Anasakidae in Ameiva a. ameiva. Both S. spinicauda and Physaloptera sp. represent new records from C. cryptus.
Mohan, Sharad; Mauchline, Tim H; Rowe, Janet; Hirsch, Penny R; Davies, Keith G
2012-03-01
The Pasteuria group of Gram-positive, endospore-forming bacteria are parasites of invertebrates and exhibit differences in host specificity. We describe a cross-infection study between an isolate of Pasteuria from pigeon pea cyst nematode, Heterodera cajani, which also infects the potato cyst nematode, Globodera pallida, from the United Kingdom. A proportion of the attached endospores, 13% on H. cajani and 22% on G. pallida adhere to the cuticle in an inverted orientation. Inverted and conventionally attached endospores germinated and produced bacillus-like rods that completed their life cycle in Pasteuria population was systematically followed in two different nematode genera. A 1430-base pair fragment of the 16S rRNA gene sequence of the Pasteuria isolate from H. cajani revealed 98.6% similarity to the orthologous gene in Pasteuria nishizawae. Additionally, their respective endospore sizes were not significantly different, in contrast their host ranges are. Potential reasons for this remain unclear and are discussed. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
Redescription of Heterodera fici (Nematoda: Heteroderidae) with SEM Observations
Golden, A. Morgan; Maqbool, M. A.; Shahina, F.
1988-01-01
Heterodera fici is redescribed and illustrated with comparative details and revised measurements and diagnostic characters of the females, males, cysts, and juveniles from Maryland and Pakistan. This species is in the "schachtii group" (cysts lemon shaped, with bullae, and ambifenestrate) but the fenestrae in some cysts, presumab!y young ones, are small and widely spaced, appearing bifenestrate. It is most closely related to H. schachtii, H. glycines, and H. cajani but differs from these spec...
Das, Adrian J.; Stephenson, Nathan L.
2013-01-01
Climate is a master controller of the structure, composition, and function of biotic communities, affecting them both directly, through physiological effects, and indirectly, by mediating biotic interactions and by influencing disturbance regimes. Sequoia and Kings Canyon National Park’s (SEKI’s) dramatic elevational changes in biotic communities -- from warm mediterranean to cold alpine -- are but one manifestation of climate’s overarching importance in shaping SEKI’s landscape. Yet humans are now altering the global climate, with measurable effects on ecosystems (IPCC 2007). Over the last few decades across the western United States, human-induced climatic changes have likely contributed to observed declines in fraction of precipitation falling as snow and snowpack water content (Mote et al. 2005, Knowles et al. 2006), advance in spring snowmelt (Stewart et al. 2005, Barnett et al. 2008), and consequent increase in area burned in wildfires (Westerling et al. 2006). In the Sierra Nevada, warming temperatures have likely contributed to observed glacial recession (Basagic 2008), uphill migration of small mammals (Moritz et al. 2008), and increasing tree mortality rates (van Mantgem and Stephenson 2007, van Mantgem et al. 2009). More substantial changes can be expected for the future (e.g., IPCC 2007). Given the central importance of climate and climatic changes, we sought to describe long-term trends in temperature and precipitation at SEKI. Time and budget constraints limited us to analyses of mean annual temperature and mean annual precipitation, using readily-available data. If funds become available in the future, further analyses will be needed to analyze trends by season, trends in daily minimum and maximum temperatures, and so on. We chose to analyze data from individual weather stations rather than use interpolated climatic data from sources such as PRISM (http://www.prism.oregonstate.edu/). In topographically complex mountainous regions with few
Acid mist and ozone effects on the leaf chemistry of two western conifer species
Westman, Walter E.; Temple, Patrick J.
1989-01-01
The effects of ozone and acid-mist exposures on the leaf chemistry of Jeffrey pine and giant sequoia seedlings grown in filtered-air greenhouses were investigated. Acid-mist treatments (pH 4.1, 3.4, 2.7, or 2.0) were administered for 3 h, and ozone exposures (0, 0.10, and 0.20 microliter/liter), which followed acid-mist treatments, for 4 h, each for three days a week for six to nine weeks. It was found that seedlings were more susceptible to acid-mist and acid mist/ozone combinations, than to ozone alone. Acid mist treatment resulted in higher levels of nitrogen and sulfur (both present in acid mist) as well as Na. Leaves of giant sequoia exhibited increased K and decreased Mn, while Jeffrey pine showed increases in Fe and Mn. In sequoia leaves, concentrations of Ca, Mg, and Ba decreased. Acid treatment also reduced chlorophyll b concentrations in both conifer species. Extensive changes induced by acid mist are consistent with earlier observations of changes in spectral reflectance of conifer seedlings observed after three weeks of fumigation.
Description of Globodera ellingtonae n. sp. (Nematoda: Heteroderidae) from Oregon.
Handoo, Zafar A; Carta, Lynn K; Skantar, Andrea M; Chitwood, David J
2012-03-01
A new species of cyst nematode, Globodera ellingtonae, is described from soil collected from a field in Oregon. Second-stage juveniles (J2) of the species are characterized by body length of 365-515 μm, stylet length of 19-22.5 μm, basal knobs rounded posteriorly and pointed anteriorly, tail 39-55 μm, hyaline tail terminus 20-32.5 μm, and tail tapering uniformly but abruptly narrowing and constricted near the posterior third of the hyaline portion, ending with a peg-like, finely rounded to pointed terminus. Cysts are spherical to sub-spherical, dark to light brown and circumfenestrate and cyst wall pattern is ridge-like with heavy punctations. Males have a stylet length of 21-25 μm and spicule length of 30-37 μm with a pointed thorn-like tip. Females have a stylet length of 20-22.5 μm, one head annule and labial disc, heavy punctations on the cuticle, and short vulval slit 7.5-8 μm long. Morphologically this new, round-cyst species differs from the related species G. pallida, G. rostochiensis, G. tabacum complex and G. mexicana by its distinctive J2 tail, and by one or another of the following: shorter mean stylet length in J2, females and males; number of refractive bodies in the hyaline tail terminus of J2; cyst morphology including Granek's ratio; number of cuticular ridges between the anus and vulva; and in the shape and length of spicules in males. Its relationship to these closely related species are discussed. Based upon analysis of ribosomal internal transcribed spacer (ITS) sequences, G. ellingtonae n. sp. is distinct from G. pallida, G. rostochiensis, G. tabacum and G. mexicana. Bayesian and Maximum Parsimony analysis of cloned ITS rRNA gene sequences indicated three clades, with intraspecific variability as high as 2.8%. In silico analysis revealed ITS restriction fragment length polymorphisms for enzymes Bsh 1236I, Hinf I, and Rsa I that overlap patterns for other Globodera species.
Center, Barbara J.; Giblin-Davis, Robin M.; Herre, E. Allen; Chung-Schickler, Genevieve C.
1999-01-01
Syconia (enclosed infructescences) infested with host-specific species of Schistonchus (Aphelenchoididae) were collected from six species of Ficus (Moraceae) native to Florida or Panama. They were sectioned and histologically examined to assess the effects of parasitism. Parasitism by Schistonchus spp. was associated with hypertrophied cells, tissue necrosis, and the presence of an exudate in all species. Occasional hypertrophy of the outer epidermal cells occurred on seed florets, wasp florets, and on the endothecial cells of male florets in F. aurea (subgenus Urostigma) from Florida. Aberrations of the inner mesocarp occurred under the hypertrophied cells on seed florets. In F. laevigata (subgenus Urostigma) from Florida, Schistonchus sp. infested immature male florets and was associated with hypertrophy of endothecial cells, epidermal cells of the anther filaments, and anthers. Schistonchus sp. also caused aberrations of the anther filament, anthers, and pollen. Ficus poponoei (subgenus Urostigma) and F. glabrata (subgenus Pharmacosycea), both from Panama, had hypertrophied outer epidermal cells on seed florets. Ficus poponoei also had Schistonchus sp. within the pedicel of an aborted floret, with hypertrophy of the cortical parenchyma. Ficus trigonata (subgenus Urostigma) from Panama had hypertrophy of the outer epidermis of seed florets. When the outer epidermis on these florets was missing, the inner mesocarp was hypertrophied. Ficus maxima (subgenus Pharmacosycea) from Panama had hypertrophy on the outer epidermis of seed and aborted florets. Schistonchus spp. were not found in wasp larvae or pupae in any of the Ficus spp. examined. Hypertrophy was never observed in the absence of Schistonchus spp. PMID:19270912
The ASC Sequoia Programming Model
Energy Technology Data Exchange (ETDEWEB)
Seager, M
2008-08-06
In the late 1980's and early 1990's, Lawrence Livermore National Laboratory was deeply engrossed in determining the next generation programming model for the Integrated Design Codes (IDC) beyond vectorization for the Cray 1s series of computers. The vector model, developed in mid 1970's first for the CDC 7600 and later extended from stack based vector operation to memory to memory operations for the Cray 1s, lasted approximately 20 years (See Slide 5). The Cray vector era was deemed an extremely long lived era as it allowed vector codes to be developed over time (the Cray 1s were faster in scalar mode than the CDC 7600) with vector unit utilization increasing incrementally over time. The other attributes of the Cray vector era at LLNL were that we developed, supported and maintained the Operating System (LTSS and later NLTSS), communications protocols (LINCS), Compilers (Civic Fortran77 and Model), operating system tools (e.g., batch system, job control scripting, loaders, debuggers, editors, graphics utilities, you name it) and math and highly machine optimized libraries (e.g., SLATEC, and STACKLIB). Although LTSS was adopted by Cray for early system generations, they later developed COS and UNICOS operating systems and environment on their own. In the late 1970s and early 1980s two trends appeared that made the Cray vector programming model (described above including both the hardware and system software aspects) seem potentially dated and slated for major revision. These trends were the appearance of low cost CMOS microprocessors and their attendant, departmental and mini-computers and later workstations and personal computers. With the wide spread adoption of Unix in the early 1980s, it appeared that LLNL (and the other DOE Labs) would be left out of the mainstream of computing without a rapid transition to these 'Killer Micros' and modern OS and tools environments. The other interesting advance in the period is that systems were being developed with multiple 'cores' in them and called Symmetric Multi-Processor or Shared Memory Processor (SMP) systems. The parallel revolution had begun. The Laboratory started a small 'parallel processing project' in 1983 to study the new technology and its application to scientific computing with four people: Tim Axelrod, Pete Eltgroth, Paul Dubois and Mark Seager. Two years later, Eugene Brooks joined the team. This team focused on Unix and 'killer micro' SMPs. Indeed, Eugene Brooks was credited with coming up with the 'Killer Micro' term. After several generations of SMP platforms (e.g., Sequent Balance 8000 with 8 33MHz MC32032s, Allian FX8 with 8 MC68020 and FPGA based Vector Units and finally the BB&N Butterfly with 128 cores), it became apparent to us that the killer micro revolution would indeed take over Crays and that we definitely needed a new programming and systems model. The model developed by Mark Seager and Dale Nielsen focused on both the system aspects (Slide 3) and the code development aspects (Slide 4). Although now succinctly captured in two attached slides, at the time there was tremendous ferment in the research community as to what parallel programming model would emerge, dominate and survive. In addition, we wanted a model that would provide portability between platforms of a single generation but also longevity over multiple--and hopefully--many generations. Only after we developed the 'Livermore Model' and worked it out in considerable detail did it become obvious that what we came up with was the right approach. In a nutshell, the applications programming model of the Livermore Model posited that SMP parallelism would ultimately not scale indefinitely and one would have to bite the bullet and implement MPI parallelism within the Integrated Design Code (IDC). We also had a major emphasis on doing everything in a completely standards based, portable methodology with POSIX/Unix as the target environment. We decided against specialized libraries like STACKLIB for performance, but kept as many general purpose, portable math libraries as were needed by the codes. Third, we assumed that the SMPs in clusters would evolve in time to become more powerful, feature rich and, in particular, offer more cores. Thus, we focused on OpenMP, and POSIX PThreads for programming SMP parallelism. These code porting efforts were lead by Dale Nielsen, A-Division code group leader, and Randy Christensen, B-Division code group leader. Most of the porting effort revolved removing 'Crayisms' in the codes: artifacts of LTSS/NLTSS, Civic compiler extensions beyond Fortran77, IO libraries and dealing with new code control languages (we switched to Perl and later to Python). Adding MPI to the codes was initially problematic and error prone because the programmers used MPI directly and sprinkled the calls throughout the code.
Lifescience Database Archive (English)
Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = ...jct: 64 GRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGSILFEETLY 121 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta
Taliraps on koristatud ja müüdudki / Lii Sammler
Sammler, Lii, 1963-
2014-01-01
Esimest korda talirapsiga viljelusvõistlusel osalenud Väätsa Agro ja Karinu PM OÜ panustasid sordile DK 'Sequoia' ja esialgsetel andmetel korjati kuiva seemet 4-5 tonni ümber hektarilt. Vestlusest agronoomidega
2011-03-15
... Wilderness; 14. Emigrant Wilderness; 15. Hoover Wilderness; 16. Yosemite National Park; 17. Ansel Adams... monitor) Ansel Adams WA, Kaiser WA, John 15.5 14.9 13.6 7.1 2200 Muir WA (KAIS monitor)......... Sequoia...
Magnetic record associated with tree ring density: Possible climate proxy
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther; Pruner, Petr; Venhodová, Daniela; Kadlec, Jaroslav
2007-01-01
RoÄ. 8, - (2007), s. 1-11 ISSN 1467-4866 Institutional research plan: CEZ:AV0Z3013912 Keywords : palaeo-climatic indicator * sequoia tree * magnetic properties Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.842, year: 2007
Decomposition and N cycling changes in redwood forests caused by sudden oak death
Richard C. Cobb; David M. Rizzo
2012-01-01
Phytophthora ramorum is an emergent pathogen in redwood forests which causes the disease sudden oak death. Although the disease does not kill coast redwood (Sequoia sempervirens), extensive and rapid mortality of tanoak (Notholithocarpus densiflorus) has removed this...
Information needs for natural fire management planning
Parsons, David; Bancroft, Larry; Nichols, Thomas; Stohlgren, Thomas
1985-01-01
The development and implementation of an effective natural fire management program require a clear definition of goals and objectives, an ever-expanding information base, and effective program evaluation. Examples are given from Sequoia and Kings Canyon National Parks.
Analysis of forest structure using thematic mapper simulator data
Peterson, D. L.; Westman, W. E.; Brass, J. A.; Stephenson, N. J.; Ambrosia, V. G.; Spanner, M. A.
1986-01-01
The potential of Thematic Mapper Simulator (TMS) data for sensing forest structure information has been explored by principal components and feature selection techniques. In a survey of forest structural properties conducted for 123 field sites of the Sequoia National Park, the canopy closure could be well estimated (r = 0.62 to 0.69) by a variety of channel bands and band ratios, without reference to the forest type. Estimation of the basal area was less successful (r = 0.51 or less) on the average, but could be improved for certain forest types when data were stratified by floristic composition. To achieve such a stratification, individual sites were ordinated by a detrended correspondence analysis based on the canopy of dominant species. The analysis of forest structure in the Sequoia data suggests that total basal area can be best predicted in stands of lower density, and in younger even-aged managed stands.
Mark Spencer; Kevin O' Hara
2007-01-01
Phytophthora ramorum attacks tanoak (Lithocarpus densiflorus) in California and Oregon. We present a stand-level study examining the presence of disease symptoms in individual stems. Working with data from four plots in redwood (Sequoia sempervirens)/tanoak forests in Marin County, and three plots in Mendocino...
Lifescience Database Archive (English)
Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = 261 bits (667), Expect = 3e...GLASRSAAYYQQGARFAK 183 Query: 637 WRTVV 651 WRTVV Sbjct: 184 WRTVV 188 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta
Gregory A. Guisti
2012-01-01
A standardized, interactive, interview process was used with practicing Registered Professional Foresters asking a suite of questions to ascertain their management approaches to coast redwood (Sequoia sempervirens [D. Don] Endl.) stands that could best be transferred to other projects and lands interested in recruiting older forest...
Sudden Oak Death in redwood forests: vegetation dynamics in the wake of tanoak decline
Benjamin Ramage; Kevin O’Hara
2010-01-01
Numerous lines of inquiry have concluded that tanoak (Lithocarpus densiflorus) will continue to experience drastic population declines and may even disappear entirely from redwood (Sequoia sempervirens) forests as a result of the exotic disease sudden oak death (SOD) (Maloney and others 2005, McPherson and others 2005,...
Lucy Kerhoulas; Nicholas Kerhoulas; Wade Polda; John-Pascal Berrill
2017-01-01
Reforestation following timber harvests is an important topic throughout the coast redwood (Sequoia sempervirens (D. Don) Endl.) range. Furthermore, as drought-induced mortality spreads across many of California’s forests, it is important to understand how physiology and stand structure influence reforestation success. Finally, as climate...
New Cyst Nematode, Heterodera sojae n. sp. (Nematoda: Heteroderidae) from Soybean in Korea.
Kang, Heonil; Eun, Geun; Ha, Jihye; Kim, Yongchul; Park, Namsook; Kim, Donggeun; Choi, Insoo
2016-12-01
A new soybean cyst nematode Heterodera sojae n. sp. was found from the roots of soybean plants in Korea. Cysts of H. sojae n. sp. appeared more round, shining, and darker than that of H. glycines . Morphologically, H. sojae n. sp. differed from H. glycines by fenestra length (23.5-54.2 µm vs. 30-70 µm), vulval silt length (9.0-24.4 µm vs. 43-60 µm), tail length of J2 (54.3-74.8 µm vs. 40-61 µm), and hyaline part of J2 (32.6-46.3 µm vs. 20-30 µm). It is distinguished from H. elachista by larger cyst (513.4-778.3 µm × 343.4-567.1 µm vs. 350-560 µm × 250-450 µm) and longer stylet length of J2 (23.8-25.3 µm vs. 17-19 µm). Molecular analysis of rRNA large subunit (LSU) D2-D3 segments and ITS gene sequence shows that H. sojae n. sp. is more close to rice cyst nematode H. elachista than H. glycines . Heterodera sojae n. sp. was widely distributed in Korea. It was found from soybean fields of all three provinces sampled.
Using wood quality measures to evaluate second-growth redwood
Stephen L. Quarles; Yana. Vlachovic
2012-01-01
Redwood (Sequoia sempervirens) a valued species for use in appearance grade applications, such as decking, exterior siding and interior paneling, because of its dimensional stability. It is also valued for certain exterior-use applications because of its natural decay resistance. Studies have found that young-growth redwood is less resistant to...
High Sierra Ecosystems: The Role of Fish Stocking in Amphibian Declines
Kathleen Matthews
2003-01-01
With a rich diversity of aquatic habitats, including deep lakes, shallow ponds, and rushing streams, Dusy Basinin Sequoia-Kings Canyon National Parks typifies the high Sierra ecosystem where mountain yellow-legged frogs usually thrive. Yet throughout the Sierra, aquatic ecologist Kathleen Matthews found entire water basins empty of these amphibians. Comprehensive...
The impact of normative message types on off-trail hiking
P.L. Winter
2006-01-01
Depreciative activities and high annual visitation levels threaten the health and sustainability of the giant Sequoia. Signage is one route to managing visitor behavior. Research suggests a two-by-two conceptualization of normative messages in signs. Messages may present the "ought" (injunctive) or the "is" (descriptive) of behavior and may be...
Natural seedlings and sprouts after regeneration cuttings in old-growth redwood
Kenneth N. Boe
1975-01-01
Natural regeneration of harvested old-growth stands of redwood (Sequoia sempervirens) is one way to start a new forest that is needed quickly for continuous timber production. Natural seedlings and sprouts developing after stands were cut were studied on the Redwood Experimental Forest, northern California. Three types of regeneration cuttings were...
Kyungrok Hwang; Han-sup Han; Susan E. Marshall; Deborah S. Page-Dumroese
2017-01-01
Cut-to-length (CTL) harvest systems have recently been introduced for thinning third-growth, young (<25 years old) redwood forests (Sequoia sempervirens (Lamb. ex D. Don) Endl.) in northern California. This type of harvesting can effective for thinning overstocked stands consisting of small-diameter trees. However, forestland managers and government agencies...
Predicting redwood productivity using biophysical data, spatial statistics and site quality indices
John-Pascal Berrill; Kevin L. O’Hara; Shawn Headley
2017-01-01
Coast redwood (Sequoia sempervirens (D. Don) Endl.) height growth and basal area growth are sensitive to variations in site quality. Site factors known to be correlated with redwood stand growth and yield include topographic variables such as position on slope, exposure, and the composite variable: topographic relative moisture index. Species...
Bark water uptake promotes localized hydraulic recovery in coastal redwood crown
J. Mason Earles; Or Sperling; Lucas C. R. Silva; Andrew J. McElrone; Craig R. Brodersen; Malcolm P. North; Maciej A. Zwieniecki
2015-01-01
Coastal redwood (Sequoia sempervirens), the world’s tallest tree species, rehydrates leaves via foliar water uptake during fog/rain events. Here we examine if bark also permits water uptake in redwood branches, exploring potential flow mechanisms and biological significance. Using isotopic labelling and microCT imaging, we observed that water...
Rangewide Genetic Variation in Coast Redwood Populations at a Chloroplast Microsatellite Locus
Chris Brinegar
2012-01-01
Old growth and second growth populations of coast redwood (Sequoia sempervirens) were sampled at 10 locations throughout its range and analyzed at a highly variable chloroplast microsatellite locus. Very low FST values indicated that there was no significant genetic differentiation between adjacent old growth and second growth populations at each location. Genetic...
Cradle-to-gate life cycle impacts of redwood forest resource harvesting in northern California
Han-Sup Han; Elaine Oneil; Richard D. Bergman; Ivan L. Eastin; Leonard R. Johnson
2015-01-01
The first life cycle impact assessment for redwood (Sequoia sempervirens) forest management activities (i.e. a cradle-to-sawmill gate input) including the growing, harvesting, and hauling of redwood sawlogs to a sawmill was completed. In the stump-to-truck timber harvesting analysis, primary transport activities such as skidding and yarding consumed...
Biodegrading effects of some rot fungi on Pinus caribaea wood
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... species of white-rot fungi; Corioliopsis polyzona and Pleurotus squarrosulus, and two species of brown- rot fungi; Lentinus ... The results indicated that biodegradation by rot fungi differs in intensity according to the fungus ..... wood of coast red wood Sequoia Sempervirens (D. Don). For. Prod. J. 33(5): 15-20Â ...
Inbreeding depression in selfs of redwood
W. J. Libby; B. G. McCutchan; C. I. Millar
1981-01-01
Given the polyploid chromosome constitution of Sequoia sempervirens, there was reason to question whether it would exhibit inbreeding depression. Preliminary results from studies of self and related outcross families are reported as a guide to the selection of trees for redwood seed orchards and breeding-orchards. The data indicate that, compared to...
Bat use of remnant old-growth redwood stands
William J. Zielinski; Steven T. Gellman
1999-01-01
Most of the old-growth redwood (Sequoia sempervirens) in Calfornia has been cut; regenerating forests will probably never resemble those that were harvested, and what old growth remains on private land occurs in small, isolated remnant patches. The landscapes in which these stands occur differ so markedly from their original condition that their...
Post-fire response of coast redwood one year after the Mendocino lightning complex fires
Robert B. Douglas; Tom. Bendurel
2012-01-01
Coast redwood (Sequoia sempervirens) forests have undergone significant changes over the past century and are now in state more conducive for wildfires. Because fires have been uncommon in redwood forests over the past 80 years, managers have limited data to make decisions about the post-fire environment. In June 2008, a series of lightning storms...
Fostering personal relationships with the wild: Oral history's role in recreation management
Alison Steiner; Daniel R. Williams
2017-01-01
Sequoia and Kings Canyon National Parks (SEKI) encompass much of central California's most stunning scenery. Dramatic peaks and passes, perennial snowfields, remote lake basins, alpine meadows, steep canyons, and shockingly big trees characterize the more than 800,000 acres of wild land that lie within the parks. Drought-resistant chaparral and blue oak woodlands...
R. Bergman; H. Sup-Han; E. Oneil; I. Eastin
2013-01-01
The goal of the study was to conduct a life-cycle inventory (LCI) of California redwood (Sequoia sempervirens) decking that would quantify the critical environmental impacts of decking from cradle to grave. Using that LCI data, a life-cycle assessment (LCA) was produced for redwood decking. The results were used to compare the environmental footprint...
Li, Chun-Xiang; Yang, Qun
2003-03-01
DNA sequences from 28S rDNA were used to assess relationships between and within traditional Taxodiaceae and Cupressaceae s.s. The MP tree and NJ tree generally are similar to one another. The results show that Taxodiaceae and Cupressaceae s.s. form a monophyletic conifer lineage excluding Sciadopitys. In the Taxodiaceae-Cupressaceae s.s. monophyletic group, the Taxodiaceae is paraphyletic. Taxodium, Glyptostrobus and Cryptomeria forming a clade(Taxodioideae), in which Glyptostrobus and Taxodium are closely related and sister to Cryptomeria; Sequoia, Sequoiadendron and Metasequoia are closely related to each other, forming another clade (Sequoioideae), in which Sequoia and Sequoiadendron are closely related and sister to Metasequoia; the seven genera of Cupressaceae s.s. are found to be closely related to form a monophyletic lineage (Cupressoideae). These results are basically similar to analyses from chloroplast gene data. But the relationships among Taiwania, Sequoioideae, Taxodioideae, and Cupressoideae remain unclear because of the slow evolution rate of 28S rDNA, which might best be answered by sequencing more rapidly evolving nuclear genes.
Molecular aspects of cyst nematodes.
Lilley, Catherine J; Atkinson, Howard J; Urwin, Peter E
2005-11-01
SUMMARY Taxonomy: Superkingdom Eukaryota; kingdom Metazoa; phylum Nematoda; class Chromadorea; order Tylenchida; suborder Tylenchina; superfamily Tylenchoidea; family Heteroderidae; subfamily Heteroderinae; main genera Heterodera and Globodera. Cyst nematodes comprise approximately 100 known species in six genera. They are pathogens of temperate, subtropical and tropical plant species and the host range of many species is narrow. The most economically important species are within the Globodera and Heterodera genera. Globodera pallida and G. rostochiensis are important pathogens of potato crops. There are many economic species in the Heterodera genus, including Heterodera glycines (soybean cyst nematode), H. avenae (cereal cyst nematode) and H. schachtii (sugar beet cyst nematode), the last of which attacks a range of Chenopodiaceae and Cruciferae, including Arabidopsis thaliana. Disease symptoms: Field symptoms of severe cyst nematode infection are often stunting, wilting and chlorosis, but considerable yield loss can occur without obvious symptoms. The only unique indicator of cyst nematode infection is the presence of adult female nematodes attached to host roots after several weeks of parasitism. Disease control: This is usually achieved by using integrated pest management involving cultural practices such as crop rotation, resistant cultivars if available and chemical control when economically justified.
Changing conditions on wilderness campsites: Seven case studies of trends over 13 to 32 years
David N. Cole
2013-01-01
This report brings together seven case studies of trends in the number and condition of wilderness campsites over periods ranging from 13 to 32 years. Case examples come from five mountainous wilderness areas in the western United States: Sequoia-Kings Canyon Wilderness in California, the Eagle Cap Wilderness in Oregon, the Frank Church-River of No Return Wilderness in...
Black bear damage to northwestern conifers in California: a review
Kenneth O. Fulgham; Dennis Hosack
2017-01-01
A total of 789 black bear damaged trees were investigate over a multi-year period on 14 different study sites chosen on lands of four participating timber companies. The sites ranged from 30 to 50 years of age. Four different conifer species were found to have black bear damage: coastal redwood (Sequoia sempervirens (D. Don) Endl.), Douglas-fir (...
Policy Evaluation: Use of the PSB-Aptitude Test as an Admission Requirement for the LVN Program.
Firstman, Aranga
A study was conducted to assess the use of the Psychological Services Bureau's Aptitude Test for Practical Nursing (PSB Aptitude Test) as an entrance requirement for the licensed vocational nurse (LVN) program at College of the Sequoias. The study sought to determine whether the PSB Aptitude Test was a valid indicator of success in the LVN…
Annosus Root disease of Western Conifers (FIDL)
Craig L. Schmitt; John R. Parmeter; John T. Kliejunas
2000-01-01
Annosus root disease is found on all western conifer species but is of most concern on true firs, hemlocks, and pines. Incense cedar, coast redwood and sequoia are sometimes infected in California. Western juniper is infected throughout its range. Annosus is common and causes extensive decay in old-growth western and mountain hemlock stands. Many mixed conifer stands...
Coast redwood live crown and sapwood
John-Pascal Berrill; Jesse L. Deffress; Jessica M. Engle
2012-01-01
Understanding crown rise and sapwood taper will help meet management objectives such as producing long branch-free boles for clear wood and old-growth restoration, or producing sawlogs with a high proportion of heartwood. Coast redwood (Sequoia sempervirens) tree crown ratio data were collected 20 years after partial harvesting in a 65-year-old second growth stand....
Giblin-Davis, R M; Williams, D S; Wergin, W P; Dickson, D W; Hewlett, T E; Bekal, S; Becker, J O
2001-12-01
Pasteuria sp., strain S-1, is a gram-positive, obligate endoparasitic bacterium that uses the phytoparasitic sting nematode, Belonolaimus longicaudatus, as its host in Florida. The host attachment of S-1 appears to be specific to the genus Belonolaimus with development occurring only in juveniles and adults of B. longicaudatus. This bacterium is characterized from other described species of Pasteuria using ultrastructure of the mature endospore. Penetration, development, and sporogenesis were elucidated with TEM, LTSEM, and SEM and are similar to other nematode-specific Pasteuria. Recent analysis of 16S rDNA sequence homology confirms its congeneric ranking with other Pasteuria species and strains from nematodes and cladocerans, and corroborates ultrastructural, morphological, morphometric, and host-range evidence suggesting separate species status.
Directory of Open Access Journals (Sweden)
W.S Tavares
2011-09-01
Full Text Available Soil organisms play an important role in organic crops of Crotalaria juncea (Fabaceae and are associated with the natural conservation of the environment. The present study was aimed to investigate the population of soil organisms in the organic culture of C. juncea, as well as its importance as a refuge for natural enemies. Dalbulus maidis (Hemiptera: Cicadellidae, Diabrotica sp. (Coleoptera: Chrysomelidae, Doru luteipes (Dermaptera: Forficulidae, Gryllus assimilis (Orthoptera: Gryllidae, Lagria villosa (Coleoptera: Lagriidae, Melanotus sp. (Coleoptera: Elateridae, Meloidogyne incognita (Tylenchida: Heteroderidae, Nephila clavipes (Araneae: Nephilidae, Orius insidiosus (Hemiptera: Anthocoridae, Pheidole sp. (Hymenoptera: Myrmicidae, Phyllophaga sp. (Coleoptera: Scarabeidae, Procornitermes sp. (Isoptera: Termitidae, Solenopsis sp. (Hymenoptera: Formicidae, and Utetheisa ornatrix (Lepidoptera: Arctiidae were identified in C. juncea. The organisms that were found during a 3-month period in 144 trenches in C. juncea were pest species (84.47% and natural enemies (15.53% as well. Natural enemies had an average of 11.89 individuals per 1.08 m³ of soil cultivated with C. juncea. The abundance of organisms in the pod stage (5.49% of C. juncea was lower than that in the vegetative (83.50% and flowering (11.01% stages. Crotalaria juncea plants can be used as part of a crop system for Integrated Pest Management.Organismos de solo desempenham um importante papel em cultivos orgânicos de Crotalaria juncea (Fabaceae e estão associados com a conservação natural do ambiente. O presente estudo teve como objetivo investigar a população de organismos de solo no cultivo orgânico de C. juncea, bem como sua importância como um refúgio para inimigos naturais. Dalbulus maidis (Hemiptera: Cicadellidae, Diabrotica sp. (Coleoptera: Chrysomelidae, Doru luteipes (Dermaptera: Forficulidae, Gryllus assimilis (Orthoptera: Gryllidae, Lagria villosa (Coleoptera
Information concerning the occurrence and distribution of cyst nematodes (Heterodera spp.) in Samsun, Turkey is needed to assess their potential to cause economic damage on many crop plants. Surveys on the distribution and infestation rates of cyst nematodes in cabbage fields in Samsun were conducte...
Transgenic Strategies for Enhancement of Nematode Resistance in Plants
Directory of Open Access Journals (Sweden)
Muhammad A. Ali
2017-05-01
Full Text Available Plant parasitic nematodes (PPNs are obligate biotrophic parasites causing serious damage and reduction in crop yields. Several economically important genera parasitize various crop plants. The root-knot, root lesion, and cyst nematodes are the three most economically damaging genera of PPNs on crops within the family Heteroderidae. It is very important to devise various management strategies against PPNs in economically important crop plants. Genetic engineering has proven a promising tool for the development of biotic and abiotic stress tolerance in crop plants. Additionally, the genetic engineering leading to transgenic plants harboring nematode resistance genes has demonstrated its significance in the field of plant nematology. Here, we have discussed the use of genetic engineering for the development of nematode resistance in plants. This review article also provides a detailed account of transgenic strategies for the resistance against PPNs. The strategies include natural resistance genes, cloning of proteinase inhibitor coding genes, anti-nematodal proteins and use of RNA interference to suppress nematode effectors. Furthermore, the manipulation of expression levels of genes induced and suppressed by nematodes has also been suggested as an innovative approach for inducing nematode resistance in plants. The information in this article will provide an array of possibilities to engineer resistance against PPNs in different crop plants.
Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Preprint)
2011-11-01
The Fluxgate Magnetometer ,†J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P. Wikswo, Jr., “A...206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12. Primdahl, F., 1979...superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in aircraft aluminum
Detection of Oil in Water Column, Final Report: Detection Prototype Tests
2014-07-01
nautical miles per hour) LED Light-emitting diode LISST Laser In Situ Scattering and Transmissometry LUT Look-up table μm Micron or micrometer...nozzles are attached to an electrically actuated solenoid valve. When a remotely operated switch energizes the valve, oil flows through the nozzles...smaller droplet sizes below 70 μm. Ohmsett personnel used a Sequoia Laser In Situ Scattering and Transmissometry (LISST) 100X off-the-shelf particle
Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Postprint)
2011-08-01
Primdahl, F., 1979, “The Fluxgate Magnetometer ,†J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P...Issues 1-2, Pages 203-206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12...Wikswo, Jr., “A superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in
Contaminant studies in the Sierra Nevadas
Sparling, D.W.; Fellers, G.
2002-01-01
full text: Several species of anuran amphibians (frogs and toads) are experiencing severe population declines in even seemingly pristine areas of the Sierra Mountains of California. Among the most severely depressed species are the redlegged frog, the foothill and mountain yellow-legged frogs, the Yosemite toad, and the Cascades frog. Several factors, such as habitat fragmentation, introduced predators (especially fish), and disease, have been linked to these declines. But recent evidence from a USGS-led study shows that contaminants are a primary factor. During the past three years, researchers from the USGS Patuxent Wildlife Research Center, the Western Ecology Research Center, the USDA Beltsville Agriculture Research Center, and the Texas A&M University have teamed up to conduct an extensive study on airborne pesticides and their effects on amphibian populations in the Sierra Nevada Mountains. Previous work on environmental chemistry demonstrated that pesticides from the intensely agricultural Central Valley of California are being blown into the more pristine Sierra Nevada Mountains, especially around Sequoia and Yosemite National Parks. Several pesticides, including diazinon, chlorpyrifos, malathion and endosulfan, can be measured in snow, rainfall, and pond waters in these national parks. With the exception of endosulfan, these pesticides affect and even kill both invertebrates and vertebrate species by inhibiting cholinesterase, an enzyme essential to proper nervous system functioning. In the summer of 2001, we published a paper showing that these same pesticides are now found in adults and the tadpoles of Pacific treefrogs. The results of this landmark study showed that more than 50 percent of the tadpoles and adults sampled in Yosemite and Sequoia National Parks had detectable levels of diazinon or chlorpyrifos and that 86 percent of the Pacific treefrogs sampled in the Lake Tahoe region had detectable levels of endosulfan. In contrast, frogs that were
Scalable Engineering of Quantum Optical Information Processing Architectures (SEQUOIA)
2016-12-13
fast: recently, it was demonstrated experimentally that photonic cluster states can be produced deterministically by photon scattering off a lambda ...U. The CNOT gate operation corresponds to the sub- matrix of the logic states, shown in solid-color bars and marked with red axis labels. Plots (c
Directory of Open Access Journals (Sweden)
Carla Vanina Dagatti
2014-12-01
Full Text Available El objetivo de esta investigación fue comparar y establecer relaciones entre los diferentes indicadores de crecimiento entre plantas de vid con dos niveles de infestación (alto y leve de Meloidogyne spp. El estudio se realizó en un viñedo cv Merlot, situado en Agrelo, Mendoza, donde se escogieron 2 parcelas, con y sin nematodos, con diferentes niveles de crecimiento vegetativo. Los indicadores a evaluar fueron: peso y número de racimos por planta, peso de poda, cantidad de entrenudos y área foliar de hojas y feminelas. El grado de infestación de nematodos de cada parcela se determinó mediante la técnica flotación - centrifugación. Para el análisis estadÃstico se utilizó la prueba de wilcoxon (Mann Whitney U y el test de student. Además, mediante un análisis de regresión lineal, se comprobó si existÃa relación entre los indicadores evaluados y la densidad de población de Meloidogyne spp. expresado en número de estados juveniles (J2 presentes en el suelo. Los resultados indicaron que la parcela con menor densidad poblacional de juveniles de Meloidogyne spp., presentó mayor peso promedio de madera de poda, asà como también un área foliar de hojas y feminelas superior. Con respecto al peso promedio de racimos por planta, dicha parcela también superó a aquella con alta concentración de nematodos.
Sapwood area - leaf area relationships for coast redwood
Stancioiu, P T; O'Hara, K L
2005-01-01
Coast redwood (Sequoia sempervirens (D. Don) Endl.) trees in different canopy strata and crown positions were sampled to develop relationships between sapwood cross-sectional area and projected leaf area. Sampling occurred during the summers of 2000 and 2001 and covered tree heights ranging from 7.7 to 45.2 m and diameters at breast height ranging from 9.4 to 92.7 cm. Foliage morphology varied greatly and was stratified into five types based on needle type (sun or shade) and twig color. A str...
Bernard, Ernest C; Handoo, Zafar A; Powers, Thomas O; Donald, Patricia A; Heinz, Robert D
2010-06-01
A new genus and species of cyst nematode, Vittatidera zeaphila, is described from Tennessee. The new genus is superficially similar to Cactodera but is distinguished from other cyst-forming taxa in having a persistent lateral field in females and cysts, persistent vulval lips covering a circumfenestrate vulva, and subventral gland nuclei of the female contained in a separate small lobe. Infective juveniles (J2) are distinguished from all previously described Cactodera spp. by the short stylet in the second-stage juvenile (14-17 μm); J2 of Cactodera spp. have stylets at least 18 μm long. The new species also is unusual in that the females produce large egg masses. Known hosts are corn and goosegrass. DNA analysis suggests that Vittatidera forms a separate group apart from other cyst-forming genera within Heteroderinae.
36 CFR 7.8 - Sequoia and Kings Canyon National Parks.
2010-07-01
... National Parks. (a) Dogs and cats. Dogs and cats are prohibited on any park land or trail except within one-fourth mile of developed areas which are accessible by a designated public automobile road. (b) Fishing. (1) Fishing restrictions, based on management objectives described in the parks' Resources Management...
Climatic and physiological effects on leaf and tree-ring stable isotopes in California redwoods
Ambrose, A. R.; Baxter, W.; Wong, C.; Dawson, T. E.; Carroll, A.; Voelker, S.
2016-12-01
Variation in the stable isotope composition of organic matter can provide important information about environmental change and biological responses to it. We analyzed the stable carbon (d13C) and oxygen (d18O) isotope ratios of leaves and of the cellulose from individual tree-rings of California's two redwood species to examine how these trees have responded to environmental variation and change in both time and space. Analyses of leaf d13C for both coast redwood (Sequoia sempervirens) and giant sequoia (Sequoiadendron giganteum) from throughout their geographical ranges show a marked gradient with tree height for trees of all sizes and ages but no clear difference among species or populations. The gradient is best explained by tree response to changes in both microenvironment and physiology that are known to change with height. In contrast, leaf d18O for both species showed no clear relationship with height but very clear differences between species and populations with giant sequoia displaying a much stronger inferred leaf-level response to the higher evaporative conditions present in the Sierra Nevada mountains as compared to the coast. Both species showed population-level differences with the driest and warmest sites most distinct from all of the others. Intra-annual analyses of d13C and d18O in tree-rings over a 21-year period (1974-1994) were also used to explore how climate and tree response to climate was recorded for both species. These analyses revealed unique (local) climatic effects and response to the climate for each species and population of both redwood species. Most pronounced was a significant increase in intrinsic Water Use Efficiency (iWUE) derived from d13C data over the study period in both species, and a distinct d18O response in relation to drought (e.g. 1976/1977) and to warmer days and nights and above-average precipitation (e.g., 1982-1985). Patterns of co-variation in d13C and d18O in both species suggest that during dry and also warm
A comparative study of modern and fossil cone scales and seeds of conifers: A geochemical approach
Artur, Stankiewicz B.; Mastalerz, Maria; Kruge, M.A.; Van Bergen, P. F.; Sadowska, A.
1997-01-01
Modern cone scales and seeds of Pinus strobus and Sequoia sempervirens, and their fossil (Upper Miocene, c. 6 Mar) counterparts Pinus leitzii and Sequoia langsdorfi have been studied using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), electron-microprobe and scanning electron microscopy. Microscopic observations revealed only minor microbial activity and high-quality structural preservation of the fossil material. The pyrolysates of both modern genera showed the presence of ligno-cellulose characteristic of conifers. However, the abundance of (alkylated)phenols and 1,2-benzenediols in modern S. sempervirens suggests the presence of non-hydrolysable tannins or abundant polyphenolic moieties not previously reported in modern conifers. The marked differences between the pyrolysis products of both modern genera are suggested to be of chemosystematic significance. The fossil samples also contained ligno-cellulose which exhibited only partial degradation, primarily of the carbohydrate constituents. Comparison between the fossil cone scale and seed pyrolysates indicated that the ligno-cellulose complex present in the seeds is chemically more resistant than that in the cone scales. Principal component analysis (PCA) of the pyrolysis data allowed for the determination of the discriminant functions used to assess the extent of degradation and the chemosystematic differences between both genera and between cone scales and seeds. Elemental composition (C, O, S), obtained using electron-microprobe, corroborated the pyrolysis results. Overall, the combination of chemical, microscopic and statistical methods allowed for a detailed characterization and chemosystematic interpretations of modern and fossil conifer cone scales and seeds.
Directory of Open Access Journals (Sweden)
Manuel Francisco Polanco Puerta
2018-05-01
Full Text Available The aim of this study was to cross lulo plants of cv. La Selva to obtain a hybrid with tolerance to the fruit borer Neoleucinodes elegantalis Guenée (Lepidoptera: Crambidae and to the nematode Meloidogyne incognita (Kofoid & White (Nematoda: Heteroderidae, to obtain better-adapted plants to the conditions of the Colombian coffee-growing region and with bigger and non-dehiscent fruits. La Selva cultivar is a hybrid developed from the interspecific backcross of Solanum quitoense Lam. × Solanum hirtum Vahl with plants of lulo cv. Castilla Larga Vida. The experiment was conducted in the municipality of Dosquebradas, Risaralda, Colombia, located at 1,465 m a.s.l. F1 plants were obtained from reciprocal crossings. When inoculated with the nematode M. incognita, plants showed susceptibility in their seedling stage; however, when we carried out the evaluation six months after transplantation under field conditions, nematode infestation was less than 1%, which likely indicates the tolerance of these materials to the nematode. When assessing the resistance of the hybrid to the attack of N. elegantalis, we found that the evaluated materials were resistant to this insect. The resulting hybrids showed good agronomic characteristics, such as a good morphological structure and vigor, high productivity, good solar exposure adaptation, large fruits (5.6 cm average diameter similar to those of cv. Castilla, with yellow peel, green pulp and non-dehiscent fruits with pleasant aroma and flavor. As an undesirable characteristic plants had thorns on leaves and stems.
Feng, Yaxing; Wang, Dong; Xiao, Dongxue; Pereira, Tiago josÉ; Xuan, Yuanhu; Wang, Yuanyuan; Liu, Xiaoyu; Chen, Lijie; Duan, Yuxi; Zhu, Xiaofeng
2018-04-11
A new species of cyst nematode, Cactodera chenopodiae n. sp., parasitizing common lambsquarter, Chenopodium album L., is described from native vegetation in Liaoning, China. Cactodera chenopodiae n. sp. has a circumfenestrate pattern typical of the genus and is morphologically similar to C. cacti Krall Krall, 1978. However, in the new species, females and cysts show a larger L/W ratio whereas second-stage juveniles (J2s) have a longer hyaline region. The new species is also morphologically similar to C. milleri Graney Bird, 1990, but the J2s differ by a larger b ratio and longer tail. Based on DNA sequences of the 28S and ITS rRNA, C. chenopodiae n. sp. comes close to C. estonica Krall Krall, 1978, although it is distinct from the latter with respect to the presence of a punctate eggshell and larger b ratio in the J2s. Although morphometric comparisons with additional Cactodera species show the overlapping of diagnostic morphological characters, our phylogenetic analyses based on both rRNA genes support C. chenopodiae n. sp. as a unique lineage.
Pliocene taxodiaceous fossil wood from southwestern Ukraine and its palaeoenvironmental implications
Directory of Open Access Journals (Sweden)
Yi Tiemei
2013-10-01
Full Text Available Mineralized wood collected from Late Pliocene strata near Gorbki village in the Transcarpathian region of Beregovo Kholmogor'e in southwestern Ukraine was anatomically studied and identified. The wood possesses distinctive anatomical features and has distinct growth rings with an abrupt transition from early- to late-wood. Wood consists of tracheids with 1–3 seriate, dominating bi-seriate, opposite pits on the radial walls and taxodioid cross-field pitting, indentures present. Rays are uni-seriate and 1 to 73 cells high. Ray parenchyma horizontal walls thin and smooth. Axial parenchyma distributed in early- and late-wood and is solitary and diffuse, with end walls nearly smooth or slightly nodular. The combination of features observed in the wood indicates it belongs to the conifer family Taxodiaceae and is most similar to modern Sequoia and assigned to the fossil genus Sequoioxylon. Comparison with species of Sequoioxylon show it is most similar to Sequoioxylon burejense, but ray tracheids were not found in our specimens. We describe the specimens here as Sequoioxylon cf. s. burejense noting this similarity. Extant Sequoia is distributed in the northern California coastal forest eco-region of northern California and southern Oregon in the United States where they usually grow in a unique environment with heavy seasonal precipitation (2500 mm annually, cool coastal air and fog drip. This study supplies magafossil evidence of Sequoioxylon as an element of the Late Pliocene forest community in Ukraine and indicates a climate with heavy seasonal precipitation and fog drip.
Return to the little kingdom Steve Jobs, the creation of Apple, and how it changed the world
Moritz, Michael
2010-01-01
Almost thirty years ago, Michael Moritz, then a young journalist at Time magazine, was allowed exclusive access to the inner workings of a cutting-edge technology company to tell the story of its first decade in business. The Little Kingdom: The Private Story of Apple Computer brought readers into the childhood homes of Steve Jobs and Steve Wozniak, showed how they dropped out of college and founded Apple in 1976, and charted the company's rise from basement brainstorming to colossal empire. Now, after spending almost twenty-five years at Sequoia Capital, the much admired private investm
INVESTIGATION OF PARALLAX ISSUES FOR MULTI-LENS MULTISPECTRAL CAMERA BAND CO-REGISTRATION
Directory of Open Access Journals (Sweden)
J. P. Jhan
2017-08-01
Full Text Available The multi-lens multispectral cameras (MSCs, such as Micasense Rededge and Parrot Sequoia, can record multispectral information by each separated lenses. With their lightweight and small size, which making they are more suitable for mounting on an Unmanned Aerial System (UAS to collect high spatial images for vegetation investigation. However, due to the multi-sensor geometry of multi-lens structure induces significant band misregistration effects in original image, performing band co-registration is necessary in order to obtain accurate spectral information. A robust and adaptive band-to-band image transform (RABBIT is proposed to perform band co-registration of multi-lens MSCs. First is to obtain the camera rig information from camera system calibration, and utilizes the calibrated results for performing image transformation and lens distortion correction. Since the calibration uncertainty leads to different amount of systematic errors, the last step is to optimize the results in order to acquire a better co-registration accuracy. Due to the potential issues of parallax that will cause significant band misregistration effects when images are closer to the targets, four datasets thus acquired from Rededge and Sequoia were applied to evaluate the performance of RABBIT, including aerial and close-range imagery. From the results of aerial images, it shows that RABBIT can achieve sub-pixel accuracy level that is suitable for the band co-registration purpose of any multi-lens MSC. In addition, the results of close-range images also has same performance, if we focus on the band co-registration on specific target for 3D modelling, or when the target has equal distance to the camera.
Energy Technology Data Exchange (ETDEWEB)
Bellmann, H J; Schuettler, J; Jakisch, E
1981-11-01
This paper discusses the occurrence of silicified tree trunks and stumps in the Boehlen brown coal field. The trees, mainly Taxodium and Sequoia 25 million years old, are located within the top brown coal seam of the deposit and present a major obstacle to excavator operation, together with other forms of so-called 'brown coal quartzite'. The quartz of the silicified trees occurs as opal, cryptocrystalline quartz and low temperature quartz. The separate removal and disposal of this wood as well as efforts made to use selected wood as raw material are briefly summarized. Various products for interior house decoration have been manufactured from the wood. (4 refs.)
Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.
Midoro-Horiuti, T; Nouno, S; Seino, Y
1992-10-01
Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.
Smart grids are advancing, light and supple
International Nuclear Information System (INIS)
Petitot, Pauline
2016-01-01
While indicating some innovations produced by the Greenlys laboratory (SmartScan to localize losses by means of smart counters, a system for grid self-healing, Sequoia to manage a low voltage network, a tool for the prediction of photovoltaic production in real time), and also the main smart grid projects in France (Nice Grid, Solenn, SoGrid, Smart Electric Lyon, Poste intelligent, Greenlys, Smart Grids Vendee, BienVEnu), this article comments the emergence of several experiments on smart grids in France, the first drawn conclusions and recommendations. Some issues for this new architecture are discussed: the active demand management, cut-offs and flexibility, and the search for profitability
76 FR 9537 - Sequoia National Forest; California; Piute Mountains Travel Management Plan
2011-02-18
... camping, hunting, sightseeing, horseback riding, hiking, rock climbing, rock hounding, and vegetation and... providing benefits equal to or better than the current condition. Alternatives being considered at this time...
International Nuclear Information System (INIS)
Dimitrov, S.; Yovchev, M.; Geleva, E.
2010-01-01
For the purposes of environmental assessment of the area around the Research reactor in Sofia, species from monitored control points, selected in a certain way (habitat, population, air and hydrogeological parameters) are examined. Samples from following phytomonitored species: Betula pendula (silver birch) popullus canadensis (Canadian populus), Quercus sp. (Oak), Dactilus glomerata (Cock's-foot), Abies alba (Silver Fir) and Sequoia sempervirens (Coast Redwood) were analyzed. The total beta activity was determined by radiometric analysis and heavy metals content was measured using X-ray fluorescence analysis. The results are discussed in terms of radiation monitoring program of INRNE (gamma-background, aerosols, surface and groundwater, soil, plants) and obtained values are compared with reference points in the country
On the occurrence of nuclei in mature sieve elements.
Event, R F; Davis, J D; Tucker, C M; Alfieri, F J
1970-12-01
The secondary phloem of 3 species of the Taxodiaceae and 13 species of woody dicotyledons was examined for the occurrence of nuclei in mature sieve elements. Nuclei were found in all mature sieve cells of Metasequoia glyptostroboides, Sequoia sempervirens and Taxodium distichum, and in some mature sieve-tube members in 12 of the 13 species of woody dicotyledons. Except for nuclei of sieve cells undergoing cessation of function, the nuclei in mature sieve cells of M. glyptostroboides, S. sempervirens and T. distichum were normal in appearance. The occurrence and morphology of nuclei in mature sieve-tube members of the woody dicotyledons were quite variable. Only 3 species, Robinia pseudoacacia, Ulmus americana and Vitis riparia, contained some mature sieve elements with apparently normal nuclei.
Zhuo, K; Wang, H H; Ye, W; Peng, D L; Liao, J L
2014-12-01
Cryphodera sinensis n. sp. is described from ramie (Boehmeria nivea) based on the morphology and molecular analyses of rRNA small subunit (SSU), D2D3 expansion domains of large subunit (LSU D2D3) and internal transcribed spacer (ITS). This new species is characterized by oval females with a distinct subcrystalline layer and pronounced and protruding vulval lip, distinctly concave vulva-anus profile and a vulva-anus distance of 29.5-35.8 μm. Males possess two annuli in the lip region, a stylet 27-32.5 μm in length with round knobs sloping slightly posteriorly, lateral fields with three lines, spicules 20-28 μm long and the presence of a short cloacal tube. Second-stage juveniles possess three lip annuli, a stylet 28-31 μm in length with well-developed knobs projected anteriorly and three lines along the lateral field. The pointed tail, 52-65 μm long, possesses a mucro-like tip and a hyaline region, 24.5-35 μm long. Large phasmids with a lens-like structure are located 2-6 annuli posterior to the anus. Phylogenetic analysis shows that the species has unique SSU, LSU D2D3 and ITS rRNA sequences. Phylogenetic relationships of the three rDNA sequences of C. sinensis n. sp. and other cystoid/cyst nematodes are analysed together with a comparison of other species within the genus Cryphodera.
Bałazy, Stanisław; Wrzosek, Marta; Sosnowska, Danuta; Tkaczuk, Cezary; Muszewska, Anna
2008-02-01
Laboratory assays have been carried out to artificially infect insect larvae of the birch bark-beetle (Scolytus ratzeburgi Jans.-Coleoptera, Scolytidae) and codling moth Cydia pomonella L. -Lepidoptera, Tortricidae) as well as the potato cyst nematode-Globodera rostochiensis Wollenweber, sugar beet nematode-Heterodera schachtii Schmidt and root-knot nematode-Meloidogyne hapla Chif (Nematoda, Heteroderidae), by the phialoconidia of some fungal species of the genus Hirsutella. From among four species tested on insects only H. nodulosa Petch infected about 20% of S. ratzeburgi larvae, whereas H. kirchneri (Rostrup) Minter, Brady et Hall, H. minnesotensis Chen, Liu et Chen, and H. rostrata Bałazy et Wiśniewski did not affect insect larvae. Only single eggs of the root-knot nematode were infected by H. minnesotensis in the laboratory trials, whereas its larvae remained unaffected. No infection cases of the potato cyst nematode (G. rostochiensis) and sugar beet nematode eggs were obtained. Comparisons of DNA-ITS-region sequences of the investigated strains with GenBank data showed no differences between H. minnesotensis isolates from the nematodes Heterodera glycines Ichinohe and from tarsonemid mites (authors' isolate). A fragment of ITS 2 with the sequence characteristic only for H. minnesotensis was selected. Two cluster analyses indicated close similarity of this species to H. thompsonii as sister clades, but the latter appeared more heterogenous. Insect and mite pathogenic species H. nodulosa localizes close to specialized aphid pathogen H. aphidis, whereas the phytophagous mite pathogens H. kirchneri and H. gregis form a separate sister clade. Hirsutella rostrata does not show remarkable relations to the establishment of aforementioned groups. Interrelated considerations on the morphology, biology and DNA sequencing of investigated Hirsutella species state their identification more precisely and facilitate the establishment of systematic positions.
Passive Sampler for Measurements of Atmospheric Nitric Acid Vapor (HNO3 Concentrations
Directory of Open Access Journals (Sweden)
Andrzej Bytnerowicz
2001-01-01
Full Text Available Nitric acid (HNO3 vapor is an important nitrogenous air pollutant responsible for increasing saturation of forests with nitrogen and direct injury to plants. The USDA Forest Service and University of California researchers have developed a simple and inexpensive passive sampler for monitoring air concentrations of HNO3. Nitric acid is selectively absorbed on 47-mm Nylasorb nylon filters with no interference from particulate NO3-. Concentrations determined with the passive samplers closely corresponded with those measured with the co-located honeycomb annular denuder systems. The PVC protective caps of standardized dimensions protect nylon filters from rain and wind and allow for reliable measurements of ambient HNO3 concentrations. The described samplers have been successfully used in Sequoia National Park, the San Bernardino Mountains, and on Mammoth Mountain in California.
2011-04-26
... compliance with Sec. 4(d)(5) of the Wilderness Act. The WSP will reevaluate existing wilderness-related plans... the Web site (to assist in reducing costs, the public is strongly encouraged to accept compact disks... available at any time. While you can ask us in your comment to withhold your personal identifying...
2011 Computation Directorate Annual Report
Energy Technology Data Exchange (ETDEWEB)
Crawford, D L
2012-04-11
From its founding in 1952 until today, Lawrence Livermore National Laboratory (LLNL) has made significant strategic investments to develop high performance computing (HPC) and its application to national security and basic science. Now, 60 years later, the Computation Directorate and its myriad resources and capabilities have become a key enabler for LLNL programs and an integral part of the effort to support our nation's nuclear deterrent and, more broadly, national security. In addition, the technological innovation HPC makes possible is seen as vital to the nation's economic vitality. LLNL, along with other national laboratories, is working to make supercomputing capabilities and expertise available to industry to boost the nation's global competitiveness. LLNL is on the brink of an exciting milestone with the 2012 deployment of Sequoia, the National Nuclear Security Administration's (NNSA's) 20-petaFLOP/s resource that will apply uncertainty quantification to weapons science. Sequoia will bring LLNL's total computing power to more than 23 petaFLOP/s-all brought to bear on basic science and national security needs. The computing systems at LLNL provide game-changing capabilities. Sequoia and other next-generation platforms will enable predictive simulation in the coming decade and leverage industry trends, such as massively parallel and multicore processors, to run petascale applications. Efficient petascale computing necessitates refining accuracy in materials property data, improving models for known physical processes, identifying and then modeling for missing physics, quantifying uncertainty, and enhancing the performance of complex models and algorithms in macroscale simulation codes. Nearly 15 years ago, NNSA's Accelerated Strategic Computing Initiative (ASCI), now called the Advanced Simulation and Computing (ASC) Program, was the critical element needed to shift from test-based confidence to science-based confidence
Energy Technology Data Exchange (ETDEWEB)
Bechtel, A.; Sachsenhofer, R.F.; Markic, M.; Gratzer, R.; Lucke, A.; Puttmann, W. [Montan University of Leoben, Leoben (Austria)
2003-07-01
A Pliocene lignite seam up to 160 m thick occurs in the Velenje basin (Slovenia). The seam originated in a topogenous mire and evolved within a non-marine, transgressive setting. Differences in soluble organic matter yield and hydrocarbon content of borehole samples from the lignite are related to differences in the composition of free lipids of microbial origin and/or hydrocarbons derived from the biogeochemical degradation of plant tissue. Variations of the redox conditions within the mire are reflected by pristane/phytane ratios. The abundance of terpenoid biomarkers indicates the predominance of gymnosperms over angiosperms, which is consistent with palynomorphic spectra dominated by pollen of the Sequoia-Taxodium-Metasequoia plant community rather than by angiosperms. Evidence is also provided that the content of land plant derived biomarkers and the preservation of plant tissue is controlled by the input of resin-rich, decay-resistant conifers.
Measurement of proton momentum distributions using a direct geometry instrument
International Nuclear Information System (INIS)
Senesi, R; Andreani, C; Kolesnikov, A I
2014-01-01
We report the results of inelastic neutron scattering measurements on bulk water and ice using the direct geometry SEQUOIA chopper spectrometer at the Spallation Neutron Source (USA), with incident energy E i = 6 eV. In this set up the measurements allow to access the Deep Inelastic Neutron Scattering regime. The scattering is centred at the proton recoil energy given by the impulse approximation, and the shape of the recoil peak conveys information on the proton momentum distribution in the system. The comparison with the performance of inverse geometry instruments, such as VESUVIO at the ISIS source (UK), shows that complementary information can be accessed by the use of direct and inverse geometry instruments. Analysis of the neutron Compton profiles shows that the proton kinetic energy in ice at 271 K is larger than in room temperature liquid water, in agreement with previous measurements on VESUVIO
Areal variation and chemical modification of weathered shale infiltration characteristics
International Nuclear Information System (INIS)
Luxmoore, R.J.; Spalding, B.P.; Munro, I.M.
1981-01-01
Spatial variability of infiltration into a weathered shale subsoil was evaluated at a site proximal to one used for shallow land burial of low-level radioactive waste at Oak Ridge National Laboratory. Double-ring infiltometers were installed at 48 locations on a 2- by 2-m grid after the removal of 1 to 2 m of soil (Litz-Sequoia association, Typic Hapludults). Infiltration rates were measured before and during the 0- to 20- and 239- to 259-day periods following treatment with solutions of NaOH, KOH, NaF, NaAlO 2 , and Na 2 SiO 3 at rates of 151 equivalents/m 2 . None of these chemical treatments significantly altered infiltration rate, indicating that chemical modification of soil exchange properties may be achieved without inducing hydrologic disturbance in these subsoils. A semivariogram analysis of infiltration data showed that areal variability was random; any spatial patterning must therefore occur at a smaller scale than 2 m
International Nuclear Information System (INIS)
Kohut, Robert
2007-01-01
The risk of ozone injury to plants was assessed in support of the National Park Service's Vital Signs Monitoring Network program. The assessment examined bioindicator species, evaluated levels of ozone exposure, and investigated soil moisture conditions during periods of exposure for a 5-year period in each park. The assessment assigned each park a risk rating of high, moderate, or low. For the 244 parks for which assessments were conducted, the risk of foliar injury was high in 65 parks, moderate in 46 parks, and low in 131 parks. Among the well-known parks with a high risk of ozone injury are Gettysburg, Valley Forge, Delaware Water Gap, Cape Cod, Fire Island, Antietam, Harpers Ferry, Manassas, Wolf Trap Farm Park, Mammoth Cave, Shiloh, Sleeping Bear Dunes, Great Smoky Mountains, Joshua Tree, Sequoia and Kings Canyon, and Yosemite. - An assessment of the risk of foliar ozone injury on plants was conducted for 269 parks in support of the U.S. National Park Service's Vital Signs Monitoring Network Program
Kusumi, J; Tsumura, Y; Yoshimaru, H; Tachida, H
2000-10-01
Nucleotide sequences from four chloroplast genes, the matK, chlL, intergenic spacer (IGS) region between trnL and trnF, and an intron of trnL, were determined from all species of Taxodiaceae and five species of Cupressaceae sensu stricto (s.s.). Phylogenetic trees were constructed using the maximum parsimony and the neighbor-joining methods with Cunninghamia as an outgroup. These analyses provided greater resolution of relationships among genera and higher bootstrap supports for clades compared to previous analyses. Results indicate that Taiwania diverged first, and then Athrotaxis diverged from the remaining genera. Metasequoia, Sequoia, and Sequoiadendron form a clade. Taxodium and Glyptostrobus form a clade, which is the sister to Cryptomeria. Cupressaceae s.s. are derived from within Taxodiaceae, being the most closely related to the Cryptomeria/Taxodium/Glyptostrobus clade. These relationships are consistent with previous morphological groupings and the analyses of molecular data. In addition, we found acceleration of evolutionary rates in Cupressaceae s.s. Possible causes for the acceleration are discussed.
Kulkarni, Abhishek; Ertekin, Deniz; Lee, Chi-Hon; Hummel, Thomas
2016-03-17
The precise recognition of appropriate synaptic partner neurons is a critical step during neural circuit assembly. However, little is known about the developmental context in which recognition specificity is important to establish synaptic contacts. We show that in the Drosophila visual system, sequential segregation of photoreceptor afferents, reflecting their birth order, lead to differential positioning of their growth cones in the early target region. By combining loss- and gain-of-function analyses we demonstrate that relative differences in the expression of the transcription factor Sequoia regulate R cell growth cone segregation. This initial growth cone positioning is consolidated via cell-adhesion molecule Capricious in R8 axons. Further, we show that the initial growth cone positioning determines synaptic layer selection through proximity-based axon-target interactions. Taken together, we demonstrate that birth order dependent pre-patterning of afferent growth cones is an essential pre-requisite for the identification of synaptic partner neurons during visual map formation in Drosophila.
Kinetic turbulence simulations at extreme scale on leadership-class systems
Energy Technology Data Exchange (ETDEWEB)
Wang, Bei [Princeton Univ., Princeton, NJ (United States); Ethier, Stephane [Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Tang, William [Princeton Univ., Princeton, NJ (United States); Princeton Plasma Physics Lab. (PPPL), Princeton, NJ (United States); Williams, Timothy [Argonne National Lab. (ANL), Argonne, IL (United States); Ibrahim, Khaled Z. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Madduri, Kamesh [The Pennsylvania State Univ., University Park, PA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Williams, Samuel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Oliker, Leonid [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2013-01-01
Reliable predictive simulation capability addressing confinement properties in magnetically confined fusion plasmas is critically-important for ITER, a 20 billion dollar international burning plasma device under construction in France. The complex study of kinetic turbulence, which can severely limit the energy confinement and impact the economic viability of fusion systems, requires simulations at extreme scale for such an unprecedented device size. Our newly optimized, global, ab initio particle-in-cell code solving the nonlinear equations underlying gyrokinetic theory achieves excellent performance with respect to "time to solution" at the full capacity of the IBM Blue Gene/Q on 786,432 cores of Mira at ALCF and recently of the 1,572,864 cores of Sequoia at LLNL. Recent multithreading and domain decomposition optimizations in the new GTC-P code represent critically important software advances for modern, low memory per core systems by enabling routine simulations at unprecedented size (130 million grid points ITER-scale) and resolution (65 billion particles).
2011-03-15
..., University of California at Berkeley, Berkeley, CA, for research and storage. While conducting NAGPRA... ethnographic study. Ethnographic data places the CA-KER-14 site close to the village hamlets of the Tubatulabal... in Yokut territory) compose the Tubatulabal (Smith 1978). Burial customs based on ethnographic data...
2013-12-26
... posted to the Region 5 Web site at http://www.fs.usda.gov/main/r5/landmanagement/planning . The Forest..., U.S. Forest Service, Ecosystem Planning Staff, 1323 Club Drive, Vallejo, CA 94592. Comments or...-8823. Individuals who use telecommunication devices for the deaf (TDD) may call the Federal Information...
Energy Technology Data Exchange (ETDEWEB)
O' Brien, M. J.; Brantley, P. S.
2015-01-20
In order to run Monte Carlo particle transport calculations on new supercomputers with hundreds of thousands or millions of processors, care must be taken to implement scalable algorithms. This means that the algorithms must continue to perform well as the processor count increases. In this paper, we examine the scalability of:(1) globally resolving the particle locations on the correct processor, (2) deciding that particle streaming communication has finished, and (3) efficiently coupling neighbor domains together with different replication levels. We have run domain decomposed Monte Carlo particle transport on up to 221 = 2,097,152 MPI processes on the IBM BG/Q Sequoia supercomputer and observed scalable results that agree with our theoretical predictions. These calculations were carefully constructed to have the same amount of work on every processor, i.e. the calculation is already load balanced. We also examine load imbalanced calculations where each domain’s replication level is proportional to its particle workload. In this case we show how to efficiently couple together adjacent domains to maintain within workgroup load balance and minimize memory usage.
Energy Technology Data Exchange (ETDEWEB)
Kohut, Robert [Boyce Thompson Institute for Plant Research, Cornell University, Ithaca, NY 14853 (United States)], E-mail: rjk9@cornell.edu
2007-10-15
The risk of ozone injury to plants was assessed in support of the National Park Service's Vital Signs Monitoring Network program. The assessment examined bioindicator species, evaluated levels of ozone exposure, and investigated soil moisture conditions during periods of exposure for a 5-year period in each park. The assessment assigned each park a risk rating of high, moderate, or low. For the 244 parks for which assessments were conducted, the risk of foliar injury was high in 65 parks, moderate in 46 parks, and low in 131 parks. Among the well-known parks with a high risk of ozone injury are Gettysburg, Valley Forge, Delaware Water Gap, Cape Cod, Fire Island, Antietam, Harpers Ferry, Manassas, Wolf Trap Farm Park, Mammoth Cave, Shiloh, Sleeping Bear Dunes, Great Smoky Mountains, Joshua Tree, Sequoia and Kings Canyon, and Yosemite. - An assessment of the risk of foliar ozone injury on plants was conducted for 269 parks in support of the U.S. National Park Service's Vital Signs Monitoring Network Program.
International Nuclear Information System (INIS)
Seo, Young Lan; Choi, Chul Soon; Kim, Ho Chul; Yoon, Dae Young; Han, Dae Hee; Bae, Sang Hoon
2002-01-01
To compare the quality of ultrasonographic (US) images, tissue harmonic image (THI) versus fundamental image (FI), of the pancreas. During a recent 2 month period, forty one patients with the normal pancreas on US were included. All of them were free of abnormal clinical and laboratory findings suggestive of pancreatic disease, US was performed by an abdominal radiologist with a 2.5-5 MHz convex-array transducer (Sequoia 512: Acuson, Mountain View, Calif.U.S.A.). Comparison of THI and FI of the pancreas was done for the following parameters:conspicuity, intermal architecture, and delineation range. Grading was made by the consensus of two abdominal radiologist witha three-point scale. Statistical analysis was done using Wilcox signed rank sum test. For the evaluation of the US image quality of the pancreas THI showed better conspicuity (p=0.0130), clearer internal architecture (p=0.0029) and superior delineation range (p=0.0191) than those of FI. THI appears to show a superior image quality than FI in evaluation of the pancreas.
Thorne, J. H.; Schwartz, M. W.; Holguin, A. J.; Moritz, M.; Batllori, E.; Folger, K.; Nydick, K.
2013-12-01
Ecological systems may respond in complex manners as climate change progresses. Among the responses, site-level climate conditions may cause a shift in vegetation due to the physiological tolerances of plant species, and the fire return interval may change. Natural resource managers challenged with maintaining ecosystem health need a way to forecast how these processes may affect every location, in order to determine appropriate management actions and prioritize locations for interventions. We integrated climate change-driven vegetation type transitions with projected change in fire frequency for 45,203 km2 of the southern Sierra Nevada, California, containing over 10 land management agencies as well as private lands. This Magnitude of Change (MOC) approach involves classing vegetation types in current time according to their climate envelopes, and identifying which sites will in the future have climates beyond what that vegetation currently occurs in. Independently, fire models are used to determine the change in fire frequency for each site. We examined 82 vegetation types with >50 grid cell occurrences. We found iconic resources such as the giant sequoia, lower slope oak woodlands, and high elevation conifer forests are projected as highly vulnerable by models that project a warmer drier future, but not as much by models that project a warmer future that is not drier than current conditions. Further, there were strongly divergent vulnerabilities of these forest types across land ownership (National Parks versus US Forest Service lands), and by GCM. For example, of 50 giant sequoia (Sequoiadendron giganteum) groves and complexes, all but 3 (on Sierra National Forest) were in the 2 highest levels of risk of climate and fire under the GFDL A2 projection, while 15 groves with low-to-moderate risk were found on both the National Parks and National Forests 18 in the 2 under PCM A2. Landscape projections of potential MOC suggest that the region is likely to experience
Wilzbach, P.; Frazey, S.
2005-05-01
Productivities of resident salmonid populations, upland, and riparian areas in 25 small watersheds of coastal northern California were estimated and compared to determine if: 1) upland site productivity predicted riparian site productivity; 2) either upland or riparian site productivity predicted salmonid productivity; and 3) other parameters explained more of the variance in salmonid productivity than upland or riparian site productivity. Salmonid productivity was indexed by total salmonid biomass, length of age 1 fish, and percent habitat saturation. Upland and riparian site productivities were estimated using site indices for redwood (Sequoia sempervirens) and red alder (Alnus rubra), respectively. Upland and riparian site indices were correlated, but neither factor contributed to the best approximating models of salmonid biomass or fish length at age one. Salmonid biomass was best described by a positive relationship with drainage area, and length at age was best described by a positive relationship with percent of riparian hardwoods. Percent habitat saturation was not well described by any of the models constructed. Lack of a relationship between upland conifer and salmonid productivity suggests that management of land for timber productivity and component streams for salmonid production in these sites will require separate, albeit integrated, strategies.
International Nuclear Information System (INIS)
Barbieri, M.
2002-01-01
A recent discovery of Pliocene tree trunks (Taxodium, Glyptostrobus or Sequoia) perfectly preserved in the fluvial lacustrine sediments deposited in the old Tiberin Lake (near the town of Dunarobba, Central Italy) has led to the study of the conditions responsible for the trunks preservation. The present work has applied Sr isotope techniques to examine and confirm fluid migration in the different sediment types which cross the entire fluvial-lacustrine sequence. Based on the 87 Sr/ 86 Sr ratios measured in carbonate and in silicate fractions of samples collected from a bore hole (from 0 to 120 m) it is concluded that each sedimentary level has limited communication between zones and is characterised by different isotope values. This suggests that the intrinsic properties of these clays make them a good material for isolating waste, both for direct use and for a better buffer in other formations, possibly less secure, such as salt or granite. The results obtained in the present work have demonstrated some of the potential uses of the 87 Sr/ 86 Sr isotopic ratio as an environmental tracer for confirming results from some of the geotechnical (such as permeability) and geochemical parameters of these host sediments
Increasing the UAV data value by an OBIA methodology
GarcÃa-Pedrero, Angel; Lillo-Saavedra, Mario; Rodriguez-Esparragon, Dionisio; Rodriguez-Gonzalez, Alejandro; Gonzalo-Martin, Consuelo
2017-10-01
Recently, there has been a noteworthy increment of using images registered by unmanned aerial vehicles (UAV) in different remote sensing applications. Sensors boarded on UAVs has lower operational costs and complexity than other remote sensing platforms, quicker turnaround times as well as higher spatial resolution. Concerning this last aspect, particular attention has to be paid on the limitations of classical algorithms based on pixels when they are applied to high resolution images. The objective of this study is to investigate the capability of an OBIA methodology developed for the automatic generation of a digital terrain model of an agricultural area from Digital Elevation Model (DEM) and multispectral images registered by a Parrot Sequoia multispectral sensor board on a eBee SQ agricultural drone. The proposed methodology uses a superpixel approach for obtaining context and elevation information used for merging superpixels and at the same time eliminating objects such as trees in order to generate a Digital Terrain Model (DTM) of the analyzed area. Obtained results show the potential of the approach, in terms of accuracy, when it is compared with a DTM generated by manually eliminating objects.
The Inelastic Instrument suite at the SNS
International Nuclear Information System (INIS)
Granroth, Garrett E; Abernathy, Douglas L; Ehlers, Georg; Hagen, Mark E; Herwig, Kenneth W; Mamontov, Eugene; Ohl, Michael E; Wildgruber, Christoph U
2008-01-01
The instruments in the extensive suite of spectrometers at the SNS are in various stages of installation and commissioning. The Back Scattering Spectrometer (BASIS) is installed and is in commissioning. It's near backscattering analyzer crystals provide the 3 eV resolution as expected. BASIS will enter the user program in the fall of 2007. The ARCS wide angular-range thermal to epithermal neutron spectrometer will come on line in the fall of 2007 followed shortly by the Cold Neutron Chopper Spectrometer. These two direct geometry instruments provide moderate resolution and the ability to trade resolution for flux. In addition both instruments have detector coverage out to 140o to provide a large Q range. The SEQUOIA spectrometer, complete in 2008, is the direct geometry instrument that will provide fine resolution in the thermal to epithermal range. The Spin-Echo spectrometer, to be completed on a similar time scale, will provide the finest energy resolution worldwide. The HYSPEC spectrometer, available no later than 2011, will provide polarized capabilities and optimized flux in the thermal energy range. Finally, the Vision chemical spectrometer will use crystal analyzers to study energy transfers into the epithermal range
How big is big and how small is small the sizes of everything and why
Smith, Timothy Paul
2013-01-01
This book is about how big is the universe and how small are quarks, and what are the sizes of dozens of things between these two extremes. It describes the sizes of atoms and planets, quarks and galaxies, cells and sequoias. It is a romp through forty-five orders of magnitude from the smallest sub-nuclear particles we have measured, to the edge of the observed universe. It also looks at time, from the epic age of the cosmos to the fleeting lifetimes of ethereal particles. It is a narrative that trips its way from stellar magnitudes to the clocks on GPS satellites, from the nearly logarithmic scales of a piano keyboard through a system of numbers invented by Archimedes and on to the measurement of the size of an atom. Why do some things happen at certain scales? Why are cells a hundred thousandths of a meter across? Why are stars never smaller than about 100 million meters in diameter? Why are trees limited to about 120 meters in height? Why are planets spherical, but asteroids not? Often the size of an objec...
Molecular-Level Simulations of the Turbulent Taylor-Green Flow
Gallis, M. A.; Bitter, N. P.; Koehler, T. P.; Plimpton, S. J.; Torczynski, J. R.; Papadakis, G.
2017-11-01
The Direct Simulation Monte Carlo (DSMC) method, a statistical, molecular-level technique that provides accurate solutions to the Boltzmann equation, is applied to the turbulent Taylor-Green vortex flow. The goal of this work is to investigate whether DSMC can accurately simulate energy decay in a turbulent flow. If so, then simulating turbulent flows at the molecular level can provide new insights because the energy decay can be examined in detail from molecular to macroscopic length scales, thereby directly linking molecular relaxation processes to macroscopic transport processes. The DSMC simulations are performed on half a million cores of Sequoia, the 17 Pflop platform at Lawrence Livermore National Laboratory, and the kinetic-energy dissipation rate and the energy spectrum are computed directly from the molecular velocities. The DSMC simulations are found to reproduce the Kolmogorov -5/3 law and to agree with corresponding Navier-Stokes simulations obtained using a spectral method. Sandia National Laboratories is a multimission laboratory managed and operated by National Technology and Engineering Solutions of Sandia, LLC., a wholly owned subsidiary of Honeywell International, Inc., for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-NA0003525.
Directory of Open Access Journals (Sweden)
Christopher R. Keyes
2014-02-01
Full Text Available Restoration of second-growth riparian stands has become an important issue for managers of redwood (Sequoia sempervirens [D. Don] Endl. forest reserves. Identifying differences between old-growth and second-growth forest vegetation is a necessary step in evaluating restoration needs and targets. The objective of this study was to characterize and contrast vegetation structure and composition in old-growth and unmanaged second-growth riparian forests in adjacent, geomorphologically similar watersheds at Redwood National Park. In the old-growth, redwood was the dominant overstory species in terms of stem density, basal area, and importance values. Second-growth was dominated by red alder (Alnus rubra Bong., Douglas-fir (Pseudotsuga menziesii [Mirbel] Franco, and redwood. Understory species were similar in both forests, with several key differences: Oxalis oregana Nutt. and Trillium ovatum Pursh had greater importance values in the old-growth, and Vaccinium parvifolium Sm., Dryopteris spp. and sedges Carex spp. had greater importance values in the second-growth. Notable differences in structure and composition suggest that restoration practices such as thinning could expedite the acquisition of old-growth characteristics in second-growth riparian forests.
Directory of Open Access Journals (Sweden)
Timus Asea M.
2006-01-01
Full Text Available Sugar beet is one of the most important agricultural crops in the Republic of Moldova. The North and Central regions have good enough pedoclimatic conditions. The genetic potential of sorts and hybrids can be created through the application of modern technologies in order to grow at least 32-35 tons/ha of sugar beet roots. In the Republic of Moldova, sugar beet vegetates between 160 and 180 days in the first year and needs approximately an amount of 2400-2900°C, average of 15.3-15.4°C. Each phenological phase needs different temperatures: at least 4C° is necessary for planting and springing an amount of 650°C is necessary for foliar apparatus; an amount of 1150- 1800°C is necessary to grow the volume of roots and for sugar depositing the average of 2400 to 2600°C is necessary. The mentioned temperatures ensure a normal development of sugar beet plants. If these temperatures fluctuate, the pathogens and pests are stimulated to develop. The most frequent diseases of sugar beet are: Pythium de baryanum Hesse., Aphanomyces cochlioides Dresch. Peronospora schachtii Fuck., Phoma betae Fr. Cercospora beticola Sacc. Erysiphe communis Grev. f. betae Jacz., virosis - Beta virus 2, 3 si 4 etc. The main pests belong to the following categories: Homoptera: Aphis fabae Scop. (fam. Aphididae, Pemphigus fuscicornis Koch. (fam. Pemphigidae Coleoptera: Agriotes sp. (fam. Elateridae, Chaetocnema concinna M. Ch. breviuscula Fld., Cassida nebulosa L. (fam. Chrysomelidae, Atomaria linearis Step. (fam. Cryptophagidae; Bothynoderes punctiventris Germ., Tanymechus dilaticollis Gyll., T. palliatus F., Psalidium maxillosum F. (Curculionidae; Lepidoptera: Agrotis segetum Den. et Schiff., Authographa gamma L. Mamestra (Barathra brassicae L. (Noctuidae, Loxostege sticticalis L. (Pyralidae, Gnorimoschema ocellatella Boyd.; Diptera Pegomyia betae Curtis. (fam. Anthomyidae. Heterodera schachtii Schmidt (Heteroderidae. The most recommended insecticides for fighting the
Spectral changes in conifers subjected to air pollution and water stress: Experimental studies
Westman, Walter E.; Price, Curtis V.
1988-01-01
The roles of leaf anatomy, moisture and pigment content, and number of leaf layers on spectral reflectance in healthy, pollution-stressed, and water-stressed conifer needles were examined experimentally. Jeffrey pine (Pinus jeffreyi) and giant sequoia (Sequoiadendron gigantea) were exposed to ozone and acid mist treatments in fumigation chambers; red pine (Pinus resinosa) needles were artificially dried. Infrared reflectance from stacked needles rose with free water loss. In an air-drying experiment, cell volume reductions induced by loss of turgor caused near-infrared reflectance (TM band 4) to drop after most free water was lost. Under acid mist fumigation, stunting of tissue development similarly reduced band 4 reflectance. Both artificial drying and pollutant fumigation caused a blue shift of the red edge of spectral reflectance curves in conifers, attributable to chlorophyll denaturation. Thematic mapper band ratio 4/3 fell and 5/4 rose with increasing pollution stress on artificial drying. Loss of water by air-drying, freeze-drying, or oven-drying enhanced spectral features, due in part to greater scattering and reduced water absorption. Grinding of the leaf tissue further enhanced the spectral features by increasing reflecting surfaces and path length. In a leaf-stacking experiment, an asymptote in visible and infrared reflectance was reached at 7-8 needle layers of red pine.
[Estimation of the atrioventricular time interval by pulse Doppler in the normal fetal heart].
Hamela-Olkowska, Anita; Dangel, Joanna
2009-08-01
To assess normative values of the fetal atrioventricular (AV) time interval by pulse-wave Doppler methods on 5-chamber view. Fetal echocardiography exams were performed using Acuson Sequoia 512 in 140 singleton fetuses at 18 to 40 weeks of gestation with sinus rhythm and normal cardiac and extracardiac anatomy. Pulsed Doppler derived AV intervals were measured from left ventricular inflow/outflow view using transabdominal convex 3.5-6 MHz probe. The values of AV time interval ranged from 100 to 150 ms (mean 123 +/- 11.2). The AV interval was negatively correlated with the heart rhythm (page of gestation (p=0.007). However, in the same subgroup of the fetal heart rate there was no relation between AV intervals and gestational age. Therefore, the AV intervals showed only the heart rate dependence. The 95th percentiles of AV intervals according to FHR ranged from 135 to 148 ms. 1. The AV interval duration was negatively correlated with the heart rhythm. 2. Measurement of AV time interval is easy to perform and has a good reproducibility. It may be used for the fetal heart block screening in anti-Ro and anti-La positive pregnancies. 3. Normative values established in the study may help obstetricians in assessing fetal abnormalities of the AV conduction.
Energy Technology Data Exchange (ETDEWEB)
Barbieri, M
2002-12-01
A recent discovery of Pliocene tree trunks (Taxodium, Glyptostrobus or Sequoia) perfectly preserved in the fluvial lacustrine sediments deposited in the old Tiberin Lake (near the town of Dunarobba, Central Italy) has led to the study of the conditions responsible for the trunks preservation. The present work has applied Sr isotope techniques to examine and confirm fluid migration in the different sediment types which cross the entire fluvial-lacustrine sequence. Based on the {sup 87}Sr/{sup 86}Sr ratios measured in carbonate and in silicate fractions of samples collected from a bore hole (from 0 to 120 m) it is concluded that each sedimentary level has limited communication between zones and is characterised by different isotope values. This suggests that the intrinsic properties of these clays make them a good material for isolating waste, both for direct use and for a better buffer in other formations, possibly less secure, such as salt or granite. The results obtained in the present work have demonstrated some of the potential uses of the {sup 87}Sr/{sup 86}Sr isotopic ratio as an environmental tracer for confirming results from some of the geotechnical (such as permeability) and geochemical parameters of these host sediments.
Zhou, Haiming; Hanson, Timothy; Knapp, Roland
2015-12-01
The global emergence of Batrachochytrium dendrobatidis (Bd) has caused the extinction of hundreds of amphibian species worldwide. It has become increasingly important to be able to precisely predict time to Bd arrival in a population. The data analyzed herein present a unique challenge in terms of modeling because there is a strong spatial component to Bd arrival time and the traditional proportional hazards assumption is grossly violated. To address these concerns, we develop a novel marginal Bayesian nonparametric survival model for spatially correlated right-censored data. This class of models assumes that the logarithm of survival times marginally follow a mixture of normal densities with a linear-dependent Dirichlet process prior as the random mixing measure, and their joint distribution is induced by a Gaussian copula model with a spatial correlation structure. To invert high-dimensional spatial correlation matrices, we adopt a full-scale approximation that can capture both large- and small-scale spatial dependence. An efficient Markov chain Monte Carlo algorithm with delayed rejection is proposed for posterior computation, and an R package spBayesSurv is provided to fit the model. This approach is first evaluated through simulations, then applied to threatened frog populations in Sequoia-Kings Canyon National Park. © 2015, The International Biometric Society.
Tree thermometers and commodities: historic climate indicators
International Nuclear Information System (INIS)
Libby, L.M.; Pandolfi, L.J.
1979-01-01
In four modern trees, hydrogen and oxygen isotope ratios track the modern temperature records. In a 2000-yr sequence of a Japanese cedar, there are the same periodicities of variation of D/H and O 18 /O 16 as have been found in O 18 /O 16 in a Greenland ice well. The same periodicities are found in uranium and organic carbon concentrations versus depth in a sea core from the Santa Barbara Channel, and in carbon-14 variations in a sequence of Bristlecone pine from southern California. In a 2000-yr sequence of Japanese cedar and in a 1000-yr sequence of European oak D/H and O 18 /O 16 are related to each other by a slope of 8, just as they are in world-wide precipitation. In a 72-yr sequence of Sequoia gigantea, measured year by year for its oxygen isotope ratios, the 10.5-yr cycle of sunspot numbers found, but not the 21-yr cycle of sunspot magnetism; this we believe indicates that the sun is affecting the earth's climate with non-magnetic particles, probably photons. All these phenomena are related to periodic changes in sea surface temperature caused by periodic changes in the sun. (author)
Directory of Open Access Journals (Sweden)
Kevin L. O’Hara
2017-04-01
Full Text Available Coast redwood (Sequoia sempervirens (Lamb. ex. D. Don Endl. is unique among conifer species because of its longevity, the great sizes of individual trees, and its propensity to reproduce through sprouts. Timber harvesting in the native redwood range along the coast of the western United States has necessitated restoration aimed to promote old forest structures to increase the total amount of old forest, the connectivity between old forests, and to enhance the resiliency of these ecosystems. After disturbance or harvest, healthy redwood stumps sprout vigorously, often producing dozens of sprouts within two years of disturbance. These sprouts form highly aggregated spatial patterns because they are clustered around stumps that may number less than 50 ha−1. Thinning of sprouts can accelerate individual tree growth, providing an effective restoration strategy to accelerate formation of large trees and old forest structures or increase stand growth for timber production. However, management, including restoration activities, is a contentious issue throughout the native range of redwood because of the history of overexploitation of this resource and perceptions that overexploitation is continuing. This paper reviews the science of early stand dynamics in coast redwood and their implications for restoration and other silvicultural strategies.
Directory of Open Access Journals (Sweden)
José Manuel Fernández-Guisuraga
2018-02-01
Full Text Available This study evaluated the opportunities and challenges of using drones to obtain multispectral orthomosaics at ultra-high resolution that could be useful for monitoring large and heterogeneous burned areas. We conducted a survey using an octocopter equipped with a Parrot SEQUOIA multispectral camera in a 3000 ha framework located within the perimeter of a megafire in Spain. We assessed the quality of both the camera raw imagery and the multispectral orthomosaic obtained, as well as the required processing capability. Additionally, we compared the spatial information provided by the drone orthomosaic at ultra-high spatial resolution with another image provided by the WorldView-2 satellite at high spatial resolution. The drone raw imagery presented some anomalies, such as horizontal banding noise and non-homogeneous radiometry. Camera locations showed a lack of synchrony of the single frequency GPS receiver. The georeferencing process based on ground control points achieved an error lower than 30 cm in X-Y and lower than 55 cm in Z. The drone orthomosaic provided more information in terms of spatial variability in heterogeneous burned areas in comparison with the WorldView-2 satellite imagery. The drone orthomosaic could constitute a viable alternative for the evaluation of post-fire vegetation regeneration in large and heterogeneous burned areas.
An individual-based growth and competition model for coastal redwood forest restoration
van Mantgem, Phillip J.; Das, Adrian J.
2014-01-01
Thinning treatments to accelerate coastal redwood forest stand development are in wide application, but managers have yet to identify prescriptions that might best promote Sequoia sempervirens (Lamb. ex D. Don) Endl. (redwood) growth. The creation of successful thinning prescriptions would be aided by identifying the underlying mechanisms governing how individual tree growth responds to competitive environments in coastal redwood forests. We created a spatially explicit individual-based model of tree competition and growth parameterized using surveys of upland redwood forests at Redwood National Park, California. We modeled competition for overstory trees (stems ≥ 20 cm stem diameter at breast height, 1.37 m (dbh)) as growth reductions arising from sizes, distances, and species identity of competitor trees. Our model explained up to half of the variation in individual tree growth, suggesting that neighborhood crowding is an important determinant of growth in this forest type. We used our model to simulate the effects of novel thinning prescriptions (e.g., 40% stand basal area removal) for redwood forest restoration, concluding that these treatments could lead to substantial growth releases, particularly for S. sempervirens. The results of this study, along with continued improvements to our model, will help to determine spacing and species composition that best encourage growth.
2011-09-29
...-installation and removal of the equipment from the U.S. hospital and the export of the equipment from the...). Maghazehe had knowledge that a U.S. hospital was discarding the oncology system and that a company in Iran... States. For purposes of this paragraph, servicing means installation, maintenance, repair, modification...
Landi, Silvia; d'Errico, Giada; Gagnarli, Elena; Barzanti, Gian Paolo; Cito, Annarita; Papini, Rossella; Simoni, Sauro; Roversi, Pio Federico
2014-05-01
Rice is the most important cereal crop in the developing world and, in Europe, Italy is leader in rice production. The intensive cultivation of rice leads to continuous inputs chemicals as fertilizers, weeding and pesticides. The intensification of sustainable rice production by minimizing the impact on the environment of cultivation is a main issue . In this context this study, supported by the Italian National Project POLORISO (MIPAAF), aims to afford preliminary indications about the evaluation of ecological impact by different managements on soil mesofauna biodiversity. Biomonitoring of soil mesofauna, in particular nematodes and microarthropods, allows to determine the effects of crop management on the communities; the lack and/or reduction of these organisms can allow inference on the soil quality. This preliminary study aims at evaluate the different influence of conventional, integrated and biological managements on mesofauna communities. The samplings were conducted in Summer and Autumn 2013 near Vercelli (North Italy) in three study sites with similar pedologic characteristics but different in control strategies (conventional, organic farming, Integrated Pest Management (IPM)). The extraction of nematodes and microarthropods was performed by Bermann method and the Berlese-Tullgren selector, respectively. All specimens were counted and determined up to the order level. The biological soil quality was evaluated by Maturity Index (MI) for nematodes, BSQar and the soil Biological Classes (sBC)(range I-VII) for microarthropods. Regarding nematodes, Rhabditidae, Dorylamidae, Mononchidae, Tylenchidae and Heteroderidae were the most represented families. The Principal Component Analysis (PCA) evidenced that the trophic group of plant parasites was favored in organic farming, while groups of omnivores and predators were abundant in the other managements. The lowest nematodes' abundance was found in submerged rice soil with dominance of omnivores and plant
Cobb, Richard C; Eviner, Valerie T; Rizzo, David M
2013-10-01
Few studies have quantified pathogen impacts to ecosystem processes, despite the fact that pathogens cause or contribute to regional-scale tree mortality. We measured litterfall mass, litterfall chemistry, and soil nitrogen (N) cycling associated with multiple hosts along a gradient of mortality caused by Phytophthora ramorum, the cause of sudden oak death. In redwood forests, the epidemiological and ecological characteristics of the major overstory species determine disease patterns and the magnitude and nature of ecosystem change. Bay laurel (Umbellularia californica) has high litterfall N (0.992%), greater soil extractable NO3 -N, and transmits infection without suffering mortality. Tanoak (Notholithocarpus densiflorus) has moderate litterfall N (0.723%) and transmits infection while suffering extensive mortality that leads to higher extractable soil NO3 -N. Redwood (Sequoia sempervirens) has relatively low litterfall N (0.519%), does not suffer mortality or transmit the pathogen, but dominates forest biomass. The strongest impact of pathogen-caused mortality was the potential shift in species composition, which will alter litterfall chemistry, patterns and dynamics of litterfall mass, and increase soil NO3 -N availability. Patterns of P. ramorum spread and consequent mortality are closely associated with bay laurel abundances, suggesting this species will drive both disease emergence and subsequent ecosystem function. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Kevin L. O’Hara
2010-08-01
Full Text Available Tanoak (Notholithocarpus densiflorus syn. Lithocarpus densiflorus is one of the most widespread and abundant associates of coast redwood (Sequoia sempervirens, but little is known about the structural relationships between these two species. Knowledge of such relationships is essential for a thorough understanding of the impacts of sudden oak death (caused by the exotic pathogen Phytophthora ramorum, which is currently decimating tanoak populations throughout the redwood range. In this study, we utilized a stratified plot design and a stand reconstruction technique to assess structural impacts, at present and in the future, of this emerging disease. We found that residual trees in diseased plots were more aggregated than trees in unaffected plots, and we predicted that the loss of tanoak will lead to the following short-term changes: greater average diameter, height, height-to-live-crown, and crown length, as well as an increase in average nearest neighbor differences for diameter, height, and crown length. In addition, plots lacking tanoak (living or dead—as compared to plots with tanoak—exhibited greater average diameter and increased nearest neighbor differences with regard to diameter, height, and crown length. We also conducted a preliminary exploration of how sudden oak death-induced structural changes compare with typical old-growth characteristics, and how this disease may affect the structure of old-growth forests.
Goudey, Benjamin; Abedini, Mani; Hopper, John L; Inouye, Michael; Makalic, Enes; Schmidt, Daniel F; Wagner, John; Zhou, Zeyu; Zobel, Justin; Reumann, Matthias
2015-01-01
Genome-wide association studies (GWAS) are a common approach for systematic discovery of single nucleotide polymorphisms (SNPs) which are associated with a given disease. Univariate analysis approaches commonly employed may miss important SNP associations that only appear through multivariate analysis in complex diseases. However, multivariate SNP analysis is currently limited by its inherent computational complexity. In this work, we present a computational framework that harnesses supercomputers. Based on our results, we estimate a three-way interaction analysis on 1.1 million SNP GWAS data requiring over 5.8 years on the full "Avoca" IBM Blue Gene/Q installation at the Victorian Life Sciences Computation Initiative. This is hundreds of times faster than estimates for other CPU based methods and four times faster than runtimes estimated for GPU methods, indicating how the improvement in the level of hardware applied to interaction analysis may alter the types of analysis that can be performed. Furthermore, the same analysis would take under 3 months on the currently largest IBM Blue Gene/Q supercomputer "Sequoia" at the Lawrence Livermore National Laboratory assuming linear scaling is maintained as our results suggest. Given that the implementation used in this study can be further optimised, this runtime means it is becoming feasible to carry out exhaustive analysis of higher order interaction studies on large modern GWAS.
Robust and adaptive band-to-band image transform of UAS miniature multi-lens multispectral camera
Jhan, Jyun-Ping; Rau, Jiann-Yeou; Haala, Norbert
2018-03-01
Utilizing miniature multispectral (MS) or hyperspectral (HS) cameras by mounting them on an Unmanned Aerial System (UAS) has the benefits of convenience and flexibility to collect remote sensing imagery for precision agriculture, vegetation monitoring, and environment investigation applications. Most miniature MS cameras adopt a multi-lens structure to record discrete MS bands of visible and invisible information. The differences in lens distortion, mounting positions, and viewing angles among lenses mean that the acquired original MS images have significant band misregistration errors. We have developed a Robust and Adaptive Band-to-Band Image Transform (RABBIT) method for dealing with the band co-registration of various types of miniature multi-lens multispectral cameras (Mini-MSCs) to obtain band co-registered MS imagery for remote sensing applications. The RABBIT utilizes modified projective transformation (MPT) to transfer the multiple image geometry of a multi-lens imaging system to one sensor geometry, and combines this with a robust and adaptive correction (RAC) procedure to correct several systematic errors and to obtain sub-pixel accuracy. This study applies three state-of-the-art Mini-MSCs to evaluate the RABBIT method's performance, specifically the Tetracam Miniature Multiple Camera Array (MiniMCA), Micasense RedEdge, and Parrot Sequoia. Six MS datasets acquired at different target distances and dates, and locations are also applied to prove its reliability and applicability. Results prove that RABBIT is feasible for different types of Mini-MSCs with accurate, robust, and rapid image processing efficiency.
International Nuclear Information System (INIS)
Kanamori, Norio; Kondo, Makoto; Fukuoka, Yoshitomo; Higuchi, Hirokazu; Kubota, Tomoyuki; Matsuoka, Ryota; Araki, Makoto; Tanio, Hitoshi; Doyama, Kiyoshi
2007-01-01
Myocardial accumulation before reperfusion therapy of a radioactive tracer in the completely occluded region, conceivably reflects the viability of myocytes and degree of collateral circulation. To confirm this, the present study examined the relationship in the title. Subjects were 33 patients (F 7, M 26; average age 65 y) of the first 1-branch acute myocardial infarction and of TIMI (thrombolysis in myocardial infarction trial) grade 0 who recovered to TIMI 3 within 12 hr after attack: 99m Tc-tetrofosmin, 740 MBq, was intravenously injected before reperfusion and just after which, SPECT imaging (TF-SPECT) was conducted with Toshiba E. CAM, and regional severity score index (RSSI) (0-3) was calculated. About 1 week later, to see the myocardial viability in the chronic phase, GITl (Glucose-Insulin- 201 Tl) (111 MBq) SPECT was performed 30 min after its injection to calculate RSSI as above, and the echocardiography with ALOKA Pro Sound SSD-4000 or SIEMENS Acuson SEQUOIA C256 was done to calculate the regional wall motion score index (RWMSI) (0-4). RWMSI was found significantly correlated with TF-RSSI, the group with the better collateral circulation (TF-RSSI, 1.9 or less) exhibited significantly lower GITl-RSSI and RWMSI, and correlation between the ischemic time and neither TF-RSSI, GITl-RSSI nor RWMSI was found. Thus under these conditions, the development of collateral vessels was found to have potential protective effects on myocardium independently on the ischemic time. (T.I.)
Influence of sample composition on aerosol organic and black carbon determinations
Energy Technology Data Exchange (ETDEWEB)
Novakov, T.; Corrigan, C.E.
1995-07-01
In this paper we present results on characterization of filter-collected redwood (Sequoia sempevirens)-needle and eucalyptus smoke particles by thermal, optical, and solvent extraction methods. Our results demonstrate that organic and black carbon concentrations determined by thermal and optical methods are not only method dependent, but also critically influenced by the overall chemical composition of the samples. These conclusions are supported by the following: (1) the organic fraction of biomass smoke particles analyzed includes a component, ranging in concentration from about 6-20% of total carbon or from 16-30% of organic carbon, that is relatively non-volatile and has a combustion temperature close to that of black carbon; (2) presence of K or Na in biomass smoke samples lowers the combustion temperatures of this organic component and of black carbon, making their combustion properties indistinguishable; (3) about 20% of total organic material is nonvolatile when heated to 550{degrees}C in an inert atmosphere. Consequently, thermal methods that rely on a specific temperature to separate organic from black carbon may either underestimate or overestimate the black and organic carbon concentrations, depending on the amounts of Na and K and on the composition and concentration of organic material present in a sample. These analytical uncertainties and, under some conditions, absorption by organic material may contribute to the variability of empirically derived proportionality between light transmission through filter deposits and black carbon concentrations.
Holmquist, Jeffrey G.; Schmidt-Gengenbach, Jutta; Haultain, Sylvia A.
2013-12-01
Grazing management necessarily emphasizes the most spatially extensive vegetation assemblages, but landscapes are mosaics, often with more mesic vegetation types embedded within a matrix of drier vegetation. Our primary objective was to contrast effects of equine grazing on both subalpine vegetation structure and associated arthropods in a drier reed grass ( Calamagrostis muiriana) dominated habitat versus a wetter, more productive sedge habitat ( Carex utriculata). A second objective was to compare reed grass and sedge as habitats for fauna, irrespective of grazing. All work was done in Sequoia National Park (CA, USA), where detailed, long-term records of stock management were available. We sampled paired grazed and control wet meadows that contained both habitats. There were moderate negative effects of grazing on vegetation, and effects were greater in sedge than in reed grass. Conversely, negative grazing effects on arthropods, albeit limited, were greater in the drier reed grass, possibly due to microhabitat differences. The differing effects on plants and animals as a function of habitat emphasize the importance of considering both flora and fauna, as well as multiple habitat types, when making management decisions. Sedge supported twice the overall arthropod abundance of reed grass as well as greater diversity; hemipteran and dipteran taxa were particularly abundant in sedge. Given the greater grazing effects on sedge vegetation, greater habitat provision for terrestrial arthropods, and value as aquatic arthropod habitat, the wetter sedge assemblage is worthy of additional consideration by managers when planning for grazing and other aspects of land usage.
Computation Directorate 2008 Annual Report
Energy Technology Data Exchange (ETDEWEB)
Crawford, D L
2009-03-25
Whether a computer is simulating the aging and performance of a nuclear weapon, the folding of a protein, or the probability of rainfall over a particular mountain range, the necessary calculations can be enormous. Our computers help researchers answer these and other complex problems, and each new generation of system hardware and software widens the realm of possibilities. Building on Livermore's historical excellence and leadership in high-performance computing, Computation added more than 331 trillion floating-point operations per second (teraFLOPS) of power to LLNL's computer room floors in 2008. In addition, Livermore's next big supercomputer, Sequoia, advanced ever closer to its 2011-2012 delivery date, as architecture plans and the procurement contract were finalized. Hyperion, an advanced technology cluster test bed that teams Livermore with 10 industry leaders, made a big splash when it was announced during Michael Dell's keynote speech at the 2008 Supercomputing Conference. The Wall Street Journal touted Hyperion as a 'bright spot amid turmoil' in the computer industry. Computation continues to measure and improve the costs of operating LLNL's high-performance computing systems by moving hardware support in-house, by measuring causes of outages to apply resources asymmetrically, and by automating most of the account and access authorization and management processes. These improvements enable more dollars to go toward fielding the best supercomputers for science, while operating them at less cost and greater responsiveness to the customers.
Influence of sample composition on aerosol organic and black carbon determinations
International Nuclear Information System (INIS)
Novakov, T.; Corrigan, C.E.
1995-07-01
In this paper we present results on characterization of filter-collected redwood (Sequoia sempevirens)-needle and eucalyptus smoke particles by thermal, optical, and solvent extraction methods. Our results demonstrate that organic and black carbon concentrations determined by thermal and optical methods are not only method dependent, but also critically influenced by the overall chemical composition of the samples. These conclusions are supported by the following: (1) the organic fraction of biomass smoke particles analyzed includes a component, ranging in concentration from about 6-20% of total carbon or from 16-30% of organic carbon, that is relatively non-volatile and has a combustion temperature close to that of black carbon; (2) presence of K or Na in biomass smoke samples lowers the combustion temperatures of this organic component and of black carbon, making their combustion properties indistinguishable; (3) about 20% of total organic material is nonvolatile when heated to 550 degrees C in an inert atmosphere. Consequently, thermal methods that rely on a specific temperature to separate organic from black carbon may either underestimate or overestimate the black and organic carbon concentrations, depending on the amounts of Na and K and on the composition and concentration of organic material present in a sample. These analytical uncertainties and, under some conditions, absorption by organic material may contribute to the variability of empirically derived proportionality between light transmission through filter deposits and black carbon concentrations
International Nuclear Information System (INIS)
Watson, J.G.; Chow, J.C.; Egami, R.T.; Bowen, J.L.; Frazier, C.A.
1991-06-01
The State of California monitors the concentrations of acidic gases and particles at 10 sites throughout the state. Seven sites represent urban areas (South Coast Air Basin - three sites, San Francisco Bay Area, Bakersfield, Santa Barbara, and Sacramento) and three represent forested areas (Sequoia National Park, Yosemite National Park, and Gasquet). Several sites are collocated with monitoring instruments for other air quality and forest response networks. Continuous monitors for the dry deposition network collect hourly average values for ozone, wind speed, wind direction, atmospheric stability, temperature, dew point, time of wetness, and solar radiation. A newly-designed gas/particle sampler collects daytime (6 a.m. to 6 p.m.) and nighttime (6 p.m. to 6 a.m.) samples every sixth day for sulfur dioxide, ammonia, nitrogen dioxide, and nitric acid. Particles are collected on the same day/night schedule in PM(10) and PM(2.5) size ranges, and are analyzed for mass, sulfate, nitrate, chloride, ammonium, sodium, magnesium, potassium, and calcium ions. The sampling schedule follows the regulatory schedule adopted by the EPA and ARB for suspended particulate matter. Wet deposition data are collected at or nearby the dry deposition stations. The first year of the monitoring program included installation of the network, training of technicians, acquisition and validation of data, and transfer of the sampling and analysis technology to Air Resources Board operating divisions. Data have been validated and stored for the period May, 1988 through September, 1989
Plant Uptake of Atmospheric Carbonyl Sulfide in Coast Redwood Forests
Campbell, J. E.; Whelan, M. E.; Berry, J. A.; Hilton, T. W.; Zumkehr, A.; Stinecipher, J.; Lu, Y.; Kornfeld, A.; Seibt, U.; Dawson, T. E.; Montzka, S. A.; Baker, I. T.; Kulkarni, S.; Wang, Y.; Herndon, S. C.; Zahniser, M. S.; Commane, R.; Loik, M. E.
2017-12-01
The future resilience of coast redwoods (Sequoia sempervirens) is now of critical concern due to the detection of a 33% decline in California coastal fog over the 20th century. However, ecosystem-scale measurements of photosynthesis and stomatal conductance are challenging in coast redwood forests, making it difficult to anticipate the impacts of future changes in fog. To address this methodological problem, we explore coastal variations in atmospheric carbonyl sulfide (COS or OCS), which could potentially be used as a tracer of these ecosystem processes. We conducted atmospheric flask campaigns in coast redwood sites, sampling at surface heights and in the canopy ( 70 m), at the University of California Landels-Hill Big Creek Reserve and Big Basin State Park. We simulated COS atmosphere-biosphere exchange with a high-resolution 3-D model to interpret these data. Flask measurements indicated a persistent daytime drawdown between the coast and the downwind forest (45 ± 6 ppt COS) that is consistent with the expected relationship between COS plant uptake, stomatal conductance, and gross primary production. Other sources and sinks of COS that could introduce noise to the COS tracer technique (soils, anthropogenic activity, nocturnal plant uptake, and surface hydrolysis on leaves) are likely to be small relative to daytime COS plant uptake. These results suggest that COS measurements may be useful for making ecosystem-scale estimates of carbon, water, and energy exchange in coast redwood forests.
Ferrenberg, Scott; Schwilk, Dylan W.; Knapp, Eric E.; Groth, Eric; Keeley, Jon E.
2006-01-01
Prior to fire suppression in the 20th century, the mixed-conifer forests of the Sierra Nevada, California, U.S.A., historically burned in frequent fires that typically occurred during the late summer and early fall. Fire managers have been attempting to restore natural ecosystem processes through prescription burning, and have often favored burning during the fall in order to mimic historical fire regimes. Increasingly, however, prescription burning is also being done during the late spring and early summer in order to expand the window of opportunity for needed fuel reduction burning. The effect of prescribed fires outside of the historical fire season on forest arthropods is not known. The objective of this study was to compare the short-term effects of prescribed fires ignited in the early and late fire season on forest floor arthropods. Arthropod abundance and diversity were assessed using pitfall trapping in replicated burn units in Sequoia National Park, California. Overall, abundance of arthropods was lower in the burn treatments than in the unburned control. However, diversity tended to be greater in the burn treatments. Fire also altered the relative abundances of arthropod feeding guilds. No significant differences in arthropod community structure were found between early and late season burn treatments. Instead, changes in the arthropod community appeared to be driven largely by changes in fuel loading, vegetation, and habitat heterogeneity, all of which differed more between the burned and unburned treatments than between early and late season burn treatments.
Meyer, Erik; Seale, L. Don; Permar, Brianne; McClary, Andrew
2017-06-01
Growth of invasive, opportunistic plants (i.e. lampenflora) in popular tour caves is a significant concern for land managers worldwide. Numerous chemicals at various concentrations have been utilized to remove phototrophic lampenflora colonizing artificially lit surfaces within these caves; however formulations, effectiveness, and impacts appear anecdotal and temporally limited. At Crystal Cave, Sequoia National Park, California, we study lampenflora and cave springtail ( Tomocerus celsus) response to a single 0.05 ml/cm2 dose of 1.0% sodium hypochlorite, 0.5% sodium hypochlorite, and 15.0% hydrogen peroxide compared to no treatment over the course of one year. Additionally, we explore potential food web impacts resulting from invasive lampenflora in naturally oligotrophic caves by utilizing stable isotope analysis of T. celsus found on and off lampenflora. Time-effect decay models indicate 1.0 and 0.5% sodium hypochlorite effectively eliminate lampenflora in 11 and 21 days, respectively, while lampenflora decay projections exceed 600 days with 15.0% hydrogen peroxide treatment. Repeat surveys of T. celsus indicate a negative response to 1.0% sodium hypochlorite ( P = 0.02), and the probability of observing T. celsus was inversely related to the effectiveness of each treatment. Further, T. celsus had similar diets regardless of their lampenflora association ( P = 0.92). We conclude that treatments of sodium hypochlorite at or below 0.5% achieve management goals with limited impacts to the presence or diet of a common cave-adapted indicator species.
Climate Variability, Dissolved Organic Carbon, UV Exposure, and Amphibian Decline
Brooks, P. D.; O'Reilly, C. M.; Diamond, S.; Corn, S.; Muths, E.; Tonnessen, K.; Campbell, D. H.
2001-12-01
Increasing levels of UV radiation represent a potential threat to aquatic organisms in a wide range of environments, yet controls on in situ variability on UV exposure are relatively unknown. The primary control on the penetration of UV radiation in surface water environments is the amount of photoreactive dissolved organic carbon (DOC). Consequently, biogeochemical processes that control the cycling of DOC also affect the exposure of aquatic organisms to UV radiation. Three years of monitoring UV extinction and DOC composition in Rocky Mountain, Glacier, Sequoia/ Kings Canyon, and Olympic National Parks demonstrate that the amount of fulvic acid DOC is much more important than the total DOC pool in controlling UV attenuation. This photoreactive component of DOC originates primarily in soil, and is subject both to biogeochemical controls (e.g. temperature, moisture, vegetation, soil type) on production, and hydrologic controls on transport to surface water and consequently UV exposure to aquatic organisms. Both of these controls are positively related to precipitation with greater production and transport associated with higher precipitation amounts. For example, an approximately 20 percent reduction in precipitation from 1999 to 2000 resulted in a 27% - 59% reduction in the amount of photoreactive DOC at three sites in Rocky Mountain National Park. These differences in the amount of hydrophobic DOC result in an increase in UV exposure in the aquatic environment by a factor of 2 or more. Implications of these findings for observed patterns of amphibian decline will be discussed.
Making the transition to the third era of natural resources management
Stephenson, Nathan L.
2015-01-01
We are entering the third era of National Park Service (NPS) natural resources management— an era defined by rapid and unprecedented global changes. This third era promises to overturn not only some of our most fundamental assumptions about parks and protected areas, but also many of the ideals we currently hold dear. A common initial reaction to the diverse challenges of this transition is to feel overwhelmed and adrift; I have certainly had such feelings myself. But these feelings carry the risk of reducing our effectiveness as resource stewards right when we can least afford to be less effective: during a transition that is demanding us to be particularly clear-headed and far-seeing. Here I briefly examine some of the challenges of this new era, focusing on those that can most often elicit feelings of discouragement. When we examine the challenges individually, they begin to lose some of their ability to cast gloom—especially when we consider them in the light of lessons from an earlier fundamental transition in NPS natural resources management, beginning a half-century ago. My perspective is shaped by my 35 years as a place-based scientist stationed in a large national park (Sequoia and Kings Canyon), and by my passion for national parks in general. While the discussion that follows is most relevant to large national parks set aside primarily for their natural features, several of the ideas are also relevant to other park units.
Directory of Open Access Journals (Sweden)
Nirmala K. Hapukotuwa
2011-11-01
Full Text Available The Formosan subterranean termite, Coptotermes formosanus Shiraki, and the Asian subterranean termite, Coptotermes gestroi (Wasmann, are both pests of wood in service in Hawaii and Florida. We conducted a laboratory study using method modified from those described in standard E1-09 of the American Wood Protection Association (AWPA 2009 to assess the termite resistance of three commercially available wood species used in regions of the USA where both termite species occur: Douglas fir, Pseudotsuga menziessii, southern yellow pine, Pinus spp. and redwood, Sequoia sempervirens. A multiple-choice (three-choice assay was used for four weeks (28 days in order to simulate field conditions of food choice and assess termite feeding preferences under 28 °C and 72–80% RH. 400 termites (360 workers: 40 soldiers were released into each test jar. Five replicates and two controls of each wood species were used with each termite species. Termite mortality was recorded at the end of the test; and wood wafers were oven-dried and weighed before and after termite exposure to determine the mass loss due to termite feeding, and rated visually on a 0 (failure to 10 (sound scale. There were significant differences in mean mass loss values among the three wood species and between two termite species. The mean mass loss value for redwood was significantly lower than Douglas fir and southern yellow pine with both termite species. However, C. formosanus showed increased feeding on Douglas fir and southern yellow pine compared to C. gestroi.
Sources and Deposition of Polycyclic Aromatic Hydrocarbons to Western U.S. National Parks
USENKO, SASCHA; MASSEY SIMONICH, STACI L.; HAGEMAN, KIMBERLY J.; SCHRLAU, JILL E.; GEISER, LINDA; CAMPBELL, DON H.; APPLEBY, PETER G.; LANDERS, DIXON H.
2010-01-01
Seasonal snowpack, lichens, and lake sediment cores were collected from fourteen lake catchments in eight western U.S. National Parks and analyzed for sixteen polycyclic aromatic hydrocarbons (PAHs) in order to determine their current and historical deposition, as well as to identify their potential sources. Seasonal snowpack was measured to determine the current wintertime atmospheric PAH deposition; lichens were measured to determine the long-term, year around deposition; and the temporal PAH deposition trends were reconstructed using lake sediment cores dated using 210Pb and 137Cs. The fourteen remote lake catchments ranged from low-latitude catchments (36.6° N) at high elevation (2900 masl) in Sequoia National Park, CA to high-latitude catchments (68.4° N) at low elevation (427 masl) in the Alaskan Arctic. Over 75% of the catchments demonstrated statistically significant temporal trends in ΣPAH sediment flux, depending on catchment proximity to source regions and topographic barriers. The ΣPAH concentrations and fluxes in seasonal snowpack, lichens, and surficial sediment were 3.6 to 60,000 times greater in the Snyder Lake catchment of Glacier National Park than the other 13 lake catchments. The PAH ratios measured in snow, lichen, and sediment were used to identify a local aluminum smelter as a major source of PAHs to the Snyder Lake catchment. These results suggest that topographic barriers influence the atmospheric transport and deposition of PAHs in high-elevation ecosystems and that PAH sources to these national park ecosystems range from local point sources to diffuse regional and global sources. PMID:20465303
Engber, Eamon; Teraoka, Jason; van Mantgem, Phillip J.
2017-01-01
Almost half of Redwood National Park is comprised of second-growth forests characterized by high stand density, deficient redwood composition, and low understory biodiversity. Typical structure of young redwood stands impedes the recovery of old-growth conditions, such as dominance of redwood (Sequoia sempervirens (D. Don) Endl.), distinct canopy layers and diverse understory vegetation. Young forests are commonly comprised of dense, even-aged Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) and redwood stump sprouts, with simple canopy structure and little understory development. Moreover, many of these young stands are believed to be vulnerable to disturbance in the form of drought, disease and fire. Silvicultural practices are increasingly being employed by conservation agencies to restore degraded forests throughout the coast redwood range; however, prescribed fire treatments are less common and potentially under-utilized as a restoration tool. We present an early synthesis from three separate management-scale prescribed fire projects at Redwood National Park spanning 1to 7 years post-treatment. Low intensity prescribed fire had minimal effect on overstory structure, with some mortality observed in trees smaller than 30 cm diameter. Moderate to high intensity fire may be required to reduce densities of larger Douglas-fir, the primary competitor of redwood in the Park’s second growth forests. Fine woody surface fuels fully recovered by 7 years post-burn, while recruitment of larger surface fuels was quite variable. Managers of coastal redwood ecosystems will benefit by having a variety of tools at their disposal for forest restoration and management.
Smaill, Simeon J; Bayne, Karen M; Coker, Graham W R; Paul, Thomas S H; Clinton, Peter W
2014-04-01
Stakeholders in plantation forestry are increasingly aware of the importance of the ecosystem services and non-market values associated with forests. In New Zealand, there is significant interest in establishing species other than Pinus radiata D. Don (the dominant plantation species) in the belief that alternative species are better suited to deliver these services. Significant risk is associated with this position as there is little objective data to support these views. To identify which species were likely to be planted to deliver ecosystem services, a survey was distributed to examine stakeholder perceptions. Stakeholders were asked which of 15 tree attributes contributed to the provision of five ecosystem services (amenity value, bioenergy production, carbon capture, the diversity of native habitat, and erosion control/water quality) and to identify which of 22 candidate tree species possessed those attributes. These data were combined to identify the species perceived most suitable for the delivery of each ecosystem service. Sequoia sempervirens (D.Don) Endl. closely matched the stakeholder derived ideotypes associated with all five ecosystem services. Comparisons to data from growth, physiological and ecological studies demonstrated that many of the opinions held by stakeholders were inaccurate, leading to erroneous assumptions regarding the suitability of most candidate species. Stakeholder perceptions substantially influence tree species selection, and plantations established on the basis of inaccurate opinions are unlikely to deliver the desired outcomes. Attitudinal surveys associated with engagement campaigns are essential to improve stakeholder knowledge, advancing the development of fit-for-purpose forest management that provides the required ecosystem services.
TRAO Multibeam Receiver System and Key Science Programs
Lee, Youngung
2017-06-01
Taeduk Radio Astronomy Observatory (TRAO) is now equipped with a main controling computer with VxWorks operating system, a new receiver system, and a new backend system. The new receiver system(TRAO-SEQUOIA) is equipped with high-performing 16-pixel MMIC pre-amplifiers in a 4x4 array, operating within 85~115 GHz frequency range. The system temperature ranges from 150 K (86~110 GHz) to 450 K (115 GHz). The 2nd IF modules with the narrow band and the 8 channels with 4 FFT spectrometers allow to observe 2 frequencies simultaneously within the 85~100 or 100~115 GHz bands for all 16 pixels of the receiver. Radome replacement was completed successfully as of February 2017. In addition, a new servo system will be installed in 2017 summer. We provide OTF (On-The-Fly) as a main observing mode, and position switching mode is available as well. The backend system (FFT spectrometer) provides the 4096x2 channels with fine velocity resolution of about 0.05 km/sec (15 kHz) per channel, and their full spectra bandwidth is 60 MHz. Beam efficiency of the TRAO was measured to be about 46% - 54% (with less than 2% error) between 86 and 115 GHz bands and pointing errors of the 14m telescope were found be 4.4 arcsec in AZ direction and 6 arcsec in EL direction. Generally, we allocate 18 hours of telescope time a day from January to the middle of May, and from October to December. Three Key Science Programs had been selected in 2015 fall and they are supposed to have higher priority for telescope time.
Modularized Parallel Neutron Instrument Simulation on the TeraGrid
International Nuclear Information System (INIS)
Chen, Meili; Cobb, John W.; Hagen, Mark E.; Miller, Stephen D.; Lynch, Vickie E.
2007-01-01
In order to build a bridge between the TeraGrid (TG), a national scale cyberinfrastructure resource, and neutron science, the Neutron Science TeraGrid Gateway (NSTG) is focused on introducing productive HPC usage to the neutron science community, primarily the Spallation Neutron Source (SNS) at Oak Ridge National Laboratory (ORNL). Monte Carlo simulations are used as a powerful tool for instrument design and optimization at SNS. One of the successful efforts of a collaboration team composed of NSTG HPC experts and SNS instrument scientists is the development of a software facility named PSoNI, Parallelizing Simulations of Neutron Instruments. Parallelizing the traditional serial instrument simulation on TeraGrid resources, PSoNI quickly computes full instrument simulation at sufficient statistical levels in instrument de-sign. Upon SNS successful commissioning, to the end of 2007, three out of five commissioned instruments in SNS target station will be available for initial users. Advanced instrument study, proposal feasibility evaluation, and experiment planning are on the immediate schedule of SNS, which pose further requirements such as flexibility and high runtime efficiency on fast instrument simulation. PSoNI has been redesigned to meet the new challenges and a preliminary version is developed on TeraGrid. This paper explores the motivation and goals of the new design, and the improved software structure. Further, it describes the realized new features seen from MPI parallelized McStas running high resolution design simulations of the SEQUOIA and BSS instruments at SNS. A discussion regarding future work, which is targeted to do fast simulation for automated experiment adjustment and comparing models to data in analysis, is also presented
Osborne, Colin P; Beerling, David J
2003-10-01
Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm "greenhouse" climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with "living fossils" in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox.
Osborne, Colin P.; Beerling, David J.
2003-01-01
Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm “greenhouse†climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with “living fossils†in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox. PMID:12972654
The forgotten organ: Contrast enhanced sonography of the spleen
International Nuclear Information System (INIS)
Goerg, Christian
2007-01-01
Objective: Ultrasound contrast agents in conjunction with contrast specific imaging techniques, are increasingly accepted in clinical use for diagnostic imaging in several organs. Contrast enhanced sonography (CES) of second-generation contrast media have shown a spleen-specific uptake of the microbubble contrast agent. The aim of this review is to illustrate indications for the use of CES in patients with suspected (peri-)splenic pathology. Methods: This review based on the experience of transcutaneous CES in 200 patients with (peri-)splenic pathology diagnosed by B-mode sonography at an internal medicine center. CES studies were performed with a contrast-devoted unit (Acuson, Sequoia, Siemens medical solution) that had contrast-specific, continuous-mode software. A low mechanical index was used. A sulfur hexafluoride-based microbubble contrast medium (Sonovue, Bracco SpA, Milan, Italy) was injected. Results: On our experience, there are several clinical conditions which may show an diagnostic advantage of CES in comparison to B-mode US. CES should be performed to investigate: (1) the perisplenic tumor to diagnose or exclude accessory spleen, (2) the small-sized spleen to diagnose functional asplenia/hyposplenia, (3) the inhomogenous spleen of unknown cause to diagnose focal lesions within the spleen, (4) the incidentally found hypoechoic splenic tumor to diagnose high vascular splenic hemangioma, (5) focal lesions suspect for splenic abscess, hematoma, infarction to confirme diagnosis, and (6) patients with abdominal trauma to diagnose or exclude splenic injuriy. Conclusion: CES is of diagnostic value in several clinical circumstances to diagnose accessory spleen, functional asplenia, small-sized splenic involvement, high vascular splenic hemangioma, and vascular splenic pathology like splenic infarction, splenic abscess, and splenic laceration
The forgotten organ: Contrast enhanced sonography of the spleen
Energy Technology Data Exchange (ETDEWEB)
Goerg, Christian [Medizinische Universitaetsklinik, Baldingerstrasse, 35043 Marburg/Lahn (Germany)], E-mail: goergc@med.uni-marburg.de
2007-11-15
Objective: Ultrasound contrast agents in conjunction with contrast specific imaging techniques, are increasingly accepted in clinical use for diagnostic imaging in several organs. Contrast enhanced sonography (CES) of second-generation contrast media have shown a spleen-specific uptake of the microbubble contrast agent. The aim of this review is to illustrate indications for the use of CES in patients with suspected (peri-)splenic pathology. Methods: This review based on the experience of transcutaneous CES in 200 patients with (peri-)splenic pathology diagnosed by B-mode sonography at an internal medicine center. CES studies were performed with a contrast-devoted unit (Acuson, Sequoia, Siemens medical solution) that had contrast-specific, continuous-mode software. A low mechanical index was used. A sulfur hexafluoride-based microbubble contrast medium (Sonovue, Bracco SpA, Milan, Italy) was injected. Results: On our experience, there are several clinical conditions which may show an diagnostic advantage of CES in comparison to B-mode US. CES should be performed to investigate: (1) the perisplenic tumor to diagnose or exclude accessory spleen, (2) the small-sized spleen to diagnose functional asplenia/hyposplenia, (3) the inhomogenous spleen of unknown cause to diagnose focal lesions within the spleen, (4) the incidentally found hypoechoic splenic tumor to diagnose high vascular splenic hemangioma, (5) focal lesions suspect for splenic abscess, hematoma, infarction to confirme diagnosis, and (6) patients with abdominal trauma to diagnose or exclude splenic injuriy. Conclusion: CES is of diagnostic value in several clinical circumstances to diagnose accessory spleen, functional asplenia, small-sized splenic involvement, high vascular splenic hemangioma, and vascular splenic pathology like splenic infarction, splenic abscess, and splenic laceration.
The Lunula: An ultrasound imaging approach
International Nuclear Information System (INIS)
Choi, Soo Jung; Shin, Myung Jin; Kim, Sung Moon; Ahn, Joong Mo
2001-01-01
The lunula is the white, half-moon-shaped area seen on some, but not all nails. Usually the lunula is the topographic marker of the distal part of the nail matrix, and known to have the ability of nail production. Ultrasonographic imaging of the lunula has not been reported before. This study was undertaken to demonstrate normal ultrasonographic features of the lunula. Ultrasonographic examination of the lunula was performed in the right thumb of 20 healthy volunteers (10M, 10F, mean age 30, range 26-36 years) with a real-time, high-resolution ultrasound unit (Sequoia 512, Acuson, Mountain view, CA, USA) with 8-15 MHz linear transducers. Gray scale color, and special Doppler imagings were performed with longitudinal scanning. The lunula was not seen inspection in three of the 20 volunteers. The mean size of the lunula in the other 17 volumteen was 3.31 ± 1.24 mm (range 2-6.2 mm). Gray scale ultrasound imaging showed the lunula; ovoid shaped hypo-echoic zone in proximal fingernail in 18 of 20 volunteers (mean size, 6.74 ± 0.98 mm, range 5-8.8 mm). In two of 20 volunteers, the lunula was indistinct on gray scale ultrasound examination. However, all lunula were identifiable on color Doppler imaging by detecting vascularity within the lunula. Spectral wave pattern of the lunula was a bi-directional pulsatile wave. Peak velocity was within 5-15 m/sec (mean 8 m/sec). The lunula is identifiable on ultrasound examination as a hyper-vascular, ovoid shaped, hypo-echoic zone in proximal fingernail. This normal structure should not be misinterpreted as an abnormal sub-ungual lesion.
Effects of eradication and restoration treatments on Italian thistle (Carduus pycnocephalus)
McGinnis, Thomas; Keeley, Jon
2011-01-01
Low elevation grasslands in California long have been dominated by Mediterranean grasses, but many areas still have large native forb populations. Alien forbs invade these grasslands, displacing both native and other alien species. Italian thistle is a noxious alien herb that has recently invaded these grasslands, including ungrazed blue oak (Quercus douglassii) and interior live oak (Quercus wislizenii) stands in Sequoia National Park. Here, Italian thistle tends to dominate under oaks and has the potential to substantially alter the foothill ecosystem by displacing native plants and acting as a ladder fuel that can carry fires into the oak canopy. We tested the effects of selectively reducing Italian thistle populations alone and in combination with restoration of native species. Two thistle eradication techniques (clipping and the application of clopyralid herbicide) and two restoration techniques (addition of native forb seeds or planting native grass plugs) were used. After two consecutive years of treatment we found: a) clipping was not effective at reducing Italian thistle populations (clipping reduced Italian thistle density in some areas, but not vegetative cover), b) herbicide reduced both Italian thistle density and vegetative cover for the first two growing seasons after application, but cover rebounded in the third growing season, c) native forb cover and species richness were not significantly affected by clipping or spot-treating with herbicide, d) the grass and forb addition treatments by themselves were not effective at reducing Italian thistle during the course of this study and e) sowing annual forb seeds after clipping resulted in greater forb cover and moderately reduced Italian thistle vegetative cover in the short term.
Nanus, Leora; Clow, David; Saros, Jasmine; McMurray, Jill; Blett, Tamara; Sickman, James
2017-04-01
High-elevation aquatic ecosystems in Wilderness areas of the western United States are impacted by current and historic atmospheric nitrogen (N) deposition associated with local and regional air pollution. Documented effects include elevated surface water nitrate concentrations, increased algal productivity, and changes in diatom species assemblages. A predictive framework was developed for sensitive high-elevation basins across the western United States at multiple spatial scales including the Rocky Mountain Region (Rockies), the Greater Yellowstone Area (GYA), and Yosemite (YOSE) and Sequoia & Kings Canyon (SEKI) National Parks. Spatial trends in critical loads of N deposition for nutrient enrichment of aquatic ecosystems were quantified and mapped using a geostatistical approach, with modeled N deposition, topography, vegetation, geology, and climate as potential explanatory variables. Multiple predictive models were created using various combinations of explanatory variables; this approach allowed for better quantification of uncertainty and identification of areas most sensitive to high atmospheric N deposition (> 3 kg N ha-1 yr-1). For multiple spatial scales, the lowest critical loads estimates (1.5 + 1 kg N ha-1 yr-1) correspond with areas of high N deposition and vary spatially ranging from less than 20% to over 40% of the study area for the Rockies, GYA, YOSE, and SEKI. These predictive models and maps identify sensitive aquatic ecosystems that may be impacted by excess atmospheric N deposition and can be used to help protect against future anthropogenic disturbance. The approach presented here may be transferable to other remote and protected high-elevation ecosystems at multiple spatial scales that are sensitive to adverse effects of pollutant loading in the US and around the world.
Jones, Laura J.; Ostoja, Steven M.; Brooks, Matthew L.; Hutten, Martin
2015-01-01
One of the highest priority invasive species at both Yosemite and Sequoia and Kings Canyon national parks is Holcus lanatus L. (common velvetgrass), a perennial bunchgrass that invades mid-elevation montane meadows. Despite velvetgrass being a high priority species, there is little information available on control techniques. The goal of this project was to evaluate the short-term response of a single application of common chemical and manual velvetgrass control techniques. The study was conducted at three montane sites in Yosemite National Park. Glyphosate spot-spray treatments were applied at 0.5, 1.0, 1.5, and 2.0% concentrations, and compared with hand pulling to evaluate effects on cover of common velvetgrass, cover of other plant species, and community species richness. Posttreatment year 1 cover of common velvetgrass was 12.1% ± 1.6 in control plots, 6.3% ± 1.5 averaged over the four chemical treatments (all chemical treatments performed similarly), and 13.6% ± 1.7 for handpulled plots. This represents an approximately 50% reduction in common velvetgrass cover in chemically- treated plots recoded posttreatment year 1 and no statistically significant reduction in hand pulled plots compared with controls. However, there was no treatment effect in posttreatment year 2, and all herbicide application rates performed similarly. In addition, there were no significant treatment effects on nontarget species or species richness. These results suggest that for this level of infestation and habitat type, (1) one year of hand pulling is not an effective control method and (2) glyphosate provides some level of control in the short-term without impact to nontarget plant species, but the effect is temporary as a single year of glyphosate treatment is ineffective over a two-year period.
Measurement of Vapor Flow As an Important Source of Water in Dry Land Eco-Hydrology
Wang, Z.; He, Z.; Wang, Y.; Gao, Z.; Hishida, K.
2014-12-01
When the temperature of land surface is lower than that of air and deeper soils, water vapor gathers toward the ground surface where dew maybe formed depending on the prevailing dew point and wind speed. Some plants are able to absorb the dew and vapor flow while the soil can readily absorb both. Certain animals such as desert beetles and ants harvest the dew or fog for daily survival. Recently, it is also realized that the dew and vapor flow can be a life-saving amount of water for plant survival at the driest seasons of the year in arid and semi-arid regions. Researches are conducted to quantify the amount of near-surface vapor flow in arid and semi-arid regions in China and USA. Quantitative leaf water absorption and desorption functions were derived based on laboratory experiments. Results show that plant leaves absorb and release water at different speeds depending on species and varieties. The "ideal" native plants in the dry climates can quickly absorb water and slowly release it. This water-holding capacity of plant is characterized by the absorption and desorption functions derived for plant physiology and water balance studies. Field studies are conducted to measure the dynamic vapor flow movements from the atmosphere and the groundwater table to soil surface. Results show that dew is usually formed on soil and plant surfaces during the daily hours when the temperature gradients are inverted toward the soil surface. The amount of dew harvested using gravels on the soil surface was enough to support water melon agriculture on deserts. The vapor flow can be effectively intercepted by artificially seeded plants in semi-arid regions forming new forests. New studies are attempted to quantify the role of vapor flow for the survival of giant sequoias in the southern Sierra Nevada Mountains of California.
Llorens, Laura; Osborne, Colin P; Beerling, David J
2009-07-01
During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO(2)-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO(2)] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO(2)] reduces plant water use over the growing season. Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) 'living fossil' coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69 degrees N) conditions at either ambient (400 micromol mol(-1)) or elevated (800 micromol mol(-1)) [CO(2)]. Stimulation of whole-plant WUE (WUE(P)) by CO(2) enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUE(L)) and delta(13)C of foliage (tWUE(L)). This response was driven largely by increased rates of carbon uptake, because there was no overall CO(2) effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUE(L) differed from those measured for iWUE(L). The results suggest caution against over simplistic interpretations of WUE(P) based on leaf isotopic composition. The data suggest that the efficiency of whole-tree water use may be improved by CO(2) enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO(2) in the living fossil species investigated.
Directory of Open Access Journals (Sweden)
Jeffrey G Holmquist
Full Text Available Conclusions regarding disturbance effects in high elevation or high latitude ecosystems based solely on infrequent, long-term sampling may be misleading, because the long winters may erase severe, short-term impacts at the height of the abbreviated growing season. We separated a long-term effects of pack stock grazing, manifested in early season prior to stock arrival, from b additional pack stock grazing effects that might become apparent during annual stock grazing, by use of paired grazed and control wet meadows that we sampled at the beginning and end of subalpine growing seasons. Control meadows had been closed to grazing for at least two decades, and meadow pairs were distributed across Sequoia National Park, California, USA. The study was thus effectively a landscape-scale, long-term manipulation of wetland grazing. We sampled arthropods at these remote sites and collected data on associated vegetation structure. Litter cover and depth, percent bare ground, and soil strength had negative responses to grazing. In contrast, fauna showed little response to grazing, and there were overall negative effects for only three arthropod families. Mid-season and long-term results were generally congruent, and the only indications of lower faunal diversity on mid-season grazed wetlands were trends of lower abundance across morphospecies and lower diversity for canopy fauna across assemblage metrics. Treatment x Season interactions almost absent. Thus impacts on vegetation structure only minimally cascaded into the arthropod assemblage and were not greatly intensified during the annual growing season. Differences between years, which were likely a response to divergent snowfall patterns, were more important than differences between early and mid-season. Reliance on either vegetation or faunal metrics exclusively would have yielded different conclusions; using both flora and fauna served to provide a more integrative view of ecosystem response.
Holmquist, Jeffrey G; Schmidt-Gengenbach, Jutta; Haultain, Sylvia A
2013-01-01
Conclusions regarding disturbance effects in high elevation or high latitude ecosystems based solely on infrequent, long-term sampling may be misleading, because the long winters may erase severe, short-term impacts at the height of the abbreviated growing season. We separated a) long-term effects of pack stock grazing, manifested in early season prior to stock arrival, from b) additional pack stock grazing effects that might become apparent during annual stock grazing, by use of paired grazed and control wet meadows that we sampled at the beginning and end of subalpine growing seasons. Control meadows had been closed to grazing for at least two decades, and meadow pairs were distributed across Sequoia National Park, California, USA. The study was thus effectively a landscape-scale, long-term manipulation of wetland grazing. We sampled arthropods at these remote sites and collected data on associated vegetation structure. Litter cover and depth, percent bare ground, and soil strength had negative responses to grazing. In contrast, fauna showed little response to grazing, and there were overall negative effects for only three arthropod families. Mid-season and long-term results were generally congruent, and the only indications of lower faunal diversity on mid-season grazed wetlands were trends of lower abundance across morphospecies and lower diversity for canopy fauna across assemblage metrics. Treatment x Season interactions almost absent. Thus impacts on vegetation structure only minimally cascaded into the arthropod assemblage and were not greatly intensified during the annual growing season. Differences between years, which were likely a response to divergent snowfall patterns, were more important than differences between early and mid-season. Reliance on either vegetation or faunal metrics exclusively would have yielded different conclusions; using both flora and fauna served to provide a more integrative view of ecosystem response.
Perakis, S.S.; Kellogg, C.H.
2007-01-01
Woody vegetation is distributed patchily in many arid and semi-arid ecosystems, where it is often associated with elevated nitrogen (N) pools and availability in islands of fertility. We measured N availability and δ15N in paired blue-oak versus annual grass dominated patches to characterize the causes and consequences of spatial variation in N dynamics of grassland-savanna in Sequoia-Kings Canyon National Park. We found significantly greater surface soil N pools (0–20 cm) in oak patches compared to adjacent grass areas across a 700 m elevation gradient from foothills to the savanna-forest boundary. N accumulation under oaks was associated with a 0.6‰ depletion in soil δ15N relative to grass patches. Results from a simple δ15N mass balance simulation model, constrained by surface soil N and δ15N measured in the field, suggest that the development of islands of N fertility under oaks can be traced primarily to enhanced N inputs. Net N mineralization and percent nitrification in laboratory incubations were consistently higher under oaks across a range of experimental soil moisture regimes, suggesting a scenario whereby greater N inputs to oak patches result in net N accumulation and enhanced N cycling, with a potential for greater nitrate loss as well. N concentrations of three common herbaceous annual plants were nearly 50% greater under oak than in adjacent grass patches, with community composition shifted towards more N-demanding species under oaks. We find that oaks imprint distinct N-rich islands of fertility that foster local feedback between soil N cycling, plant N uptake, and herbaceous community composition. Such patch-scale differences in N inputs and plant–soil interactions increase biogeochemical heterogeneity in grassland-savanna ecosystems and may shape watershed-level responses to chronic N deposition.
Lightning safety awareness of visitors in three California national parks.
Weichenthal, Lori; Allen, Jacoby; Davis, Kyle P; Campagne, Danielle; Snowden, Brandy; Hughes, Susan
2011-09-01
To assess the level of lightning safety awareness among visitors at 3 national parks in the Sierra Nevada Mountains of California. A 12-question, short answer convenience sample survey was administered to participants 18 years of age and over concerning popular trails and points of interest with known lightning activity. There were 6 identifying questions and 5 knowledge-based questions pertaining to lightning that were scored on a binary value of 0 or 1 for a total of 10 points for the survey instrument. Volunteers in Fresno, California, were used as a control group. Participants were categorized as Sequoia and Kings Canyon National Park (SEKI), frontcountry (FC), or backcountry (BC); Yosemite National Park (YNP) FC or BC; and Fresno. Analysis of variance (ANOVA) was used to test for differences between groups. 467 surveys were included for analysis: 77 in Fresno, 192 in SEKI, and 198 in YNP. National park participants demonstrated greater familiarity with lightning safety than individuals from the metropolitan community (YNP 5.84 and SEKI 5.65 vs Fresno 5.14, P = .0032). There were also differences noted between the BC and FC subgroups (YNP FC 6.07 vs YNP BC 5.62, P = .02; YNP FC 6.07 vs SEKI FC 5.58, P = .02). Overall results showed that participants had certain basic lightning knowledge but lacked familiarity with other key lightning safety recommendations. While there are statistically significant differences in lightning safety awareness between national parks and metropolitan participants, the clinical impact of these findings are debatable. This study provides a starting point for providing educational outreach to visitors in these national parks. Copyright © 2011 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.
Forest gradient response in Sierran landscapes: the physical template
Urban, Dean L.; Miller, Carol; Halpin, Patrick N.; Stephenson, Nathan L.
2000-01-01
Vegetation pattern on landscapes is the manifestation of physical gradients, biotic response to these gradients, and disturbances. Here we focus on the physical template as it governs the distribution of mixed-conifer forests in California's Sierra Nevada. We extended a forest simulation model to examine montane environmental gradients, emphasizing factors affecting the water balance in these summer-dry landscapes. The model simulates the soil moisture regime in terms of the interaction of water supply and demand: supply depends on precipitation and water storage, while evapotranspirational demand varies with solar radiation and temperature. The forest cover itself can affect the water balance via canopy interception and evapotranspiration. We simulated Sierran forests as slope facets, defined as gridded stands of homogeneous topographic exposure, and verified simulated gradient response against sample quadrats distributed across Sequoia National Park. We then performed a modified sensitivity analysis of abiotic factors governing the physical gradient. Importantly, the model's sensitivity to temperature, precipitation, and soil depth varies considerably over the physical template, particularly relative to elevation. The physical drivers of the water balance have characteristic spatial scales that differ by orders of magnitude. Across large spatial extents, temperature and precipitation as defined by elevation primarily govern the location of the mixed conifer zone. If the analysis is constrained to elevations within the mixed-conifer zone, local topography comes into play as it influences drainage. Soil depth varies considerably at all measured scales, and is especially dominant at fine (within-stand) scales. Physical site variables can influence soil moisture deficit either by affecting water supply or water demand; these effects have qualitatively different implications for forest response. These results have clear implications about purely inferential approaches
Field instruments for real time in-situ crude oil concentration measurements
International Nuclear Information System (INIS)
Fuller, C.B.; Bonner, J.S.; Page, C.A.; Arrambide, G.; Sterling, M.C.Jr.; Ojo, T.O.
2003-01-01
Accidental oil spills, contaminant release during resuspension, storms, and harmful algal blooms are all episodic events that can effect coastal margins. It is important to quantitatively describe water and ecological quality evolution and predict the impact to these areas by such events, but traditional sampling methods miss environmental activity during cyclical events. This paper presents a new sampling approach that involves continuous, real-time in-situ monitoring to provide data for development of comprehensive modeling protocols. It gives spill response coordinators greater assurance in making decisions using the latest visualization tools which are based on a good understanding of the physical processes at work in pulsed events. Five sensors for rapid monitoring of crude oil concentrations in aquatic systems were described. The in-situ and ex-situ sensors can measure plume transport and estimate polycyclic aromatic hydrocarbon exposure concentrations to assess risk of toxicity. A brief description and evaluation of the following 5 sensors was provided: the LISST-100 by Sequoia Instrument, a submersible multi-angle laser scattering instrument; the AU-10 field fluorometer by Turner Designs, an ex-situ single wavelength fluorometer; the Flashlamp by WET Labs Inc., an in-situ single wavelength fluorometer; and, the ECO-FL3 and SAFire by WET Labs Inc., two in-situ multiple wavelength fluorometers. These instruments were used to analyze crude oil emissions of various concentrations. All of the instruments followed a linear response within the tested concentration range. At the lowest concentrations the LISST-100 was not as effective as the fluorometers because of limited particle volume for scatter. For the AU-10 field fluorometer, the highest concentrations tested were above the measurement range of the instrument. 6 refs., 5 figs
Past, Present, and Future Old Growth in Frequent-fire Conifer Forests of the Western United States
Directory of Open Access Journals (Sweden)
Scott R. Abella
2007-12-01
Full Text Available Old growth in the frequent-fire conifer forests of the western United States, such as those containing ponderosa pine (Pinus ponderosa, Jeffrey pine (P. jeffreyi, giant sequoia (Sequioa giganteum and other species, has undergone major changes since Euro-American settlement. Understanding past changes and anticipating future changes under different potential management scenarios are fundamental to developing ecologically based fuel reduction or ecological restoration treatments. Some of the many changes that have occurred in these forests include shifts from historically frequent surface fire to no fire or to stand-replacing fire regimes, increases in tree density, increased abundance of fire-intolerant trees, decreases in understory productivity, hydrological alterations, and accelerated mortality of old trees. Although these changes are widespread, the magnitude and causes of changes may vary within and among landscapes. Agents of change, such as fire exclusion or livestock grazing, likely interacted and had multiple effects. For example, historical ranching operations may have altered both fire regimes and understory vegetation, and facilitated institutional fire exclusion through fragmentation and settlement. Evidence exists for large variation in presettlement characteristics and current condition of old growth across this broad forest region, although there are many examples of striking similarities on widely distant landscapes. Exotic species, climate change, unnatural stand-replacing wildfires, and other factors will likely continue to degrade or eradicate old growth in many areas. As a policy of fire exclusion is proving to be unsustainable, mechanical tree thinning, prescribed fire, or wildland fire use will likely be key options for forestalling continued eradication of old growth by severe crown fires. For many practical and societal reasons, the wildland-urban interface may afford some of the most immediate opportunities for re
Alan Watson; Steve Martin; Neal Christensen; Gregg Fauth; Dan Williams
2015-01-01
In a recent national survey of federal wilderness managers, respondents identified the high priority need for scientific information about public attitudes toward biophysical intervention to adapt to climate change and attitudes of the public toward restoration of natural conditions. In a survey of visitors to one National Park wilderness in California, visitors...
Estimation the remaining service-lifetime of wooden structure of geothermal cooling tower
Directory of Open Access Journals (Sweden)
Effendi Tri Bahtiar
2017-06-01
Full Text Available Similar with other construction materials, wood strength is decreasing when applied by long term loading. Wooden cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd was built in 1998 and it should be evaluated to avoid sudden structural failure. Evaluation conducted through several steps: wood species identification, the physical and mechanical properties testing, and estimation for remaining service-lifetime by generating mathematical models derived from creep test and reduction of cross sectional area of the wood. Identification result that the wood are redwood (Sequoia sempervirens and Douglas fir (Pseudotsuga menziesii. The wood density value has degraded from the surface until 0.25 cm depth. Strength characteristics of the wood have considerably decreased, but the allowable stress for bending, tension parallel to grain, and shear were still higher than NDS2005 requirements. The allowable stress for compression parallel to grain was slightly lower than NDS, while compression perpendicular to grain was much lower. Average modulus of elasticity reduces become lower than the value stated by the code, but the minimum value of modulus of elasticity (Emin of redwood was still higher than the code value, while Emin of Douglas fir is slightly lower. Then, in accordance with those findings, the construction would not failure yet but the deformation and vibration will occur in higher rate than design planning. This research develops mathematical models for estimating the remaining service-lifetime of the wooden cooling tower structure in geothermal power plant based on the wood performance in resisting long term loading and its deterioration rate. The deterioration rate of wood member of cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd is 0.0147 cm depth per year, so equation for the residual service life estimation is σlaterσtoday=bh2(b−0.0147T(h−0.0147T2, and σlater must be lower than allowable stress.
Banavar, Jayanth
2009-03-01
The unity of life is expressed not only in the universal basis of inheritance and energetics at the molecular level, but also in the pervasive scaling of traits with body size at the whole-organism level. More than 75 years ago, Kleiber and Brody and Proctor independently showed that the metabolic rates, B, of mammals and birds scale as the three-quarter power of their mass, M. Subsequent studies showed that most biological rates and times scale as M-1/4 and M^1/4 respectively, and that these so called quarter-power scaling relations hold for a variety of organisms, from unicellular prokaryotes and eukaryotes to trees and mammals. The wide applicability of Kleiber's law, across the 22 orders of magnitude of body mass from minute bacteria to giant whales and sequoias, raises the hope that there is some simple general explanation that underlies the incredible diversity of form and function. We will present a general theoretical framework for understanding the relationship between metabolic rate, B, and body mass, M. We show how the pervasive quarter-power biological scaling relations arise naturally from optimal directed resource supply systems. This framework robustly predicts that: 1) whole organism power and resource supply rate, B, scale as M^3/4; 2) most other rates, such as heart rate and maximal population growth rate scale as M-1/4; 3) most biological times, such as blood circulation time and lifespan, scale as M^1/4; and 4) the average velocity of flow through the network, v, such as the speed of blood and oxygen delivery, scales as M^1/12. Our framework is valid even when there is no underlying network. Our theory is applicable to unicellular organisms as well as to large animals and plants. This work was carried out in collaboration with Amos Maritan along with Jim Brown, John Damuth, Melanie Moses, Andrea Rinaldo, and Geoff West.
2010-01-01
Background Y- graft (Y-G) is a graft formed by the Left Internal Mammary Artery (LIMA) connected to the Left Anterior Descending Artery (LAD) and by a free Right Internal Mammary Artery (RIMA) connected to LIMA and to a Marginal artery of Left Circumflex Artery (LCx). Aim of the work was to study the flow of this graft during a six months follow-up to assess whether the graft was able to meet the request of all the left coronary circulation, and to assess whether it could be done by evaluation of coronary flow reserve (CFR). Methods In 13 consecutive patients submitted to Y-G (13 men), CFR was measured in distal LAD and in distal LCx from 1 week after , every two months, up to six months after operation (a total of 8 tests for each patient) by means of transthoracic echocardiography (TTE) and Adenosine infusion (140 mcg/kg/min for 3-6 min). A Sequoia 256, Acuson-Siemens, was used. Contrast was used when necessary (Levovist 300 mg/ml solution at a rate of 0,5-1 ml/min). Max coronary flow diastolic velocity post-/pre-test ≥2 was considered normal CFR. Results Coronary arteriography revealed patency of both branches of Y-G after six months. Accuracy of TTE was 100% for LAD and 85% for LCx. Feasibility was 100% for LAD and 85% for LCx. CFR improved from baseline in LAD (2.21 ± 0.5 to 2.6 ± 0.5, p = 0.03) and in LCx (1.7 ± 1 to 2.12 ± 1, p = 0.05). CFR was under normal at baseline in 30% of patients vs 8% after six months in LAD (p = 0.027), and in 69% of patients vs 30% after six months in LCx (p = 0.066). Conclusion CFR in Y-G is sometimes reduced in both left territories postoperatively but it improves at six months follow-up. A follow-up can be done non-invasively by TTE and CFR evaluation. PMID:20716357
Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.
Carroll, Allyson L; Sillett, Stephen C; Kramer, Russell D
2014-01-01
Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI) helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE) have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood species have
Llorens, Laura; Osborne, Colin P.; Beerling, David J.
2009-01-01
Background and Aims During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO2-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO2] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO2] reduces plant water use over the growing season. Methods Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) ‘living fossil’ coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69°N) conditions at either ambient (400 µmol mol−1) or elevated (800 µmol mol−1) [CO2]. Key Results Stimulation of whole-plant WUE (WUEP) by CO2 enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUEL) and δ13C of foliage (tWUEL). This response was driven largely by increased rates of carbon uptake, because there was no overall CO2 effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUEL differed from those measured for iWUEL. The results suggest caution against over simplistic interpretations of WUEP based on leaf isotopic composition. Conclusions The data suggest that the efficiency of whole-tree water use may be improved by CO2 enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO2 in the living fossil species investigated. PMID:19447810
Lefebvre, Jean-Pierre; Ouillon, Sylvain; Vinh, Vu Duy; Arfi, Robert; Panché, Jean-Yves; Mari, Xavier; Van Thuoc, Chu; Torréton, Jean-Pascal
2012-04-01
In the Bach Dang-Cam Estuary, northern Vietnam, mechanisms governing cohesive sediment aggregation were investigated in situ in 2008-2009. As part of the Red River delta, this estuary exhibits a marked contrast in hydrological conditions between the monsoon and dry seasons. The impact on flocculation processes was assessed by means of surveys of water discharge, suspended particulate matter concentration and floc size distributions (FSDs) conducted during a tidal cycle at three selected sites along the estuary. A method was developed for calculating the relative volume concentration for the modes of various size classes from FSDs provided by the LISST 100X (Sequoia Scientific Inc.). It was found that all FSDs comprised four modes identified as particles/flocculi, fine and coarse microflocs, and macroflocs. Under the influence of the instantaneous turbulent kinetic energy, their proportions varied but without significant modification of their median diameters. In particular, when the turbulence level corresponded to a Kolmogorov microscale of less than ˜235 μm, a major breakup of flocs resulted in the formation of particles/flocculi and fine microflocs. Fluctuations in turbulence level were governed by seasonal variations in freshwater discharge and by the tidal cycle. During the wet season, strong freshwater input induced a high turbulent energy level that tended to generate sediment transfer from the coarser size classes (macroflocs, coarse microflocs) to finer ones (particles/flocculi and fine microflocs), and to promote a transport of sediment seawards. During the dry season, the influence of tides predominated. The turbulent energy level was then only episodically sufficiently high to generate transfer of sediment between floc size classes. At low turbulent energy, modifications in the proportions of floc size classes were due to differential settling. Tidal pumping produced a net upstream transport of sediment. Associated with the settling of sediment
Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.
Directory of Open Access Journals (Sweden)
Allyson L Carroll
Full Text Available Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood
Herbst, Elizabeth B; Unnikrishnan, Sunil; Wang, Shiying; Klibanov, Alexander L; Hossack, John A; Mauldin, Frank William
2017-02-01
The use of ultrasound imaging for cancer diagnosis and screening can be enhanced with the use of molecularly targeted microbubbles. Nonlinear imaging strategies such as pulse inversion (PI) and "contrast pulse sequences" (CPS) can be used to differentiate microbubble signal, but often fail to suppress highly echogenic tissue interfaces. This failure results in false-positive detection and potential misdiagnosis. In this study, a novel acoustic radiation force (ARF)-based approach was developed for superior microbubble signal detection. The feasibility of this technique, termed ARF decorrelation-weighted PI (ADW-PI), was demonstrated in vivo using a subcutaneous mouse tumor model. Tumors were implanted in the hindlimb of C57BL/6 mice by subcutaneous injection of MC38 cells. Lipid-shelled microbubbles were conjugated to anti-VEGFR2 antibody and administered via bolus injection. An image sequence using ARF pulses to generate microbubble motion was combined with PI imaging on a Verasonics Vantage programmable scanner. ADW-PI images were generated by combining PI images with interframe signal decorrelation data. For comparison, CPS images of the same mouse tumor were acquired using a Siemens Sequoia clinical scanner. Microbubble-bound regions in the tumor interior exhibited significantly higher signal decorrelation than static tissue (n = 9, P < 0.001). The application of ARF significantly increased microbubble signal decorrelation (n = 9, P < 0.01). Using these decorrelation measurements, ADW-PI imaging demonstrated significantly improved microbubble contrast-to-tissue ratio when compared with corresponding CPS or PI images (n = 9, P < 0.001). Contrast-to-tissue ratio improved with ADW-PI by approximately 3 dB compared with PI images and 2 dB compared with CPS images. Acoustic radiation force can be used to generate adherent microbubble signal decorrelation without microbubble bursting. When combined with PI, measurements of the resulting microbubble signal
Herbst, Elizabeth; Unnikrishnan, Sunil; Wang, Shiying; Klibanov, Alexander L.; Hossack, John A.; Mauldin, F. William
2016-01-01
Objectives The use of ultrasound imaging for cancer diagnosis and screening can be enhanced with the use of molecularly targeted microbubbles. Nonlinear imaging strategies such as pulse inversion (PI) and “contrast pulse sequences†(CPS) can be used to differentiate microbubble signal, but often fail to suppress highly echogenic tissue interfaces. This failure results in false positive detection and potential misdiagnosis. In this study, a novel Acoustic Radiation Force (ARF) based approach was developed for superior microbubble signal detection. The feasibility of this technique, termed ARF-decorrelation-weighted PI (ADW-PI), was demonstrated in vivo using a subcutaneous mouse tumor model. Materials and Methods Tumors were implanted in the hindlimb of C57BL/6 mice by subcutaneous injection of MC38 cells. Lipid-shelled microbubbles were conjugated to anti-VEGFR2 antibody and administered via bolus injection. An image sequence using ARF pulses to generate microbubble motion was combined with PI imaging on a Verasonics Vantage programmable scanner. ADW-PI images were generated by combining PI images with inter-frame signal decorrelation data. For comparison, CPS images of the same mouse tumor were acquired using a Siemens Sequoia clinical scanner. Results Microbubble-bound regions in the tumor interior exhibited significantly higher signal decorrelation than static tissue (n = 9, p < 0.001). The application of ARF significantly increased microbubble signal decorrelation (n = 9, p < 0.01). Using these decorrelation measurements, ADW-PI imaging demonstrated significantly improved microbubble contrast-to-tissue ratio (CTR) when compared to corresponding CPS or PI images (n = 9, p < 0.001). CTR improved with ADW-PI by approximately 3 dB compared to PI images and 2 dB compared to CPS images. Conclusions Acoustic radiation force can be used to generate adherent microbubble signal decorrelation without microbubble bursting. When combined with pulse inversion
Redwoods, restoration, and implications for carbon budgets
Madej, Mary Ann
2010-01-01
The coast redwoods (Sequoia sempervirens) of California have several unique characteristics that influence interactions between vegetation and geomorphic processes. Case studies, using a combination of in-channel wood surveys and an air photo inventory of landslides, illustrate current conditions in a redwood-dominated watershed undergoing restoration work, and the influence of wood loading and landslides on the carbon budget. Redwood trees have extremely large biomass (trunk wood volumes of 700 to 1000 m3) and are very decay-resistant; consequently, they have a large and persistent influence on in-channel wood loading. Large wood surveys indicate high wood loading in streams in uncut forests (0.3-0.5 m3/m2 of channel), but also show that high wood loading can persist in logged basin with unlogged riparian buffers because of the slow decay of fallen redwoods. Through a watershed restoration program, Redwood National Park increases in-channel wood loading in low-order streams, but the effectiveness of this technique has not yet been tested by a large flood. Another unique characteristic of redwood is its ability to resprout from basal burls after cutting, so that root strength may not decline as sharply following logging as in other types of forests. An air photo inventory of landslides following a large storm in 1997 indicated: 1) that in the Redwood Creek watershed the volume of material displaced by landslides in harvested areas was not related to the time elapsed since logging, suggesting that the loss of root strength was not a decisive factor in landslide initiation, 2) landslide production on decommissioned logging roads was half that of untreated roads, and 3) landslides removed an estimated 28 Mg of organic carbon/km2 from hillslopes. The carbon budget of a redwood-dominated catchment is dominated by the vegetative component, but is also influenced by the extent of mass movement, erosion control work, and in-channel storage of wood.
Concentration Measurements of Suspended Load using ADV with Influence of the Particle Size
Schwarzwälder, Kordula
2017-04-01
ADV backscatter data can be used under certain conditions to gain information about the concentrations of suspended loads. This was shown in many studies before (Fugate and Friedrichs 2002; Chanson et al 2008; Ha et al. 2009). This paper reports on a pre-study to investigate the influence of particle size on concentration measurements for suspended sediment load with ADV. The study was conducted in a flume in the Oskar-von-Miller-Institute using fresh water from a river including the natural suspended load. The ADV used in the experiments was a Vectrino Profiler (Nortek). In addition water samples were taken for TSS and TOC. For the measurements a surge was generated in the flume to ensure that also particles of larger size will be present in the water phase. The measurements and samples were taken during the whole surge event. Therefore we were able to find a good correlation between the backscatter data of the ADV and the TSS as well as TOC results. For the decreasing part of the flow event the concentration of TOC in the suspended load of the water phase is decreasing much slower than the TSS and results in a damped decrease of the backscatter values. This means that the results for concentration measurements might be slightly influenced by the size of the particles. Further evaluations of measurements conducted with a LISST SL (Sequoia) will be investigated to show the trend of the particle sizes during this process and fortify this result. David C. Fugate, Carl T. Friedrichs, Determining concentration and fall velocity of estuarine particle populations using ADV, OBS and LISST, Continental Shelf Research, Volume 22, Issues 11-13, 2002 H.K. Ha, W.-Y. Hsu, J.P.-Y. Maa, Y.Y. Shao, C.W. Holland, Using ADV backscatter strength for measuring suspended cohesive sediment concentration, Continental Shelf Research, Volume 29, Issue 10, 2009 Hubert Chanson, Maiko Takeuchi, Mark Trevethan, Using turbidity and acoustic backscatter intensity as surrogate measures of
Ma, Peter; Morisette, T.; Rodman, Ann; McClure, Craig; Pedelty, Jeff; Benson, Nate; Paintner, Kara; Most, Neal; Ullah, Asad; Cai, Weijie;
2007-01-01
The USGS and NASA, in conjunction with Colorado State University, George Mason University and other partners, have developed the Invasive Species Forecasting System (ISFS), a flexible tool that capitalizes on NASA's remote sensing resource to produce dynamic habitat maps of invasive terrestrial plant species across the United States. In 2006 ISFS was adopted to generate predictive invasive habitat maps to benefit noxious plant and fire management teams in three major National Park systems: The Greater Yellowstone Area (Yellowstone / Grand Tetons National Parks), Sequoia and Kings Canyon National Park, and interior Alaskan (between Denali, Gates of The Arctic and Yukon-Charley). One of the objectives of this study is to explore how the ISFS enhances decision support apparatus in use by National Park management teams. The first step with each park system was to work closely with park managers to select top-priority invasive species. Specific species were chosen for each study area based on management priorities, availability of observational data, and their potential for invasion after fire disturbances. Once focal species were selected, sources of presence/absence data were collected from previous surveys for each species in and around the Parks. Using logistic regression to couple presence/absence points with environmental data layers, the first round of ISFS habitat suitability maps were generated for each National Park system and presented during park visits over the summer of 2006. This first engagement provided a demonstration of what the park service can expect from ISFS and initiated the ongoing dialog on how the parks can best utilized the system to enhance their decisions related to invasive species control. During the park visits it was discovered that separate "expert opinion" maps would provide a valuable baseline to compare against the ISFS model output. Opinion maps are a means of spatially representing qualitative knowledge into a quantitative two
Sellars, S. L.; Gao, X.; Hsu, K. L.; Sorooshian, S.; McCabe-Glynn, S.
2014-12-01
Atmospheric Rivers (ARs), the large plumes of moisture transported from the tropics, impact many aspects of society in the Western U.S. When ARs make landfall, they are often associated with torrential rains, swollen rivers, flash flooding, and mudslides. We demonstrate that by viewing precipitation events associated with ARs as "objects", calculating their physical characteristics (mean intensity (mm/hr), speed (km/hr), etc.), assigning environmental characteristics (e.g. phase of the El Nino Southern Oscillation) for each system, and then performing empirical analyses, we can reveal interactions between different climate phenomena. To perform this analysis, we use a unique object oriented data set based on the gridded, satellite precipitation data from the Precipitation Estimation from Remotely Sensed Information using Artificial Neural Networks (PERSIANN) algorithm known as PERSIANN-CONNECT, for the period 3/2000 to 12/2010. The data is segmented into 4D objects (longitude, latitude, time and intensity). Each of the segmented precipitation systems is described by over 72 characteristics. A search of the PERSIANN-CONNECT database for all Western U.S. large-scale precipitation systems returns 626 systems. Out of the 626 large-scale precipitation systems, 200 occurred at the same time as documented Western U.S. land falling ARs (a list of ARs provided by Dr. Martin Ralph). Here we report the physical and environmental characteristics for these 200 storms including a comparison to the 426 non-AR storms. We also report results of an analysis of the δ18O measurements collected from Giant Forest, Sequoia National Park in the Southwestern Sierra Nevada Mountains (McCabe-Glynn et al., in prep.) for the 200 AR precipitation systems. For an overall assessment of the impacts of climate variability on all 626 precipitation systems, we focus on ENSO, and show that during El Nino/La Nina, as compared with Neutral phases of ENSO, the systems are larger (9505, 9097, vs. 6075km
Directory of Open Access Journals (Sweden)
Redactie KITLV
2003-01-01
Full Text Available -Philip D. Morgan, Marcus Wood, Blind memory: Visual representations of slavery in England and America 1780-1865. New York: Routledge, 2000. xxi + 341 pp. -Rosemarijn Hoefte, Ron Ramdin, Arising from bondage: A history of the Indo-Caribbean people. New York: New York University Press, 2000. x + 387 pp. -Flávio dos Santos Gomes, David Eltis, The rise of African slavery in the Americas. Cambridge: Cambridge University Press, 2000. xvii + 353 pp. -Peter Redfield, D. Graham Burnett, Masters of all they surveyed: Exploration, geography, and a British El Dorado. Chicago: University of Chicago Press, 2000. xv + 298 pp. -Bernard Moitt, Eugenia O'Neal, From the field to the legislature: A history of women in the Virgin Islands. Westport CT: Greenwood Press, 2001. xiii + 150 pp. -Allen M. Howard, Nemata Amelia Blyden, West Indians in West Africa, 1808-1880: The African Diaspora in reverse. Rochester NY: University of Rochester Press, 2000. xi + 258 pp. -Michaeline A. Crichlow, Kari Levitt, The George Beckford papers. Kingston: Canoe Press, 2000. lxxi + 468 pp. -Michaeline A. Crichlow, Audley G. Reid, Community formation; A study of the 'village' in postemancipation Jamaica. Kingston: Canoe Press, 2000. xvi + 156 pp. -Linden Lewis, Brian Meeks, Narratives of resistance: Jamaica, Trinidad, the Caribbean. Kingston: University of the West Indies Press, 2000. xviii + 240 pp. -Roderick A. McDonald, Bridget Brereton, Law, justice, and empire: The colonial career of John Gorrie, 1829-1892. Kingston: University of the West Indies Press, 1997. xx + 371 pp. -Karl Watson, Gary Lewis, White rebel: The life and times of TT Lewis. Kingston: University of the West Indies Press, 1999. xxvii + 214 pp. -Mary Turner, Armando Lampe, Mission or submission? Moravian and Catholic missionaries in the Dutch Caribbean during the nineteenth century. Göttingen, FRG: Vandenburg & Ruprecht, 2001. 244 pp. -O. Nigel Bolland, Anton L. Allahar, Caribbean charisma: Reflections on
Andrews, M. Y.; Palmer, B.; Leake, J. R.; Banwart, S. A.; Beerling, D. J.
2009-12-01
The rise of land plants in the Paleozoic is classically implicated as driving lower atmospheric CO2 levels through enhanced weathering of Ca and Mg bearing silicate minerals. However, this view overlooks the fact that plants coevolved with associated mycorrhizal fungi over this time, with many of the weathering processes usually ascribed to plants actually being driven by the combined activities of roots and mycorrhizal fungi. Here we present initial results from a novel mesocosm-scale laboratory experiment designed to allow investigation of plant-driven carbon flux and mineral weathering at different soil depths under ambient (400 ppm) and elevated (1500 ppm) atmospheric CO2. Four species of plants were chosen to address evolutionary trends in symbiotic mycorrhizal association and rooting depth on biologically driven silicate weathering under the different CO2 regimes. Gymnosperms were used to investigate potential differences in weathering capabilities of two fungal symbioses: Sequoia sempervirens and Metasequoia glyptostroboides (arbuscular mycorrhizal, AM) and Pinus sylvestris (ectomycorrhizal, EM), and the shallow rooted ancient fern, Osmunda regalis, used to provide a contrast to the three more deeply rooted trees. Plants were grown in a cylindrical mesocosm with four horizontal inserts at each depth. These inserts are a mesh-covered dual-core unit whereby an inner core containing silicate minerals can be rotated within an outer core. The mesh excludes roots from the cylinders allowing fungal-rock pairings to be examined at each depth. Each core contains either basalt or granite, each with severed (rotated cores) or intact (static cores) mycorrhizae. This system provides a unique opportunity to examine the ability of a plant to weather minerals with and without its symbiotic fungi. Preliminary results indicate marked differences in nutritional and water requirements, and response to elevated CO2 between the species. The bulk solution chemistries (p
Cenozoic plant diversity of Yunnan: A review
Directory of Open Access Journals (Sweden)
Yongjiang Huang
2016-12-01
Full Text Available Yunnan in southwestern China is renowned for its high plant diversity. To understand how this modern botanical richness formed, it is critical to investigate the past biodiversity throughout the geological time. In this review, we present a summary on plant diversity, floristics and climates in the Cenozoic of Yunnan and document their changes, by compiling published palaeobotanical sources. Our review demonstrates that thus far a total of 386 fossil species of ferns, gymnosperms and angiosperms belonging to 170 genera within 66 families have been reported from the Cenozoic, particularly the Neogene, of Yunnan. Angiosperms display the highest richness represented by 353 species grouped into 155 genera within 60 families, with Fagaceae, Fabaceae, Lauraceae and Juglandaceae being the most diversified. Most of the families and genera recorded as fossils still occur in Yunnan, but seven genera have disappeared, including Berryophyllum, Cedrelospermum, Cedrus, Palaeocarya, Podocarpium, Sequoia and Wataria. The regional extinction of these genera is commonly referred to an aridification of the dry season associated with Asian monsoon development. Floristic analyses indicate that in the late Miocene, Yunnan had three floristic regions: a northern subtropical floristic region in the northeast, a subtropical floristic region in the east, and a tropical floristic region in the southwest. In the late Pliocene, Yunnan saw two kinds of floristic regions: a subalpine floristic region in the northwest, and two subtropical floristic regions separately in the southwest and the eastern center. These floristic concepts are verified by results from our areal type analyses which suggest that in the Miocene southwestern Yunnan supported the most Pantropic elements, while in the Pliocene southwestern Yunnan had abundant Tropical Asia (Indo–Malaysia type and East Asia and North America disjunct type that were absent from northwestern Yunnan. From the late Miocene to
Forest Resources of the Caucasian Black Sea Coast: Problems and Prospects of Rational Use
Directory of Open Access Journals (Sweden)
S. M. Bebia
2015-02-01
Full Text Available More than 70 % of the Caucasian Black Sea Coast (CBSC forests grow in mountainous conditions of the Colchis phytogeographical province and perform primary environmental functions. In these forests for a long period of time excessively intense logging has been in practice, which caused serious damage to their health. The main issues of forestry here are the introduction of effective methods of harvesting, using rational technology in logging operations, restoring native forest types at past logging sites, increasing the productivity and sustainability of forests on the bioecological biogeocenotical level, and preserving the riparian-protective role of forests. In the article, the author analyzes the results of many years of research in forests of the CBSC, that consider the question of condition of forests, peculiarity the multifunctional values and priority direction forestry in them. The author also considers the basic conformity of structure and com-position of forest stands, and presents evidence about the natural renewal of logging sites in fir and beech forests. It has been established that high intensity selective logging more than 50 % canopy cover and bringing the stand after logging 0.5 and below leads to degradation of forests, except for the possibility of natural regeneration felling areas for over 70 years. The study substantiates the effectiveness of selective forms of forest management in the uneven-aged stands and the importance of a multi-purpose and sustainable use of forest resources. The study emphasizes the need for a rational technology of logging operations and silvicultural demands strict compliance with the development of cutting areas and suggests ways to improve the productivity of forests, using introduced valuable tree species. For example, Sequoia sempervirens Endl. in the plantings of forest monocultures on the Abkhazian Research Forest Experimental Station (Ochamchira at age of 50 years forms a valuable timber of
Documenter le futur: fantasmes, projections et decalages spatiotemporels
Directory of Open Access Journals (Sweden)
Alice Forge
2015-10-01
Full Text Available Le concept de documentation future recèle un paradoxe : le mot documenter renvoie à des traces relevées dans un passé factuel, tandis que le futur ne peut, par définition, être qu’incertain, que l’objet de fantasmes, de projections. L’analyse suivante questionne ce paradoxe à travers l’analyse d’un motif cinématographique : un homme et une femme face à une tranche de séquoia, représentation symbolique du temps. Ce motif apparait dans trois oeuvres majeures du cinéma : Vertigo, d’Alfred Hitchcock, La Jetée de Chris Marker, et l’Armée des douze singes, de Terry Gilliam. La répétition de ce motif est mise en rapport avec l’ouvrage de Pierre Bayard, Le plagiat par anticipation, afin de l’envisager sous l’angle du paradoxe temporel, plutôt que sous le régime de la chronologie historique. Cette analyse prend pour point de départ une oeuvre intitulée Vozes Fantasmas, qui sur le principe de la documentation future propose d’écouter des murmures de spectateurs visitant une exposition qui n’a pas eu lieu. RESUMO O conceito de documentação do futuro evoca um paradoxo: o verbo documentar refere-se a traços ou rastros preservados de um passado factual, enquanto o futuro por definição é algo incerto, objeto de especulações, fantasias e projeções. Nossa reflexão questiona este paradoxo a partir da análise de uma cena cinematográfica: um homem e uma mulher em frente de um corte de sequoia, que é a representação simbólica do tempo. Esta cena aprece em três grandes obras do cinema: Vertigo (Um corpo que cai de Alfred Hitchcock, La Jetée de Chris Marker, e Os Doze Macacos de Terry Gilliam. A repetição desta cena é abordada em relação à obra de Pierre Bayard, Plágio por antecipação, a fim de considerá-la em termos de paradoxo temporal, e não como uma cronologia histórica. Esta análise tem como ponto de partida um trabalho artÃstico intitulado Vozes Fantasmas, que seguindo o princÃpio de
Directory of Open Access Journals (Sweden)
Rachel Benetti Queiroz Voltan
1996-01-01
Full Text Available Foi realizado um estudo de caracterização botânica em seis cultivares de morangueiro (Fragaria X ananassa Duch. quatro desenvolvidos no Brasil - 'Campinas (IAC-2712', 'Guarani (IAC-5074', 'AGF 080' e 'IAC Princesa Isabel' - e dois introduzidos - 'Reiko', do Japão, e 'Sequóia', dos Estados Unidos - visando sua distinção taxonômica. Os experimentos foram desenvolvidos na Estação Experimental de Monte Alegre do Sul (SP durante os anos agrÃcolas de 1992/93. Os caracteres morfológicos que se mostraram úteis na diferenciação dos seis cultivares foram os seguintes: tipo de planta; número de folÃolos; coloração da folha; razão entre o comprimento e a largura dos folÃolos medianos; ângulo da base do limbo do folÃolo mediano; comprimento das estipulas; posição das flores primárias em relação à folhagem; número de pétalas das flores primárias; razão entre o comprimento e a largura das pétalas; receptáculo do ovário; forma das infrutescências e da base da infrutescência; posição do cálice e calÃculo; espaços vazios no interior da infrutescência e comprimento e largura da infrutescência. Para a identificação dos cultivares, foi elaborada uma chave analÃtica. Os cultivares AGF 080 e Campinas não foram distinguidos com base nos caracteres analisados.Six strawberry cultivars (Fragaria X ananassa Duch., four developed in Brazil (AGF 080, Campinas, Guarani and IAC Princesa Isabel and two introduced (Reiko from Japan and Sequoia from USA were botanically evaluated in order to screening morphological vegetativa and reproductive characters to get the taxonomical distinction of them. Two experiments were carried out in 1992 and 1993 at the Experimental Station of Monte Alegre do Sul, Instituto Agronômico (IAC, State of São Paulo, Brazil. The following morphological characters were screened to distinguish the cultivars studied: growing habit; leaflet number; leaf colour; middle leaflet length and width ratio; middle
Fellers, Gary M.; Bradford, David F.; Pratt, David; Wood, Leslie
2008-01-01
In the late 1970s, Rana muscosa (mountain yellow-legged frog) was common in the Tableland area of Sequoia National Park, California where it was possible to find hundreds of tadpoles and adults around many of the ponds and lakes. Surveys in 1993-1995 demonstrated that R. muscosa was absent from more than half of all suitable habitat within the park, including the Tableland area. At that same time, R. muscosa was still common at Sixty Lake Basin, Kings Canyon National Park, 30 km to the northeast. To evaluate the potential causes for the extirpation, we repatriated R. muscosa eggs, tadpoles, subadults, and adult frogs from Sixty Lake Basin to four sites in the Tableland area in 1994 and 1995. We subsequently surveyed each release site and the surrounding area 2 - 3 times per week in 1994-1995, and intermittently in 1996-1997, to monitor the survival of all life history stages, and to detect dispersal of adults and subadults. We also monitored predation, water quality, weather, and water temperature. Our techniques for capturing, holding, transporting, and releasing R. muscosa were refined during the study, and during 1995 resulted in high initial survival rates of all life history stages. Adult frogs were anaesthetized, weighed, measured, tagged, and held in plastic boxes with wet paper towels. Tadpoles were collected and held in fiberglass screen cages set in the water at the edge of a pond. This resulted in relatively natural conditions with less crowding and good water circulation. Frogs, tadpoles, and eggs were placed in Ziploc bags for transport to the Tableland by helicopter. Short-term survival of tadpoles, subadults, and adults was high at all four release sites, tadpoles reached metamorphosis, and adult frogs were still present. However, we detected no evidence of reproduction at three sites (e.g., no new eggs or small tadpoles) and nearly all life history stages disappeared within 12 months. At the fourth site, there was limited reproduction, but it was
FOREWORD: VI Workshop in Electron Volt Neutron Spectroscopy: Frontiers and Horizons
Seel, A. G.; Senesi, R.; Fernandez-Alonso, F.
2014-12-01
January 2014 saw the congregation in Abingdon (UK) of scientists from across the world, to discuss the current state and future of spectroscopy using epithermal neutrons. This meeting was the sixth in a series of workshops held in collaboration between the Science and Technology Facilities Council (UK) and the Consiglio Nazionale delle Ricerche (Italy), aimed at bringing together researchers with an interest in the use of electron-volt neutrons in spectroscopic studies [1]. This technique is termed Deep Inelastic Neutron Scattering (DINS), and also Neutron Compton Scattering (NCS) in reference to the analogy with Compton scattering of X-rays from electrons. In particular, this meeting centred jointly around experimentalists and theoreticians, formulating animated discussions as to the current overview of DINS and future horizons facing the field. The use of electron Volt neutrons for spectroscopic measurements dates back to the advent of proton-driven spallation neutron sources in the 1970s and 1980s. Following an initial scientific meeting in Los Alamos (USA) [2], the first two meetings in this series were held in Abingdon (UK) in 1995 and 1998, with subsequent meetings held in Santa Fe (USA) in 2005 [3], Oak Ridge National Laboratory (USA) in 2006 [4], and Rome, Italy; in 2010 [5]. The flagship instrument serving a continual user-programme for DINS measurements, and the main focus of this meeting, has been the VESUVIO spectrometer at ISIS [6, 7]. Subsequent instruments like SEQUOIA in the USA [8, 9] and a newer spectrometer in the Bariloche LINAC in Argentina [10, 11] have also been commissioned and began serving a growing user community. The availability of DINS measurements has extended the range of possible spectroscopic techniques that utilise neutrons into the kinematic region of high energy and momentum transfers, shown schematically in Figure 1. Spectroscopic instrument suites such as that of ISIS are thus able to probe processes on timescales across nine
McCabe-Glynn, Staryl
climate changes largely due to increased water vapor content in a warmer atmosphere. I also utilize precipitation data and isotopic analysis from precipitation samples collected weekly from near the cave site at Giant Forest, Sequoia National Park, California, from 2001 to 2011, to analyze climate mode patterns during extreme precipitation events and to construct an isotopic data base of precipitation samples. Composite maps indicate extreme precipitation weeks consist of a weaker Aleutian Low, coupled with a deep low pressure cell located northwest of California and enhanced subtropical moisture. I find extreme precipitation weeks occur more often during the La Nina phase and less during the positive Eastern Pacific (EP) phase or during the Central Pacific (CP) neutral phase at our site. Analyses of climate mode patterns and precipitation amounts indicate that when the negative Arctic Oscillation (AO), negative and neutral Pacific North American pattern (PNA), and positive Southern Oscillation Index (SOI) (La Nina) are in sync, the maximum amount of precipitation anomalies are distributed along the Western US. Additionally, the central or eastern Pacific location of El Nino Southern Oscillation sea surface temperature anomalies can further enhance predictive capabilities of the landfall location of extreme precipitation.
Sources of nitrogen deposition in Federal Class I areas in the US
Directory of Open Access Journals (Sweden)
H.-M. Lee
2016-01-01
Full Text Available It is desired to control excessive reactive nitrogen (Nr deposition due to its detrimental impact on ecosystems. Using a three-dimensional atmospheric chemical transport model, GEOS-Chem, Nr deposition in the contiguous US and eight selected Class I areas (Voyageurs (VY, Smoky Mountain (SM, Shenandoah (SD, Big Bend (BB, Rocky Mountain (RM, Grand Teton (GT, Joshua Tree (JT, and Sequoia (SQ is investigated. First, modeled Nr deposition is compared with National Trends Network (NTN and Clean Air Status and Trends Network (CASTNET deposition values. The seasonality of measured species is generally well represented by the model (R2 > 0.6, except in JT. While modeled Nr is generally within the range of seasonal observations, large overestimates are present in sites such as SM and SD in the spring and summer (up to 0.6 kg N ha month−1, likely owing to model high-biases in surface HNO3. The contribution of non-measured species (mostly dry deposition of NH3 to total modeled Nr deposition ranges from 1 to 55 %. The spatial distribution of the origin of Nr deposited in each Class I area and the contributions of individual emission sectors are estimated using the GEOS-Chem adjoint model. We find the largest role of long-range transport for VY, where 50 % (90 % of annual Nr deposition originates within 670 (1670 km of the park. In contrast, the Nr emission footprint is most localized for SQ, where 50 % (90 % of the deposition originates from within 130 (370 km. Emissions from California contribute to the Nr deposition in remote areas in the western US (RM, GT. Mobile NOx and livestock NH3 are found to be the major sources of Nr deposition in all sites except BB, where contributions of NOx from lightning and soils to natural levels of Nr deposition are significant (∼ 40 %. The efficiency in terms of Nr deposition per kg emissions of NH3-N, NOx-N, and SO2-S are also estimated. Unique seasonal features are found in JT (opposing
Troy, R. M.
2005-12-01
and functions may be integrated into a system efficiently, with minimal effort, and with an eye toward an eventual Computational Unification of the Earth Sciences. A fundamental to such systems is meta-data which describe not only the content of data but also how intricate relationships are represented and used to good advantage. Retrieval techniques will be discussed including trade-offs in using externally managed meta-data versus embedded meta-data, how the two may be integrated, and how "simplifying assumptions" may or may not actually be helpful. The perspectives presented in this talk or poster session are based upon the experience of the Sequoia 2000 and BigSur research projects at the University of California, Berkeley, which sought to unify NASA's Mission To Planet Earth's EOS-DIS, and on-going experience developed by Science Tools corporation, of which the author is a principal. NOTE: These ideas are most easily shared in the form of a talk, and we suspect that this session will generate a lot of interest. We would therefore prefer to have this session accepted as a talk as opposed to a poster session.
Uranium-lead isotopic ages from the Sierra Nevada Batholith, California
Chen, J.
1982-01-01
This study provides new information on the timing and distribution of Mesozoic magmatic events in the Sierra Nevada batholithic complex chiefly between 36° and 37°N. latitude. U-Pb ages have been determined for 133 zircon and 7 sphene separates from 82 samples of granitoid rocks. Granitoid rocks in this area range in age from 217 to 80 m.y. Triassic intrusions are restricted to the east side of the batholith; Jurassic plutons occur south of the Triassic plutons east of the Sierra Nevada, as isolated masses within the Cretaceous batholith, and in the western foothills of the range; Cretaceous plutons form a continuous belt along the axis of the batholith and occur as isolated masses east of the Sierra Nevada. No granitic intrusions were emplaced for 37 m.y. east of the Sierra Nevada following the end of Jurassic plutonism. However, following emplacement of the eastern Jurassic granitoids, regional extension produced a fracture system at least 350 km long into which the dominantly mafic, calc-alkalic Independence dike swarm was intruded 148 m.y. ago. The dike fractures probably represents a period of regional crustal extension caused by a redistribution of the regional stress pattern accompanying the Nevadan orogeny. Intrusion of Cretaceous granitic plutons began in large volume about 120 m.y. ago in the western Sierra Nevada and migrated steadily eastward for 40 m.y. at a rate of 2.7 mm/y. This slow and constant migration indicates remarkably uniform conditions of subduction with perhaps downward migration of parent magma generation or a slight flattening of the subduction zone. Such steady conditions could be necessary for the production of large batholithic complexes such as the Sierra Nevada. The abrupt termination of plutonism 80 m.y. ago may have resulted from an increased rate of convergence of the American and eastern Pacific plates and dramatic flattening of the subduction zone. U-Pb ages of the Giant Forest-alaskite sequence in Sequoia National Park are
Population dynamics of spotted owls in the Sierra Nevada, California
Blakesley, J.A.; Seamans, M.E.; Conner, M.M.; Franklin, A.B.; White, Gary C.; Gutierrez, R.J.; Hines, J.E.; Nichols, J.D.; Munton, T.E.; Shaw, D.W.H.; Keane, J.J.; Steger, G.N.; McDonald, T.L.
2010-01-01
The California spotted owl (Strix occidentalis occidentalis) is the only spotted owl subspecies not listed as threatened or endangered under the United States Endangered Species Act despite petitions to list it as threatened. We conducted a meta-analysis of population data for 4 populations in the southern Cascades and Sierra Nevada, California, USA, from 1990 to 2005 to assist a listing evaluation by the United States Fish and Wildlife Service. Our study areas (from N to S) were on the Lassen National Forest (LAS), Eldorado National Forest (ELD), Sierra National Forest (SIE), and Sequoia and Kings Canyon National Parks (SKC). These study areas represented a broad spectrum of habitat and management conditions in these mountain ranges. We estimated apparent survival probability, reproductive output, and rate of population change for spotted owls on individual study areas and for all study areas combined (meta-analysis) using model selection or model-averaging based on maximum-likelihood estimation. We followed a formal protocol to conduct this analysis that was similar to other spotted owl meta-analyses. Consistency of field and analytical methods among our studies reduced confounding methodological effects when evaluating results. We used 991 marked spotted owls in the analysis of apparent survival. Apparent survival probability was higher for adult than for subadult owls. There was little difference in apparent survival between male and female owls. Model-averaged mean estimates of apparent survival probability of adult owls varied from 0.811 ?? 0.021 for females at LAS to 0.890 ?? 0.016 for males at SKC. Apparent survival increased over time for owls of all age classes at LAS and SIE, for adults at ELD, and for second-year subadults and adults at SKC. The meta-analysis of apparent survival, which included only adult owls, confirmed an increasing trend in survival over time. Survival rates were higher for owls on SKC than on the other study areas. We analyzed data
Characteristics of subtropic karstic Dinaride Lake in its unstable geothectonic regime
Krstic, N.
2009-04-01
the brown coal. To WNW Charophyta algae were collected during mapping of the sheet Udbina (SokaÄ et al., 1976). Farther on, toward ESE, in Sinj (see fig. 1, bellow) only Alisma (swampy plant) seeds were determined (Mandić et al., 2008). Second part, is characterized by compensated calcium carbonate sedimentation (mostly lacustrine chalk up to 95% of CaCO3). In some places textures of subsurface lacustrine current are shown, like obstacle flow, therefore Lake should be deep in its central parts. Diverse Congeria genera are enough numerous. Charaophyta gyrogonites are present in lacustrine chalk 4m abowe the coal (key fossil Rabdochara langeri in Plevlja, Otilovići) but up the column are lacking while water becmome to deep and turbid. Thickness of sediments between two coals (brown and lignite) in the central depressions (Livno) amount 1.500 m (Kochansky & Sli\\vsković, 1980). Third part with its lignite coal belong to time of another tectonic push by Adriatic Plate. This time up to 17 lignite beds were counted (in Livno), many of them with tree trunks nearly 10m in diameter, fractured mainly in small parts, one extra large peace was 10m long. Between particular earthquakes must have elapsed several thousands of years to allow Sequoia and other trees to grow on hilly islands. Most of interbeds make different gastropods: numerous well preserved Hydrobiids and single shells of Planorbarius (key-genus for the swampy shoreline) completely pressed. Some white laminated interbeds are very light and it is not known if this is not a diatomite. Ostracode assemblages slighly differ from previous, maybe because the sediment has lesser CaCO3 component. No Charophyta algae are mentoned. Congeria in the limestone of Sarajevo regia belong to the sli\\vskovići species indicating high energy environment. To WNW, in the Bihać area numerous gastropods also indicate high energy water; opposite to them excelent preserved saltwater ostracodes (Krstić, 2000) like Chinometacypris