Sample records for sequoia sempervirens foliage
-
Directory of Open Access Journals (Sweden)
Chen Yu-Ting
2010-12-01
Full Text Available Abstract Background Restoration of rooting competence is important for rejuvenation in Sequoia sempervirens (D. Don Endl and is achieved by repeatedly grafting Sequoia shoots after 16 and 30 years of cultivation in vitro. Results Mass spectrometry-based proteomic analysis revealed three proteins that differentially accumulated in different rejuvenation stages, including oxygen-evolving enhancer protein 2 (OEE2, glycine-rich RNA-binding protein (RNP, and a thaumatin-like protein. OEE2 was found to be phosphorylated and a phosphopeptide (YEDNFDGNSNVSVMVpTPpTDK was identified. Specifically, the protein levels of OEE2 increased as a result of grafting and displayed a higher abundance in plants during the juvenile and rejuvenated stages. Additionally, SsOEE2 displayed the highest expression levels in Sequoia shoots during the juvenile stage and less expression during the adult stage. The expression levels also steadily increased during grafting. Conclusion Our results indicate a positive correlation between the gene and protein expression patterns of SsOEE2 and the rejuvenation process, suggesting that this gene is involved in the rejuvenation of Sequoia sempervirens.
-
Clonal Spread in Second Growth Stands of Coast Redwood, Sequoia sempervirens
Vladimir Douhovnikoff; Richard S. Dodd
2007-01-01
Coast redwood (Sequoia sempervirens) is one of the rare conifers to reproduce successfully through clonal spread. The importance of this mode of reproduction in stand development is largely unknown. Understanding the importance of clonal spread and the spatial structure of clones is crucial for stand management strategies that would aim to maximize...
-
Stephenson, Nathan L.; Das, Adrian J.; Ampersee, Nicholas J.; Cahill, Kathleen G.; Caprio, Anthony C.; Sanders, John E.; Williams, A. Park
2018-01-01
Hotter droughts – droughts in which unusually high temperatures exacerbate the effects of low precipitation – are expected to increase in frequency and severity in coming decades, challenging scientists and managers to identify which parts of forested landscapes may be most vulnerable. In 2014, in the middle of California’s historically unprecedented 2012–2016 hotter drought, we noticed apparently drought-induced foliage dieback in giant sequoias (Sequoiadendron giganteum Lindl. [Buchholz]) in Sequoia and Kings Canyon national parks, California. Characteristics of the dieback were consistent with a controlled process of drought-induced senescence: younger (distal) shoots remained green while older (proximal) shoots were preferentially shed. As part of an ongoing interdisciplinary effort to understand and map sequoia vulnerability to hotter droughts, we reviewed historical records for evidence of previous foliage dieback events, surveyed dieback along trail corridors in eight sequoia groves, and analyzed tree-ring data from a high- and a low-foliage-dieback area. In sharp contrast to the greatly elevated mortality of other coniferous species found at low and middle elevations, we estimate that <1% of sequoias died during the drought. Foliage dieback was notably elevated in 2014 – the most severe single drought year in our 122-year record – but much lower in subsequent years. We found no historical records of similar foliage dieback during previous droughts. Dieback in 2014 was highly variable both within and among groves, ranging from virtually no dieback in some areas to nearly 50% in others. Dieback was highest (1) at low elevations, probably due to higher temperatures, reduced snowpack, and earlier snowmelt; (2) in areas of low adult sequoia densities, which likely reflect intrinsically more stressful sites; and (3) on steep slopes, probably reflecting reduced water availability. Average sequoia ring widths were narrower at the high-dieback than the
-
Produção de painéis compensados fenólicos com lâminas de madeira de Sequoia sempervirens
Directory of Open Access Journals (Sweden)
Setsuo Iwakiri
Full Text Available Esta pesquisa teve como objetivo avaliar a qualidade dos painéis compensados multilaminados produzidos com lâminas de madeira de Sequoia sempervirens. Foram produzidos em laboratório compensados com cinco lâminas de 2,0 mm de espessura, coladas com resina fenol-formaldeído, com duas diferentes formulações: (A FF = 100; E = 5; CC = 5; A = 5, e (B FF = 100; E = 15; CC = 15; A = 15, e duas gramaturas: 280g/m² e 320 g/m². Os painéis foram prensados com pressão específica de 10 kgf/cm², temperatura de 130 ºC e tempo de prensagem de dez minutos. Foram avaliadas as propriedades de resistência da linha de cola aos esforços de cisalhamento e de flexão estática (módulo de elasticidade e módulo de ruptura, paralelo e perpendicular às fibras. De uma forma geral, as diferentes formulações de cola e gramaturas não afetaram significativamente as propriedades dos painéis, o que representa um aspecto importante sob o ponto de vista econômico. A resistência ao cisalhamento e a percentagem de falhas na madeira dos painéis produzidos com a formulação (B atenderam aos requisitos mínimos da norma EN 314-2 (1993 para painéis de uso externo. Os resultados indicam que as lâminas de Sequoia sempervirens podem ser utilizadas para compor o miolo de painéis compensados para uso externo.
-
Landscape-scale variation in canopy water content of giant sequoias during drought
Paz-Kagan, Tarin; Vaughn, Nicolas R.; Martin, Roberta E.; Brodrick, Philip G.; Stephenson, Nathan L.; Das, Adrian; Nydick, Koren R.; Asner, Gregory P.
2018-01-01
Recent drought (2012–2016) caused unprecedented foliage dieback in giant sequoias (Sequoiadendron giganteum), a species endemic to the western slope of the southern Sierra Nevada in central California. As part of an effort to understand and map sequoia response to droughts, we studied the patterns of remotely sensed canopy water content (CWC), both within and among sequoia groves in two successive years during the drought period (2015 and 2016). Our aims were: (1) to quantify giant sequoia responses to severe drought stress at a landscape scale using CWC as an indicator of crown foliage status, and (2) to estimate the effect of environmental correlates that mediate CWC change within and among giant sequoia groves. We utilized airborne high fidelity imaging spectroscopy (HiFIS) and light detection and ranging (LiDAR) data from the Carnegie Airborne Observatory to assess giant sequoia foliage status during 2015 and 2016 of the 2012–2016 droughts. A series of statistical models were generated to classify giant sequoias and to map their location in Sequoia and Kings Canyon National Parks (SEKI) and vicinity. We explored the environmental correlates and the spatial patterns of CWC change at the landscape scale. The mapped CWC was highly variable throughout the landscape during the two observation years, and proved to be most closely related to geological substrates, topography, and site-specific water balance. While there was an overall net gain in sequoia CWC between 2015 and 2016, certain locations (lower elevations, steeper slopes, areas more distant from surface water sources, and areas with greater climate water deficit) showed CWC losses. In addition, we found greater CWC loss in shorter sequoias and those growing in areas with lower sequoia stem densities. Our results suggest that CWC change indicates sequoia response to droughts across landscapes. Long-term monitoring of giant sequoia CWC will likely be useful for modeling and predicting their population
-
Martin, Roberta E.; Asner, Gregory P.; Francis, Emily; Ambrose, Anthony; Baxter, Wendy; Das, Adrian J.; Vaughn, Nicolas R.; Paz-Kagan, Tarin; Dawson, Todd E.; Nydick, Koren R.; Stephenson, Nathan L.
2018-01-01
California experienced severe drought from 2012 to 2016, and there were visible changes in the forest canopy throughout the State. In 2014, unprecedented foliage dieback was recorded in giant sequoia (Sequoiadendron giganteum) trees in Sequoia National Park, in the southern California Sierra Nevada mountains. Although visible changes in sequoia canopies can be recorded, biochemical and physiological responses to drought stress in giant sequoia canopies are not well understood. Ground-based measurements provide insight into the mechanisms of drought responses in trees, but are often limited to few individuals, especially in trees of tall stature such as giant sequoia. Recent studies demonstrate that remotely measured forest canopy water content (CWC) is a general indicator of canopy response to drought, but the underpinning leaf- to canopy-level causes of observed variation in CWC remain poorly understood. We combined field and airborne remote sensing measurements taken in 2015 and 2016 to assess the biophysical responses of giant sequoias to drought. In 49 study trees, CWC was related to leaf water potential, but not to the other foliar traits, suggesting that changes in CWC were made at whole-canopy rather than leaf scales. We found a non-random, spatially varying pattern in mapped CWC, with lower CWC values at lower elevation and along the outer edges of the groves. This pattern was also observed in empirical measurements of foliage dieback from the ground, and in mapped CWC across multiple sequoia groves in this region, supporting the hypothesis that drought stress is expressed in canopy-level changes in giant sequoias. The fact that we can clearly detect a relationship between CWC and foliage dieback, even without taking into account prior variability or new leaf growth, strongly suggests that remotely sensed CWC, and changes in CWC, are a useful measure of water stress in giant sequoia, and valuable for assessing and managing these iconic forests in drought.
-
Sapwood area - leaf area relationships for coast redwood
Stancioiu, P T; O'Hara, K L
2005-01-01
Coast redwood (Sequoia sempervirens (D. Don) Endl.) trees in different canopy strata and crown positions were sampled to develop relationships between sapwood cross-sectional area and projected leaf area. Sampling occurred during the summers of 2000 and 2001 and covered tree heights ranging from 7.7 to 45.2 m and diameters at breast height ranging from 9.4 to 92.7 cm. Foliage morphology varied greatly and was stratified into five types based on needle type (sun or shade) and twig color. A str...
-
Nydick, Koren R.; Stephenson, Nathan L.; Ambrose, Anthony R.; Asner, Gregory P.; Baxter, Wendy L.; Das, Adrian J.; Dawson, Todd E.; Martin, Roberta E.; Paz-Kagan, Tarin
2018-01-01
Hotter droughts are becoming more common as climate change progresses, and they may already have caused instances of forest dieback on all forested continents. Learning from hotter droughts, including where on the landscape forests are more or less vulnerable to these events, is critical to help resource managers proactively prepare for the future. As part of our Leaf to Landscape Project, we measured the response of giant sequoia, the world’s largest tree species, to the extreme 2012–2016 hotter drought in California. The project integrated leaf-level physiology measurements, crown-level foliage dieback surveys, and remotely sensed canopy water content (CWC) to shed light on mechanisms and spatial patterns in drought response. Here we summarize initial findings, present a conceptual model of drought response, and discuss management implications; details are presented in the other four articles of the special section on Giant Sequoias and Drought. Giant sequoias exhibited both leaf- and canopy-level responses that were effective in protecting whole-tree hydraulic integrity for the vast majority of individual sequoias. Very few giant sequoias died during the drought compared to other mixed conifer tree species; however, the magnitude of sequoia drought response varied across the landscape. This variability was partially explained by local site characteristics, including variables related to site water balance. We found that low CWC is an indicator of recent foliage dieback, which occurs when stress levels are high enough that leaf-level adjustments alone are insufficient for giant sequoias to maintain hydraulic integrity. CWC or change in CWC may be useful indicators of drought stress that reveal patterns of vulnerability to future hotter droughts. Future work will measure recovery from the drought and strengthen our ability to interpret CWC maps. Our ultimate goal is to produce giant sequoia vulnerability maps to help target management actions, such as
-
Coping with gravity: the foliar water relations of giant sequoia.
Williams, Cameron B; Reese Næsborg, Rikke; Dawson, Todd E
2017-10-01
In tall trees, the mechanisms by which foliage maintains sufficient turgor pressure and water content against height-related constraints remain poorly understood. Pressure-volume curves generated from leafy shoots collected crown-wide from 12 large Sequoiadendron giganteum (Lindley) J. Buchholz (giant sequoia) trees provided mechanistic insights into how the components of water potential vary with height in tree and over time. The turgor loss point (TLP) decreased with height at a rate indistinguishable from the gravitational potential gradient and was controlled by changes in tissue osmotica. For all measured shoots, total relative water content at the TLP remained above 75%. This high value has been suggested to help leaves avoid precipitous declines in leaf-level physiological function, and in giant sequoia was controlled by both tissue elasticity and the balance of water between apoplasm and symplasm. Hydraulic capacitance decreased only slightly with height, but importantly this parameter was nearly double in value to that reported for other tree species. Total water storage capacity also decreased with height, but this trend essentially disappeared when considering only water available within the typical range of water potentials experienced by giant sequoia. From summer to fall measurement periods we did not observe osmotic adjustment that would depress the TLP. Instead we observed a proportional shift of water into less mobile apoplastic compartments leading to a reduction in hydraulic capacitance. This collection of foliar traits allows giant sequoia to routinely, but safely, operate close to its TLP, and suggests that gravity plays a major role in the water relations of Earth's largest tree species. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
-
Estimating Leaf Water Potential of Giant Sequoia Trees from Airborne Hyperspectral Imagery
Francis, E. J.; Asner, G. P.
2015-12-01
Recent drought-induced forest dieback events have motivated research on the mechanisms of tree survival and mortality during drought. Leaf water potential, a measure of the force exerted by the evaporation of water from the leaf surface, is an indicator of plant water stress and can help predict tree mortality in response to drought. Scientists have traditionally measured water potentials on a tree-by-tree basis, but have not been able to produce maps of tree water potential at the scale of a whole forest, leaving forest managers unaware of forest drought stress patterns and their ecosystem-level consequences. Imaging spectroscopy, a technique for remote measurement of chemical properties, has been used to successfully estimate leaf water potentials in wheat and maize crops and pinyon-pine and juniper trees, but these estimates have never been scaled to the canopy level. We used hyperspectral reflectance data collected by the Carnegie Airborne Observatory (CAO) to map leaf water potentials of giant sequoia trees (Sequoiadendron giganteum) in an 800-hectare grove in Sequoia National Park. During the current severe drought in California, we measured predawn and midday leaf water potentials of 48 giant sequoia trees, using the pressure bomb method on treetop foliage samples collected with tree-climbing techniques. The CAO collected hyperspectral reflectance data at 1-meter resolution from the same grove within 1-2 weeks of the tree-level measurements. A partial least squares regression was used to correlate reflectance data extracted from the 48 focal trees with their water potentials, producing a model that predicts water potential of giant sequoia trees. Results show that giant sequoia trees can be mapped in the imagery with a classification accuracy of 0.94, and we predicted the water potential of the mapped trees to assess 1) similarities and differences between a leaf water potential map and a canopy water content map produced from airborne hyperspectral data, 2
-
York, Robert A.; Stephenson, Nathan L.; Meyer, Marc; Hanna, Steve; Tadashi, Moody; Caprio, Anthony C.; Battles, John J.
2013-01-01
For natural resource managers in the southern Sierra Nevada, giant sequoia requires very little introduction. It receives great attention as an icon of western forests and as a common namesake with the areas where it occurs. While it is a single component of a very complex system, its attention in this assessment and in general is well deserved. Giant sequoia is one of the few "destination species" that attracts a wide swath of the public by nature of it simply being present. It draws people, who otherwise may not travel, to a natural environment. The result is an expansion of the public’s sense of natural resource stewardship. Because park managers could not achieve their mission without public support, this fostering role of giant sequoia is critical for park natural resources and is important for natural resources in general. Despite its social relevance and physical size, we re-emphasize here that the giant sequoia resource is a relatively small component of the ecosystems of the southern Sierra Nevada. As is the case with all of the resources assessed in the NRCA, we focus on giant sequoia with the understanding that other resources will be considered simultaneously when evaluating management decisions that impact giant sequoia. While we attempt to explicitly address the interaction of giant sequoia with other resources and stressors, we also realize that ultimately managers will integrate much more information than is presented here when making decisions that influence giant sequoia. The autecology and management issues surrounding giant sequoia have been thoroughly reviewed elsewhere (Harvey et al. 1980, Aune 1994, Stephenson 1996). Stephenson (1996), in particular, should be reviewed when considering any management decisions that potentially impact giant sequoia. For those who may not be familiar with giant sequoia ecology, a summary of basic information is provided in a table below. In some parts of this assessment, we reproduce text from Stephenson
-
Directory of Open Access Journals (Sweden)
Paolo Bellavite
2011-01-01
Full Text Available Gelsemium sempervirens is used in homeopathy for treating patients with anxiety related symptoms, however there have been few experimental studies evaluating its pharmacological activity. We have investigated the effects of homeopathic doses of G. sempervirens on mice, using validated behavioral models. Centesimal (CH dilutions/dynamizations of G. sempervirens, the reference drug diazepam (1 mg/kg body weight or a placebo (solvent vehicle were intraperitoneally delivered to groups of mice of CD1 strain during 8 days, then the effects were assessed by the Light-Dark (LD choice test and by the Open-Field (OF exploration test, in a fully blind manner. In the LD test, the mean time spent in the illuminated area by control and placebo-treated animals was 15.98%, for mice treated with diazepam it increased to 19.91% (P = .047, while with G. sempervirens 5 CH it was 18.11% (P = .341, non-significant. The number of transitions between the two compartments increased with diazepam from 6.19 to 9.64 (P < .001 but not with G. Sempervirens. In the OF test, G. sempervirens 5 CH significantly increased the time spent and the distance traveled in the central zone (P = .009 and P = .003, resp., while diazepam had no effect on these OF test parameters. In a subsequent series of experiments, G. sempervirens 7 and 30 CH also significantly improved the behavioral responses of mice in the OF test (P < .01 for all tested variables. Neither dilutions of G. sempervirens affected the total distance traveled, indicating that the behavioral effect was not due to unspecific changes in locomotor activity. In conclusion, homeopathic doses of G. sempervirens influence the emotional responses of mice to novel environments, suggesting an improvement in exploratory behavior and a diminution of thigmotaxis or neophobia.
-
Energy Technology Data Exchange (ETDEWEB)
Grulke, N.E.; Miller, P.R. (USDA Forest Service, Riverside, CA (United States))
Native stands of giant sequoia are being exposed to relatively high concentrations of atmospheric ozone produced in urban and agricultural areas upwind. The expected change in environmental conditions over the next 100 y is likely to be unprecendented in the life span (ca 2,500 y) of giant sequoia. Changes in the physiological responses of three age classes of giant sequoia (current year, 12 y and 25 y) to different concentrations of ozone were determined, and age-related differences in sensitivity to pollutants were assessed by examining physiological changes (gas exchange, water use efficiency) across the life span of giant sequoia. The CO[sub 2] exchange rate (CER) was greater in current year (12.1 [mu]mol CO[sub 2]/m[sup 2]s) and 2 year old seedlings (4.8 [mu]mol CO[sub 2]/m[sup 2]s) than in all older trees (average of 3.0 [mu]mol CO[sub 2]/m[sup 2]s). Dark respiration was highest for current year seedlings and was increased twofold in symptotic individuals exposed to elevated ozone concentrations. Stomatal conductance was greater in current-year and 2 year old seedlings (335 and 200 mmol H[sub 2]O/m[sup 2]s), respectively, than in all older trees (50 mmol H[sub 2]O/m[sup 2]s), indicating that the ozone concentration in substomatol cavities is higher in young seedlings than in older trees. Significant changes in water use efficiency occurred in trees between ages 5 and 20 years. It is concluded that giant sequoia seedlings are sensitive to atmospheric ozone until they are ca 5 y old. Low conductance, high water use efficiency, and compact mesophyll all contribute to a natural ozone tolerance, or defense, or both, in foliage of older trees. 11 refs., 1 fig., 1 tab.
-
Directory of Open Access Journals (Sweden)
Monika Strzałkowska-Abramek
2016-04-01
Full Text Available Ecological environment in urban areas is specific in many aspects. There are evidences that ornamental plants cultivated in local urban gardens may help in conservation of pollinators. In this study, the flowering pattern, the abundance of flowering, nectar and pollen production as well as insect visitation in Arabis procurrens Waldst. & Kit. and Iberis sempervirens L. were investigated. The species were grown in the UMCS Botanical Garden in Lublin, southeastern Poland. Arabis procurrens bloomed from the middle of April until middle of May and I. sempervirens from the end of April until middle of June. In both species, most flowers opened in the morning hours (40–45% of total were opened by 8:00 h GMT + 2 h. The average sugar yield of A. procurrens was ca. 53% lower compared to I. sempervirens (mean = 1.08 g/m2 and 2.32 g/m2, respectively. In both species, considerable differences in the amount of produced sugars were noted between years. The mass of pollen produced in the flowers of A. procurrens was approx. 35% lower compared to that of I. sempervirens (mean = 0.06 mg and 0.09 mg per flower, respectively. Pollen produced per unit area was correlated with the number of flowers. On average, the species produced 1.46 g (A. procurrens and 2.54 g (I. sempervirens of pollen per 1 m2. The flowers of A. procurrens attracted mainly dipterans (56.3% of total visitors, while I. sempervirens lured chiefly solitary bees (47.4% of total visitors, however in both cases, honeybees, bumblebees and lepidopterans were also recorded. The A. procurrens and I. sempervirens due to flowering in early spring period may be promoted for use in small gardens (rock or pot gardens for both aesthetic value and as plants that support insect visitors in nectar and pollen rewards.
-
Directory of Open Access Journals (Sweden)
Christine Venard
2011-01-01
Full Text Available Centesimal dilutions (5, 9 and 15 cH of Gelsemium sempervirens are claimed to be capable of exerting anxiolytic and analgesic effects. However, basic results supporting this assertion are rare, and the mechanism of action of G. sempervirens is completely unknown. To clarify the point, we performed a comparative analysis of the effects of dilutions 5, 9 and 15 cH of G. sempervirens or gelsemine (the major active principle of G. sempervirens on allopregnanolone (3α,5α-THP production in the rat limbic system (hippocampus and amygdala or H-A and spinal cord (SC. Indeed, H-A and SC are two pivotal structures controlling, respectively, anxiety and pain that are also modulated by the neurosteroid 3α,5α-THP. At the dilution 5 cH, both G. sempervirens and gelsemine stimulated [3H]progesterone conversion into [3H]3α,5α-THP by H-A and SC slices, and the stimulatory effect was fully (100% reproducible in all assays. The dilution 9 cH of G. sempervirens or gelsemine also stimulated 3α,5α-THP formation in H-A and SC but the reproducibility rate decreased to 75%. At 15 cH of G. sempervirens or gelsemine, no effect was observed on 3α,5α-THP neosynthesis in H-A and SC slices. The stimulatory action of G. sempervirens and gelsemine (5 cH on 3α,5α-THP production was blocked by strychnine, the selective antagonist of glycine receptors. Altogether, these results, which constitute the first basic demonstration of cellular effects of G. sempervirens, also offer interesting possibilities for the improvement of G. sempervirens-based therapeutic strategies.
-
Decomposition and N cycling changes in redwood forests caused by sudden oak death
Richard C. Cobb; David M. Rizzo
2012-01-01
Phytophthora ramorum is an emergent pathogen in redwood forests which causes the disease sudden oak death. Although the disease does not kill coast redwood (Sequoia sempervirens), extensive and rapid mortality of tanoak (Notholithocarpus densiflorus) has removed this...
-
Mark Spencer; Kevin O' Hara
2007-01-01
Phytophthora ramorum attacks tanoak (Lithocarpus densiflorus) in California and Oregon. We present a stand-level study examining the presence of disease symptoms in individual stems. Working with data from four plots in redwood (Sequoia sempervirens)/tanoak forests in Marin County, and three plots in Mendocino...
-
Gregory A. Guisti
2012-01-01
A standardized, interactive, interview process was used with practicing Registered Professional Foresters asking a suite of questions to ascertain their management approaches to coast redwood (Sequoia sempervirens [D. Don] Endl.) stands that could best be transferred to other projects and lands interested in recruiting older forest...
-
Sudden Oak Death in redwood forests: vegetation dynamics in the wake of tanoak decline
Benjamin Ramage; Kevin O’Hara
2010-01-01
Numerous lines of inquiry have concluded that tanoak (Lithocarpus densiflorus) will continue to experience drastic population declines and may even disappear entirely from redwood (Sequoia sempervirens) forests as a result of the exotic disease sudden oak death (SOD) (Maloney and others 2005, McPherson and others 2005,...
-
Lucy Kerhoulas; Nicholas Kerhoulas; Wade Polda; John-Pascal Berrill
2017-01-01
Reforestation following timber harvests is an important topic throughout the coast redwood (Sequoia sempervirens (D. Don) Endl.) range. Furthermore, as drought-induced mortality spreads across many of Californiaâs forests, it is important to understand how physiology and stand structure influence reforestation success. Finally, as climate...
-
Using wood quality measures to evaluate second-growth redwood
Stephen L. Quarles; Yana. Vlachovic
2012-01-01
Redwood (Sequoia sempervirens) a valued species for use in appearance grade applications, such as decking, exterior siding and interior paneling, because of its dimensional stability. It is also valued for certain exterior-use applications because of its natural decay resistance. Studies have found that young-growth redwood is less resistant to...
-
Natural seedlings and sprouts after regeneration cuttings in old-growth redwood
Kenneth N. Boe
1975-01-01
Natural regeneration of harvested old-growth stands of redwood (Sequoia sempervirens) is one way to start a new forest that is needed quickly for continuous timber production. Natural seedlings and sprouts developing after stands were cut were studied on the Redwood Experimental Forest, northern California. Three types of regeneration cuttings were...
-
Kyungrok Hwang; Han-sup Han; Susan E. Marshall; Deborah S. Page-Dumroese
2017-01-01
Cut-to-length (CTL) harvest systems have recently been introduced for thinning third-growth, young (<25 years old) redwood forests (Sequoia sempervirens (Lamb. ex D. Don) Endl.) in northern California. This type of harvesting can effective for thinning overstocked stands consisting of small-diameter trees. However, forestland managers and government agencies...
-
Predicting redwood productivity using biophysical data, spatial statistics and site quality indices
John-Pascal Berrill; Kevin L. O’Hara; Shawn Headley
2017-01-01
Coast redwood (Sequoia sempervirens (D. Don) Endl.) height growth and basal area growth are sensitive to variations in site quality. Site factors known to be correlated with redwood stand growth and yield include topographic variables such as position on slope, exposure, and the composite variable: topographic relative moisture index. Species...
-
Bark water uptake promotes localized hydraulic recovery in coastal redwood crown
J. Mason Earles; Or Sperling; Lucas C. R. Silva; Andrew J. McElrone; Craig R. Brodersen; Malcolm P. North; Maciej A. Zwieniecki
2015-01-01
Coastal redwood (Sequoia sempervirens), the worldâs tallest tree species, rehydrates leaves via foliar water uptake during fog/rain events. Here we examine if bark also permits water uptake in redwood branches, exploring potential flow mechanisms and biological significance. Using isotopic labelling and microCT imaging, we observed that water...
-
Rangewide Genetic Variation in Coast Redwood Populations at a Chloroplast Microsatellite Locus
Chris Brinegar
2012-01-01
Old growth and second growth populations of coast redwood (Sequoia sempervirens) were sampled at 10 locations throughout its range and analyzed at a highly variable chloroplast microsatellite locus. Very low FST values indicated that there was no significant genetic differentiation between adjacent old growth and second growth populations at each location. Genetic...
-
Cradle-to-gate life cycle impacts of redwood forest resource harvesting in northern California
Han-Sup Han; Elaine Oneil; Richard D. Bergman; Ivan L. Eastin; Leonard R. Johnson
2015-01-01
The first life cycle impact assessment for redwood (Sequoia sempervirens) forest management activities (i.e. a cradle-to-sawmill gate input) including the growing, harvesting, and hauling of redwood sawlogs to a sawmill was completed. In the stump-to-truck timber harvesting analysis, primary transport activities such as skidding and yarding consumed...
-
Biodegrading effects of some rot fungi on Pinus caribaea wood
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... species of white-rot fungi; Corioliopsis polyzona and Pleurotus squarrosulus, and two species of brown- rot fungi; Lentinus ... The results indicated that biodegradation by rot fungi differs in intensity according to the fungus ..... wood of coast red wood Sequoia Sempervirens (D. Don). For. Prod. J. 33(5): 15-20 ...
-
Inbreeding depression in selfs of redwood
W. J. Libby; B. G. McCutchan; C. I. Millar
1981-01-01
Given the polyploid chromosome constitution of Sequoia sempervirens, there was reason to question whether it would exhibit inbreeding depression. Preliminary results from studies of self and related outcross families are reported as a guide to the selection of trees for redwood seed orchards and breeding-orchards. The data indicate that, compared to...
-
Bat use of remnant old-growth redwood stands
William J. Zielinski; Steven T. Gellman
1999-01-01
Most of the old-growth redwood (Sequoia sempervirens) in Calfornia has been cut; regenerating forests will probably never resemble those that were harvested, and what old growth remains on private land occurs in small, isolated remnant patches. The landscapes in which these stands occur differ so markedly from their original condition that their...
-
Aspen Characteristics - Sequoia National Forest [ds377
California Natural Resource Agency — The database represents point locations and associated stand assessment data collected within aspen stands in the Cannell Meadows Ranger District, Sequoia National...
-
Aspen Delineation - Sequoia National Forest [ds378
California Natural Resource Agency — The database represents delineations of aspen stands associated with stand assessment data (SEQUOIA_NF_PTS) collected in aspen stands in the Cannell Meadows Ranger...
-
Post-fire response of coast redwood one year after the Mendocino lightning complex fires
Robert B. Douglas; Tom. Bendurel
2012-01-01
Coast redwood (Sequoia sempervirens) forests have undergone significant changes over the past century and are now in state more conducive for wildfires. Because fires have been uncommon in redwood forests over the past 80 years, managers have limited data to make decisions about the post-fire environment. In June 2008, a series of lightning storms...
-
R. Bergman; H. Sup-Han; E. Oneil; I. Eastin
2013-01-01
The goal of the study was to conduct a life-cycle inventory (LCI) of California redwood (Sequoia sempervirens) decking that would quantify the critical environmental impacts of decking from cradle to grave. Using that LCI data, a life-cycle assessment (LCA) was produced for redwood decking. The results were used to compare the environmental footprint...
-
Black bear damage to northwestern conifers in California: a review
Kenneth O. Fulgham; Dennis Hosack
2017-01-01
A total of 789 black bear damaged trees were investigate over a multi-year period on 14 different study sites chosen on lands of four participating timber companies. The sites ranged from 30 to 50 years of age. Four different conifer species were found to have black bear damage: coastal redwood (Sequoia sempervirens (D. Don) Endl.), Douglas-fir (...
-
Coast redwood live crown and sapwood
John-Pascal Berrill; Jesse L. Deffress; Jessica M. Engle
2012-01-01
Understanding crown rise and sapwood taper will help meet management objectives such as producing long branch-free boles for clear wood and old-growth restoration, or producing sawlogs with a high proportion of heartwood. Coast redwood (Sequoia sempervirens) tree crown ratio data were collected 20 years after partial harvesting in a 65-year-old second growth stand....
-
Directory of Open Access Journals (Sweden)
Magalis Bittner
2009-03-01
Full Text Available Components of essential oils from the Chilean Monimiaceae, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, and laurel (Laurelia sempervirens (Ruiz & Pav. Tul. were determined using Gas Chromatography- Mass Spectrometry (GCMS and fungistatic activity of the essential oils was tested against Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz G. Winter, and Fusarium oxysporum Schltdl. The essential oils of the Monimiaceae species shared some common components; all three had the 3-carene, α-phellandrene, and α-pinene terpenes. L. philippiana and L. sempervirens also had safrole.The main components were ascaridol in P. boldus oil, 3-carene in L. philippiana, and safrole in L. sempervirens. The essential oil from L. sempervirens showed the highest fungistatic activity with significant differences in dose as well as exposure. P. violaceum was the most sensitive strain and P. irregulare the most resistant of all the essential oils (P. boldus extract affected growth by only 19%. Therefore, essential oils from these three plants could be used to control the fungal strains studied.Se determinaron los compuestos de aceites esenciales de Monimiaceae chilenas, boldo (Peumus boldus Mol., tepa (Laureliopsis philippiana (Looser Schodde, y laurel (Laurelia sempervirens (Ruiz & Pav. Tul. a través de cromatografía de gas con espectrometría de masas (CG-EM y se midió la actividad fungistática de los aceites sobre los hongos Rhizoctonia solani Kühn (Donk, Pythium irregulare Buisman, Ceratocystis pilifera (Fr. C. Moreau, Phragmidium violaceum (Schultz Winter y Fusarium oxysporum Schltdl. Los aceites esenciales de las especies de Monimiaceae tienen algunos compuestos en común; en las especies estudiadas se encontró que todos tenían los terpenos 3-careno, α-felandreno, y α-pineno. L. philippiana y L. sempervirens además tienen safrol. En cambio
-
Visual Impacts of Prescribed Burning on Mixed Conifer and Giant Sequoia Forests
Lin Cotton; Joe R. McBride
1987-01-01
Prescribed burning programs have evolved with little concern for the visual impact of burning and the potential prescribed burning can have in managing the forest scene. Recent criticisms by the public of the prescribed burning program at Sequoia National Park resulted in an outside review of the National Park fire management programs in Sequoia, Kings Canyon, and...
-
Biological and Management Implications of Fire-Pathogen Interactions in the Giant Sequoia Ecosystem
Douglas D. Piirto; John R. Parmeter; Fields W. Cobb; Kevin L. Piper; Amy C. Workinger; William J. Otrosina
1998-01-01
An overriding management goal for national parks is the maintenance or, where necessary, the restoration of natural ecological processes. In Sequoia-Kings Canyon and Yosemite National Parks, there is concern about the effects of fire suppression on the giant sequoia-mixed conifer forest ecosystem. The National Park Service is currently using prescribed fire management...
-
Air pollution effects on giant sequoia ecosystems.
P.R. Miller; Nancy Grulke; K.W. Stolte
1994-01-01
Giant sequoia [Sequoiadendron giganteum (Lindl.) Buchholz] groves are found entirely within the Sierra Nevada mixed-conifer type. Several of its companion tree species, mainly ponderosa pine (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (P. jeffreyi Grev. & Balf.), show foliar injury after...
-
A Propagation Environment Modeling in Foliage
Directory of Open Access Journals (Sweden)
Samn SherwoodW
2010-01-01
Full Text Available Foliage clutter, which can be very large and mask targets in backscattered signals, is a crucial factor that degrades the performance of target detection, tracking, and recognition. Previous literature has intensively investigated land clutter and sea clutter, whereas foliage clutter is still an open-research area. In this paper, we propose that foliage clutter should be more accurately described by a log-logistic model. On a basis of pragmatic data collected by ultra-wideband (UWB radars, we analyze two different datasets by means of maximum likelihood (ML parameter estimation as well as the root mean square error (RMSE performance. We not only investigate log-logistic model, but also compare it with other popular clutter models, namely, log-normal, Weibull, and Nakagami. It shows that the log-logistic model achieves the smallest standard deviation (STD error in parameter estimation, as well as the best goodness-of-fit and smallest RMSE for both poor and good foliage clutter signals.
-
2013-11-05
... sequoia habitat, wetlands, and soundscapes within the Mariposa Grove, this alternative would relocate... for restoration of wetlands, soundscapes, and giant sequoia habitat within the Mariposa Grove by...
-
Potential sources of methylmercury in tree foliage
International Nuclear Information System (INIS)
Tabatchnick, Melissa D.; Nogaro, Géraldine; Hammerschmidt, Chad R.
2012-01-01
Litterfall is a major source of mercury (Hg) and toxic methylmercury (MeHg) to forest soils and influences exposures of wildlife in terrestrial and aquatic ecosystems. However, the origin of MeHg associated with tree foliage is largely unknown. We tested the hypothesis that leaf MeHg is influenced by root uptake and thereby related to MeHg levels in soils. Concentrations of MeHg and total Hg in deciduous and coniferous foliage were unrelated to those in soil at 30 urban and rural forested locations in southwest Ohio. In contrast, tree genera and trunk diameter were significant variables influencing Hg in leaves. The fraction of total Hg as MeHg averaged 0.4% and did not differ among tree genera. Given that uptake of atmospheric Hg 0 appears to be the dominant source of total Hg in foliage, we infer that MeHg is formed by in vivo transformation of Hg in proportion to the amount accumulated. - Highlights: ► Levels of methylmercury and total Hg in foliage were unrelated to those in soil. ► Methylmercury:total Hg ratio in leaves did not differ among nine tree genera. ► Hg in foliage varied inversely with trunk diameter, a proxy for respiration. ► Methylmercury in leaves may result from in vivo methylation of atmospheric Hg. - Methylmercury in tree foliage appears to result from in vivo methylation of mercury accumulated from the atmosphere.
-
2013-03-14
... Environmental Impact Statement for Restoration of the Mariposa Grove of Giant Sequoias, Yosemite National Park, Madera, and Mariposa Counties, CA AGENCY: National Park Service, Interior. ACTION: Notice of availability... the Mariposa Grove of giant sequoias in Yosemite National Park. This Draft EIS presents three...
-
On the occurrence of nuclei in mature sieve elements.
Event, R F; Davis, J D; Tucker, C M; Alfieri, F J
1970-12-01
The secondary phloem of 3 species of the Taxodiaceae and 13 species of woody dicotyledons was examined for the occurrence of nuclei in mature sieve elements. Nuclei were found in all mature sieve cells of Metasequoia glyptostroboides, Sequoia sempervirens and Taxodium distichum, and in some mature sieve-tube members in 12 of the 13 species of woody dicotyledons. Except for nuclei of sieve cells undergoing cessation of function, the nuclei in mature sieve cells of M. glyptostroboides, S. sempervirens and T. distichum were normal in appearance. The occurrence and morphology of nuclei in mature sieve-tube members of the woody dicotyledons were quite variable. Only 3 species, Robinia pseudoacacia, Ulmus americana and Vitis riparia, contained some mature sieve elements with apparently normal nuclei.
-
NUTRIENTS DIGESTIBILITY IN Tithonia diversifolia FOLIAGE IN FATTENING RABBITS
Directory of Open Access Journals (Sweden)
Duilio Nieves
2010-10-01
Full Text Available An experiment was carried out to determine the nutrients digestibility in Tithonia diversifolia foliage in fattening rabbits, 30 animals (1.450 g ± 93.77 initial body weight were distributed according to a completely randomized experimental design in three treatments and ten replicates. The mash diets including 0, 9 and 18 % of tithonia foliage. The dry matter (DMD, organic matter (OMD, crude protein (CPD, neutral detergent fiber (FDND, hemicellulose (HEMD and energy digestibilities (DE were determined using the acid insoluble ash method. The nutrient digestibility in foliage was estimated by the replacing test ingredient method. The DMD, OMD, PCD and HEMD (51.12, 53.45 and 51.25; 51.99, 54.87 and 52.60; 68.57, 60.11 and 64.08, and 44.20, 45.37 and 47.24 % for the three foliage inclusion level, respectively were similar (P>0.05 among diets. The foliage MSD, OMD, PCD, and ED DHEM was 53.80, 55.19, 59.17, 50.00 and 39.18%, while the protein and energy digestible content in tithonia foliage was 109.60 g/kg and 2139.45 kcal/kg. It was concluded that the tithonia foliage has high content of nutrients
-
Igarashi, Miho; Song, Chorong; Ikei, Harumi; Miyazaki, Yoshifumi
2015-01-01
Natural scenes like forests and flowers evoke neurophysiological responses that can suppress anxiety and relieve stress. We examined whether images of natural objects can elicit neural responses similar to those evoked by real objects by comparing the activation of the prefrontal cortex during presentation of real foliage plants with a projected image of the same foliage plants. Oxy-hemoglobin concentrations in the prefrontal cortex were measured using time-resolved near-infrared spectroscopy while the subjects viewed the real plants or a projected image of the same plants. Compared with a projected image of foliage plants, viewing the actual foliage plants significantly increased oxy-hemoglobin concentrations in the prefrontal cortex. However, using the modified semantic differential method, subjective emotional response ratings ("comfortable vs. uncomfortable" and "relaxed vs. awakening") were similar for both stimuli. The frontal cortex responded differently to presentation of actual plants compared with images of these plants even when the subjective emotional response was similar. These results may help explain the physical and mental health benefits of urban, domestic, and workplace foliage. © 2014 The Authors. Journal of Neuroimaging published by the American Society of Neuroimaging.
-
A computational model for biosonar echoes from foliage.
Directory of Open Access Journals (Sweden)
Chen Ming
Full Text Available Since many bat species thrive in densely vegetated habitats, echoes from foliage are likely to be of prime importance to the animals' sensory ecology, be it as clutter that masks prey echoes or as sources of information about the environment. To better understand the characteristics of foliage echoes, a new model for the process that generates these signals has been developed. This model takes leaf size and orientation into account by representing the leaves as circular disks of varying diameter. The two added leaf parameters are of potential importance to the sensory ecology of bats, e.g., with respect to landmark recognition and flight guidance along vegetation contours. The full model is specified by a total of three parameters: leaf density, average leaf size, and average leaf orientation. It assumes that all leaf parameters are independently and identically distributed. Leaf positions were drawn from a uniform probability density function, sizes and orientations each from a Gaussian probability function. The model was found to reproduce the first-order amplitude statistics of measured example echoes and showed time-variant echo properties that depended on foliage parameters. Parameter estimation experiments using lasso regression have demonstrated that a single foliage parameter can be estimated with high accuracy if the other two parameters are known a priori. If only one parameter is known a priori, the other two can still be estimated, but with a reduced accuracy. Lasso regression did not support simultaneous estimation of all three parameters. Nevertheless, these results demonstrate that foliage echoes contain accessible information on foliage type and orientation that could play a role in supporting sensory tasks such as landmark identification and contour following in echolocating bats.
-
Variations of Mercury Concentrations in American Beech Foliage over a Growing Season
Stinson, I.; Tsui, M. T. K.; Chow, A. T.
2017-12-01
Accumulation of atmospheric gaseous mercury (Hg) in foliage is well known, however, a small fraction of Hg always exists as highly bioavailable methylmercury (MeHg) in foliage but the source of MeHg in foliage is unknown. Recent studies suggested in-vivo Hg methylation in foliage while others suggested external inputs (e.g., precipitation) as sources of MeHg in foliage. This study assesses the accumulation of total Hg and MeHg within the foliage of a small sample set of American Beech trees, one of the common tree species in the east coast and the study site is located within the campus of University of North Carolina - Greensboro, over the growing season in 2017 (spring, summer, and fall). In addition, this study evaluates the Hg concentrations in foliage as related to other physiological parameters (e.g., stomatal density, leaf area, chlorophyll, and carbon/nitrogen content) and the changes in environmental characteristics (e.g., sunlight) over the growing season. For this investigation, five American Beech trees with varying characteristics (height, age, and location) were selected. On a biweekly basis, starting late April 2017, foliage samples were collected and composited from different positions on each tree. For the samples processed to date, our results indicate that total Hg accumulation is occurring for all five trees with an initial mean value of 5.79 ng/g, increasing to a mean value of 13.9 ng/g over a ten-week period. Coincidentally, there has been a similar increase in chlorophyll (a+b) concentrations for the foliage, and there is a strong, positive relationship between chlorophyll and total-Hg concentrations. However, we found no relationships between total Hg concentrations and stomatal density of foliage or carbon/nitrogen content. This study is still ongoing and will continue through the end of the growing season in 2017. Additionally, from the same sample sets, besides total Hg analysis and other ancillary parameters in foliage, MeHg analysis
-
Management of Giant Sequoia on Mountain Home Demonstration State Forest
Norman J. Benson
1986-01-01
Established in 1946, the Mountain Home Demonstration State Forest, Tulare County, California, is managed by the California Department of Forestry. It is a multiple-use forest with recreation as its primary focus, although timber management has always played an important role. Giant sequoia (Sequoiadendron giganteum [Lindl. ] Buchholz) occurs in...
-
Foliage efficiency of forest-forming species in the climatic gradients of Eurasia
Directory of Open Access Journals (Sweden)
V. A. Usoltsev
2017-08-01
Full Text Available The paperis of the scientific area of biogeography and devoted to a new aspect in the study of biological productivity of forest ecosystems on a geographical basis, expressed indirectly by climate parameters, namely, the foliage efficiency that until now is not investigated at the global level. Foliage efficiency is the ratio of net primary production (NPP to foliage biomass and is expressed in relative units. Some features of change of foliage efficiency of vicarious forest-forming species in Eurasian transcontinental gradients are showed for the first time using the voluminous factual material. The set of published biomass and NPP data (t/ha obtained in a number of 2192 plots is compiled. Using multiple regression analysis technique, the statistically significant changes in foliage efficiency values according to two transcontinental gradients, namely by zonal belts and continentality of climate, are stated for each forest-forming species. The species-specificity of age dynamics of stem volume and foliage efficiency is shown. It is monotonically decreased almost for all tree species in the following order: spruce and fir, pine, birch, oak, larch and aspen-poplar. When climate continentality increasing, foliage efficiency values of mature forests is dropping, most intensively in pines, less intensive in deciduous forests and virtually no changes in spruce-fir communities. In zonal gradient from the northern temperate to the subequatorial belt, foliage efficiency of deciduous species decreases, but it of the evergreen spruce and pine increases in the same direction. One of the possible causes of these opposite zonal trends of foliage efficiency in evergreen and deciduous species consists in different conditions of physiological processes in the year cycle, in particular, in year-round assimilates accumulation in the first and seasonal one in the second.
-
Communicating the role of science in managing giant sequoia groves
Douglas D. Pilrto; Robert R. Rogers; Mary Chislock Bethke
1997-01-01
Management of giant sequoia groves has been and continues to be a hotly debated issue. The debate has reached Congress, with all parties seeking resolution as to what constitutes an ecologically and publicly acceptable management approach. Determining the correct management approach and communicating that approach to the general public is the crux of the problem....
-
High-resolution 3D simulations of NIF ignition targets performed on Sequoia with HYDRA
Marinak, M. M.; Clark, D. S.; Jones, O. S.; Kerbel, G. D.; Sepke, S.; Patel, M. V.; Koning, J. M.; Schroeder, C. R.
2015-11-01
Developments in the multiphysics ICF code HYDRA enable it to perform large-scale simulations on the Sequoia machine at LLNL. With an aggregate computing power of 20 Petaflops, Sequoia offers an unprecedented capability to resolve the physical processes in NIF ignition targets for a more complete, consistent treatment of the sources of asymmetry. We describe modifications to HYDRA that enable it to scale to over one million processes on Sequoia. These include new options for replicating parts of the mesh over a subset of the processes, to avoid strong scaling limits. We consider results from a 3D full ignition capsule-only simulation performed using over one billion zones run on 262,000 processors which resolves surface perturbations through modes l = 200. We also report progress towards a high-resolution 3D integrated hohlraum simulation performed using 262,000 processors which resolves surface perturbations on the ignition capsule through modes l = 70. These aim for the most complete calculations yet of the interactions and overall impact of the various sources of asymmetry for NIF ignition targets. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.
-
A comparative study of modern and fossil cone scales and seeds of conifers: A geochemical approach
Artur, Stankiewicz B.; Mastalerz, Maria; Kruge, M.A.; Van Bergen, P. F.; Sadowska, A.
1997-01-01
Modern cone scales and seeds of Pinus strobus and Sequoia sempervirens, and their fossil (Upper Miocene, c. 6 Mar) counterparts Pinus leitzii and Sequoia langsdorfi have been studied using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS), electron-microprobe and scanning electron microscopy. Microscopic observations revealed only minor microbial activity and high-quality structural preservation of the fossil material. The pyrolysates of both modern genera showed the presence of ligno-cellulose characteristic of conifers. However, the abundance of (alkylated)phenols and 1,2-benzenediols in modern S. sempervirens suggests the presence of non-hydrolysable tannins or abundant polyphenolic moieties not previously reported in modern conifers. The marked differences between the pyrolysis products of both modern genera are suggested to be of chemosystematic significance. The fossil samples also contained ligno-cellulose which exhibited only partial degradation, primarily of the carbohydrate constituents. Comparison between the fossil cone scale and seed pyrolysates indicated that the ligno-cellulose complex present in the seeds is chemically more resistant than that in the cone scales. Principal component analysis (PCA) of the pyrolysis data allowed for the determination of the discriminant functions used to assess the extent of degradation and the chemosystematic differences between both genera and between cone scales and seeds. Elemental composition (C, O, S), obtained using electron-microprobe, corroborated the pyrolysis results. Overall, the combination of chemical, microscopic and statistical methods allowed for a detailed characterization and chemosystematic interpretations of modern and fossil conifer cone scales and seeds.
-
Within crown variation in the relationship between foliage biomass and sapwood area in jack pine.
Schneider, Robert; Berninger, Frank; Ung, Chhun-Huor; Mäkelä, Annikki; Swift, D Edwin; Zhang, S Y
2011-01-01
The relationship between sapwood area and foliage biomass is the basis for a lot of research on eco-phyisology. In this paper, foliage biomass change between two consecutive whorls is studied, using different variations in the pipe model theory. Linear and non-linear mixed-effect models relating foliage differences to sapwood area increments were tested to take into account whorl location, with the best fit statistics supporting the non-linear formulation. The estimated value of the exponent is 0.5130, which is significantly different from 1, the expected value given by the pipe model theory. When applied to crown stem sapwood taper, the model indicates that foliage biomass distribution influences the foliage biomass to sapwood area at crown base ratio. This result is interpreted as being the consequence of differences in the turnover rates of sapwood and foliage. More importantly, the model explains previously reported trends in jack pine sapwood area at crown base to tree foliage biomass ratio.
-
Foliage penetration radar detection and characterization of objects under trees
Davis, Mark
2011-01-01
This book covers all aspects of foliage penetration (FOPEN) radar, concentrating on both airborne military radar systems as well as earth resource mapping radars. It is the first concise and thorough treatment of FOPEN, covering the results of a decade-long investment by DARPA in characterizing foliage and earth surface with ultrawideband UHF and VHF synthetic aperture radar (SAR).
-
Multiyear impacts of partial throughfall exclusion on Buxus sempervirens in a Mediterranean forest
Energy Technology Data Exchange (ETDEWEB)
Rodriguez-Calcerrada, J.; Letts, M. G.; Rolo, V.; Roset, S.; Rambal, S.
2013-09-01
Aim of study:We examined the impact of sustained partial throughfall exclusion on the functional performance of Buxus sempervirens L. in the understory of a Mediterranean evergreen forest. We further considered whether any impacts of throughfall exclusion were affected by light availability. Area of study: The study was conducted in the south of France. Material and methods: Several leaf physiological and branch structural traits were measured along a light gradient after seven years from the onset of a throughfall exclusion experiment (TEE). The results were analysed along with annual growth and survival data. Main results: Plant mortality was nil in both the throughfall exclusion and control treatments. Stem diameter growth was reduced by 39% in plants subjected to throughfall exclusion, but this difference was only significant at the p = 0.10 significance level. Leaf physiology remained unaffected by the TEE, but small changes were evident in branch structural traits in high light microsites following throughfall exclusion; branches had lower wood density in the TEE plot, and more biomass was partitioned to leaves relative to stems. Research highlights: These changes do not seem to reflect an acclimatory response that would enhance drought tolerance. Instead, we suggest that these drought effects might exacerbate vulnerability to xylem cavitation in the more open microsites. Reduced growth and increased vulnerability to drought may indicate an incipient decline in plant vitality following TEE. The extension of observations to the whole-plant level and longer periods will elucidate the consequences of these observations for plant fitness, and permit verification of the positive effect of shade on Buxus sempervirens under increased drought. (Author)
-
Three-dimensional mapping of light transmittance and foliage distribution using lidar
International Nuclear Information System (INIS)
Todd, K.W.; Csillag, F.; Atkinson, P.M.
2003-01-01
The horizontal and vertical distributions of light transmittance were evaluated as a function of foliage distribution using lidar (light detection and ranging) observations for a sugar maple (Acer saccharum) stand in the Turkey Lakes Watershed. Along the vertical profile of vegetation, horizontal slices of probability of light transmittance were derived from an Optech ALTM 1225 instrument's return pulses (two discrete, 15-cm diameter returns) using indicator kriging. These predictions were compared with (i) below canopy (1-cm spatial resolution) transect measurements of the fraction of photosynthetically active radiation (FPAR) and (ii) measurements of tree height. A first-order trend was initially removed from the lidar returns. The vertical distribution of vegetation height was then sliced into nine percentiles and indicator variograms were fitted to them. Variogram parameters were found to vary as a function of foliage height above ground. In this paper, we show that the relationship between ground measurements of FPAR and kriged estimates of vegetation cover becomes stronger and tighter at coarser spatial resolutions. Three-dimensional maps of foliage distribution were computed as stacks of the percentile probability surfaces. These probability surfaces showed correspondence with individual tree-based observations and provided a much more detailed characterization of quasi-continuous foliage distribution. These results suggest that discrete-return lidar provides a promising technology to capture variations of foliage characteristics in forests to support the development of functional linkages between biophysical and ecological studies. (author)
-
Viewpoint-Driven Simplification of Plant and Tree Foliage
Directory of Open Access Journals (Sweden)
Cristina Gasch
2018-03-01
Full Text Available Plants and trees are an essential part of outdoor scenes. They are represented by such a vast number of polygons that performing real-time visualization is still a problem in spite of the advantages of the hardware. Some methods have appeared to solve this drawback based on point- or image-based rendering. However, geometry representation is required in some interactive applications. This work presents a simplification method that deals with the geometry of the foliage, reducing the number of primitives that represent these objects and making their interactive visualization possible. It is based on an image-based simplification that establishes an order of leaf pruning and reduces the complexity of the canopies of trees and plants. The proposed simplification method is viewpoint-driven and uses the mutual information in order to choose the leaf to prune. Moreover, this simplification method avoids the pruned appearance of the tree that is usually produced when a foliage representation is formed by a reduced number of leaves. The error introduced every time a leaf is pruned is compensated for if the size of the nearest leaf is altered to preserve the leafy appearance of the foliage. Results demonstrate the good quality and time performance of the presented work.
-
Foliage biomass qualitative indices of selected forest forming tree species in Ukrainian Steppe
Directory of Open Access Journals (Sweden)
Sytnyk Svitlana
2017-06-01
Full Text Available Our study objective was research on the assimilation component of aboveground biomass of trees and its correlation with mensurational indices of trees (age, diameter and height in stands of the main forest forming species in the Ukrainian Northern Steppe zone - Pinus sylvestris L. (Scots pine and Robinia pseudoacacia L. (Black locust. The research was carried out in forest stands subordinated to the State Agency of Forest Resources of Ukraine. We used experimental data collected on sample plots established during years 2014-2016. The main research results prove that the foliage share in the tree greenery biomass structure had a wide range of values. For both investigated species, a positive correlation was found between the dry matter content in the tree foliage and the tree age, height and diameter. The foliage share in tree greenery biomass decreased with increasing mensurational index values. Correlation analysis revealed linear relationships between the mensurational indices and the discussed aboveground live biomass parameters. The closest correlation was observed between the stand age, mean stand diameter, mean stand height and dry matter content in the foliage.
-
Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.
Midoro-Horiuti, T; Nouno, S; Seino, Y
1992-10-01
Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.
-
2011-12-02
... tree. Fire plays an important role in giant sequoia ecology, creating canopy openings and releasing soil nutrients needed for seedling establishment. Fire scars on the trees indicate that fires occurred... and sites within the Grove include the parking areas, gift shop, ticket booth, tram staging area...
-
Dissipation and distribution of chlorpyrifos in selected vegetables through foliage and root uptake.
Ge, Jing; Lu, Mengxiao; Wang, Donglan; Zhang, Zhiyong; Liu, Xianjin; Yu, Xiangyang
2016-02-01
Dissipation, distribution and uptake pathways of chlorpyrifos were investigated in pakchoi (Brassica chinensis L.) and lettuce (Lactuca sativa) with foliage treatments under a greenhouse trial and root treatments under a hydroponic experiment. The dissipation trends were similar for chlorpyrifos in pakchoi and lettuce with different treatments. More than 94% of chlorpyrifos was degraded in the samples for both of the vegetables 21 days after the foliage treatments. For the root treatment, the dissipation rate of chlorpyrifos in pakchoi and lettuce at the low concentration was greater than 93%, however, for the high concentrations, the dissipation rates were all under 90%. Both shoots and roots of the vegetables were able to absorb chlorpyrifos from the environment and distribute it inside the plants. Root concentration factor (RCF) values at different concentrations with the hydroponic experiment ranged from 5 to 39 for pakchoi, and from 14 to 35 for lettuce. The translocation factor (TF) representing the capability of the vegetables to translocate contaminants was significantly different for pakchoi and lettuce with foliage and root treatments. The values of TF with foliage treatments ranged from 0.003 to 0.22 for pakchoi, and from 0.032 to 1.63 for lettuce. The values of TF with root treatments ranged from 0.01 to 0.17 for pakchoi, and from 0.003 to 0.23 for lettuce. Significant difference of TF was found between pakchoi and lettuce with foliage treatments, and at high concentrations (10 and 50 mg L(-1)) with root treatments as well. However, there was no significant difference of TF between pakchoi and lettuce at 1 mg L(-1) with root treatment. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
G. Richard Strimbeck; Trygve D. Kjellsen; Paul G. Schaberg; Paula F. Murakami
2007-01-01
Because they maintain green foliage throughout the winter season, evergreen conifers may face special physiological challenges in a warming world. We assessed the midwinter low-temperature (LT) tolerance of foliage from eight temperate and boreal species in each of the genera Abies, Picea, and Pinus growing in an arboretum in...
-
Delgado, Denia Caridad; Galindo, Juana; González, Rogelio; González, Niurca; Scull, Idania; Dihigo, Luís; Cairo, Juan; Aldama, Ana Irma; Moreira, Onidia
2012-06-01
The aim of this paper was to present the main results obtained in Cuba on the effects of feeding tropical trees and shrubs on rumen methanogenesis in animals fed with low quality fibrous diets. More than 20 tree and shrub foliages were screened for phytochemicals and analyzed for chemical constituents. From these samples, seven promising plants (Samanea saman, Albizia lebbeck, Tithonia diversifolia, Leucaena leucocephala, Trichantera gigantea, Sapindus saponaria, and Morus alba) were evaluated for methane reduction using an in vitro rumen fermentation system. Results indicated that the inclusion levels of 25% of Sapindo, Morus, or Trichantera foliages in the foliages/grass mixtures (grass being Pennisetum purpureum) reduced (P lebbeck, or T. diversifolia accession 23 foliages when mixed at the rate of 30% in Cynodon nlemfuensis grass produced lower methane compared to the grass alone. Inclusion levels of 15% and 25% of a ruminal activator supplement containing 29% of L. leucocehala foliage meal reduced methane by 37% and 42% when compared to the treatment without supplementation. In vivo experiment with sheep showed that inclusion of 27% of L. leucocephala in the diet increased the DM intake but did not show significant difference in methane production compared to control diet without this foliage. The results of these experiments suggest that the feeding of tropical tree and shrub foliages could be an attractive strategy for reduction of ruminal methanogenesis from animals fed with low-quality forage diets and for improving their productivity.
-
Orange Is the New Green: Exploring the Restorative Capacity of Seasonal Foliage in Schoolyard Trees
Directory of Open Access Journals (Sweden)
Eli Paddle
2016-05-01
Full Text Available Urban schoolyard environments are increasingly characterized by a proliferation of hard surfaces with little if any greenery. Schoolyard “greening” initiatives are becoming increasingly popular; however, schoolyard designs often fail to realize their restorative potential. In this quasi-experimental study, a proposed schoolyard greening project was used to visualize alternative planting designs and seasonal tree foliage; these design alternatives were subsequently used as visual stimuli in a survey administered to children who will use the schoolyard to assess the perceived restorative capacity of different design features. The findings indicate that seasonal changes in tree foliage enhance the perceived restorative quality of schoolyard environments. Specifically, fall foliage colour, when compared to green foliage, is rated as being perceived to be equally restorative for children. Additionally, seasonal planting, including evergreen conifers, may enhance the restorative quality of the schoolyard especially when deciduous trees are leafless. Landscape design professionals, community-based organizations, and other decision-makers in schoolyard greening efforts should strategically consider their tree choices to maximize year-round support for healthy attention functioning in children through restoration.
-
Insects associated with tropical foliage produced in the coffee growing region of Colombia
Directory of Open Access Journals (Sweden)
Luis F. Aristizábal
2013-09-01
Full Text Available We conducted a survey of insects and pest management practices on 34 farms growing ornamental tropical foliage plants in the central coffee region of Colombia over two years. Tropical foliage provided habitat for a diverse range of insects. In total, phytophagous or detritivorous insects from six orders, 40 families and 62 genera were collected. The most common were Hemiptera (29 genera from 16 families, followed by Coleoptera (17 genera from 4 families, Diptera (5 genera from 5 families, Lepidoptera (5 genera from 4 families, Hymenoptera (3 genera from 2 families and Orthoptera (2 genera from 2 families. The most common phytophagous species were leaf cutting ants (Atta and Acromyrmex spp., leaf beetles (Chrysomelidae, leafhoppers (Cicadellidae, stinkbugs (Pentatomidae, squash bugs (Coreidae, tree hoppers (Membracidae and plant hoppers (Fulgoridae. Beneficial insects identified from tropical foliage included predators and parasitoids amongst 5 orders, 12 families and 22 genera. The most abundant were predators among the Coccinellidae, Chrysopidae, Reduviidae, Lycidae and Formicidae but only low numbers of parasitoids (Ichneumonidae, Braconidae and Tachinidae were collected. A pest management questionnaire given to growers revealed a preponderance of reliance on broad spectrum insecticides with a smaller number of growers (approximately one third also using some biological control methods. Our survey contributes basic information regarding diversity of Neotropical insects associated with ornamental foliage plants.
-
Xie, Y.; Wilson, A. M.
2017-12-01
Plant phenology studies typically focus on the beginning and end of the growing season in temperate forests. We know too little about fall foliage peak coloration, which is a bioindicator of plant response in autumn to environmental changes, an important visual cue in fall associated with animal activities, and a key element in fall foliage ecotourism. Spatiotemporal changes in timing of fall foliage peak coloration of temperate forests and the associated environmental controls are not well understood. In this study, we examined multiple color indices to estimate Land Surface Phenology (LSP) of fall foliage peak coloration of deciduous forest in the northeastern USA using Moderate Resolution Imaging Spectroradiometer (MODIS) daily imagery from 2000 to 2015. We used long term phenology ground observations to validate our estimated LSP, and found that Visible Atmospherically Resistant Index (VARI) and Plant Senescence Reflectance Index (PSRI) were good metrics to estimate peak and end of leaf coloration period of deciduous forest. During the past 16 years, the length of period with peak fall foliage color of deciduous forest at southern New England and northern Appalachian forests regions became longer (0.3 7.7 days), mainly driven by earlier peak coloration. Northern New England, southern Appalachian forests and Ozark and Ouachita mountains areas had shorter period (‒0.2 ‒9.2 days) mainly due to earlier end of leaf coloration. Changes in peak and end of leaf coloration not only were associated with changing temperature in spring and fall, but also to drought and heat in summer, and heavy precipitation in both summer and fall. The associations between leaf peak coloration phenology and climatic variations were not consistent among ecoregions. Our findings suggested divergent change patterns in fall foliage peak coloration phenology in deciduous forests, and improved our understanding in the environmental control on timing of fall foliage color change.
-
Bai, Cheng; Reilly, Charles C; Wood, Bruce W
2006-02-01
The existence of nickel (Ni) deficiency is becoming increasingly apparent in crops, especially for ureide-transporting woody perennials, but its physiological role is poorly understood. We evaluated the concentrations of ureides, amino acids, and organic acids in photosynthetic foliar tissue from Ni-sufficient (Ni-S) versus Ni-deficient (Ni-D) pecan (Carya illinoinensis [Wangenh.] K. Koch). Foliage of Ni-D pecan seedlings exhibited metabolic disruption of nitrogen metabolism via ureide catabolism, amino acid metabolism, and ornithine cycle intermediates. Disruption of ureide catabolism in Ni-D foliage resulted in accumulation of xanthine, allantoic acid, ureidoglycolate, and citrulline, but total ureides, urea concentration, and urease activity were reduced. Disruption of amino acid metabolism in Ni-D foliage resulted in accumulation of glycine, valine, isoleucine, tyrosine, tryptophan, arginine, and total free amino acids, and lower concentrations of histidine and glutamic acid. Ni deficiency also disrupted the citric acid cycle, the second stage of respiration, where Ni-D foliage contained very low levels of citrate compared to Ni-S foliage. Disruption of carbon metabolism was also via accumulation of lactic and oxalic acids. The results indicate that mouse-ear, a key morphological symptom, is likely linked to the toxic accumulation of oxalic and lactic acids in the rapidly growing tips and margins of leaflets. Our results support the role of Ni as an essential plant nutrient element. The magnitude of metabolic disruption exhibited in Ni-D pecan is evidence of the existence of unidentified physiological roles for Ni in pecan.
-
International Nuclear Information System (INIS)
Dimitrov, S.; Yovchev, M.; Geleva, E.
2010-01-01
For the purposes of environmental assessment of the area around the Research reactor in Sofia, species from monitored control points, selected in a certain way (habitat, population, air and hydrogeological parameters) are examined. Samples from following phytomonitored species: Betula pendula (silver birch) popullus canadensis (Canadian populus), Quercus sp. (Oak), Dactilus glomerata (Cock's-foot), Abies alba (Silver Fir) and Sequoia sempervirens (Coast Redwood) were analyzed. The total beta activity was determined by radiometric analysis and heavy metals content was measured using X-ray fluorescence analysis. The results are discussed in terms of radiation monitoring program of INRNE (gamma-background, aerosols, surface and groundwater, soil, plants) and obtained values are compared with reference points in the country
-
Simon, Edina; Braun, Mihály; Vidic, Andreas; Bogyó, Dávid; Fábián, István; Tóthmérész, Béla
2011-05-01
Foliage dust contains heavy metal that may have harmful effects on human health. The elemental contents of tree leaves and foliage dust are especially useful to assess air environmental pollution. We studied the elemental concentrations in foliage dust and leaves of Acer pseudoplatanus along an urbanization gradient in Vienna, Austria. Samples were collected from urban, suburban and rural areas. We analysed 19 elements in both kind of samples: aluminium, barium, calcium, copper, iron, potassium, magnesium, sodium, phosphor, sulphur, strontium and zinc. We found that the elemental concentrations of foliage dust were significantly higher in the urban area than in the rural area for aluminium, barium, iron, lead, phosphor and selenium. Elemental concentrations of leaves were significantly higher in urban than in rural area for manganese and strontium. Urbanization changed significantly the elemental concentrations of foliage dust and leaves and the applied method can be useful for monitoring the environmental load. Copyright © 2011 Elsevier Ltd. All rights reserved.
-
Factors affecting arsenic injury to lowbush blueberry foliage
Energy Technology Data Exchange (ETDEWEB)
Hall, I V; Lockhart, C L; Newbery, R J; Wood, G W
1971-01-01
In a laboratory study calcium arsenate dust applied at 70% relative humidity did not cause any appreciable injury to foliage of lowbush blueberry. At 90% relative humidity there was marked burning and considerable defoliation. There was no apparent difference in the amount of injury when the dust was applied at 8.9, 17.8, or 26.7 kg/ha.
-
Directory of Open Access Journals (Sweden)
Julia B. Althaus
2014-05-01
Full Text Available Buxus sempervirens L. (European Box, Buxaceae has been used in ethnomedicine to treat malaria. In the course of our screening of plant extracts for antiprotozoal activity, a CH2Cl2 extract from leaves of B. sempervirens showed selective in vitro activity against Plasmodium falciparum (IC50 = 2.79 vs. 20.2 µg/mL for cytotoxicity against L6 rat cells. Separation of the extract by acid/base extraction into a basic and a neutral non-polar fraction led to a much more active and even more selective fraction with alkaloids while the fraction of non-polar neutral constituents was markedly less active than the crude extract. Thus, the activity of the crude extract could clearly be attributed to alkaloid constituents. Identification of the main triterpene-alkaloids and characterization of the complex pattern of this alkaloid fraction was performed by UHPLC/+ESI-QTOF-MS analyses. ESI-MS/MS target-guided larger scale preparative separation of the alkaloid fraction was performed by ‘spiral coil-countercurrent chromatography’. From the most active subfraction, the cycloartane alkaloid O-tigloylcyclovirobuxeine-B was isolated and evaluated for antiplasmodial activity which yielded an IC50 of 0.455 µg/mL (cytotoxicity against L6 rat cells: IC50 = 9.38 µg/mL. O-tigloylcyclovirobuxeine-B is thus most significantly responsible for the high potency of the crude extract.
-
Experimental neuropharmacology of Gelsemium sempervirens: Recent advances and debated issues.
Bellavite, Paolo; Bonafini, Clara; Marzotto, Marta
Gelsemium sempervirens L. (Gelsemium) is traditionally used for its anxiolytic-like properties and its action mechanism in laboratory models are under scrutiny. Evidence from rodent models was reported suggesting the existence of a high sensitivity of central nervous system to anxiolytic power of Gelsemium extracts and Homeopathic dilutions. In vitro investigation of extremely low doses of this plant extract showed a modulation of gene expression of human neurocytes. These studies were criticized in a few commentaries, generated a debate in literature and were followed by further experimental studies from various laboratories. Toxic doses of Gelsemium cause neurological signs characterized by marked weakness and convulsions, while ultra-low doses or high Homeopathic dilutions counteract seizures induced by lithium and pilocarpine, decrease anxiety after stress and increases the anti-stress allopregnanolone hormone, through glycine receptors. Low (non-Homeopathic) doses of this plant or its alkaloids decrease neuropathic pain and c-Fos expression in mice brain and oxidative stress. Due to the complexity of the matter, several aspects deserve interpretation and the main controversial topics, with a focus on the issues of high dilution pharmacology, are discussed and clarified. Copyright © 2017 Transdisciplinary University, Bangalore and World Ayurveda Foundation. Published by Elsevier B.V. All rights reserved.
-
Directory of Open Access Journals (Sweden)
Juferi Idris
2013-01-01
Full Text Available The effectiveness of dragon fruit foliage as a natural coagulant for treatment of concentrated latex effluent was investigated and compared with ferric sulfate, a chemical coagulant. Dragon fruit is a round and often red-colored fruit with scales-like texture and is native to south American countries which is also cultivated and heavily marketed in southeast Asian countries. Its foliage represents a part of its overall plant system. Latex effluent is one of the main byproduct from rubber processing factories in Malaysia. Three main parameters investigated were chemical oxygen demand (COD, suspended solids (SS, and turbidity of effluent. Coagulation experiments using jar test were performed with a flocculation system where the effects of latex effluent pH as well as coagulation dosage on coagulation effectiveness were examined. The highest recorded COD, SS, and turbidity removal percentages for foliage were observed for effluent pH 10 at 94.7, 88.9, and 99.7%, respectively. It is concluded that the foliage showed tremendous potential as a natural coagulant for water treatment purposes. The foliage could be used in the pretreatment stage of Malaysian latex effluent prior to secondary treatment.
-
Further studies in using mangrove foliage as a prawn feed
Digital Repository Service at National Institute of Oceanography (India)
Sumitra-Vijayaraghavan; Wafar, S.
Changes in biochemical composition and energy content of foliage of eight mangrove species at various phases of life and during decay were studied. Decomposition resulted in loss of organic contents, carbon and C:N ratio and increase in calorific...
-
Directory of Open Access Journals (Sweden)
Seyed Jalal Modaresi
2016-11-01
Full Text Available Introduction This study was intended to evaluate the nutritional value, phenolic compounds and digestibility coefficients of barberry leaves. Berberis vulgaris is one of the major crops in the province. The province has more than 70 percent and 95 percent of the total area under cultivation of barberry. Waste and foliage of barberry harvest traditionally used to feed livestock Tannin concentration greater than 3 to 4 percent in food, can have negative effects on digestibility in ruminants and in particular to reduce the absorption of dietary protein. So it can be expected that high amounts of tannins within waste foliage of barberry reduce its efficiency in ruminants to be fed. Several studies have shown that the addition of certain compounds such as urea, polyethylene Due to the high volume of barberry foliage that remains after harvesting and the possibility of its use in animal nutrition, this study tried to determine some nutrient compounds, phenolic compounds and degradation parameters were barberry leaves. In addition, in this study to determine the best additives are effective in reducing the concentration of tannins and phenolic compounds, urea, polyethylene glycol, sodium hydroxide and calcium hydroxide were compared. Materials and method As the samples were dried by the sun for 6 days. The amount of 5% by weight (dry matter basis urea, polyethylene glycol, sodium hydroxide or calcium hydroxide that was prepared with distilled water, was sprayed on 5 kg of the sample and thoroughly mixed. Each of the treatments were prepared in triplicate. Treatments include: 1 control (foliage without additives, 2 foliage with 5% solution of urea, 3 foliage with 5% polyethylene glycol, 4 foliage with 5% sodium hydroxide, 5 with 5% calcium hydroxide was foliage. The sample were kept in anaerobic plastic containers for 3 days and then opened and dried at room temperature. Samples were analyzed for crude protein, neutral detergent fiber, acid detergent
-
Directory of Open Access Journals (Sweden)
Carmen Herrera-Rodríguez
2015-09-01
Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is one of most important pest of stored seeds worldwide, but its current control method is based on the use of synthetic insecticides, usually leading to undesirable problems such as insecticide residues on treated food, human intoxications, and insect resistance development. Therefore the search of friendly alternative methods is required. The aim of this study was to assess, under laboratory conditions, the insecticidal properties of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul., and Laureliopsis philippiana (Looser Schodde essential oils against S. zeamais. The phytochemical analysis of the three essential oils showed 1,8-cineole, safrole and methyleugenol as the common components; all of them documented with insecticidal activity from essential oils from other plant species. The highest toxicity (100% mortality of these three oils acting as a contact insecticide was observed at 24 h exposure at 4% concentration. The estimated LC50 values for P. boldus, L. sempervirens, and L. philippiana were 0.37, 1.02, and 0.28 μL g-1, respectively. Peumus boldus exhibited the highest fumigant activity with 100% adult mortality at 30 μL oil L-1 air. At ≥ 0.5% (v/w concentration, all essential oils showed repellent activity. These three essential oils showed a promissory insecticidal activity against the maize weevil.
-
Bai, Cheng; Reilly, Charles C.; Wood, Bruce W.
2006-01-01
The existence of nickel (Ni) deficiency is becoming increasingly apparent in crops, especially for ureide-transporting woody perennials, but its physiological role is poorly understood. We evaluated the concentrations of ureides, amino acids, and organic acids in photosynthetic foliar tissue from Ni-sufficient (Ni-S) versus Ni-deficient (Ni-D) pecan (Carya illinoinensis [Wangenh.] K. Koch). Foliage of Ni-D pecan seedlings exhibited metabolic disruption of nitrogen metabolism via ureide catabolism, amino acid metabolism, and ornithine cycle intermediates. Disruption of ureide catabolism in Ni-D foliage resulted in accumulation of xanthine, allantoic acid, ureidoglycolate, and citrulline, but total ureides, urea concentration, and urease activity were reduced. Disruption of amino acid metabolism in Ni-D foliage resulted in accumulation of glycine, valine, isoleucine, tyrosine, tryptophan, arginine, and total free amino acids, and lower concentrations of histidine and glutamic acid. Ni deficiency also disrupted the citric acid cycle, the second stage of respiration, where Ni-D foliage contained very low levels of citrate compared to Ni-S foliage. Disruption of carbon metabolism was also via accumulation of lactic and oxalic acids. The results indicate that mouse-ear, a key morphological symptom, is likely linked to the toxic accumulation of oxalic and lactic acids in the rapidly growing tips and margins of leaflets. Our results support the role of Ni as an essential plant nutrient element. The magnitude of metabolic disruption exhibited in Ni-D pecan is evidence of the existence of unidentified physiological roles for Ni in pecan. PMID:16415214
-
Monte Carlo simulation of the resolution volume for the SEQUOIA spectrometer
Directory of Open Access Journals (Sweden)
Granroth G.E.
2015-01-01
Full Text Available Monte Carlo ray tracing simulations, of direct geometry spectrometers, have been particularly useful in instrument design and characterization. However, these tools can also be useful for experiment planning and analysis. To this end, the McStas Monte Carlo ray tracing model of SEQUOIA, the fine resolution fermi chopper spectrometer at the Spallation Neutron Source (SNS of Oak Ridge National Laboratory (ORNL, has been modified to include the time of flight resolution sample and detector components. With these components, the resolution ellipsoid can be calculated for any detector pixel and energy bin of the instrument. The simulation is split in two pieces. First, the incident beamline up to the sample is simulated for 1 × 1011 neutron packets (4 days on 30 cores. This provides a virtual source for the backend that includes the resolution sample and monitor components. Next, a series of detector and energy pixels are computed in parallel. It takes on the order of 30 s to calculate a single resolution ellipsoid on a single core. Python scripts have been written to transform the ellipsoid into the space of an oriented single crystal, and to characterize the ellipsoid in various ways. Though this tool is under development as a planning tool, we have successfully used it to provide the resolution function for convolution with theoretical models. Specifically, theoretical calculations of the spin waves in YFeO3 were compared to measurements taken on SEQUOIA. Though the overall features of the spectra can be explained while neglecting resolution effects, the variation in intensity of the modes is well described once the resolution is included. As this was a single sharp mode, the simulated half intensity value of the resolution ellipsoid was used to provide the resolution width. A description of the simulation, its use, and paths forward for this technique will be discussed.
-
Brian J. Clough; Matthew B. Russell; Grant M. Domke; Christopher W. Woodall; Philip J. Radtke
2016-01-01
tEstimation of live tree biomass is an important task for both forest carbon accounting and studies of nutri-ent dynamics in forest ecosystems. In this study, we took advantage of an extensive felled-tree database(with 2885 foliage biomass observations) to compare different models and grouping schemes based onphylogenetic and geographic variation for predicting foliage...
-
Sampling strategies for efficient estimation of tree foliage biomass
Hailemariam Temesgen; Vicente Monleon; Aaron Weiskittel; Duncan Wilson
2011-01-01
Conifer crowns can be highly variable both within and between trees, particularly with respect to foliage biomass and leaf area. A variety of sampling schemes have been used to estimate biomass and leaf area at the individual tree and stand scales. Rarely has the effectiveness of these sampling schemes been compared across stands or even across species. In addition,...
-
An individual-based growth and competition model for coastal redwood forest restoration
van Mantgem, Phillip J.; Das, Adrian J.
2014-01-01
Thinning treatments to accelerate coastal redwood forest stand development are in wide application, but managers have yet to identify prescriptions that might best promote Sequoia sempervirens (Lamb. ex D. Don) Endl. (redwood) growth. The creation of successful thinning prescriptions would be aided by identifying the underlying mechanisms governing how individual tree growth responds to competitive environments in coastal redwood forests. We created a spatially explicit individual-based model of tree competition and growth parameterized using surveys of upland redwood forests at Redwood National Park, California. We modeled competition for overstory trees (stems ≥ 20 cm stem diameter at breast height, 1.37 m (dbh)) as growth reductions arising from sizes, distances, and species identity of competitor trees. Our model explained up to half of the variation in individual tree growth, suggesting that neighborhood crowding is an important determinant of growth in this forest type. We used our model to simulate the effects of novel thinning prescriptions (e.g., 40% stand basal area removal) for redwood forest restoration, concluding that these treatments could lead to substantial growth releases, particularly for S. sempervirens. The results of this study, along with continued improvements to our model, will help to determine spacing and species composition that best encourage growth.
-
Amri, Ismail; Hanana, Mohsen; Gargouri, Samia; Jamoussi, Bassem; Hamrouni, Lamia
2013-01-01
Maritime pine (Pinus pinaster Aiton) and Saharan cypress (Cupressus sempervirens L. var. dupreziana [A. Camus] Silba) are two cone-bearing seed coniferous woody plants. The chemical composition of their essential oils, isolated from needles and leaves by hydrodistillation, was analyzed with gas chromatography (GC) and gas chromatography mass spectrometry (GC/MS). A total of 66 and 28 compounds were identified, which represented 99.5% and 98.9% of total pine and cypress oils, respectively. Pin...
-
Ventura-Cordero, J; González-Pech, P G; Jaimez-Rodriguez, P R; Ortíz-Ocampo, G I; Sandoval-Castro, C A; Torres-Acosta, J F J
2017-01-01
It is important to determine whether gastrointestinal nematodes (GINs) affect foliage choice of goats leading to confirm the expression of a self-medication behavior. This study investigated the effect of GIN infection on tropical foliage selection by goats. During experimental stage 1 (10 days), goats had a natural mixed GIN infection, and at stage 2 (10 days), goats were treated with effective anthelmintics to maintain them free of GIN infection. During stage 1 the twelve adult goats (32 ± 2.3 kg live weight [LW]) were assigned to three groups (n = 4) according to their initial GIN infection status: HI group, with fecal egg count (FEC) between 1450 and 2150 eggs per g/feces (EPG); MI group, medium FEC (592-1167 EPG); and the NI group, free from GIN infection. Fresh foliage of four tropical plants were offered to goats ad libitum for 1 h daily: Gymnopodium floribundum (high condensed tannin [CT] content, 37-40 %), Mimosa bahamensis (medium CT content, 16-17 %), Leucaena leucocephala (low CT content, 3-5 %), and Viguiera dentata (negligible CT content, 0.6-0.9 %). Jacobs' selection indexes (JSIs) were estimated for the experimental foliage based on dry matter (DM), CT, or crude protein (CP) intake. During both study stages, individual fecal egg counts were estimated. The JSI patterns of different plant species, based on DM, CT, or CP, were similar irrespective of infection level during stage 1 (HI, MI, and NI) or no GIN infection (stage 2). Thus, irrespective of GIN infection, goats actively selected M. bahamensis (high CT, low CP content) and V. dentata (negligible CT, high CP content) but avoided G. floribundum (high CT, low CP content) and L. leucocephala (medium CT and high CP content). Thus, natural GIN infection did not influence goats' foliage selection.
-
Llorens, Laura; Osborne, Colin P; Beerling, David J
2009-07-01
During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO(2)-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO(2)] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO(2)] reduces plant water use over the growing season. Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) 'living fossil' coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69 degrees N) conditions at either ambient (400 micromol mol(-1)) or elevated (800 micromol mol(-1)) [CO(2)]. Stimulation of whole-plant WUE (WUE(P)) by CO(2) enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUE(L)) and delta(13)C of foliage (tWUE(L)). This response was driven largely by increased rates of carbon uptake, because there was no overall CO(2) effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUE(L) differed from those measured for iWUE(L). The results suggest caution against over simplistic interpretations of WUE(P) based on leaf isotopic composition. The data suggest that the efficiency of whole-tree water use may be improved by CO(2) enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO(2) in the living fossil species investigated.
-
Evaluation of bifenthrin barrier spray on foliage in a suburban eastern North Carolina neighborhood.
VanDusen, Amberlynne E; Richards, Stephanie L; Balanay, Jo Anne G
2016-05-01
Mosquitoes can transmit pathogens through blood feeding. Mosquito control programs conduct surveillance and source reduction, treat mosquito oviposition sites and spray adulticides to protect public health. In some areas, homeowners may contract with private mosquito control companies to address mosquito-related issues. We evaluated the efficacy of barrier sprays by comparing weekly host-seeking mosquito abundance at treatment and control properties in a residential neighborhood. The chemical concentration of bifenthrin residue on foliage was quantified, and field-collected mosquitoes, primarily Aedes albopictus, were tested for bifenthrin resistance using bottle bioassays. Mosquito abundance at treatment properties was significantly (P bifenthrin detected on foliage from treatment properties was not correlated with mosquito abundance. No bifenthrin resistance was detected in captured mosquitoes. Based on the rate of application, we expected that chemical analysis of bifenthrin residue would show similar concentrations of bifenthrin on foliage in treatment areas. Although mosquitoes were not bifenthrin resistant, further studies are needed to evaluate the extent to which resistance changes over time with repeated applications. Findings from this study provide insight into control methods commonly used by mosquito control companies and could potentially be used to guide future mosquito management strategies. © 2015 Society of Chemical Industry.
-
Directory of Open Access Journals (Sweden)
Avijit Dey
2017-02-01
Full Text Available Objective An experiment was conducted to examine the effect of dietary supplementation of dried and ground foliage of black gram (Vigna mungo L. on feed intake and utilization, and production performance of crossbred lactating cows. Methods Eighteen lactating crossbred (Bos taurus×Bos indicus cows (body weight 330.93± 10.82 kg at their second and mid lactation (milk yield 6.77±0.54 kg/d were randomly divided into three groups of six each in a completely randomized block design. Three supplements were formulated by quantitatively replacing 0, 50, and 100 per cent of dietary wheat bran of concentrate mixture with dried and ground foliage of black gram. The designated supplement was fed to each group with basal diet of rice straw (ad libitum to meet the requirements for maintenance and milk production. Daily feed intake and milk yield was recorded. A digestion trial was conducted to determine the total tract digestibility of various nutrients. Results The daily feed intake was increased (p0.05, the fibre digestibility was increased (p0.05 among the groups, milk yield was increased by 10 per cent with total replacement of wheat bran in concentrate mixture with of black gram foliage. The economics of milk production calculated as feed cost per kg milk yield (INR 10.61 vs 7.98 was reduced by complete replacement of wheat bran with black gram foliage. Conclusion Black gram foliage could be used as complete replacement for wheat bran in concentrate mixture of dairy cows in formulating least cost ration for economic milk production in small holders’ animal production.
-
George N. Steger; Thomas E. Munton; Kenneth D. Johnson; Gary P. Eberlein
2002-01-01
Nine years (1990â1998) of demographic data on California spotted owls (Strix occidentalis occidentalis) in two study areas on the western slopes of the Sierra Nevadaâone in the Sierra National Forest (SNF), the other in Sequoia/Kings Canyon National Parks (SNP)âare summarized. Numbers of territorial owls fluctuated from 85 to 50 in SNF and 80 to 58...
-
Mokany, Karel; McMurtrie, Ross E; Atwell, Brian J; Keith, Heather
2003-10-01
In native stands of Eucalyptus delegatensis R. T. Baker, sapwood area (As) to foliage area (Af) ratios (As:Af) decreased as tree height increased, contradicting the common interpretation of the Pipe Model Theory as well as the generally observed trend of increasing As:Af ratios with tree height. To clarify this relationship, we estimated sapwood hydraulic conductivity theoretically based on measurements of sapwood vessel diameters and Poiseuille's law for fluid flow through pipes. Despite the observed decrease in As:Af ratios with tree height, leaf specific conductivity increased with total tree height, largely as a result of an increase in the specific conductivity of sapwood. This observation supports the proposition that the stem's ability to supply foliage with water must increase as trees grow taller, to compensate for the increased hydraulic path length. The results presented here highlight the importance of measuring sapwood hydraulic conductivity in analyses of sapwood-foliage interactions, and suggest that measurements of sapwood hydraulic conductivity may help to resolve conflicting observations of how As:Af ratios change as trees grow taller.
-
Directory of Open Access Journals (Sweden)
Khuc Thi Hue
2012-12-01
Full Text Available The experiment studied the effect of harvesting frequencies and varieties on yield, chemical composition and hydrogen cyanide content in cassava foliage. Foliage from three cassava varieties, K94 (very bitter, K98-7 (medium bitter and a local (sweet, were harvested in three different cutting cycles, at 3, 6 and 9 months; 6 and 9 months and 9 months after planting, in a 2-yr experiment carried out in Hanoi, Vietnam. Increasing the harvesting frequency increased dry matter (DM and crude protein (CP production in cassava foliage. The K94 variety produced higher foliage yields than the other two varieties. Dry matter, neutral detergent fibre (NDF, acid detergent fibre (ADF and total tannin content increased with months to the first harvest, whereas CP content decreased. Hydrogen cyanide (HCN content was lower at the first harvest than at later harvests for all cutting cycles. At subsequent harvests the content of total tannins tended to decline, while HCN content increased (p<0.05. Chemical composition differed somewhat across varieties except for total tannins and ash. Dry matter, NDF, ADF and total tannins were higher in fully matured leaves, while CP and HCN were lower in developing leaves.
-
International Nuclear Information System (INIS)
Simon, Edina; Braun, Mihaly; Vidic, Andreas; Bogyo, David; Fabian, Istvan; Tothmeresz, Bela
2011-01-01
Foliage dust contains heavy metal that may have harmful effects on human health. The elemental contents of tree leaves and foliage dust are especially useful to assess air environmental pollution. We studied the elemental concentrations in foliage dust and leaves of Acer pseudoplatanus along an urbanization gradient in Vienna, Austria. Samples were collected from urban, suburban and rural areas. We analysed 19 elements in both kind of samples: aluminium, barium, calcium, copper, iron, potassium, magnesium, sodium, phosphor, sulphur, strontium and zinc. We found that the elemental concentrations of foliage dust were significantly higher in the urban area than in the rural area for aluminium, barium, iron, lead, phosphor and selenium. Elemental concentrations of leaves were significantly higher in urban than in rural area for manganese and strontium. Urbanization changed significantly the elemental concentrations of foliage dust and leaves and the applied method can be useful for monitoring the environmental load. - Highlights: → We studied the elements in dust and leaves along an urbanization gradient, Austria. → We analysed 19 elements: Al, Ba, Ca, Cd, Cu, Fe, K, Mg, Na, P, Pb, S, Sr and Zn. → Elemental concentrations were higher in urban area than in the rural area. → Studied areas were separated by CDA based on the elemental concentrations. → Dust and leaves can be useful for monitoring the environmental load. - Studying the elements (Al, Ba, Ca, Cu, Fe, K, Mg, Na, P, S, Sr, Zn) in dust and leaves along an urbanization gradient in Wien, Austria we found that the elemental concentrations of foliage dust were significantly higher in the urban area than in the rural area for Al, Ba, Fe, Pb, P and Se, and concentrations of leaves were significantly higher in urban than in rural area for Mn and Sr.
-
Energy Technology Data Exchange (ETDEWEB)
Simon, Edina, E-mail: edina.simon@gmail.com [Department of Ecology, University of Debrecen, H-4010 Debrecen, P.O. Box 71 (Hungary); Braun, Mihaly [Department of Inorganic and Analytical Chemistry, University of Debrecen, H-4010 Debrecen, P.O. Box 21 (Hungary); Vidic, Andreas [Department fuer Naturschutzbiologie, Vegetations- und Landschaftsoekologie, Universitat Wien, Althanstrasse 14, 1090 Wien (Austria); Bogyo, David [Department of Ecology, University of Debrecen, H-4010 Debrecen, P.O. Box 71 (Hungary); Fabian, Istvan [Department of Inorganic and Analytical Chemistry, University of Debrecen, H-4010 Debrecen, P.O. Box 21 (Hungary); Tothmeresz, Bela [Department of Ecology, University of Debrecen, H-4010 Debrecen, P.O. Box 71 (Hungary)
2011-05-15
Foliage dust contains heavy metal that may have harmful effects on human health. The elemental contents of tree leaves and foliage dust are especially useful to assess air environmental pollution. We studied the elemental concentrations in foliage dust and leaves of Acer pseudoplatanus along an urbanization gradient in Vienna, Austria. Samples were collected from urban, suburban and rural areas. We analysed 19 elements in both kind of samples: aluminium, barium, calcium, copper, iron, potassium, magnesium, sodium, phosphor, sulphur, strontium and zinc. We found that the elemental concentrations of foliage dust were significantly higher in the urban area than in the rural area for aluminium, barium, iron, lead, phosphor and selenium. Elemental concentrations of leaves were significantly higher in urban than in rural area for manganese and strontium. Urbanization changed significantly the elemental concentrations of foliage dust and leaves and the applied method can be useful for monitoring the environmental load. - Highlights: > We studied the elements in dust and leaves along an urbanization gradient, Austria. > We analysed 19 elements: Al, Ba, Ca, Cd, Cu, Fe, K, Mg, Na, P, Pb, S, Sr and Zn. > Elemental concentrations were higher in urban area than in the rural area. > Studied areas were separated by CDA based on the elemental concentrations. > Dust and leaves can be useful for monitoring the environmental load. - Studying the elements (Al, Ba, Ca, Cu, Fe, K, Mg, Na, P, S, Sr, Zn) in dust and leaves along an urbanization gradient in Wien, Austria we found that the elemental concentrations of foliage dust were significantly higher in the urban area than in the rural area for Al, Ba, Fe, Pb, P and Se, and concentrations of leaves were significantly higher in urban than in rural area for Mn and Sr.
-
Hailemariam, Samson; Urge, Mengistu; Menkir, Sissay
2016-02-01
The study was conducted to determine the effects of dried foliage of Acacia senegal and Neem (Azadirachta indica) tree supplementations on feed intake, nutrient digestibility, growth, and carcass parameters in short-eared Somali goats. Twenty male intact short-eared Somali goat yearlings with an average live weight of 16.2 ± 1.08 (Mean ± SD) were assigned to four treatment groups, which comprised a basal diet of hay alone (T1) and supplementation with the tree foliages. Supplements consisted Neem tree (T2), A. senegal (T3) and the mixture of the two (1:1 ratio; T4) dried foliages. The crude protein (CP) content of Neem tree foliage, A. senegal, and their mixture were 16.92, 17.5 and 17.01 % of dry matter (DM), respectively. Total DM intake and digestibility of DM and organic matter were significantly (P senegal (67 %). The final body weights were higher (P Senegal. An average daily body weight (BW) gain was higher (P senegal (8.3 kg) among the supplemented groups, all of which are higher than the control (4.9 kg). It is concluded that the supplementation with tree foliage, especially with A. senegal tree foliage, on grass hay encouraged a better utilization of nutrients and animal performance as compared to goats fed on a basal diet of grass hay only.
-
Park, Sin-Ae; Song, Chorong; Oh, Yun-Ah; Miyazaki, Yoshifumi; Son, Ki-Cheol
2017-09-20
The objective of this study was to compare physiological and psychological relaxation by assessing heart rate variability (HRV), prefrontal cortex activity, and subjective indexes while subjects performed a task with and without foliage plants. In a crossover experimental design, 24 university students performed a task transferring pots with and without a foliage plant for 3 min. HRV and oxyhemoglobin (oxy-Hb) concentration in the prefrontal cortex were continuously measured. Immediately thereafter, subjective evaluation of emotions was performed using a modified semantic differential (SD) method and a profile of mood state questionnaire (POMS). Results showed that the natural logarithmic (ln) ratio of low frequency/high frequency, as an estimate of sympathetic nerve activity, was significantly lower while performing the task with foliage plants for the average 3 min measurement interval. Oxy-Hb concentration in the left prefrontal cortex showed a tendency to decrease in the 2-3 min interval in the task with foliage plants compared to the task without plants. Moreover, significant psychological relaxation according to POMS score and SD was demonstrated when the task involved foliage plants. In conclusion, the task involving foliage plants led to more physiological and psychological relaxation compared with the task without foliage plants.
-
Jumeno, Desto; Matsumoto, Hiroshi
2015-02-01
Escalation of task demands and time pressures tends to make a worker run into work stress, which leads to mental fatigue and depression. The mental fatigue can be reduced when attention capacity is restored. Nature can serve as a source of fascination which can restore the attention capacity. People bring plants indoors so they can experience nature in their workplace. The stress and fatigue are also affected by air temperatures. The increase or decrease of temperatures from the comfort zone may induce the stress and fatigue. The objective of this study is to investigate the intervention of using foliage plants placed inside a building at different air temperature levels. The effects of foliage plants on human stress and fatigue were measured by human physiological responses such as heart rate, amylase level, electroencephalography (EEG), and the secondary task-reaction time. Several different tasks, namely typing, math and logical sequences are included in the investigation of these studies. Fifteen subjects, with the age ranged from 22 to 38 years old have participated in the study using within subject design. From the study, it is revealed that the presence of foliage plants at several temperatures have different effects on meditation, secondary task reaction time and typing accuracy. This study also revealed that the presence of plants on several types of tasks has different effects of attention which are useful for increasing work performance.
-
Halmagyi, A; Surducan, E; Surducan, V
2017-09-01
Two distinct microwave power levels and techniques have been studied in two cases: low-power microwave (LPM) irradiation on in vitro Sequoia plants and high-power microwave (HPM) exposure on recovery rates of cryostored (-196°C) Sequoia shoot apices. Experimental variants for LPM exposure included: (a) in vitro plants grown in regular conditions (at 24 ± 1°C during a 16-h light photoperiod with a light intensity of 39.06 μEm -2 s -1 photosynthetically active radiation), (b) in vitro plants grown in the anechoic chamber with controlled environment without microwave irradiation, and (c) in vitro plants grown in the anechoic chamber with LPM irradiation for various times (5, 15, 30, 40 days). In comparison to control plants, significant differences in shoot multiplication and growth parameters (length of shoots and roots) were observed after 40 days of LPM exposure. An opposite effect was achieved regarding the content of total soluble proteins, which decreased with increasing exposure time to LPM. HPM irradiation was tested as a novel rewarming method following storage in liquid nitrogen. To our knowledge, this is the first report using this type of rewarming method. Although, shoot tips subjected to HPM exposure showed 28% recovery following cryostorage compared to 44% for shoot tips rewarmed in liquid medium at 22 ± 1 °C, we consider that the method represent a basis and can be further improved. The results lead to the overall conclusion that LPM had a stimulating effect on growth and multiplication of in vitro Sequoia plants, while the HPM used for rewarming of cryopreserved apices was not effective to achieve high rates of regrowth after liquid nitrogen exposure.
-
Directory of Open Access Journals (Sweden)
Sin-Ae Park
2017-09-01
Full Text Available The objective of this study was to compare physiological and psychological relaxation by assessing heart rate variability (HRV, prefrontal cortex activity, and subjective indexes while subjects performed a task with and without foliage plants. In a crossover experimental design, 24 university students performed a task transferring pots with and without a foliage plant for 3 min. HRV and oxyhemoglobin (oxy-Hb concentration in the prefrontal cortex were continuously measured. Immediately thereafter, subjective evaluation of emotions was performed using a modified semantic differential (SD method and a profile of mood state questionnaire (POMS. Results showed that the natural logarithmic (ln ratio of low frequency/high frequency, as an estimate of sympathetic nerve activity, was significantly lower while performing the task with foliage plants for the average 3 min measurement interval. Oxy-Hb concentration in the left prefrontal cortex showed a tendency to decrease in the 2–3 min interval in the task with foliage plants compared to the task without plants. Moreover, significant psychological relaxation according to POMS score and SD was demonstrated when the task involved foliage plants. In conclusion, the task involving foliage plants led to more physiological and psychological relaxation compared with the task without foliage plants.
-
Energy Technology Data Exchange (ETDEWEB)
Waterhouse, M J; Armleder, H M; Dawson, R J
1991-01-01
In the interior of British Columbia, Douglas-fir litterfall is a major source of mule deer winter food. An earlier study found that preference for Douglas-fir foliage was correlated with tree diameter. This study identified the underlying factors of selection so that wildlife managers might have a wider range of forage enhancement options on mule deer winter range. Samples of Douglas-fir foliage were collected from trees at Knife Creek and Big Lake, and analyzed for minerals, tannins, and in vitro digestible dry matter.
-
Directory of Open Access Journals (Sweden)
Sahadev Sharma
2014-08-01
Full Text Available Background Progress of forest production in response to the environment requires a quantitative understanding of leaf area development. Therefore, it is necessary to investigate the dynamics of seasonal crown foliage in order to understand the productivity of mangroves, which play an important role in the subtropical and tropical coastlines of the world. Method Crown foliage dynamics of the mangrove Rhizophora stylosa were studies to reveal patterns of leaf recruitment, survival and seasonal leaf area growth. Results Flushing of leaves occurred throughout the year, but both flushing and leaf area growth pattern of leaves varied with season. Maximum flushing occurred in summer, but leaf areas did not differ significantly with season. The half-expansion period is longer, and the intrinsic rate of increase was lower in winter. Summer flushed leaves grew faster at their initial stage and reached their maximum area over a shorter period of time. The difference in temperature and air vapor pressure deficit (VPD between summer and winter contributed to the present dynamics of foliage patterns. The mean leaf longevity was estimated to be 13.1 month. The crown foliage area was almost stable throughout the year. Conclusions Homeostatic control of the crown foliage area may be accompanied by the existence of ecophysiological mechanisms in R. stylosa. Integrating crown foliage dynamics into forest models represents an important step towards incorporating physiological mechanisms into the models for predicting growth responses to environmental changes and for understanding the complex responses of tree growth and litter production.
-
Directory of Open Access Journals (Sweden)
Yelu Zeng
2015-10-01
Full Text Available The development of near-surface remote sensing requires the accurate extraction of leaf area index (LAI from networked digital cameras under all illumination conditions. The widely used directional gap fraction model is more suitable for overcast conditions due to the difficulty to discriminate the shaded foliage from the shadowed parts of images acquired on sunny days. In this study, a new LAI extraction method by the sunlit foliage component from downward-looking digital photography under clear-sky conditions is proposed. In this method, the sunlit foliage component was extracted by an automated image classification algorithm named LAB2, the clumping index was estimated by a path length distribution-based method, the LAD and G function were quantified by leveled digital images and, eventually, the LAI was obtained by introducing a geometric-optical (GO model which can quantify the sunlit foliage proportion. The proposed method was evaluated at the YJP site, Canada, by the 3D realistic structural scene constructed based on the field measurements. Results suggest that the LAB2 algorithm makes it possible for the automated image processing and the accurate sunlit foliage extraction with the minimum overall accuracy of 91.4%. The widely-used finite-length method tends to underestimate the clumping index, while the path length distribution-based method can reduce the relative error (RE from 7.8% to 6.6%. Using the directional gap fraction model under sunny conditions can lead to an underestimation of LAI by (1.61; 55.9%, which was significantly outside the accuracy requirement (0.5; 20% by the Global Climate Observation System (GCOS. The proposed LAI extraction method has an RMSE of 0.35 and an RE of 11.4% under sunny conditions, which can meet the accuracy requirement of the GCOS. This method relaxes the required diffuse illumination conditions for the digital photography, and can be applied to extract LAI from downward-looking webcam images
-
Characterization of Foliage Mutants for Plant Variety Registration
International Nuclear Information System (INIS)
Affrida Abu Hassan; Shuhaimi Shamsuddin; Zaiton Ahmad
2011-01-01
Breeding for new plant varieties requires a substantial investment in terms of skill, labour, material resources and financing. Thus, registration of new plant variety is important to ensure return of revenue and protection of the breeder's right. Before a new variety is registered, it has to comply certain requirements under Plant Variety Protection Act. One of the most important requirements is, the new species/variety must be morphologically distinguishable from existing plant varieties. This paper discusses detailed leaf characteristics of 4 foliage mutants produced by Malaysian Nuclear Agency as part of the requirement for new variety registration. (author)
-
Directory of Open Access Journals (Sweden)
Anelise Fonseca
2011-10-01
Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20
-
International Nuclear Information System (INIS)
Wang, Yan; Wang, Shaorui; Xu, Yue; Luo, Chunling; Li, Jun; Zhang, Gan
2015-01-01
Rice and the distinctive cultivation practices employed in rice growth can significantly influence the environmental fate of polybrominated diphenyl ethers (PBDEs) in a paddy field. We studied variations in PBDE concentrations in multiple compartments of a paddy field in the suburban area of Guangzhou, South China, including air, soil, water, and rice tissues. The input/output fluxes of air–surface and air–foliage exchange, atmospheric deposition and water input during different rice growth stages were measured simultaneously. Air–foliage and air–water diffusion exchanges were the key processes controlling inputs and outputs of PBDEs in paddy fields, respectively, whereas atmospheric deposition dominated inputs of higher brominated PBDEs. The high input of PBDEs via air–foliage exchange suggested that vegetation can significantly increase the air-to-field transport of PBDEs in ecosystems. The annual input of PBDEs in all paddy fields in Guangdong Province was estimated to be 22.1 kg. - Highlights: • PBDE concentrations in multiple compartments of a suburban paddy field were measured. • Air–water exchange was the key process controlling PBDE output in paddy fields. • Air–foliage exchange dominated the inputs of PBDEs in paddy fields. • Annual PBDE input in paddy fields in Guangdong Province was calculated to be 22 kg. - Air–foliage exchange is the most dominant inputs of PBDEs in the subtropical paddy fields
-
Sokerya, S; Waller, P J; Try, P; Höglund, J
2009-02-01
The benefit of long-term feeding of fresh or ensiled cassava foliage on gastrointestinal parasite in goats was evaluated. Eighteen male goats (15.15 +/- 2.83 kg and between 4-6 months) were randomly allocated into three treatments supplemented with 200 g of wheat bran head(-1) day(-1). All groups were fed ad-libitum on either grass (CO), fresh cassava (CaF) or ensiled cassava foliage (CaS). At the beginning of the trial, each goat was inoculated with 3000 L3 containing approximately 50% Haemonchus contortus. Individual LWt, FEC and PCV were measured at weekly intervals for 10 weeks. At the termination of the experiment all goats were slaughtered for worm recovery and enumeration. The goats in CaF and CaS had similar weight gains while those in CO lost weight (p goats. PCV of all groups decreased from above 30% to around 25% at the end of the trial. The compositions of established worm burdens were mainly H. contortus (19-40%) and Trichostrongylus colubriformis (55-76%). TWB did not differ among the groups, however, CaS significantly reduced H. contortus burdens, as compared to CaF and CO (p < or = 0.005). Thus, ensiled cassava foliage reduced the H. contortus population while the fresh foliage only reduced worm fecundity.
-
Laboratory evaluation of the Sequoia Scientific LISST-ABS acoustic backscatter sediment sensor
Snazelle, Teri T.
2017-12-18
Sequoia Scientific’s LISST-ABS is an acoustic backscatter sensor designed to measure suspended-sediment concentration at a point source. Three LISST-ABS were evaluated at the U.S. Geological Survey (USGS) Hydrologic Instrumentation Facility (HIF). Serial numbers 6010, 6039, and 6058 were assessed for accuracy in solutions with varying particle-size distributions and for the effect of temperature on sensor accuracy. Certified sediment samples composed of different ranges of particle size were purchased from Powder Technology Inc. These sediment samples were 30–80-micron (µm) Arizona Test Dust; less than 22-µm ISO 12103-1, A1 Ultrafine Test Dust; and 149-µm MIL-STD 810E Silica Dust. The sensor was able to accurately measure suspended-sediment concentration when calibrated with sediment of the same particle-size distribution as the measured. Overall testing demonstrated that sensors calibrated with finer sized sediments overdetect sediment concentrations with coarser sized sediments, and sensors calibrated with coarser sized sediments do not detect increases in sediment concentrations from small and fine sediments. These test results are not unexpected for an acoustic-backscatter device and stress the need for using accurate site-specific particle-size distributions during sensor calibration. When calibrated for ultrafine dust with a less than 22-µm particle size (silt) and with the Arizona Test Dust with a 30–80-µm range, the data from sensor 6039 were biased high when fractions of the coarser (149-µm) Silica Dust were added. Data from sensor 6058 showed similar results with an elevated response to coarser material when calibrated with a finer particle-size distribution and a lack of detection when subjected to finer particle-size sediment. Sensor 6010 was also tested for the effect of dissimilar particle size during the calibration and showed little effect. Subsequent testing revealed problems with this sensor, including an inadequate temperature
-
Mountain pine beetle attack alters the chemistry and flammability of lodgepole pine foliage
Wesley G. Page; Michael J. Jenkins; Justin B. Runyon
2012-01-01
During periods with epidemic mountain pine beetle (Dendroctonus ponderosae Hopkins) populations in lodgepole pine (Pinus contorta Dougl. ex Loud. var. latifolia Engelm.) forests, large amounts of tree foliage are thought to undergo changes in moisture content and chemistry brought about by tree decline and death. However, many of the presumed changes have yet to be...
-
Diagnosis of abiotic and biotic stress factors using the visible symptoms in foliage
International Nuclear Information System (INIS)
Vollenweider, P.; Guenthardt-Goerg, Madeleine S.
2005-01-01
Visible symptoms in the foliage of trees are recorded to monitor the effects of abiotic and biotic stress. Difficulties are reported in diagnosing the origin of stress. The present paper discusses several diagnostic criteria which are usable in different species for a better determination of the stress factor type. A new diagnosis scheme to differentiate between classes of abiotic and biotic stress factors is supplied. Abiotic stress generates gradients of symptoms. The symptom specificity is determined by the degree of interaction between the stress factor and plant defense system. Symptoms caused by abiotic stress and natural autumnal senescence can be morphologically different or undistinguishable according to the stress and plant species. With biotic stress, the class of parasitic is generally recognizable on the basis of the visible symptoms. Structurally and physiologically based explanations of the symptom morphology are still missing for many stress factors. - The morphology and distribution of visible stress symptoms in tree foliage provides diagnostic tools to identify plant defense responses and differentiate stress from natural senescence symptoms
-
Directory of Open Access Journals (Sweden)
Anelise Fonseca
2011-10-01
Full Text Available Population aging is a reality all over the world, requiring a change in the way care is perceived and resources are divided for different age groups. In Brazil, current indicators and projections place the country among those with the highest number of elderly people. By contrast, there is a shortage of action plans and inter- and multi-disciplinary teams, as well as public policies and professionals, focusing on the elderly, in part as a consequence of an accelerated aging process in developing countries. Within this context, the SEQUOIA Institute (IS was created to attend to this process by monitoring the overall health of patients. The institute's routine work includes clinical actions, team meetings, socialization projects and lectures. The IS features a 10% yearly growth in medical assistance, a 20% rise in psychological treatments, and a 50% increase in lecture attendance.Le vieillissement de la population est un phénomène mondial qui exige de revoir la façon dont sont perçus les soins et dont sont divisées les ressources en fonction des différentes tranches d’âge. Les indicateurs et les projections actuels montrent que le Brésil est le pays qui compte la plus grande proportion de personnes âgées. Et pourtant, les plans d’action, les équipes inter- et pluridisciplinaires, mais aussi les politiques publiques et les professionnels spécialistes des questions liées aux personnes âgées sont en nombre insuffisant, notamment en raison d’un processus de vieillissement accéléré dans les pays en développement. C’est dans ce contexte qu’a été créé l’Institut SEQUOIA (IS, dont la mission consiste à gérer ce processus en effectuant un suivi de la santé générale des patients. Les principales tâches de l’institut incluent études cliniques, réunions d’équipes, projets impliquant des débats et conférences. L’IS affiche une croissance annuelle de 10 % dans le secteur de l’assistance médicale, de 20
-
Modeling mountain pine beetle habitat suitability within Sequoia National Park
Nguyen, Andrew
Understanding significant changes in climate and their effects on timber resources can help forest managers make better decisions regarding the preservation of natural resources and land management. These changes may to alter natural ecosystems dependent on historical and current climate conditions. Increasing mountain pine beetle (MBP) outbreaks within the southern Sierra Nevada are the result of these alterations. This study better understands MPB behavior within Sequoia National Park (SNP) and model its current and future habitat distribution. Variables contributing to MPB spread are vegetation stress, soil moisture, temperature, precipitation, disturbance, and presence of Ponderosa (Pinus ponderosa) and Lodgepole (Pinus contorta) pine trees. These variables were obtained using various modeled, insitu, and remotely sensed sources. The generalized additive model (GAM) was used to calculate the statistical significance of each variable contributing to MPB spread and also created maps identifying habitat suitability. Results indicate vegetation stress and forest disturbance to be variables most indicative of MPB spread. Additionally, the model was able to detect habitat suitability of MPB with a 45% accuracy concluding that a geospatial driven modeling approach can be used to delineate potential MPB spread within SNP.
-
Olafadehan, Olurotimi A; Njidda, Ahmed A; Okunade, Sunday A; Salihu, Sarah O; Balogun, David O; Salem, Abdelfattah Z M
2018-02-01
Fifteen 5-month-old Red Sokoto buck-kids, (6.6 ± 0.71 kg body weight (BW)) randomly distributed into three groups of five animals per group, were used to study the effects of supplementary concentrate partially replaced with Piliostigma thonningii (PT) foliage on the growth performance, economic benefit and blood profile in a completely randomized design using analysis of variance. The goats in group 1 received 100% supplementary concentrates (PT0), groups 2 and 3 received 25% (PT25) and 50% (PT50), respectively, of concentrate replaced with an equal amount (dry matter basis) of Piliostigma foliage. The goats were fed a basal diet of threshed sorghum top (TST). Intake of concentrate, hemoglobin, mean corpuscular hemoglobin concentration, mean corpuscular hemoglobin, total feeding cost and cost/kg BW were greater (P kids. © 2017 Japanese Society of Animal Science.
-
Llorens, Laura; Osborne, Colin P.; Beerling, David J.
2009-01-01
Background and Aims During the Mesozoic, the polar regions supported coniferous forests that experienced warm climates, a CO2-rich atmosphere and extreme seasonal variations in daylight. How the interaction between the last two factors might have influenced water use of these conifers was investigated. An experimental approach was used to test the following hypotheses: (1) the expected beneficial effects of elevated [CO2] on water-use efficiency (WUE) are reduced or lost during the 24-h light of the high-latitude summer; and (2) elevated [CO2] reduces plant water use over the growing season. Methods Measurements of leaf and whole-plant gas exchange, and leaf-stable carbon isotope composition were made on one evergreen (Sequoia sempervirens) and two deciduous (Metasequoia glyptostroboides and Taxodium distichum) ‘living fossil’ coniferous species after 3 years' growth in controlled-environment simulated Cretaceous Arctic (69°N) conditions at either ambient (400 µmol mol−1) or elevated (800 µmol mol−1) [CO2]. Key Results Stimulation of whole-plant WUE (WUEP) by CO2 enrichment was maintained over the growing season for the three studied species but this pattern was not reflected in patterns of WUE inferred from leaf-scale gas exchange measurements (iWUEL) and δ13C of foliage (tWUEL). This response was driven largely by increased rates of carbon uptake, because there was no overall CO2 effect on daily whole-plant transpiration or whole-plant water loss integrated over the study period. Seasonal patterns of tWUEL differed from those measured for iWUEL. The results suggest caution against over simplistic interpretations of WUEP based on leaf isotopic composition. Conclusions The data suggest that the efficiency of whole-tree water use may be improved by CO2 enrichment in a simulated high-latitude environment, but that transpiration is relatively insensitive to atmospheric CO2 in the living fossil species investigated. PMID:19447810
-
Duringer, Jennifer M; Swan, Laurence R; Walker, Douglas B; Craig, A Morrie
2010-11-01
Recently, interest has developed for using essential oils from Western juniper (Juniperus occidentalis) foliage and Port Orford cedar (Chamaecyparis lawsoniana) heartwood in commercial products such as pest repellents and cosmetics. In order to gauge the relative toxicological risk that these oils pose to freshwater and marine organisms, the acute aquatic toxicity of these oils was evaluated using OPPTS guidelines to the cladoceran Daphnia magna, the rainbow trout Oncorhynchus mykiss and the green alga Selenastrum capricornutum. For western juniper foliage oil, no toxicity was exhibited toward D. magna or O. mykiss, even at 5.0 mg/L (the highest concentration tested and limit of solubility). For toxicity to S. capricornutum using algal cell density, the 72 and 96 h EC50 value was 1.7 mg/L and the no observable effect concentration (NOEC) was 0.63 mg/L. For Port Orford cedar heartwood oil, no toxicity was exhibited toward O. mykiss or S. capricornutum, even at 5.0 mg/L (the highest concentration tested and limit of solubility). The 48-h D. magna EC50 value was 1.9 mg/L; the NOEC values for algal cell density were 1.25 mg/L (72 h) and 0.63 mg/L (96 h). In summary, this study shows that western juniper foliage and Port Orford cedar heartwood oils demonstrate little to no risk to aquatic organisms.
-
Robust Detection of Moving Human Target in Foliage-Penetration Environment Based on Hough Transform
Directory of Open Access Journals (Sweden)
P. Lei
2014-04-01
Full Text Available Attention has been focused on the robust moving human target detection in foliage-penetration environment, which presents a formidable task in a radar system because foliage is a rich scattering environment with complex multipath propagation and time-varying clutter. Generally, multiple-bounce returns and clutter are additionally superposed to direct-scatter echoes. They obscure true target echo and lead to poor visual quality time-range image, making target detection particular difficult. Consequently, an innovative approach is proposed to suppress clutter and mitigate multipath effects. In particular, a clutter suppression technique based on range alignment is firstly applied to suppress the time-varying clutter and the instable antenna coupling. Then entropy weighted coherent integration (EWCI algorithm is adopted to mitigate the multipath effects. In consequence, the proposed method effectively reduces the clutter and ghosting artifacts considerably. Based on the high visual quality image, the target trajectory is detected robustly and the radial velocity is estimated accurately with the Hough transform (HT. Real data used in the experimental results are provided to verify the proposed method.
-
Directory of Open Access Journals (Sweden)
Chang-Zheng Song
2015-02-01
Full Text Available The effect of foliage sprayed zinc sulfate on berry development of Vitis vinifera cv. Merlot growing on arid zone Zn-deficient soils was investigated over two consecutive seasons, 2013 and 2014. Initial zinc concentration in soil and vines, photosynthesis at three berry developmental stages, berry weight, content of total soluble solids, titratable acidity, phenolics and expression of phenolics biosynthetic pathway genes throughout the stages were measured. Foliage sprayed zinc sulfate showed promoting effects on photosynthesis and berry development of vines and the promotion mainly occurred from veraison to maturation. Zn treatments enhanced the accumulation of total soluble solids, total phenols, flavonoids, flavanols, tannins and anthocyanins in berry skin, decreasing the concentration of titratable acidity. Furthermore, foliage sprayed zinc sulfate could significantly influence the expression of phenolics biosynthetic pathway genes throughout berry development, and the results of expression analysis supported the promotion of Zn treatments on phenolics accumulation. This research is the first comprehensive and detailed study about the effect of foliage sprayed Zn fertilizer on grape berry development, phenolics accumulation and gene expression in berry skin, providing a basis for improving the quality of grape and wine in Zn-deficient areas.
-
Assessment of tannin variation in Tamarisk foliage across a latitudinal gradient
Hussey, A.M.; Kimball, B.A.; Friedman, J.M.
2011-01-01
Certain phenotypic traits of plants vary with latitude of origin. To understand if tannin concentration varies among populations of tamarisk (Tamarix spp.) according to a latitudinal gradient, an analytical method was adapted from an enological tannin assay. The tannin content (wet basis) of tamarisk foliage collected from 160 plants grown in a common garden ranged from 8.26 to 62.36 mg/g and was not correlated with the latitude of the original North American plant collection site. Tannins do not contribute to observed differences in herbivory observed among these tamarisk populations.
-
Experiments were conducted over three years to evaluate whether fungicide applications could be ceased after the most susceptible stages of cone development (late July) without unduly affecting crop yield and quality when disease pressure was moderated with varying levels of basal foliage removal. I...
-
[Species-associated differences in foliage-root coupling soil-reinforcement and anti-erosion].
Liu, Fu-quan; Liu, Jing; Nao, Min; Yao, Xi-jun; Zheng, Yong-gang; Li, You-fang; Su, Yu; Wang, Chen-jia
2015-02-01
This paper took four kinds of common soil and water conservation plants of the study area, Caragana microphylla, Salix psammophila, Artemisia sphaerocephala and Hippophae rhamnides at ages of 4 as the research object. Thirteen indicators, i.e., single shrub to reduce wind velocity ration, shelterbelt reducing wind velocity ration, community reducing wind velocity ration, taproot tensile strength, representative root constitutive properties, representative root elasticity modulus, lateral root branch tensile strength, accumulative surface area, root-soil interface sheer strength, interface friction coefficient, accumulative root length, root-soil composite cohesive, root-soil composite equivalent friction angle, reflecting the characteristics of windbreak and roots, were chose to evaluate the differences of foliage-root coupling soil-reinforcement and anti-erosion among four kinds of plants by analytic hierarchy process (AHP) under the condition of spring gale and summer rainstorm, respectively. The results showed the anti-erosion index of foliage-root coupling was in the sequence of S. psammophila (0.841) > C. microphylla (0.454) > A. sphaerocephala (-0.466) > H. rhamnides (-0.829) in spring gale, and C. microphylla (0.841) > S. psammophila (0. 474) > A. sphaerocephala (-0.470) > H. rhamnides (-0.844) in summer rainstorm. S. psammophila could be regarded as one of the most important windbreak and anti-erosion species, while C. microphylla could be the most valuable soil and water conservation plant for the study area.
-
International Nuclear Information System (INIS)
Gong, Ping; Wang, Xiao-ping; Xue, Yong-gang; Xu, Bai-qing; Yao, Tan-dong
2014-01-01
Remote forests are considered a pool of Mercury (Hg) in the global Hg cycle. However, notably few studies have investigated the fate of Hg in the Tibetan forest. In this study, fifty-two foliage samples and seven litter/soil profiles were collected throughout the Tibetan forest. The concentrations of total Hg (THg) in foliage were positively correlated with longitude and negatively correlated with altitude, indicating that the emission of Hg is expected to decrease with increasing distance from emission sources to the Tibetan forest. The deposition flux of THg in the Tibetan forest (with an air-to-forest ground flux of 9.2 μg/m 2 /year) is ∼2 times the flux in clearings, which is suggestive of enhanced Hg deposition by the forest. The depositional Hg is eventually stored in the forest soil, and the soil acts as a net ‘sink’ for Hg. - Highlights: • Foliage can be used as bio-indicator for monitoring the spatial Hg distribution. • The Tibetan forest can enhance the atmospheric Hg deposition to the ground. • The Tibetan forest soil is a pool of Hg that acts to delay the regional cycling of Hg. - The Tibetan forest can accumulate atmospheric Hg, which undergoes long-range transport, and the soil of Tibetan forest acts as the final Hg ‘sink’
-
G. Richard Strimbeck; Trygve D. Kjellsen; Paul G. Schaberg; Paula F. Murakami
2008-01-01
To provide baseline data for physiological studies of extreme low-temperature (LT) tolerance in boreal conifers, we profiled LT stress responses, liquid nitrogen (LN2)-quench tolerance, and sugar concentrations in foliage of boreal-temperate species pairs in the genera Abies, Picea and Pinus, growing in an...
-
Mapping a candidate gene (MdMYB10 for red flesh and foliage colour in apple
Directory of Open Access Journals (Sweden)
Allan Andrew C
2007-07-01
Full Text Available Abstract Background Integrating plant genomics and classical breeding is a challenge for both plant breeders and molecular biologists. Marker-assisted selection (MAS is a tool that can be used to accelerate the development of novel apple varieties such as cultivars that have fruit with anthocyanin through to the core. In addition, determining the inheritance of novel alleles, such as the one responsible for red flesh, adds to our understanding of allelic variation. Our goal was to map candidate anthocyanin biosynthetic and regulatory genes in a population segregating for the red flesh phenotypes. Results We have identified the Rni locus, a major genetic determinant of the red foliage and red colour in the core of apple fruit. In a population segregating for the red flesh and foliage phenotype we have determined the inheritance of the Rni locus and DNA polymorphisms of candidate anthocyanin biosynthetic and regulatory genes. Simple Sequence Repeats (SSRs and Single Nucleotide Polymorphisms (SNPs in the candidate genes were also located on an apple genetic map. We have shown that the MdMYB10 gene co-segregates with the Rni locus and is on Linkage Group (LG 09 of the apple genome. Conclusion We have performed candidate gene mapping in a fruit tree crop and have provided genetic evidence that red colouration in the fruit core as well as red foliage are both controlled by a single locus named Rni. We have shown that the transcription factor MdMYB10 may be the gene underlying Rni as there were no recombinants between the marker for this gene and the red phenotype in a population of 516 individuals. Associating markers derived from candidate genes with a desirable phenotypic trait has demonstrated the application of genomic tools in a breeding programme of a horticultural crop species.
-
Directory of Open Access Journals (Sweden)
S.H. Abu Hafsa
2016-12-01
Full Text Available This study aimed to evaluate the effect of feeding dried foliage (leaves and petioles of Acacia saligna, Leucaena leucocephala or Moringa oleifera on the performance, digestibility, N utilisation, caecal fermentation and microbial profiles in New Zealand White (NZW rabbits. One hundred weaned male NZW rabbits weighing 819.2±16.6 g and aged 35±1 d were randomly allocated into 4 groups of 25 rabbits each. Rabbits were fed on pelleted diets containing 70% concentrate mixture and 30% Egyptian berseem (Trifolium alexandrinum hay (Control diet or one of the other 3 experimental diets, where 50% of berseem hay was replaced with A. saligna (AS, L. leucocephala (LL or M. oleifera (MO. Compared to Control diet, decreases in dry matter (DM; P=0.004, organic matter (P=0.028, crude protein (CP; P=0.001, neutral detergent fibre (P=0.033 and acid detergent fibre (P=0.011 digestibility were observed with the AS diet. However, DM and CP digestibility were increased by 3% with the MO diet, and N utilisation was decreased (P<0.05 with AS. Rabbits fed AS and LL diets showed decreased (P=0.001 average daily gain by 39 and 7%, respectively vs. Control. Feed conversion was similar in Control and MO rabbits, whereas rabbits fed AS diet ate up to 45% more feed (P=0.002 than Control rabbits to gain one kg of body weight. Caecal ammonia-N was increased (P=0.002 with LL, while acetic acid was decreased (P=0.001 with AS diet vs. other treatments. Caecal E. coli and Lactobacillus spp. bacteria counts were decreased with MO by about 44 and 51%, respectively, vs. Control. In conclusion, under the study conditions, tree foliage from M. oleifera and L. leucocephala are suitable fibrous ingredients to be included up to 150 g/kg in the diets of growing rabbits, and can safely replace 50% of berseem hay in diets of NZW rabbits without any adverse effect on their growth performance. Foliage from M. oleifera had a better potential as a feed for rabbits than that from L
-
Matchett, John R.; Lutz, James A.; Tarnay, Leland W.; Smith, Douglas G.; Becker, Kendall M.L.; Brooks, Matthew L.
2015-01-01
Forest biomass on Sierra Nevada landscapes constitutes one of the largest carbon stocks in California, and its stability is tightly linked to the factors driving fire regimes. Research suggests that fire suppression, logging, climate change, and present management practices in Sierra Nevada forests have altered historic patterns of landscape carbon storage, and over a century of fire suppression and the resulting accumulation in surface fuels have been implicated in contributing to recent increases in high severity, stand-replacing fires. For over 30 years, fire management at Yosemite (YOSE) and Sequoia & Kings Canyon (SEKI) national parks has led the nation in restoring fire to park landscapes; however, the impacts on the stability and magnitude of carbon stocks have not been thoroughly examined.
-
International Nuclear Information System (INIS)
Vollenweider, Pierre; Menard, Terry; Guenthardt-Goerg, Madeleine S.
2011-01-01
In order to achieve efficient phytoextraction of heavy metals using trees, the metal allocation to aboveground tissues needs to be characterised. In his study, the distribution of heavy metals, macro- and micronutrients and the metal micro-localisation as a function of the leaf position and heavy metal treatment were analysed in poplars grown on soil with mixed metal contamination. Zinc was the most abundant contaminant in both soil and foliage and, together with cadmium, was preferentially accumulated in older foliage whereas excess copper and lead were not translocated. Changes in other element concentrations indicated an acceleration in aging as a consequence of the metal treatment. Excess zinc was irregularly accumulated inside leaf tissues, tended to saturate the veins and was more frequently stored in cell symplast than apoplast. Storage compartments including metabolically safe and sensitive subcellular sites resulted in sizable metal accumulation as well as stress reactions. - Within foliage of poplars growing on contaminated soils, Zinc was stored at metabolically safe as well as sensitive subcellular sites, ensuring sizable bioaccumulation but also causing injuries.
-
Energy Technology Data Exchange (ETDEWEB)
Vollenweider, Pierre, E-mail: pierre.vollenweider@wsl.c [Swiss Federal Institute for Forest, Snow and Landscape Research (WSL), Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Menard, Terry; Guenthardt-Goerg, Madeleine S. [Swiss Federal Institute for Forest, Snow and Landscape Research (WSL), Zuercherstrasse 111, 8903 Birmensdorf (Switzerland)
2011-01-15
In order to achieve efficient phytoextraction of heavy metals using trees, the metal allocation to aboveground tissues needs to be characterised. In his study, the distribution of heavy metals, macro- and micronutrients and the metal micro-localisation as a function of the leaf position and heavy metal treatment were analysed in poplars grown on soil with mixed metal contamination. Zinc was the most abundant contaminant in both soil and foliage and, together with cadmium, was preferentially accumulated in older foliage whereas excess copper and lead were not translocated. Changes in other element concentrations indicated an acceleration in aging as a consequence of the metal treatment. Excess zinc was irregularly accumulated inside leaf tissues, tended to saturate the veins and was more frequently stored in cell symplast than apoplast. Storage compartments including metabolically safe and sensitive subcellular sites resulted in sizable metal accumulation as well as stress reactions. - Within foliage of poplars growing on contaminated soils, Zinc was stored at metabolically safe as well as sensitive subcellular sites, ensuring sizable bioaccumulation but also causing injuries.
-
Calvo, D.; Molina, J.M.
2010-01-01
Implications for adults' fitness through the foliage effects of five different host plants on larval survival and performance of the lappet moth, Streblote panda Hübner (Lepidoptera: Lasiocampidae), as well as their effect on species fitness were assayed. Larvae were reared under controlled laboratory conditions on excised foliage. Long-term developmental experiments were done using first instar larvae to adult emergence, and performance experiments were done using fifth instar larvae. Survival, development rates, and food use were measured. Foliar traits analysis indicated that leaves of different host plants varied, significantly affecting larvae performance and adult fitness. Pistacia lentiscus L. (Sapindales: Anacardiaceae), Arbutus unedo L. (Ericales: Ericaceae), and Retama sphaerocarpa (L.) Boiss. (Fabales: Fabaceae) were the most suitable hosts. Larvae fed on Tamarix gallica L. (Caryophyllales: Tamaricaceae) and Spartium junceum L. (Fabales: Fabaceae) showed the lowest survival, rates of development and pupal and adult weight. In general, S. panda showed a relatively high capacity to buffer low food quality, by reducing developmental rates and larvae development thereby reaching the minimum pupal weight that ensures adult survival. Less suitable plants seem to have indirect effects on adult fitness, producing smaller adults that could disperse to other habitats. PMID:21062148
-
Uptake of tritium through foliage in capsicum fruitescens, L
International Nuclear Information System (INIS)
Iyengar, T.S.; Sadarangani, S.H.; Vaze, P.K.; Soman, S.D.
1977-01-01
Tritium uptake and release patterns throuogh foliage in Capsicum fruitescens, L. were investigated using twelve potted plants, under different conditions of exposure and release. The plants studied belonged to two age groups, 3 months and 5 months. The average half residence time for the species was found to be 42.6 min, on the basis of treating the entire group of plants as a single cluster. The individual release rates showed a variation of up to a factor of two, for half residence time values (Tsub(1/2)). The second component was not easily resolvable in most of the cases. Tissue bound tritium showed interesting uptake patterns. The ratios between tissue bound tritium and tissue free water tritium concentrations indicated regular mode of uptake with well defined rate constants in the case of long exposure periods. (author)
-
BOREAS TE-9 NSA Photosynthetic Capacity and Foliage Nitrogen Data
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Dang, Qinglai; Margolis, Hank; Coyea, Marie
2000-01-01
The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-9 (Terrestrial Ecology) team collected several data sets related to chemical and photosynthetic properties of leaves in boreal forest tree species. This data set describes the spatial and temporal relationship between foliage nitrogen concentration and photosynthetic capacity in the canopies of black spruce, jack pine, and aspen located within the Northern Study Area (NSA). The data were collected from June to September 1994 and are useful for modeling the vertical distribution of carbon fixation for different forest types in the boreal forest. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
-
Directory of Open Access Journals (Sweden)
Jusoh, S
2017-06-01
Full Text Available The usage of locally available forages such as agricultural by-products and native trees is the crucial thing for goat farmers to obtain good quality feed and to reduce cost of feeding. A study was conducted to investigate the performance of crossbred goats fed urea treated rice straw supplemented with different levels of Klienhovia hospita foliage, in particular to determine the nutrient feeding value of experimental feed diets, evaluate the growth performance, feed intake and digestibility of the diets by goats. The feeding trial conducted was divided into two sections: digestibility and animal performance. The digestibility test was performed using total faecal collection method. The treatment diets were based on urea treated rice straw (RS supplemented with commercial concentrate (C and Klienhovia hospita (KH herbage: T1 with 85% RS and 15% C, T2 with 85% RS and 5% KH and 10% C, T3 with 85% RS, 10% KH and 5% C, and T4 with 85% RS and 15% KH. The feeding trial used 12 6-mo old crossbred male goats divided into 4 groups with the diets offered ad libitum and had access to clean drinking water. The left over feed was removed and weighed daily to determine voluntary DM intake. The initial average body weight of goats used ranged between 20.14�1.03 kg and 20.29�0.18 kg. The animals were placed in individual metabolic crates on slatted floor of 0.8 m above ground for 100 consecutive d. The results showed that there was no significant difference observed on body weight of goats among the treatments. ADG of goats was significantly higher in goats on diets T3 and T4 than those on control diet. Significant higher feed intake was observed in goats fed diet containing KH foliage than those fed with diet T1. Results for ASH, CP and ADF digestibility among different treatments were not significantly different whereas NDF digestibility was significantly higher in T2 treatment in comparison with T1, T3 and T4. The dry matter digestibility values of T1
-
Rotylenchulus reniformis on Greenhouse-grown Foliage Plants: Host Range and Sources of Inoculum.
Starr, J L
1991-10-01
Two sources of inoculum of reniform nematodes, Rotylenchulus reniformis, were identified for infestation of ornamental foliage plants in commercial greenhouses. These were water from a local canal system and rooted cuttings purchased from other sources. Eight ornamental plant species were identified as good hosts for the reniform nematode, with each species supporting a reniform population density equal to or greater than that supported by 'Rutgers' tomato and a reproduction factor of greater than 1.0. Nine other plant species were identified as poor hosts.
-
Impact of foliage on LoRa 433MHz propagation in tropical environment
Ahmad, Khairol Amali; Salleh, Mohd Sharil; Segaran, Jivitraa Devi; Hashim, Fakroul Ridzuan
2018-02-01
LoRa is being considered as one of the promising system for Low-Power-Wide-Area-Network (LPWAN) to support the growth of Internet of Things (IoT) applications. Designed to operate in the industrial, scientific and medical (ISM) bands, LoRa had been tested and evaluated mainly in Europe and US in the 868 MHz and 915 MHz modulation bands. Using chirp spread spectrum technology, LoRa is expected to be robust against degredation. This paper provides some early results in the performance of LoRa signal propagation of 433 MHz modulation in tropical foliage environments.
-
Directory of Open Access Journals (Sweden)
Milanović Slobodan
2007-01-01
Full Text Available The development of Gypsy moth (Lymantria dispar L was monitored in laboratory conditions, on the foliage of the species Quercus cerris L. Quercus petraea (Matt Liebl. and Quercus robur L. The experiment was established in the controlled environmental conditions, at the temperature of 25°C, photoperiod 14:10 (day: night and relative humidity 70%. The objective of the research was to determine the suitability of the study host plant species for gypsy moth development. The study results show that Gypsy moth caterpillars cultivated on Q. petraea foliage had a lower survival, higher number of moultings, longer preadult development and lower fecundity, which makes this species less suitable compared to the other two. Gypsy moth caterpillars cultivated on Q. cerris foliage had the highest survival degree the lowest number of moultings, the shortest preadult development and the highest fecundity, which makes this species the most favourable for gypsy moth development. Q. robur was between the former two species in this respect.
-
Kozlov, Mikhail V; Lanta, Vojtěch; Zverev, Vitali; Rainio, Kalle; Kunavin, Mikhail A; Zvereva, Elena L
2017-10-01
Despite the increasing rate of urbanization, the consequences of this process on biotic interactions remain insufficiently studied. Our aims were to identify the general pattern of urbanization impact on background insect herbivory, to explore variations in this impact related to characteristics of both urban areas and insect-plant systems, and to uncover the factors governing urbanization impacts on insect herbivory. We compared the foliar damage inflicted on the most common trees by defoliating, leafmining and gall-forming insects in rural and urban habitats associated with 16 European cities. In two of these cities, we explored quality of birch foliage for herbivorous insects, mortality of leafmining insects due to predators and parasitoids and bird predation on artificial plasticine larvae. On average, the foliage losses to insects were 16.5% lower in urban than in rural habitats. The magnitude of the overall adverse effect of urbanization on herbivory was independent of the latitude of the locality and was similar in all 11 studied tree species, but increased with an increase in the size of the urban area: it was significant in large cities (city population 1-5 million) but not significant in medium-sized and small towns. Quality of birch foliage for herbivorous insects was slightly higher in urban habitats than in rural habitats. At the same time, leafminer mortality due to ants and birds and the bird attack intensity on dummy larvae were higher in large cities than in rural habitats, which at least partially explained the decline in insect herbivory observed in response to urbanization. Our findings underscore the importance of top-down forces in mediating impacts of urbanization on plant-feeding insects: factors favouring predators may override the positive effects of temperature elevation on insects and thus reduce plant damage. © 2017 John Wiley & Sons Ltd.
-
Peng, D.; Hu, Y.; Li, Z.
2016-05-01
It is important to detect and quantify deforestation to guide strategic decisions regarding environment, socioeconomic development, and climate change. In the present study, we conducted a field experiment to examine spectral reflectance and vegetation index changes in poplar and locust tree foliage with different leaf area indices over the course of three sunny days, following tree removal from the canopy. The spectral reflectance of foliage from harvested trees was measured using an ASD FieldSpec Prospectroradiometer; synchronous meteorological data were also obtained. We found that reflectance in short-wave infrared and red-edge reflectance was more time sensitive after tree removal than reflectance in other spectral regions, and that the normalized difference water index (NDWI) and the red-edge chlorophyll index (CIRE) were the preferred indicators of these changes from several indices evaluated. Synthesized meteorological environments were found to influence water and chlorophyll contents after tree removal, and this subsequently changed the spectral canopy reflectance. Our results indicate the potential for such tree removal to be detected with NDWI or CIRE from the second day of a deforestation event.
-
Dawidowicz, Andrzej L; Czapczyńska, Natalia B; Wianowska, Dorota
2012-05-30
The influence of different Purge Times on the effectiveness of Pressurized Liquid Extraction (PLE) of volatile oil components from cypress plant matrix (Cupressus sempervirens) was investigated, applying solvents of diverse extraction efficiencies. The obtained results show the decrease of the mass yields of essential oil components as a result of increased Purge Time. The loss of extracted components depends on the extrahent type - the greatest mass yield loss occurred in the case of non-polar solvents, whereas the smallest was found in polar extracts. Comparisons of the PLE method with Sea Sand Disruption Method (SSDM), Matrix Solid-Phase Dispersion Method (MSPD) and Steam Distillation (SD) were performed to assess the method's accuracy. Independent of the solvent and Purge Time applied in the PLE process, the total mass yield was lower than the one obtained for simple, short and relatively cheap low-temperature matrix disruption procedures - MSPD and SSDM. Thus, in the case of volatile oils analysis, the application of these methods is advisable. Copyright © 2012 Elsevier B.V. All rights reserved.
-
Sunaryo, Y.; Purnomo, D.; Darini, M. T.; Cahyani, V. R.
2018-03-01
Hydroponic as one of the protected cultivation practices is very important to be developed in Indonesia due to not only the reduction of arable agricultural lands in lines with increasing of residential demand and other public facilities but also due to the negative influences of climate change as well global warming to plant growth. The effects of liquid fertilizer made from goat manure (LFGM) in combination with AB-Mix on three kinds of foliage vegetable growth was examined in hydroponics. The research was conducted by 3 x 4 factorial experiment and arranged in Completely Randomized Design with 3 replications. The first factor was foliage vegetable consisting of 3 levels: Mustard Green, Lettuce, and Red Spinach. The second factor was the mixture composition of nutrient solution consisting of 4 levels: LFGM + AB-Mix (v/v: 1:1), LFGM + AB-Mix (v/v: 1:3), LFGM + AB-Mix (v/v: 3:1), and A/B mix as control. Results indicated that the application of LFGM + AB-Mix (v/v: 1:3) resulted in similar plant growth as control (AB-Mix application), and also resulted in the highest chlorophyll content of Mustard green.
-
Directory of Open Access Journals (Sweden)
Yonghua Qu
2014-05-01
Full Text Available The canopy foliage clumping effect is primarily caused by the non-random distribution of canopy foliage. Currently, measurements of clumping index (CI by handheld instruments is typically time- and labor-intensive. We propose a low-cost and low-power automatic measurement system called Multi-point Linear Array of Optical Sensors (MLAOS, which consists of three above-canopy and nine below-canopy optical sensors that capture plant transmittance at different times of the day. Data communication between the MLAOS node is facilitated by using a ZigBee network, and the data are transmitted from the field MLAOS to a remote data server using the Internet. The choice of the electronic element and design of the MLAOS software is aimed at reducing costs and power consumption. A power consumption test showed that, when a 4000 mAH Li-ion battery is used, a maximum of 8–10 months of work can be achieved. A field experiment on a coniferous forest revealed that the CI of MLAOS may reveal a clumping effect that occurs within the canopy. In further work, measurement of the multi-scale clumping effect can be achieved by utilizing a greater number of MLAOS devices to capture the heterogeneity of the plant canopy.
-
Wilf, Peter
2012-03-01
Eocene caldera-lake beds at Laguna del Hunco (LH, ca. 52.2 Ma) and Río Pichileufú (RP, ca. 47.7 Ma) in Argentine Patagonia provide copious information about the biological history of Gondwana. Several plant genera from these sites are known as fossils from southern Australia and New Zealand and survive only in Australasian rainforests. The potential presence of Dacrycarpus (Podocarpaceae) holds considerable interest due to its extensive foliage-fossil record in Gondwana, its remarkably broad modern distribution in Southeast Asian and Australasian rainforests, its high physiological moisture requirements, and its bird-dispersed seeds. However, the unique seed cones that firmly diagnose Dacrycarpus were not previously known from the fossil record. I describe and interpret fertile (LH) and vegetative (LH and RP) material of Dacrycarpus and present a nomenclatural revision for fossil Dacrycarpus from South America. Dacrycarpus puertae sp. nov. is the first fossil occurrence of the unusual seed cones that typify living Dacrycarpus, attached to characteristic foliage, and of attached Dacrycarpus pollen cones and foliage. Dacrycarpus puertae is indistinguishable from living D. imbricatus (montane, Burma to Fiji). Dacrycarpus chilensis (Engelhardt) comb. nov. is proposed for Eocene vegetative material from Chile. Modern-aspect Dacrycarpus was present in Eocene Patagonia, demonstrating an astonishingly wide-ranging paleogeographic history and implying a long evolutionary association with bird dispersers. Dacrycarpus puertae provides the first significant Asian link for Eocene Patagonian floras, strengthens the biogeographic connections from Patagonia to Australasia across Antarctica during the warm Eocene, and indicates high-rainfall paleoenvironments.
-
Directory of Open Access Journals (Sweden)
R. ÖZÇELİK
2009-04-01
Full Text Available Ülkemizde bugüne kadar bir çok anıt ağaç ve meşcerenin tespiti yapılmıştır. Bu çalışmada, Mersin ili Aydıncık İlçesindeki; çap, boy, yaş, tepe çapı (somut özellikler ve Mistik özellikleri (soyut özellikler nedeniyle anıt ağaç niteliği taşıyan iki adet Dallı Servi (Cupresus sempervirens L. var. horizontalis (Mill. Gord. tanıtılmıştır. Bu iki ağaç, şimdiye kadar anıt ağaç olarak tescili yapılmış en uzun boylu servi bireyleridir. Bu nedenle; doğal, kültürel ve estetik değere sahip bu doğal varlıkların korunması gerekmektedir.
-
Kevin T. Smith; Walter C. Shortle; Jon H. Connolly; Rakesh Minocha; Jody Jellison
2009-01-01
Calcium cycling plays a key role in the health and productivity of red spruce forests in the northeastern US. A portion of the flowpath of calcium within forests includes translocation as Ca2+ in sapwood and accumulation as crystals of calcium oxalate in foliage. Concentrations of Ca in these tree tissues have been used as markers of...
-
Ferwerda, J.G.
2005-01-01
Rangeland carrying capacity is determined by both the quantity, as well as the quality, of forage. The estimation of the quantity of rangeland foliage and its spatial distribution has been studied and reliable results achieved. Traditional methods to determine quality involve collection of field
-
2008-01-01
the American Mosquito Control Association, 24(4):543–549, 2008 Copyright E 2008 by The American Mosquito Control Association, Inc. 543 Report...southern red cedar (Juniperus silicicola J. Silba), beauty berry (Callicarpa americana L.), and bay trees ( Persea spp.). Insecticides Permethrin...plant foliage to adult 544 JOURNAL OF THE AMERICAN MOSQUITO CONTROL ASSOCIATION VOL. 24, NO. 4 Cx. quinquefasciatus. A single leaf was exposed to 10–15
-
Rakesh Minocha; Gabriela Martinez; Benjamin Lyons; Stephanie Long
2009-01-01
Despite the availability of several protocols for the extraction of chlorophylls and carotenoids from foliage of forest trees, information regarding their respective extraction efficiencies is scarce. We compared the efficiencies of acetone, ethanol, dimethyl sulfoxide (DMSO), and N, N-dimethylformamide (DMF) over a range of incubation times for the extraction of...
-
D. D. Davis; J. M. Skelly; B. L. Nash
1995-01-01
Foliage was sampled in June and late August-early September in 1988 and 1989 from the outer crowns of codominant red maple (Acer rubrum L.), northern red oak (Quercus rubra L.), and white oak (Q. alba L.) trees in forest stands along an atmospheric deposition gradient in north-central Pennsylvania. Leaf samples...
-
Analysis of foliage effects on mobile propagation in dense urban environments
Bronshtein, Alexander; Mazar, Reuven; Lu, I.-Tai
2000-07-01
Attempts to reduce the interference level and to increase the spectral efficiency of cellular radio communication systems operating in dense urban and suburban areas lead to the microcellular approach with a consequent requirement to lower antenna heights. In large metropolitan areas having high buildings this requirement causes a situation where the transmitting and receiving antennas are both located below the rooftops, and the city street acts as a type of a waveguiding channel for the propagating signal. In this work, the city street is modeled as a random multislit waveguide with randomly distributed regions of foliage parallel to the building boundaries. The statistical propagation characteristics are expressed in terms of multiple ray-fields approaching the observer. Algorithms for predicting the path-loss along the waveguide and for computing the transverse field structure are presented.
-
Dry deposition of sulfate to Quercus rubra and Liriodendron tulipifera foliage
International Nuclear Information System (INIS)
Vandenberg, J.J.
1987-01-01
Estimates were made of the rate of dry deposition to red oak (Quercus rubra) and tulip poplar (Liriodendron tulipifera) foliage. In the laboratory, radioactive ammonium sulfate aerosols were generated in an exposure chamber. These aerosols were dry deposited onto leaves that were sequentially washed to examine the efficacy of washing procedures in removal of surface deposits. Over 90% of dry deposited sulfate was removed after a 30 second wash duration. Laboratory procedures also estimated the magnitude of foliar sulfur that leached into leaf wash solutions. The majority of laboratory leaves demonstrated no leaching of sulfur from the internal pool. However, some leaves showed significant sulfur leaching. It was concluded that leaching of internal sulfur was highly leaf specific. This indicated that each leaf used in field experiments needed to be individually examined for leaching
-
Directory of Open Access Journals (Sweden)
Simone Kartsiotis
2018-01-01
Full Text Available This report presents a comparison via field-testing between Parrot Sequoia and Mapir Survey2 multispectral cameras. Both sensors are commonly used in precision farming activities conducted by micro-RPAS (drones, thanks to their small size and light weight. The experimental activity was performed in summer on the vineyards of the Savignola Paolina agricultural holding in Tuscany. The sensors were taken on board the EXOS drone, a hexacopter developed by Zephyr S.r.l. company and specifically designed for precision farming operations. Good and bad qualities for each cameras are examined by a comprehensive approach, starting from technical specifications and continuing with a comparison of the results obtained on field. All the activity was performed by a partnership between the companies DroneBee and Zephyr S.r.l. .
-
Rakesh Minocha; Bradley Chamberlain; Stephanie Long; Swathi A. Turlapati; Gloria. Quigley
2015-01-01
The main goal of this study was to develop a method for the extraction and indirect estimation of the quantity of calcium oxalate (CaOx) in the foliage of trees. Foliar tissue was collected from a single tree of each species (five conifers and five hardwoods) for comparison of extractions in different solvents using 10 replicates per species from the same pool of...
-
Pisek, J.
2017-12-01
Clumping index (CI) is the measure of foliage aggregation relative to a random distribution of leaves in space. CI is an important factor for the correct quantification of true leaf area index (LAI). Global and regional scale CI maps have been generated from various multi-angle sensors based on an empirical relationship with the normalized difference between hotspot and darkspot (NDHD) index (Chen et al., 2005). Ryu et al. (2011) suggested that accurate calculation of radiative transfer in a canopy, important for controlling gross primary productivity (GPP) and evapotranspiration (ET) (Baldocchi and Harley, 1995), should be possible by integrating CI with incoming solar irradiance and LAI from MODIS land and atmosphere products. It should be noted that MODIS LAI/FPAR product uses internal non-empirical, stochastic equations for parameterization of foliage clumping. This raises a question if integration of the MODIS LAI product with empirically-based CI maps does not introduce any inconsistencies. Here, the consistency is examined independently through the `recollision probability theory' or `p-theory' (Knyazikhin et al., 1998) along with raw LAI-2000/2200 Plant Canopy Analyzer (PCA) data from > 30 sites, surveyed across a range of vegetation types. The theory predicts that the amount of radiation scattered by a canopy should depend only on the wavelength and the spectrally invariant canopy structural parameter p. The parameter p is linked to the foliage clumping (Stenberg et al., 2016). Results indicate that integration of the MODIS LAI product with empirically-based CI maps is feasible. Importantly, for the first time it is shown that it is possible to obtain p values for any location solely from Earth Observation data. This is very relevant for future applications of photon recollision probability concept for global and local monitoring of vegetation using Earth Observation data.
-
E.R Peña-Mendoza; A. Gómez-Guerrero; Mark Fenn; P. Hernández de la Rosa; D. Alvarado Rosales
2016-01-01
The nutritional content and tree top in the forests are evaluated of Abies religiosa, San Miguel Tlaixpan (SMT) and Rio Frio (RF), State of Mexico. The work had two parts. In the first, the nutritional content was evaluated in new foliage (N, P, K, Ca and Mg) in Abies religiosa trees, in periods of spring, summer and winter, in...
-
Foliage response of young central European oaks to air warming, drought and soil type.
Günthardt-Goerg, M S; Kuster, T M; Arend, M; Vollenweider, P
2013-01-01
Three Central European oak species, with four provenances each, were experimentally tested in 16 large model ecosystem chambers for their response to passive air warming (AW, ambient +1-2 °C), drought (D, -43 to -60% irrigation) and their combination (AWD) for 3 years on two forest soil types of pH 4 or 7. Throughout the entire experiment, the influence of the different ambient and experimental climates on the oak trees was strong. The morphological traits of the Quercus species were affected in opposing ways in AW and D treatments, with a neutral effect in the AWD treatment. Biochemical parameters and LMA showed low relative plasticity compared to the morphological and growth parameters. The high plasticity in physiologically important parameters of the three species, such as number of intercalary veins or leaf size, indicated good drought acclimation properties. The soil type influenced leaf chlorophyll concentration, C/N and area more than drought, whereas foliage mass was more dependent on drought than on soil type. Through comparison of visible symptom development with the water deficits, a drought tolerance threshold of -1.3 MPa was determined. Although Q. pubescens had xeromorphic leaf characteristics (small leaf size, lower leaf water content, high LMA, pilosity, more chlorophyll, higher C/N) and less response to the treatments than Q. petraea and Q. robur, it suffered more leaf drought injury and shedding of leaves than Q. petraea. However, if foliage mass were used as the criterion for sustainable performance under a future climate, Q. robur would be the most appropriate species. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.
-
Avramidou, Evangelia V; Doulis, Andreas G; Aravanopoulos, Filippos A
2015-05-15
Genetic inheritance and epigenetic inheritance are significant determinants of plant evolution, adaptation and plasticity. We studied inheritance of restriction site polymorphisms by the f-AFLP method and epigenetic DNA cytosine methylation inheritance by the f-MSAP technique. The study involved parents and 190 progeny of a Cupressus sempervirens L. full-sib family. Results from AFLP genetic data revealed that 71.8% of the fragments studied are under Mendelian genetic control, whereas faithful Mendelian inheritance for the MSAP fragments was low (4.29%). Further, MSAP fragment analysis showed that total methylation presented a mean of 28.2%, which was higher than the midparent value, while maternal inheritance was higher (5.65%) than paternal (3.01%). Interestingly de novo methylation in the progeny was high (19.65%) compared to parental methylation. Genetic and epigenetic distances for parents and offspring were not correlated (R(2)=0.0005). Furthermore, we studied correlation of total relative methylation and CG methylation with growth (height, diameter). We found CG/CNG methylation (N: A, C, T) to be positively correlated with height and diameter, while total relative methylation and CG methylation were positively correlated with height. Results are discussed in light of further research needed and of their potential application in breeding. Copyright © 2015 Elsevier B.V. All rights reserved.
-
Foliage and Grass as Fuel Pellets–Small Scale Combustion of Washed and Mechanically Leached Biomass
Directory of Open Access Journals (Sweden)
Jan Hari Arti Khalsa
2016-05-01
Full Text Available The high contents of disadvantageous elements contained in non-woody biomass are known to cause problems during small and large scale combustion, typically resulting in a higher risk of slagging, corrosion, and increased emissions. Mechanically leaching the respective elements from the biomass through a sequence of process steps has proven to be a promising solution.The florafuel process used here is comprised of size reduction followed by washing and subsequent mechanical dewatering of the biomass. Densification of the upgraded biomass into standardized pellets (Ø 6mm enables an application in existing small-scale boilers. The presented combustion trials investigated the performance of pellets made from leached grass, foliage and a mixture of both in two small-scale boilers (<100 kWth with slightly different technology (moving grate versus water-cooled burner tube during a 4-h measurement period. Emissions were in accordance with German emissions standards except for NOx (threshold is 0.50 g/m3 in the case of pure grass pellets (0.51 g/m3 and particulate matter (PM in all but one case (foliage, 13–16 mg/m3. An electrostatic precipitator (ESP unit installed with one of the boilers successfully reduced PM emission of both the grass and mixture fuel below the threshold of 20 mg/m3 (all emission values refer to 13 vol.% O2, at standard temperature and pressure (STP. Bottom ash composition and grate temperature profiles were analyzed and discussed for one of the boilers.
-
Huber, Ann; Das, Adrian; Wenk, Rebecca; Haultain, Sylvia
2013-01-01
Sequoia and Kings Canyon National Parks are located in the California Floristic Province, which has been named one of world‘s hotspots of endemic biodiversity (Myers et al. 2000). The California Floristic Province is the largest and most important geographic floristic unit in California and extends from the Klamath Mountains of southwestern Oregon to the northwestern portion of Baja California (Hickman 1993). The Sierra Nevada, one of six regions that make up the California Floristic Province, covers nearly 20% of the land in California yet contains over 50% of its flora. Within the Sierra Nevada, the southern Sierra supports more Sierran endemic and rare plant taxa than the central and northern portions of the region (Shevock 1996). Sequoia and Kings Canyon National Parks (SEKI) encompass roughly 20% of the southern Sierra Nevada region. The parks overlap three floristic subregions (central Sierra Nevada High, southern Sierra Nevada High, and southern Sierra Nevada Foothills), and border the Great Basin Floristic Province. The parks support a rich and diverse vascular flora composed of over 1,560 taxa. Of these, 150 taxa are identified as having special status. The term special status is applied here to include taxa that are state or federally listed, rare in California, or at risk because they have a limited distribution. Only one species from these parks is listed under the state or federal Endangered Species Acts (Carex tompkinsii, Tompkins‘ sedge, is listed as a rare species under the California Endangered Species Act), and one species is under review for federal endangered listing (Pinus albicaulis, whitebark pine). However, an absence of threatened and endangered species recognized by Endangered Species Acts is not equivalent to an absence of species at risk. There are 83 plant taxa documented as occurring in SEKI that are considered imperiled or vulnerable in the state by the California Department of Fish and Game‘s California Natural Diversity
-
Wilzbach, P.; Frazey, S.
2005-05-01
Productivities of resident salmonid populations, upland, and riparian areas in 25 small watersheds of coastal northern California were estimated and compared to determine if: 1) upland site productivity predicted riparian site productivity; 2) either upland or riparian site productivity predicted salmonid productivity; and 3) other parameters explained more of the variance in salmonid productivity than upland or riparian site productivity. Salmonid productivity was indexed by total salmonid biomass, length of age 1 fish, and percent habitat saturation. Upland and riparian site productivities were estimated using site indices for redwood (Sequoia sempervirens) and red alder (Alnus rubra), respectively. Upland and riparian site indices were correlated, but neither factor contributed to the best approximating models of salmonid biomass or fish length at age one. Salmonid biomass was best described by a positive relationship with drainage area, and length at age was best described by a positive relationship with percent of riparian hardwoods. Percent habitat saturation was not well described by any of the models constructed. Lack of a relationship between upland conifer and salmonid productivity suggests that management of land for timber productivity and component streams for salmonid production in these sites will require separate, albeit integrated, strategies.
-
Directory of Open Access Journals (Sweden)
Christopher R. Keyes
2014-02-01
Full Text Available Restoration of second-growth riparian stands has become an important issue for managers of redwood (Sequoia sempervirens [D. Don] Endl. forest reserves. Identifying differences between old-growth and second-growth forest vegetation is a necessary step in evaluating restoration needs and targets. The objective of this study was to characterize and contrast vegetation structure and composition in old-growth and unmanaged second-growth riparian forests in adjacent, geomorphologically similar watersheds at Redwood National Park. In the old-growth, redwood was the dominant overstory species in terms of stem density, basal area, and importance values. Second-growth was dominated by red alder (Alnus rubra Bong., Douglas-fir (Pseudotsuga menziesii [Mirbel] Franco, and redwood. Understory species were similar in both forests, with several key differences: Oxalis oregana Nutt. and Trillium ovatum Pursh had greater importance values in the old-growth, and Vaccinium parvifolium Sm., Dryopteris spp. and sedges Carex spp. had greater importance values in the second-growth. Notable differences in structure and composition suggest that restoration practices such as thinning could expedite the acquisition of old-growth characteristics in second-growth riparian forests.
-
International Nuclear Information System (INIS)
Hawke, D.J.; Newman, J.
2007-01-01
To assess the effect of nutrient inputs from breeding seabirds on forest foliage δ 13 C and δ 15 N, we collected foliage samples from two contrasting locations. Olearia lyallii forest on North East Island at The Snares hosts large numbers of (in particular) breeding sooty shearwaters (Puffinus griseus). At Mason Bay (Rakiura/Stewart Island), samples of Brachyglottis rotundifolia, Griselinia littoralis, and Dracophyllum longifolium were collected from two strata within diverse dune forest and one stratum from the open dunes. The δ 13 C results were typical of C 3 plants and did not differ significantly between Mason Bay and North East Island. In contrast, the δ 15 N results from Mason Bay (mean ± standard deviation, -6.1 ± 1.7 permille) were significantly lower than expected for temperate forest (95% confidence interval of difference, 2.7-3.9 permille), and dramatically lower (19.1-21.5 permille) than North East Island where enrichments (+14.2 ± 3.1 permille) were among the highest ever reported for vegetation. (author). 33 refs., 1 fig., 2 tabs
-
International Nuclear Information System (INIS)
Alvarez Cordero, O. F.
2001-01-01
The foliage analyses give information about the nutritional state of the plant in the past, this is that it should have lapsed time enough so that the changes are manifested in the composition of fabrics of the foliage. A nutritional pursuit, based on variations in the concentration of elements in the sap of the plant could indicate that this is nutritionally happening in the plant in the moment. This can be a tool to predict symptoms caused by nutritional anomalies in an immediate form, being able to correct more quickly the problem and to reduce the time of exhibition from the plant to the nutritional tension. The nitrogen (N) and the potassium (K) are two elements that the tomato plants require in big quantities, therefore in search of validating new methodologies, this work had as objectives: 1) To determine the utility of the levels of N and K obtained in sap analysis as a tool for the detection of nutritional lacks and as an indicator of the concentration of N and K in the nutritious solution. 2) To compare the results of analysis of sap of petioles with the routine analyses of fabric to foliate. (Author) [es
-
A lightning multiple casualty incident in Sequoia and Kings Canyon National Parks.
Spano, Susanne J; Campagne, Danielle; Stroh, Geoff; Shalit, Marc
2015-03-01
Multiple casualty incidents (MCIs) are uncommon in remote wilderness settings. This is a case report of a lightning strike on a Boy Scout troop hiking through Sequoia and Kings Canyon National Parks (SEKI), in which the lightning storm hindered rescue efforts. The purpose of this study was to review the response to a lightning-caused MCI in a wilderness setting, address lightning injury as it relates to field management, and discuss evacuation options in inclement weather incidents occurring in remote locations. An analysis of SEKI search and rescue data and a review of current literature were performed. A lightning strike at 10,600 feet elevation in the Sierra Nevada Mountains affected a party of 5 adults and 7 Boy Scouts (age range 12 to 17 years old). Resources mobilized for the rescue included 5 helicopters, 2 ambulances, 2 hospitals, and 15 field and 14 logistical support personnel. The incident was managed from strike to scene clearance in 4 hours and 20 minutes. There were 2 fatalities, 1 on scene and 1 in the hospital. Storm conditions complicated on-scene communication and evacuation efforts. Exposure to ongoing lightning and a remote wilderness location affected both victims and rescuers in a lightning MCI. Helicopters, the main vehicles of wilderness rescue in SEKI, can be limited by weather, daylight, and terrain. Redundancies in communication systems are vital for episodes of radio failure. Reverse triage should be implemented in lightning injury MCIs. Education of both wilderness travelers and rescuers regarding these issues should be pursued. Copyright © 2015 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.
-
Surveillance Unattended Foliage Penetrating Radar for Border Control and Homeland Protection
Directory of Open Access Journals (Sweden)
Felicia Amato
2013-06-01
Full Text Available The increasing request for safety, security and environment protection at local and national level reveal the deficiency of the traditional surveillance and control centers to satisfy the needs and requirements of modern border control systems for homeland protection where land border is expected to be monitored as well as the maritime one. This is, for instance, the case of any land border affected by hidden immigration and/or illegal traffics as well as any small areas such as critical infrastructures or military/ civilian posts in forest or jungle environment characterized by vegetation. In such challenging environment, logistics constraints strongly recommend to have very low power devices able to operate months or years without maintenance. A such scenario should be the perfect place for implementing an Unattended Ground Sensors (UGS network making use FOliage PENetration (FOPEN radar for border control. The paper aims to present the basic characteristics and preliminary results of a Surveillance Unattended FOPEN (SUF radar suitable for detecting moving targets, people or vehicles, in dense forest environment.
-
Climatic and physiological effects on leaf and tree-ring stable isotopes in California redwoods
Ambrose, A. R.; Baxter, W.; Wong, C.; Dawson, T. E.; Carroll, A.; Voelker, S.
2016-12-01
Variation in the stable isotope composition of organic matter can provide important information about environmental change and biological responses to it. We analyzed the stable carbon (d13C) and oxygen (d18O) isotope ratios of leaves and of the cellulose from individual tree-rings of California's two redwood species to examine how these trees have responded to environmental variation and change in both time and space. Analyses of leaf d13C for both coast redwood (Sequoia sempervirens) and giant sequoia (Sequoiadendron giganteum) from throughout their geographical ranges show a marked gradient with tree height for trees of all sizes and ages but no clear difference among species or populations. The gradient is best explained by tree response to changes in both microenvironment and physiology that are known to change with height. In contrast, leaf d18O for both species showed no clear relationship with height but very clear differences between species and populations with giant sequoia displaying a much stronger inferred leaf-level response to the higher evaporative conditions present in the Sierra Nevada mountains as compared to the coast. Both species showed population-level differences with the driest and warmest sites most distinct from all of the others. Intra-annual analyses of d13C and d18O in tree-rings over a 21-year period (1974-1994) were also used to explore how climate and tree response to climate was recorded for both species. These analyses revealed unique (local) climatic effects and response to the climate for each species and population of both redwood species. Most pronounced was a significant increase in intrinsic Water Use Efficiency (iWUE) derived from d13C data over the study period in both species, and a distinct d18O response in relation to drought (e.g. 1976/1977) and to warmer days and nights and above-average precipitation (e.g., 1982-1985). Patterns of co-variation in d13C and d18O in both species suggest that during dry and also warm
-
Hariram, Manisha; Sahu, Ravi; Elumalai, Suresh Pandian
2018-01-01
Plant species grown in the vicinity of thermal power plants (TPP) are one of the immobile substrates to sink most of the pollutants emitted from their stacks. The continuous exposure of toxic pollutants to these plants may affect their resistances and essential biochemical's concentrations. In the present study, we estimated the impact of dust load generated by a TPPs to plant's dust retention capacity and pollution resistances (APTI and API). The observed ambient air quality index (AQI) showed that the surroundings of TPPs are in the severe air pollution category. Observed AQI was greater than 100 in the surrounding area of TPP. The mean dust load on plant foliage was significantly greater in the polluted site compared with the control site: 4.45 ± 1.96 versus 1.38 ± 0.41 mg cm -2 . Nearby, TPP highest and lowest dust load were founded in F. benghalensis (7.58 ± 0.74) and F. religiosa (2.25 ± 0.12 mg cm -2 ) respectively. Analysis revealed the strong negative correlation between dust load and essential pigments of foliage, such as chlorophyll content, carotenoids, pH of foliage extract, and relative water content. Conversely, strong positive correlation was observed with the ascorbic acid content of plant species. Correlation and percentage change analysis in ascorbic acid content for the polluted site against the control site showed the adverse impact on plants due to dust load. Based on their responses to dust pollution, A. scholaris, P. longifolia, and M. indica were observed as most suitable plant species. Estimation of DRC, chlorophyll a/b ratio, APTI and API revealed the A. scholaris, F. benghalensis, P. longifolia, and M. indica as the most suitable plant species for green belt formation. The high gradation was obtained in A. scholaris, F. benghalensis, P. longifolia, and M. indica for opted parameters and showed their most suitability for green belt formation. Salient features of the present study provide useful evidences to estimate the
-
de Jong, Steven M.; Addink, Elisabeth A.; Hoogenboom, Priscilla; Nijland, Wiebe
2012-11-01
The European Mediterranean regions are expected to encounter drier summer conditions and warmer temperatures for the winter of +2 °C and of +5 °C for the summer in the next six decennia. As a result the natural vegetation will face harsher conditions due to lower water availability, longer summer droughts and higher temperatures resulting in plant stress conditions. To monitor vegetation conditions like stress and leaf area index dynamics in our study area in Mediterranean France we use earth observation techniques like imaging spectroscopy. To assist image analysis interpretation we carried out a laboratory experiment to investigate the spectral and visible response of Buxus sempervirens, a common Mediterranean species, to five different types of stress: drought, drought-and-heat, light deprivation, total saturation and chlorine poisoning. For 52 days plants were subjected to stress. We collected data on the visible and spectral signs, and calculated thirteen vegetation indices. The plant's response time to different stress types varied from 10 to 32 days. Spectroscopic techniques revealed plant stress up to 15 days earlier than visual inspection. Visible signs of stress of the plants included curling and shrinking of the leaves, de-colouring of the leaves, leaves becoming breakable, opening up of the plant's canopy and sagging of the branches. Spectral signs of stress occurred first in the water absorption bands at 1450 and 1940 nm, followed by reduced absorption in the visible wavelengths, and next by reduced reflectance in near infrared. Light deprivation did not result in any stress signs, while drought, drought and heat and chlorine poisoning resulted in significant stress. The spectral response did not show differences for different stress types. Analysis of the vegetation indices identified the Carter-2 (R695/R760), the Red-Green Index (R690/R550) and the Vogelman-2 (R734 - R747)/(R715 + R726) as the best performing ones to identify stress. The lab
-
Nanus, L.; Clow, D. W.; Sickman, J. O.
2016-12-01
High-elevation aquatic ecosystems in Yosemite (YOSE) and Sequoia and Kings Canyon (SEKI) National Parks are impacted by atmospheric nitrogen (N) deposition associated with local and regional air pollution. Documented effects include elevated surface water nitrate concentrations, increased algal productivity, and changes in diatom species assemblages. Annual wet inorganic N deposition maps, developed at 1-km resolution for YOSE and SEKI to quantify N deposition to sensitive high-elevation ecosystems, range from 1.0 to over 5.0 kg N ha-1 yr-1. Critical loads of N deposition for nutrient enrichment of aquatic ecosystems were quantified and mapped using a geostatistical approach, with N deposition, topography, vegetation, geology, and climate as potential explanatory variables. Multiple predictive models were created using various combinations of explanatory variables; this approach allowed us to better quantify uncertainty and more accurately identify the areas most sensitive to atmospherically deposited N. The lowest critical loads estimates and highest exceedances identified within YOSE and SEKI occurred in high-elevation basins with steep slopes, sparse vegetation, and areas of neoglacial till and talus. These results are consistent with previous analyses in the Rocky Mountains, and highlight the sensitivity of alpine ecosystems to atmospheric N deposition.
-
Directory of Open Access Journals (Sweden)
Kevin L. O’Hara
2017-04-01
Full Text Available Coast redwood (Sequoia sempervirens (Lamb. ex. D. Don Endl. is unique among conifer species because of its longevity, the great sizes of individual trees, and its propensity to reproduce through sprouts. Timber harvesting in the native redwood range along the coast of the western United States has necessitated restoration aimed to promote old forest structures to increase the total amount of old forest, the connectivity between old forests, and to enhance the resiliency of these ecosystems. After disturbance or harvest, healthy redwood stumps sprout vigorously, often producing dozens of sprouts within two years of disturbance. These sprouts form highly aggregated spatial patterns because they are clustered around stumps that may number less than 50 ha−1. Thinning of sprouts can accelerate individual tree growth, providing an effective restoration strategy to accelerate formation of large trees and old forest structures or increase stand growth for timber production. However, management, including restoration activities, is a contentious issue throughout the native range of redwood because of the history of overexploitation of this resource and perceptions that overexploitation is continuing. This paper reviews the science of early stand dynamics in coast redwood and their implications for restoration and other silvicultural strategies.
-
Translocation, accumulation and distribution of 137Cs in spring wheat after foliage contamination
International Nuclear Information System (INIS)
Fan Zhongxue; Xu Shiming; Zhao Wenhu; Hou Lanxin; Li Xia
1995-05-01
The foliage absorption of 137 Cs by spring wheat and the accumulation and distribution of 137 Cs in non-contaminated parts of the plant were studied. The results showed that there was a linear relationship between the content of 137 Cs and the amount of the contamination in each part of the plant. The distribution of 137 Cs in each part of the plant was related with the phyllotaxis of the contaminated leaf, but the majority of 137 Cs in the ear was distributed in the husk. The accumulation of 137 Cs in non-contaminated leaves gradually decrease with the increasing of the relative phyllotaxy distance between non-contaminated leaves and the contaminated leaf. The order of the specific activity of 137 Cs is the leaf>the stem>the ear in the tillering. The translocation rate of 137 Cs to seeds is in direct proportion to physiological metabolic activity of the treated leaf and is also related to its phyllotaxis. (11 tabs., 4 figs.)
-
Kvacek; Manchester; Schorn
2000-03-01
The cupressaceous genus Tetraclinis is recognized from the Oligocene and Miocene of western North America on the basis of co-occurring seed cones, seeds, and foliage branches. Morphological and anatomical comparisons with the two previously recognized European Tertiary species indicate that the North American specimens are morphologically inseparable from Tetraclinis salicornioides (Unger) Kvacek. The North American taxon is treated as a new variety, T. salicornioides (Unger) Kvacek var. praedecurrens (Knowlton) comb. et stat. nov., and is distinguished from the European representatives, T. salicornioides (Unger) Kvacek var. salicornioides, by slight anatomical differences in the leaf epidermis. Although cones and seeds of the fossil species are closely similar to those of extant Tetraclinis articulata, the foliage is more "spreading," composed of flattened segments with fused facial and lateral leaves that are apparently adaptive for a more mesic climate. The recognition of T. salicornioides in western North America along with the absence of Tetraclinis in the fossil and recent flora of eastern Asia provide evidence for communication of the species across the North Atlantic during the early or middle Tertiary.
-
2014-01-01
Background Gelsemium sempervirens L. (Gelsemium s.) is a traditional medicinal plant, employed as an anxiolytic at ultra-low doses and animal models recently confirmed this activity. However the mechanisms by which it might operate on the nervous system are largely unknown. This work investigates the gene expression of a human neurocyte cell line treated with increasing dilutions of Gelsemium s. extract. Methods Starting from the crude extract, six 100 × (centesimal, c) dilutions of Gelsemium s. (2c, 3c, 4c, 5c, 9c and 30c) were prepared according to the French homeopathic pharmacopoeia. Human SH-SY5Y neuroblastoma cells were exposed for 24 h to test dilutions, and their transcriptome compared by microarray to that of cells treated with control vehicle solutions. Results Exposure to the Gelsemium s. 2c dilution (the highest dose employed, corresponding to a gelsemine concentration of 6.5 × 10-9 M) significantly changed the expression of 56 genes, of which 49 were down-regulated and 7 were overexpressed. Several of the down-regulated genes belonged to G-protein coupled receptor signaling pathways, calcium homeostasis, inflammatory response and neuropeptide receptors. Fisher exact test, applied to the group of 49 genes down-regulated by Gelsemium s. 2c, showed that the direction of effects was significantly maintained across the treatment with high homeopathic dilutions, even though the size of the differences was distributed in a small range. Conclusions The study shows that Gelsemium s., a medicinal plant used in traditional remedies and homeopathy, modulates a series of genes involved in neuronal function. A small, but statistically significant, response was detected even to very low doses/high dilutions (up to 30c), indicating that the human neurocyte genome is extremely sensitive to this regulation. PMID:24642002
-
International Nuclear Information System (INIS)
Saucedo Hernandez, Yanelis; Mohamad Safa, Bassam; Gonzalez Bedia, Mirtha Mayra
2010-01-01
It is required a specific analysis technique allowing the follow-up to stability study intrinsic of Parthenium hysterophorus L. (escoba amarga) powdered dry foliage to achieve in a pharmaceutical way a antiparasitic usefulness with the quality, safety and effectiveness demanded requirements. High performance liquid chromatography was applied to P. hysterophorus degraded samples under degradation conditions in an oxidative, basic and acid medium. The analysis technique specificity was assessed to detect the interest component without interferences of its degradation products and its possible usefulness in studies on solid stability in the plant powder
-
Variation in composition and yield of foliage oil of eucalyptus polybractea
International Nuclear Information System (INIS)
Iqbal, Z.; Akhtar, M.; Qureshi, T.M.; Ahhter, J.; Ahmad, R.
2011-01-01
Eucalyptus polybractea (blue mallee) is the essential oil rich species used in the commercial production of pharmaceutical-grade Eucalyptus oil in Australia. This species was grown at Nuclear Institute for Agriculture and Biology (NIAB), Faisalabad, Pakistan during 2004-08 to investigate the quantity and quality of its foliage oil. The oils were extracted by hydro-distillation method, from the leaves of four year aged ten E. polybractea plants. The data showed a significant intra-species variation in their oil contents (29.3 to 41.8 mg g-1 fresh weight of leaves). Out of ten plants eight contained oil >30 mg g/sup -1/ fresh weight of leaves. The components of the extracted oils varied from 12-26 as detected by GC/FID on Carbowax 20 M packed glass column. Among all the oil components, 1, 8-cineole was the major compound (91.7-94.2 %), while the other identified compounds were alpha-pinene (0-1.2 %), beta-pinene (0.4-2.3 %), limonene (0.2-1.3 %), p-cymene (1.23-2.75 %), and terpinene-4-ol (0.6-0.92 %). The extracted oils from all the Eucalyptus polybractea plants contained high amount of 1, 8-cineole (>90 %), therefore, classified as species of high quality medicinal oil. (author)
-
Directory of Open Access Journals (Sweden)
E. D. Wannaz
2012-01-01
Full Text Available A pollution gradient was observed in tree foliage sampled in the vicinity of a large aluminium production facility in Patagonia (Argentina. Leaves of Eucalyptus rostrata, and Populus hybridus and different needle ages of Pinus spec. were collected and concentrations of aluminium (Al and sulphur (S as well as physiological parameters (chlorophyll and lipid oxidation products were analyzed. Al and S concentrations indicate a steep pollution gradient in the study showing a relationship with the physiological parameters in particular membrane lipid oxidation products. The present study confirms that aluminium smelting results in high Al and sulphur deposition in the study area, and therefore further studies should be carried out taking into account potentially adverse effects of these compounds on human and ecosystem health.
-
New foliage growth is a significant, unaccounted source for volatiles in boreal evergreen forests
Aalto, J.; Kolari, P.; Hari, P.; Kerminen, V.-M.; Schiestl-Aalto, P.; Aaltonen, H.; Levula, J.; Siivola, E.; Kulmala, M.; Bäck, J.
2014-03-01
Estimates of volatile organic compound (VOC) emissions from forests are based on the assumption that foliage has a steady emission potential over its lifetime, and that emissions are mainly modified by short-term variations in light and temperature. However, in many field studies this has been challenged, and high emissions and atmospheric concentrations have been measured during periods of low biological activity, such as in springtime. We conducted measurements during three years, using an online gas-exchange monitoring system to observe volatile organic emissions from a mature (1 year-old) and a growing Scots pine shoot. The emission rates of organic vapors from vegetative buds of Scots pine during the dehardening and rapid shoot growth stages were one to two orders of magnitude higher than those from mature foliage; this difference decreased and finally disappeared when the new shoot was maturing in late summer. On average, the springtime monoterpene emission rate of the bud was about 500 times higher than that of the mature needles; during the most intensive needle elongation period, the monoterpene emission rate of the growing needles was 3.5 higher than that of the mature needles, and in September the monoterpene emission rate of the same years' needles was even lower (50%) than that of the previous years' needles. For other measured compounds (methanol, acetone and methylbutenol) the values were of the same order of magnitude, except before bud break in spring, when the emission rates of buds for those compounds were on average about 20-30 times higher than that of mature needles. During spring and early summer the buds and growing shoots are a strong source of several VOCs, and if they are not accounted for in emission modeling a significant proportion of the emissions - from a few percent to even half of the annual cumulative emissions - will remain concealed. The diurnal emission pattern of growing shoots differed from the diurnal cycle in temperature as
-
Cobb, Richard C; Eviner, Valerie T; Rizzo, David M
2013-10-01
Few studies have quantified pathogen impacts to ecosystem processes, despite the fact that pathogens cause or contribute to regional-scale tree mortality. We measured litterfall mass, litterfall chemistry, and soil nitrogen (N) cycling associated with multiple hosts along a gradient of mortality caused by Phytophthora ramorum, the cause of sudden oak death. In redwood forests, the epidemiological and ecological characteristics of the major overstory species determine disease patterns and the magnitude and nature of ecosystem change. Bay laurel (Umbellularia californica) has high litterfall N (0.992%), greater soil extractable NO3 -N, and transmits infection without suffering mortality. Tanoak (Notholithocarpus densiflorus) has moderate litterfall N (0.723%) and transmits infection while suffering extensive mortality that leads to higher extractable soil NO3 -N. Redwood (Sequoia sempervirens) has relatively low litterfall N (0.519%), does not suffer mortality or transmit the pathogen, but dominates forest biomass. The strongest impact of pathogen-caused mortality was the potential shift in species composition, which will alter litterfall chemistry, patterns and dynamics of litterfall mass, and increase soil NO3 -N availability. Patterns of P. ramorum spread and consequent mortality are closely associated with bay laurel abundances, suggesting this species will drive both disease emergence and subsequent ecosystem function. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
-
Directory of Open Access Journals (Sweden)
Kevin L. O’Hara
2010-08-01
Full Text Available Tanoak (Notholithocarpus densiflorus syn. Lithocarpus densiflorus is one of the most widespread and abundant associates of coast redwood (Sequoia sempervirens, but little is known about the structural relationships between these two species. Knowledge of such relationships is essential for a thorough understanding of the impacts of sudden oak death (caused by the exotic pathogen Phytophthora ramorum, which is currently decimating tanoak populations throughout the redwood range. In this study, we utilized a stratified plot design and a stand reconstruction technique to assess structural impacts, at present and in the future, of this emerging disease. We found that residual trees in diseased plots were more aggregated than trees in unaffected plots, and we predicted that the loss of tanoak will lead to the following short-term changes: greater average diameter, height, height-to-live-crown, and crown length, as well as an increase in average nearest neighbor differences for diameter, height, and crown length. In addition, plots lacking tanoak (living or dead—as compared to plots with tanoak—exhibited greater average diameter and increased nearest neighbor differences with regard to diameter, height, and crown length. We also conducted a preliminary exploration of how sudden oak death-induced structural changes compare with typical old-growth characteristics, and how this disease may affect the structure of old-growth forests.
-
Liao, Guojian; Wu, Qianhua; Feng, Renwei; Guo, Junkang; Wang, Ruigang; Xu, Yingming; Ding, Yongzhen; Fan, Zhilian; Mo, Liangyu
2016-04-01
Paddy soils in many regions of China have been seriously polluted by multiple heavy metals or metalloids, such as arsenic (As), cadmium (Cd) and lead (Pb). In order to ensure the safety of food and take full advantage of the limited farmland resources of China, exploring an effective technology to repair contaminated soils is urgent and necessary. In this study, three technologies were employed, including variety screening, water management and foliage dressing, to assess their abilities to reduce the accumulation of Cd and As in the grains of different rice varieties, and meanwhile monitor the related yields. The results of variety screening under insufficient field drying condition showed that the As and Cd contents in the grains of only four varieties [Fengliangyouxiang 1 (P6), Zhongzheyou 8 (P7), Guangliangyou 1128 (P10), Y-liangyou 696 (P11)] did not exceed their individual national standard. P6 gained a relatively high grain yield but accumulated less As and Cd in the grains despite of the relatively high As and Cd concentrations in the rhizosphere soil. However, long-playing field drying in water management trial significantly increased Cd but decreased As content in the grains of all tested three varieties including P6, suggesting an important role of water supply in controlling the accumulation of grain As and Cd. Selenium (Se) showed a stronger ability than silicon (Si) to reduce As and Cd accumulation in the grains of Fengliangyou 4 (P2) and Teyou 524 (P13), and keep the yields. The results of this study suggest that combined application of water management and foliage dressing may be an efficient way to control As and Cd accumulation in the grains of paddy rice exposing to As- and Cd-contaminated soils. Copyright © 2016 Elsevier Ltd. All rights reserved.
-
International Nuclear Information System (INIS)
Staszak, J.; Grulke, N.E.; Marrett, M.J.; Prus-Glowacki, W.
2007-01-01
Effects of canopy ozone (O 3 ) exposure and signatures of genetic structure using isozyme markers associated with O 3 tolerance were analyzed in ∼20-, ∼80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O 3 exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O 3 exposure, and to higher O 3 exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine
-
Directory of Open Access Journals (Sweden)
Steve Wathen
Full Text Available Evidence for significant losses of species richness or biodiversity, even within protected natural areas, is mounting. Managers are increasingly being asked to monitor biodiversity, yet estimating biodiversity is often prohibitively expensive. As a cost-effective option, we estimated the spatial and temporal distribution of species richness for four taxonomic groups (birds, mammals, herpetofauna (reptiles and amphibians, and plants within Sequoia and Kings Canyon National Parks using only existing biological studies undertaken within the Parks and the Parks' long-term wildlife observation database. We used a rarefaction approach to model species richness for the four taxonomic groups and analyzed those groups by habitat type, elevation zone, and time period. We then mapped the spatial distributions of species richness values for the four taxonomic groups, as well as total species richness, for the Parks. We also estimated changes in species richness for birds, mammals, and herpetofauna since 1980. The modeled patterns of species richness either peaked at mid elevations (mammals, plants, and total species richness or declined consistently with increasing elevation (herpetofauna and birds. Plants reached maximum species richness values at much higher elevations than did vertebrate taxa, and non-flying mammals reached maximum species richness values at higher elevations than did birds. Alpine plant communities, including sagebrush, had higher species richness values than did subalpine plant communities located below them in elevation. These results are supported by other papers published in the scientific literature. Perhaps reflecting climate change: birds and herpetofauna displayed declines in species richness since 1980 at low and middle elevations and mammals displayed declines in species richness since 1980 at all elevations.
-
International Nuclear Information System (INIS)
Day, T.A.; Martin, G.; Vogelmann, T.C.
1993-01-01
In some plants, particularly herbaceous species, a considerable proportion of incident ultraviolet-B radiation (UV-B, 280-320 nm) penetrates into the leaf mesophyll where it is potentially damaging to nucleic acids and the photosynthetic machinery. We used optical techniques to look at the spatial variation in UV-B penetration through the epidermis of foliage of two herbaceous species (Chenopodium album and Smilacina stellata) and a conifer (Picea pungens). Measurements of UV-B penetration in intact foliage with a fibre-optic microprobe revealed that 300 nm radiation reached 161±36μm (mean±SD) into leaves of C. album, 154±40μm in S. stellata and 17±2μm in P. pungens, with epidermal transmittance being 39±14%, 55±19% and 0%, respectively. A thin polymer film was developed which fluoresced blue when irradiated by UV-B. Fresh epidermal leaf peels were placed over the film and irradiated with UV-B, and microscopic examination of the film from below allowed us to determine the spatial pattern of UV-B penetration through the epidermis. In herbaceous species, film fluorescence below cell walls, but not epidermal and guard cell protoplasts indicated that UV-B transmittance was much greater through anticlinal cell wall regions than protoplasts. Ultraviolet-B transmittance through large areas of epidermal cells could be induced by plasmolysis. Epidermal transmittance was also relatively high through stomal pores (and what appear to be nuclei in Smilacina), but relatively low through stomatal guard cells. Results from the fluorescing film technique were substantiated by direct measurements of UV-B transmittance through epidermal peels with a fibre-optic microprobe run paradermally along the bottom or inner side of irradiated peels. In Smilacina, we estimate that UV-B epidermal transmittance was up to 90% through anticlinal cell wall regions, but <10% through protoplast areas. In contrast to herbaceous species, we did not detect any UV-B transmittance through the
-
Transfer of atmospheric tritiated water to foliage and fruit of crops
International Nuclear Information System (INIS)
Fellows, R.J.; Cataldo, D.A.; Ligotke, M.W.; Napier, B.A.
1993-01-01
Tritiated water (THO) released to the environment from the effluent streams of nuclear reactors may be easily assimilated by organisms through metabolic fixation following foliar interception of THO vapor. This study was initiated to characterize atmospheric THO exchange parameters in two crops agronomically important to eastern Washington, grape (Vitus vinifera) and alfalfa (Medicago sativa). Short-term exposures using atmospheric THO concentrations ranging from 458 to 1,300,900 pCi/m 3 indicated no statistically significant concentration influences on THO exchange into the leaf tissue free-water (TFW) and organically bound tritium (OBT) of the leaves of either species. Long-term exposures indicated that equilibration of the leaf TFW with atmospheric THO concentrations occurred within 24 to 48 h for both species while equilibration of grape TFW appeared to take over 20 days. The rate of THO saturation of the foliage TFW appeared to be directly related to the stomatal resistance of the leaves and fruit. Desorption rates from both leaves and fruit were greater in the light than in the dark, again correlating with stomatal resistance. More than 90% of the absorbed THO was lost from the leaf TFW pool within 24 h following cessation of exposure for both species, while loss of THO from grape TFW and OBT pools was minimal. It appeared that more than 95 to 98% of the THO found in the TFW and OBT pools of the grape fruit was of atmospheric origin and not from transport from other parts of the plant
-
Benton, E P; Grant, J F; Webster, R J; Nichols, R J; Cowles, R S; Lagalante, A F; Coots, C I
2015-12-01
Widespread decline and mortality of eastern hemlock, Tsuga canadensis (L.) Carrière, have been caused by hemlock woolly adelgid, Adelges tsugae (Annand) (HWA) (Hemiptera: Adelgidae). The current study is a retrospective analysis conducted in collaboration with Great Smoky Mountains National Park (GRSM) to determine longevity of imidacloprid and its insecticidal metabolites (imidacloprid olefin, 5-hydroxy, and dihydroxy) in GRSM's HWA integrated pest management (IPM) program. Foliage samples were collected from three canopy strata of hemlocks that were given imidacloprid basal drench treatments 4-7 yr prior to sampling. Foliage was analyzed to assess concentrations in parts per billion (ppb) of imidacloprid and its metabolites. Imidacloprid and its olefin metabolite were present in most, 95 and 65%, respectively, branchlets 4-7 yr post-treatment, but the 5-hydroxy and dihydroxy metabolites were present in only 1.3 and 11.7%, respectively, of the branchlets. Imidacloprid and olefin concentrations significantly decreased between 4 and 7 yr post-treatment. Concentrations of both imidacloprid and olefin were below the LC50 for HWA 5-7 yr post-treatment. Knowledge of the longevity of imidacloprid treatments and its metabolite olefin can help maximize the use of imidacloprid in HWA IPM programs. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
-
Energy Technology Data Exchange (ETDEWEB)
Staszak, J. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland); Grulke, N.E. [USDA Forest Service, 4955 Canyon Crest Drive, Riverside, CA 92507 (United States)], E-mail: ngrulke@fs.fed.us; Marrett, M.J. [5184 Tower Road, Riverside, CA 92506 (United States); Prus-Glowacki, W. [A Mickiewicz University, Genetics Department, ul. Umultowska 89, 61-614 Poznan (Poland)
2007-10-15
Effects of canopy ozone (O{sub 3}) exposure and signatures of genetic structure using isozyme markers associated with O{sub 3} tolerance were analyzed in {approx}20-, {approx}80-, and >200-yr-old ponderosa (Pinus ponderosa Dougl. ex Laws.) and Jeffrey pine (Pinus jeffreyi Grev. and Balf.) in Sequoia National Park, California. For both species, the number of alleles and genotypes per loci was higher in parental trees relative to saplings. In ponderosa pine, the heterozygosity value increased, and the fixation index indicated reduction of homozygosity with increasing tree age class. The opposite tendencies were observed for Jeffrey pine. Utilizing canopy attributes known to be responsive to O{sub 3} exposure, ponderosa pine was more symptomatic than Jeffrey pine, and saplings were more symptomatic than old growth trees. We suggest that these trends are related to differing sensitivity of the two species to O{sub 3} exposure, and to higher O{sub 3} exposures and drought stress that younger trees may have experienced during germination and establishment. - Genetic variation in isozyme markers associated with ozone tolerance differed between parental trees and their progeny in two closely related species of yellow pine.
-
Characterization of Cypress Wood for Kraft Pulp Production
Directory of Open Access Journals (Sweden)
António J. A. Santos
2014-06-01
Full Text Available Wood samples of Cupressus arizonica, C. lusitanica, and C. sempervirens were evaluated for chemical, anatomical, and pulp characteristics as raw material for pulp production. Two 17-year-old trees per species were harvested, and wood samples were taken at a height of 2 m. Wood chips from Pinus pinaster (Portugal and P. sylvestris (Finland were used as references. C. arizonica differed from C. lusitanica and C. sempervirens with significantly lower (p < 0.05 tracheid diameter and wall thickness in the earlywood. The total extractives contents were 3.9%, 3.3%, and 2.5% for C. lusitanica, C. sempervirens, and C. arizonica, respectively, lower than the 5.1% for P. pinaster and 4.5% for P. sylvestris. Klason lignin content ranged from 33.0 to 35.6%, higher than the 28.0 to 28.7% for the pinewoods. The kraft pulp yields for C. arizonica, C. lusitanica, and C. sempervirens were 37.7%, 36.7%, and 38.7%, respectively, with kappa numbers of 32.0, 31.6, and 28.7, respectively; the yield values were 40.8% and 42.8%, with kappa numbers of 23.4 and 21.0, for P. pinaster and P. sylvestris, respectively. The cypress species are clearly different from pine in relation to wood pulping behavior. Among the cypress, C. sempervirens provided the best pulping results.
-
Lin, Lin; Yan, Jingli; Ma, Keming; Zhou, Weiqi; Chen, Guojian; Tang, Rongli; Zhang, Yuxin
2017-12-01
Plants can mitigate ambient particulate matter by cleaning the air, which is crucial to urban environments. A novel approach was presented to quantitatively characterize particulate matter deposited on urban tree foliage. This approach could accurately quantify the number, size, shape, and spatial distribution of particles with different diameters on leaves. Spatial distribution is represented by proximity, which measures the closeness of particles. We sampled three common broadleaf species and obtained images through field emission scanning electron microscopy. We conducted the object-based method to extract particles from images. We then used Fragstats to analyze the landscape characteristics of these particles in term of selected metrics. Results reveal that Salix matsudana is more efficient than Ailanthus altissima and Fraxinus chinensis in terms of the number and area of particles per unit area and the proportion of fine particulate matter. The shape complexity of the particles increases with their size. Among the three species, S. matsudana and A. altissima particles respectively yield the highest and lowest proximity. PM1 in A. altissima and PM10 in F. chinensis and S. matsudana show the highest proximity, which may influence subsequent particle retention. S. matsudana should be generally considered to collect additional small particles. Different species and particle sizes exhibit various proximities, which should be further examined to elucidate the underlying mechanism.
-
D'Angelo, J. A.; Zodrow, E.L.; Mastalerz, Maria
2012-01-01
Nearly all of the spectrochemical studies involving Carboniferous foliage of seed-ferns are based on a limited number of pinnules, mainly compressions. In contrast, in this paper we illustrate working with a larger pinnate segment, i.e., a 22-cm long neuropteroid specimen, compression-preserved with cuticle, the compression map. The objective is to study preservation variability on a larger scale, where observation of transparency/opacity of constituent pinnules is used as a first approximation for assessing the degree of pinnule coalification/fossilization. Spectrochemical methods by Fourier transform infrared spectrometry furnish semi-quantitative data for principal component analysis.The compression map shows a high degree of preservation variability, which ranges from comparatively more coalified pinnules to less coalified pinnules that resemble fossilized-cuticles, noting that the pinnule midveins are preserved more like fossilized-cuticles. A general overall trend of coalified pinnules towards fossilized-cuticles, i.e., variable chemistry, is inferred from the semi-quantitative FTIR data as higher contents of aromatic compounds occur in the visually more opaque upper location of the compression map. The latter also shows a higher condensation of the aromatic nuclei along with some variation in both ring size and degree of aromatic substitution. From principal component analysis we infer correspondence between transparency/opacity observation and chemical information which correlate with varying degree to fossilization/coalification among pinnules. ?? 2011 Elsevier B.V.
-
Plant Uptake of Atmospheric Carbonyl Sulfide in Coast Redwood Forests
Campbell, J. E.; Whelan, M. E.; Berry, J. A.; Hilton, T. W.; Zumkehr, A.; Stinecipher, J.; Lu, Y.; Kornfeld, A.; Seibt, U.; Dawson, T. E.; Montzka, S. A.; Baker, I. T.; Kulkarni, S.; Wang, Y.; Herndon, S. C.; Zahniser, M. S.; Commane, R.; Loik, M. E.
2017-12-01
The future resilience of coast redwoods (Sequoia sempervirens) is now of critical concern due to the detection of a 33% decline in California coastal fog over the 20th century. However, ecosystem-scale measurements of photosynthesis and stomatal conductance are challenging in coast redwood forests, making it difficult to anticipate the impacts of future changes in fog. To address this methodological problem, we explore coastal variations in atmospheric carbonyl sulfide (COS or OCS), which could potentially be used as a tracer of these ecosystem processes. We conducted atmospheric flask campaigns in coast redwood sites, sampling at surface heights and in the canopy ( 70 m), at the University of California Landels-Hill Big Creek Reserve and Big Basin State Park. We simulated COS atmosphere-biosphere exchange with a high-resolution 3-D model to interpret these data. Flask measurements indicated a persistent daytime drawdown between the coast and the downwind forest (45 ± 6 ppt COS) that is consistent with the expected relationship between COS plant uptake, stomatal conductance, and gross primary production. Other sources and sinks of COS that could introduce noise to the COS tracer technique (soils, anthropogenic activity, nocturnal plant uptake, and surface hydrolysis on leaves) are likely to be small relative to daytime COS plant uptake. These results suggest that COS measurements may be useful for making ecosystem-scale estimates of carbon, water, and energy exchange in coast redwood forests.
-
Hegedüs, Ramón; Barta, András; Bernáth, Balázs; Benno Meyer-Rochow, Victor; Horváth, Gábor
2007-08-01
Radiance, color, and polarization of the light in forests combine to create complex optical patterns. Earlier sporadic polarimetric studies in forests were limited by the narrow fields of view of the polarimeters used in such studies. Since polarization patterns in the entire upper hemisphere of the visual environment of forests could be important for forest-inhabiting animals that make use of linearly polarized light for orientation, we measured 180° field-of-view polarization distributions in Finnish forests. From a hot air balloon we also measured the polarization patterns of Hungarian grasslands lit by the rising sun. We found that the pattern of the angle of polarization α of sunlit grasslands and sunlit tree canopies was qualitatively the same as that of the sky. We show here that contrary to an earlier assumption, the α-pattern characteristic of the sky always remains visible underneath overhead vegetation, independently of the solar elevation and the sky conditions (clear or partly cloudy with visible sun's disc), provided the foliage is sunlit and not only when large patches of the clear sky are visible through the vegetation. Since the mirror symmetry axis of the α-pattern of the sunlit foliage is the solar-antisolar meridian, the azimuth direction of the sun, occluded by vegetation, can be assessed in forests from this polarization pattern. Possible consequences of this robust polarization feature of the optical environment in forests are briefly discussed with regard to polarization-based animal navigation.
-
Fernández-Pérez, Laura; Villar-Salvador, Pedro; Martínez-Vilalta, Jordi; Toca, Andrei; Zavala, Miguel A
2018-04-01
Drought and frosts are major determinants of plant functioning and distribution. Both stresses can cause xylem embolism and foliage damage. The objective of this study was to analyse if the distribution of six common pine species along latitudinal and altitudinal gradients in Europe is related to their interspecific differences in frost tolerance and to the physiological mechanisms underlying species-specific frost tolerance. We also evaluate if frost tolerance depends on plant water status. We studied survival to a range of freezing temperatures in 2-year-old plants and assessed the percentage loss of hydraulic conductivity (PLC) due xylem embolism formation and foliage damage determined by needle electrolyte leakage (EL) after a single frost cycle to -15 °C and over a range of predawn water potential (ψpd) values. Species experiencing cold winters in their range (Pinus nigra J.F. Arnold, Pinus sylvestris L. and Pinus uncinata Raymond ex A. DC.) had the highest frost survival rates and lowest needle EL and soluble sugar (SS) concentration. In contrast, the pines inhabiting mild or cool winter locations (especially Pinus halepensis Mill. and Pinus pinea L. and, to a lesser extent, Pinus pinaster Ait.) had the lowest frost survival and highest needle EL and SS values. Freezing-induced PLC was very low and differences among species were not related to frost damage. Reduction in ψpd decreased leaf frost damage in P. pinea and P. sylvestris, increased it in P. uncinata and had a neutral effect on the rest of the species. This study demonstrates that freezing temperatures are a major environmental driver for pine distribution and suggests that interspecific differences in leaf frost sensitivity rather than vulnerability to freezing-induced embolism or SS explain pine juvenile frost survival.
-
Directory of Open Access Journals (Sweden)
Nirmala K. Hapukotuwa
2011-11-01
Full Text Available The Formosan subterranean termite, Coptotermes formosanus Shiraki, and the Asian subterranean termite, Coptotermes gestroi (Wasmann, are both pests of wood in service in Hawaii and Florida. We conducted a laboratory study using method modified from those described in standard E1-09 of the American Wood Protection Association (AWPA 2009 to assess the termite resistance of three commercially available wood species used in regions of the USA where both termite species occur: Douglas fir, Pseudotsuga menziessii, southern yellow pine, Pinus spp. and redwood, Sequoia sempervirens. A multiple-choice (three-choice assay was used for four weeks (28 days in order to simulate field conditions of food choice and assess termite feeding preferences under 28 °C and 72–80% RH. 400 termites (360 workers: 40 soldiers were released into each test jar. Five replicates and two controls of each wood species were used with each termite species. Termite mortality was recorded at the end of the test; and wood wafers were oven-dried and weighed before and after termite exposure to determine the mass loss due to termite feeding, and rated visually on a 0 (failure to 10 (sound scale. There were significant differences in mean mass loss values among the three wood species and between two termite species. The mean mass loss value for redwood was significantly lower than Douglas fir and southern yellow pine with both termite species. However, C. formosanus showed increased feeding on Douglas fir and southern yellow pine compared to C. gestroi.
-
Engber, Eamon; Teraoka, Jason; van Mantgem, Phillip J.
2017-01-01
Almost half of Redwood National Park is comprised of second-growth forests characterized by high stand density, deficient redwood composition, and low understory biodiversity. Typical structure of young redwood stands impedes the recovery of old-growth conditions, such as dominance of redwood (Sequoia sempervirens (D. Don) Endl.), distinct canopy layers and diverse understory vegetation. Young forests are commonly comprised of dense, even-aged Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) and redwood stump sprouts, with simple canopy structure and little understory development. Moreover, many of these young stands are believed to be vulnerable to disturbance in the form of drought, disease and fire. Silvicultural practices are increasingly being employed by conservation agencies to restore degraded forests throughout the coast redwood range; however, prescribed fire treatments are less common and potentially under-utilized as a restoration tool. We present an early synthesis from three separate management-scale prescribed fire projects at Redwood National Park spanning 1to 7 years post-treatment. Low intensity prescribed fire had minimal effect on overstory structure, with some mortality observed in trees smaller than 30 cm diameter. Moderate to high intensity fire may be required to reduce densities of larger Douglas-fir, the primary competitor of redwood in the Park’s second growth forests. Fine woody surface fuels fully recovered by 7 years post-burn, while recruitment of larger surface fuels was quite variable. Managers of coastal redwood ecosystems will benefit by having a variety of tools at their disposal for forest restoration and management.
-
Smaill, Simeon J; Bayne, Karen M; Coker, Graham W R; Paul, Thomas S H; Clinton, Peter W
2014-04-01
Stakeholders in plantation forestry are increasingly aware of the importance of the ecosystem services and non-market values associated with forests. In New Zealand, there is significant interest in establishing species other than Pinus radiata D. Don (the dominant plantation species) in the belief that alternative species are better suited to deliver these services. Significant risk is associated with this position as there is little objective data to support these views. To identify which species were likely to be planted to deliver ecosystem services, a survey was distributed to examine stakeholder perceptions. Stakeholders were asked which of 15 tree attributes contributed to the provision of five ecosystem services (amenity value, bioenergy production, carbon capture, the diversity of native habitat, and erosion control/water quality) and to identify which of 22 candidate tree species possessed those attributes. These data were combined to identify the species perceived most suitable for the delivery of each ecosystem service. Sequoia sempervirens (D.Don) Endl. closely matched the stakeholder derived ideotypes associated with all five ecosystem services. Comparisons to data from growth, physiological and ecological studies demonstrated that many of the opinions held by stakeholders were inaccurate, leading to erroneous assumptions regarding the suitability of most candidate species. Stakeholder perceptions substantially influence tree species selection, and plantations established on the basis of inaccurate opinions are unlikely to deliver the desired outcomes. Attitudinal surveys associated with engagement campaigns are essential to improve stakeholder knowledge, advancing the development of fit-for-purpose forest management that provides the required ecosystem services.
-
Nesmith, C.B.; Caprio, Anthony C.; Pfaff, Anne H.; McGinnis, Thomas W.; Keeley, Jon E.
2011-01-01
Current goals for prescription burning are focused on measures of fuel consumption and changes in forest density. These benchmarks, however, do not address the extent to which prescription burning meets perceived ecosystem needs of heterogeneity in burning, both for overstory trees and understory herbs and shrubs. There are still questions about how closely prescribed fires mimic these patterns compared to natural wildfires. This study compared burn patterns of prescribed fires and managed unplanned wildfires to understand how the differing burning regimes affect ecosystem properties. Measures of forest structure and fire severity were sampled in three recent prescribed fires and three wildfires managed for resource objectives in Sequoia and Kings Canyon National Parks. Fine scale patterns of fire severity and heterogeneity were compared between fire types using ground-based measures of fire effects on fuels and overstory and understory vegetation. Prescribed fires and wildfires managed for resource objectives displayed similar patterns of overstory and understory fire severity, heterogeneity, and seedling and sapling survival. Variation among plots within the same fire was always greater than between fire types. Prescribed fires can provide burned landscapes that approximate natural fires in many ways. It is recognized that constraints placed on when wildfires managed for resource objectives are allowed to burn freely may bias the range of conditions that might have been experienced under more natural conditions. Therefore they may not exactly mimic natural wildfires. Overall, the similarity in fire effects that we observed between prescribed fires and managed wildfires indicate that despite the restrictions that are often placed on prescribed fires, they appear to be creating post-fire conditions that approximate natural fires when assessed on a fine spatial scale.
-
Clow, David W.; Forrester, Harrison; Miller, Benjamin; Roop, Heidi; Sickman, James O.; Ryu, Hodon; Santo Domingo, Jorge
2013-01-01
During 2010-2011, a study was conducted in Sequoia and Kings Canyon National Parks (SEKI) to evaluate the influence of pack animals (stock) and backpackers on water quality in wilderness lakes and streams. The study had three main components: (1) a synoptic survey of water quality in wilderness areas of the parks, (2) paired water-quality sampling above and below several areas with differing types and amounts of visitor use, and (3) intensive monitoring at six sites to document temporal variations in water quality. Data from the synoptic water-quality survey indicated that wilderness lakes and streams are dilute and have low nutrient and Escherichia coli (E. coli) concentrations. The synoptic survey sites were categorized as minimal use, backpacker use, or mixed use (stock and backpackers), depending on the most prevalent type of use upstream from the sampling locations. Sites with mixed use tended to have higher concentrations of most constituents (including E.coli) than those categorized as minimal-use (p≤0.05); concentrations at backpacker-use sites were intermediate. Data from paired-site sampling indicated that E.coli, total coliform, and particulate phosphorus concentrations were greater in streams downstream from mixed-use areas than upstream from those areas (p≤0.05). Paired-site data also indicated few statistically significant differences in nutrient, E. coli, or total coliform concentrations in streams upstream and downstream from backpacker-use areas. The intensive-monitoring data indicated that nutrient and E. coli concentrations normally were low, except during storms, when notable increases in concentrations of E.coli, nutrients, dissolved organic carbon, and turbidity occurred. In summary, results from this study indicate that water quality in SEKI wilderness generally is good, except during storms; and visitor use appears to have a small, but statistically significant influence on stream water quality.
-
Vollenweider, Pierre; Bernasconi, Petra; Gautschi, Hans-Peter; Menard, Terry; Frey, Beat; Günthardt-Goerg, Madeleine S
2011-01-01
The phytoextraction potential of plants for removing heavy metals from polluted soils is determined by their capacity to store contaminants in aboveground organs and complex them safely. In this study, the metal compartmentation, elemental composition of zinc deposits and zinc complexation within leaves from poplars grown on soil with mixed metal contamination was analysed combining several histochemical and microanalytical approaches. Zinc was the only heavy metal detected and was stored in several organelles in the form of globoid deposits showing β-metachromasy. It was associated to oxygen anions and different cations, noteworthy phosphorous. The deposit structure, elemental composition and element ratios indicated that zinc was chelated by phytic acid ligands. Maturation processes in vacuolar vs. cytoplasmic deposits were suggested by differences in size and amounts of complexed zinc. Hence, zinc complexation by phytate contributed to metal detoxification and accumulation in foliage but could not prevent toxicity reactions therein. Copyright © 2010 Elsevier Ltd. All rights reserved.
-
Energy Technology Data Exchange (ETDEWEB)
Vollenweider, Pierre, E-mail: pierre.vollenweider@wsl.c [Swiss Federal Institute for Forest, Snow and Landscape Research (WSL), Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Bernasconi, Petra [Swiss Federal Institute for Forest, Snow and Landscape Research (WSL), Zuercherstrasse 111, 8903 Birmensdorf (Switzerland); Environmental Protection Office (AfU), Aabachstrasse 5, 6300 Zug (Switzerland); Gautschi, Hans-Peter [Centre for Microscopy and Image Analysis (CMI), University of Zurich, Gloriastrasse 30, 8006 Zuerich (Switzerland); Menard, Terry; Frey, Beat; Guenthardt-Goerg, Madeleine S. [Swiss Federal Institute for Forest, Snow and Landscape Research (WSL), Zuercherstrasse 111, 8903 Birmensdorf (Switzerland)
2011-01-15
The phytoextraction potential of plants for removing heavy metals from polluted soils is determined by their capacity to store contaminants in aboveground organs and complex them safely. In this study, the metal compartmentation, elemental composition of zinc deposits and zinc complexation within leaves from poplars grown on soil with mixed metal contamination was analysed combining several histochemical and microanalytical approaches. Zinc was the only heavy metal detected and was stored in several organelles in the form of globoid deposits showing {beta}-metachromasy. It was associated to oxygen anions and different cations, noteworthy phosphorous. The deposit structure, elemental composition and element ratios indicated that zinc was chelated by phytic acid ligands. Maturation processes in vacuolar vs. cytoplasmic deposits were suggested by differences in size and amounts of complexed zinc. Hence, zinc complexation by phytate contributed to metal detoxification and accumulation in foliage but could not prevent toxicity reactions therein. - Zinc contaminants translocated to symplast of aged leaves were detoxified by phytic acid ligands.
-
International Nuclear Information System (INIS)
Vollenweider, Pierre; Bernasconi, Petra; Gautschi, Hans-Peter; Menard, Terry; Frey, Beat; Guenthardt-Goerg, Madeleine S.
2011-01-01
The phytoextraction potential of plants for removing heavy metals from polluted soils is determined by their capacity to store contaminants in aboveground organs and complex them safely. In this study, the metal compartmentation, elemental composition of zinc deposits and zinc complexation within leaves from poplars grown on soil with mixed metal contamination was analysed combining several histochemical and microanalytical approaches. Zinc was the only heavy metal detected and was stored in several organelles in the form of globoid deposits showing β-metachromasy. It was associated to oxygen anions and different cations, noteworthy phosphorous. The deposit structure, elemental composition and element ratios indicated that zinc was chelated by phytic acid ligands. Maturation processes in vacuolar vs. cytoplasmic deposits were suggested by differences in size and amounts of complexed zinc. Hence, zinc complexation by phytate contributed to metal detoxification and accumulation in foliage but could not prevent toxicity reactions therein. - Zinc contaminants translocated to symplast of aged leaves were detoxified by phytic acid ligands.
-
Directory of Open Access Journals (Sweden)
Atefeh Sheikhlar
2014-01-01
Full Text Available Two experiments were simultaneously conducted with Morus alba (white mulberry foliage extract (MFE as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp. in African catfish (Clarias gariepinus. In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC, albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM. Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish.
-
Padgett, Pamela E; Parry, Sally D; Bytnerowicz, Andrzej; Heath, Robert L
2009-01-01
Nitric acid vapor is produced by the same photochemical processes that produce ozone. In the laboratory, concentrated nitric acid is a strong acid and a powerful oxidant. In the environment, where the concentrations are much lower, it is an innocuous source of plant nitrogen. As an air pollutant, which mode of action does dry deposition of nitric acid follow? We investigated the effects of dry deposition of nitric acid on the foliage of four tree species native to the western United States. A novel controlled environment, fumigation system enabled a four-week exposure at concentrations consistent with ambient diurnal patterns. Scanning electron microscopy and automated image analysis revealed changes in the epicuticular wax layer during fumigation. Exposure to nitric acid resulted in a reproducible suite of damage symptoms that increased with increasing dose. Each tree species tested exhibited a unique set of damage features, including cracks, lesions, and conformation changes to epicuticular crystallite structures. Dry deposition of atmospheric nitric acid caused substantial perturbation to the epicuticular surface of all four tree species investigated, consistent with the chemical oxidation of epicuticular waxes. Automated image analysis eliminated many biases that can trouble microscopy studies. Trade names and commercial enterprises or products are mentioned solely for information. No endorsements by the U.S. Department of Agriculture are implied.
-
Sheikhlar, Atefeh; Alimon, Abd Razk; Daud, Hassan; Saad, Chee R.; Webster, Carl D.; Meng, Goh Yong
2014-01-01
Two experiments were simultaneously conducted with Morus alba (white mulberry) foliage extract (MFE) as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp.) in African catfish (Clarias gariepinus). In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM) of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC), albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM). Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish. PMID:25574488
-
Sheikhlar, Atefeh; Alimon, Abd Razk; Daud, Hassan; Saad, Chee R; Webster, Carl D; Meng, Goh Yong; Ebrahimi, Mahdi
2014-01-01
Two experiments were simultaneously conducted with Morus alba (white mulberry) foliage extract (MFE) as a growth promoter and treatment of Aeromonas hydrophila infection in separate 60 and 30 days trail (Experiments 1 and 2, resp.) in African catfish (Clarias gariepinus). In Experiment 1, four diets, control and control supplemented with 2, 5, or 7 g MFE/kg dry matter (DM) of diet, were used. In Experiment 2, fish were intraperitoneally infected with Aeromonas hydrophila and fed the same diets as experiment 1 plus additional two diets with or without antibiotic. Results of experiment 1 showed that growth was unaffected by dietary levels of MFE. Treatments with the inclusion of MFE at the levels of 5 and 7 g/Kg DM had no mortality. Red blood cells (RBC), albumin, and total protein were all higher for the treatments fed MFE (5 and 7 g/Kg DM). Results of experiment 2 showed RBC, hemoglobin, hematocrit, globulin, albumin, and total protein improved with the increase in MFE in the infected fish. The dietary MFE at the level of 7 g/kg DM reduced mortality rate. In conclusion, MFE at the level of 7 g/kg DM could be a valuable dietary supplement to cure the infected fish.
-
Nesmith, Jonathan C. B.; Das, Adrian J.; O'Hara, Kevin L.; van Mantgem, Phillip J.
2015-01-01
Tree mortality is a vital component of forest management in the context of prescribed fires; however, few studies have examined the effect of prefire tree health on postfire mortality. This is especially relevant for sugar pine (Pinus lambertiana Douglas), a species experiencing population declines due to a suite of anthropogenic factors. Using data from an old-growth mixed-conifer forest in Sequoia National Park, we evaluated the effects of fire, tree size, prefire radial growth, and crown condition on postfire mortality. Models based only on tree size and measures of fire damage were compared with models that included tree size, fire damage, and prefire tree health (e.g., measures of prefire tree radial growth or crown condition). Immediately following the fire, the inclusion of different metrics of prefire tree health produced variable improvements over the models that included only tree size and measures of fire damage, as models that included measures of crown condition performed better than fire-only models, but models that included measures of prefire radial growth did not perform better. However, 5 years following the fire, sugar pine mortality was best predicted by models that included measures of both fire damage and prefire tree health, specifically, diameter at breast height (DBH, 1.37 m), crown scorch, 30-year mean growth, and the number of sharp declines in growth over a 30-year period. This suggests that factors that influence prefire tree health (e.g., drought, competition, pathogens, etc.) may partially determine postfire mortality, especially when accounting for delayed mortality following fire.
-
Klinger, Robert C.; Few, Alexandra P.; Knox, Kathleen A.; Hatfield, Brian E.; Clark, Jonathan; German, David W.; Stephenson, Thomas R.
2015-01-01
Pack stock (horses, mules, burros, llamas, and goats) are frequently assumed to have negative effects on public lands, but there is a general lack of data to be able to quantify the degree to which this is actually the case. Sequoia and Kings Canyon National Parks have received complaints that pack stock may affect Sierra Nevada bighorn sheep (Ovis canadensis sierrae; SNBS), a federally endangered subspecies that occurs in largely disjunct herds in the Sierra Nevada Range of California. The potential effects are thought to be displacement of SNBS from meadows on their summer range (altered habitat use) or, more indirectly, through changes in SNBS habitat or forage quality. Our goals were to conduct an association analysis to quantify the degree of potential spatial overlap in meadow use between SNBS and pack stock and to compare differences in vegetation community composition, structure, and diversity among meadows with different levels of use by bighorn sheep and pack stock. For the association analysis, we used two approaches: (1) we quantified the proportion of meadows that were within the herd home ranges of bighorn sheep and were potentially open to pack stock, and, (2) we used Monte Carlo simulations and use-availability analyses to compare the proportion of meadows used by bighorn sheep relative to the proportional occurrence or area of meadows available to bighorn sheep that were used by pack stock. To evaluate potential effects of pack stock on meadow plant communities and SNBS forage, we sampled vegetation in 2011 and 2012 at 100 plots to generate data that allowed us to compare:
-
Kinoshita, A. M.; Hale, B.; Hogue, T. S.
2012-12-01
Post-fire management decisions are guided by rainfall-runoff predictions, which ultimately influence downstream treatment and mitigation costs. The current study investigates evolving rainfall-runoff partitioning at the watershed scale over a two-year period after the 2010 Bull Fire which occurred in the southern Sequoia National Forest in California. Stage height was measured at five-minute intervals using pressure transducers, tipping buckets were installed for rainfall duration and intensity, and channel cross-sections were measured approximately every two months to detail sediment deposition or scour. We also utilize remotely sensed vegetation data to evaluate vegetation recovery in the studied watersheds and the corresponding relationship to storm runoff. Normalized Difference Vegetation Index (NDVI), a measure of vegetation greenness, is evaluated for its potential use as a key recovery indicator. Preliminary results focus on alterations in annual and seasonal precipitation and discharge relationships using in-situ data and Landsat NDVI values for the period of study. NDVI values are consistent with a comprehensive burn, with an acute decrease observed in the initial post-fire period. However, vegetation recovery is highly variable in the studied systems and influenced by shorter-term biomass pulses (grasses) while longer-term recovery of other species (chaparral and pine) is ongoing. Runoff ratios are elevated during early storms and show some recovery in the later part of the study period. The ability to accurately and confidently predict post-fire runoff and longer-term recovery is critical for monitoring values-at-risk, reducing mitigation costs, and improving warnings to downstream public communities.
-
Grimalt, Susana; Thompson, Dean G; Coppens, Melanie; Chartrand, Derek T; Shorney, Thomas; Meating, Joe; Scarr, Taylor
2011-08-10
A rapid and sensitive LC-ESI-MS method has been developed and validated for the quantitation of azadirachtin and 3-tigloylazadirachtol in deciduous tree matrices. The method involves automated extraction and simultaneous cleanup using an accelerated solvent technique with the matrix dispersed in solid phase over a layer of primary-secondary amine silica. The limits of quantification were 0.02 mg/kg for all matrices with the exception of Norway maple foliage (0.05 mg/kg). Validation at three levels (0.02, 0.1, and 1 mg/kg), demonstrated satisfactory recoveries (71-103%) with relative standard deviation <20%. Two in-source fragment ions were used for confirmation at levels above 0.1 mg/kg. Over a period of several months, quality control analyses showed the technique to be robust and effective in tracking the fate of these natural botanical insecticides following systemic injection into various tree species for control of invasive insect pest species such as the emerald ash borer and Asian longhorned beetle.
-
Osborne, Colin P; Beerling, David J
2003-10-01
Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm "greenhouse" climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with "living fossils" in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox.
-
Osborne, Colin P.; Beerling, David J.
2003-01-01
Deciduous forests covered the ice-free polar regions 280 to 40 million years ago under warm “greenhouse” climates and high atmospheric pCO2. Their deciduous habit is frequently interpreted as an adaptation for minimizing carbon losses during winter, but experiments with “living fossils” in a simulated warm polar environment refute this explanation. Measured carbon losses through leaf abscission of deciduous trees are significantly greater than losses through winter respiration in evergreens, yet annual rates of primary productivity are similar in all species. Here, we investigate mechanisms underlying this apparent paradox by measuring the seasonal patterns of leaf photosynthesis (A) under pCO2 enrichment in the same trees. During spring, A increased significantly in coastal redwood (Sequoia sempervirens), dawn redwood (Metasequoia glyptostroboides), and swamp cypress (Taxodium distichum) at an elevated pCO2 of 80 Pa compared with controls at 40 Pa. However, strong acclimation in Rubisco carboxylation capacity (Vc,max) completely offset the CO2 response of A in all species by the end of 6 weeks of continuous illumination in the simulated polar summer. Further measurements demonstrated the temporary nature of acclimation, with increases in Vc,max during autumn restoring the CO2 sensitivity of A. Contrary to expectations, the acclimation of Vc,max was not always accompanied by accumulation of leaf carbohydrates, but was associated with a decline in leaf nitrogen in summer, suggesting an alteration of the balance in plant sources and sinks for carbon and nitrogen. Preliminary calculations using A indicated that winter carbon losses through deciduous leaf abscission and respiration were recovered by 10 to 25 d of canopy carbon fixation during summer, thereby explaining the productivity paradox. PMID:12972654
-
Effects of foliage clumping on the estimation of global terrestrial gross primary productivity
Chen, Jing M.; Mo, Gang; Pisek, Jan; Liu, Jane; Deng, Feng; Ishizawa, Misa; Chan, Douglas
2012-03-01
Sunlit and shaded leaf separation proposed by Norman (1982) is an effective way to upscale from leaf to canopy in modeling vegetation photosynthesis. The Boreal Ecosystem Productivity Simulator (BEPS) makes use of this methodology, and has been shown to be reliable in modeling the gross primary productivity (GPP) derived from CO2flux and tree ring measurements. In this study, we use BEPS to investigate the effect of canopy architecture on the global distribution of GPP. For this purpose, we use not only leaf area index (LAI) but also the first ever global map of the foliage clumping index derived from the multiangle satellite sensor POLDER at 6 km resolution. The clumping index, which characterizes the degree of the deviation of 3-dimensional leaf spatial distributions from the random case, is used to separate sunlit and shaded LAI values for a given LAI. Our model results show that global GPP in 2003 was 132 ± 22 Pg C. Relative to this baseline case, our results also show: (1) global GPP is overestimated by 12% when accurate LAI is available but clumping is ignored, and (2) global GPP is underestimated by 9% when the effective LAI is available and clumping is ignored. The clumping effects in both cases are statistically significant (p < 0.001). The effective LAI is often derived from remote sensing by inverting the measured canopy gap fraction to LAI without considering the clumping. Global GPP would therefore be generally underestimated when remotely sensed LAI (actually effective LAI by our definition) is used. This is due to the underestimation of the shaded LAI and therefore the contribution of shaded leaves to GPP. We found that shaded leaves contribute 50%, 38%, 37%, 39%, 26%, 29% and 21% to the total GPP for broadleaf evergreen forest, broadleaf deciduous forest, evergreen conifer forest, deciduous conifer forest, shrub, C4 vegetation, and other vegetation, respectively. The global average of this ratio is 35%.
-
Ruso, Gabrielle; Meyer, Erik; Das, Adrian J.
2017-01-01
Managers making decisions may benefit from a well-informed understanding of a species' population size and trends. Given the cryptic nature and habitat characteristics of the western pond turtle (Emys marmorata), however, imperfect detection may be high and population estimates are frequently varied and unreliable. As a case study to investigate this issue, we used temperature dataloggers to examine turtle behavior at 2 long-term monitoring sites with different hydrological characteristics in Sequoia National Park, California, to determine if common stream-survey techniques are consistent with site-specific turtle behavior. Sycamore Creek is an intermittent stream that dries up every summer while the North Fork Kaweah River flows year-round. We found that while turtles spent most of the recorded time in the water (55% in Sycamore Creek and 82% in the North Fork Kaweah River), the timing of traditional surveys only coincided with the turtles' aquatic activity in the North Fork Kaweah River. At Sycamore Creek, turtles were most likely to be in the water at night. In contrast, failure to detect turtles in North Fork Kaweah River is likely owing to the larger size and complexity of the underwater habitat. In both streams, turtles were also more likely to be in the water in the weeks leading up to important changes in hydroperiods. Our findings illustrate the effects that differences in water permanence can have on turtle behavior within the same watershed and how phenotypic plasticity may then affect detection during surveys. Our study highlights the importance of tailoring survey practices to the site-specific behavioral traits of the target species.
-
Energy Technology Data Exchange (ETDEWEB)
Schwartzenberg, K von
1989-09-25
This report attempts to find an answer to the question as to whether the cytokinin concentrations in the leaves of spruce trees showing discolouration or loss of foliage would be any different from those determined for trees, in which no such changes have occurred. Described is a specific analytical method developed for quantitative determinations of the cytokinins trans-zeatin (t-Z), trans-zeatin riboside (t-ZR), isopentenyladenine (ZiP) and isopentenyladenosine (ZiPA). In all, it was found that the levels determined for cytokinin ribosides in needles of the older age groups tested were quite consistent with the degree of discolouration and general damage observed in those trees. Fumigation experiments were additionally performed to find out which effect 8-11 weeks of exposure to an air pollutant, ozone, would have on young spruces. Initial measurements carried out in exposed and non-exposed plants do not yet permit any predictions to be made about the probable influence of ozone on the cytokinin concentrations of foliage. (KST).
-
Cottrell, Ted E; Wood, Bruce W; Ni, Xinzhi
2009-04-01
The nature of the interaction between the black pecan aphid, Melanocallis caryaefoliae (Davis) (Hemiptera: Aphididae), and the chlorosis it causes to foliage of its pecan [Carya illinoinensis (Wangenh.) K. Koch)] host is poorly understood. Laboratory experiments were conducted on the settling behavior of the black pecan aphid, when provided chlorotic pecan leaf discs resulting from previous black pecan aphid feeding and nonchlorotic leaf discs, under a normal photoperiod and constant dark. Additionally, aphid development from the first instar to the adult stage was examined when nymphs were either allowed to feed on the same leaf disc or moved daily to a new, nondamaged, same age leaf disc. After 24 h, a significantly higher percentage of black pecan aphids settled on chlorotic than on nonchlorotic leaf discs, regardless of photoperiod. When starting from the first instar, nymphs that were prevented from inducing leaf chlorosis by moving daily to new, same-age leaf discs took approximately 5 d longer to complete development, had a shorter body length, and had higher mortality than when aphids remained on the same leaf disc. These results show that black pecan aphid-induced leaf chlorosis plays an important role in the interaction of the black pecan aphid with its pecan host.
-
Directory of Open Access Journals (Sweden)
Dominik Skoneczny
2015-11-01
Full Text Available Metabolic profiling allows for simultaneous and rapid annotation of biochemically similar organismal metabolites. An effective platform for profiling of toxic pyrrolizidine alkaloids (PAs and their N-oxides (PANOs was developed using ultra high pressure liquid chromatography quadrupole time-of-flight (UHPLC-QTOF mass spectrometry. Field-collected populations of invasive Australian weeds, Echium plantagineum and E. vulgare were raised under controlled glasshouse conditions and surveyed for the presence of related PAs and PANOs in leaf tissues at various growth stages. Echium plantagineum possessed numerous related and abundant PANOs (>17 by seven days following seed germination, and these were also observed in rosette and flowering growth stages. In contrast, the less invasive E. vulgare accumulated significantly lower levels of most PANOs under identical glasshouse conditions. Several previously unreported PAs were also found at trace levels. Field-grown populations of both species were also evaluated for PA production and highly toxic echimidine N-oxide was amongst the most abundant PANOs in foliage of both species. PAs in field and glasshouse plants were more abundant in the more widely invasive species, E. plantagineum, and may provide competitive advantage by increasing the plant’s capacity to deter natural enemies in its invaded range through production of novel weapons.
-
Skoneczny, Dominik; Weston, Paul A.; Zhu, Xiaocheng; Gurr, Geoff M.; Callaway, Ragan M.; Weston, Leslie A.
2015-01-01
Metabolic profiling allows for simultaneous and rapid annotation of biochemically similar organismal metabolites. An effective platform for profiling of toxic pyrrolizidine alkaloids (PAs) and their N-oxides (PANOs) was developed using ultra high pressure liquid chromatography quadrupole time-of-flight (UHPLC-QTOF) mass spectrometry. Field-collected populations of invasive Australian weeds, Echium plantagineum and E. vulgare were raised under controlled glasshouse conditions and surveyed for the presence of related PAs and PANOs in leaf tissues at various growth stages. Echium plantagineum possessed numerous related and abundant PANOs (>17) by seven days following seed germination, and these were also observed in rosette and flowering growth stages. In contrast, the less invasive E. vulgare accumulated significantly lower levels of most PANOs under identical glasshouse conditions. Several previously unreported PAs were also found at trace levels. Field-grown populations of both species were also evaluated for PA production and highly toxic echimidine N-oxide was amongst the most abundant PANOs in foliage of both species. PAs in field and glasshouse plants were more abundant in the more widely invasive species, E. plantagineum, and may provide competitive advantage by increasing the plant’s capacity to deter natural enemies in its invaded range through production of novel weapons. PMID:26561809
-
Skoneczny, Dominik; Weston, Paul A; Zhu, Xiaocheng; Gurr, Geoff M; Callaway, Ragan M; Weston, Leslie A
2015-11-06
Metabolic profiling allows for simultaneous and rapid annotation of biochemically similar organismal metabolites. An effective platform for profiling of toxic pyrrolizidine alkaloids (PAs) and their N-oxides (PANOs) was developed using ultra high pressure liquid chromatography quadrupole time-of-flight (UHPLC-QTOF) mass spectrometry. Field-collected populations of invasive Australian weeds, Echium plantagineum and E. vulgare were raised under controlled glasshouse conditions and surveyed for the presence of related PAs and PANOs in leaf tissues at various growth stages. Echium plantagineum possessed numerous related and abundant PANOs (>17) by seven days following seed germination, and these were also observed in rosette and flowering growth stages. In contrast, the less invasive E. vulgare accumulated significantly lower levels of most PANOs under identical glasshouse conditions. Several previously unreported PAs were also found at trace levels. Field-grown populations of both species were also evaluated for PA production and highly toxic echimidine N-oxide was amongst the most abundant PANOs in foliage of both species. PAs in field and glasshouse plants were more abundant in the more widely invasive species, E. plantagineum, and may provide competitive advantage by increasing the plant's capacity to deter natural enemies in its invaded range through production of novel weapons.
-
Directory of Open Access Journals (Sweden)
Santos Nélida Murga-Gutiérrez
2013-06-01
Full Text Available Se investigó el efecto del follaje del “huacatay” Tagetes minutasobre la nodulación radicular producida por el nematodo Meloidogyne incognitaque parasita el “pimiento páprika” Capsicum annuumcultivado en invernadero, con la finalidad de obtener una alternativa de control de este nematodo. Se utilizaron tres grupos experimentales y un testigo, con 12 macetas cada uno, las cuales contenían suelo y arena estériles (1:1. A este substrato se adicionó el follaje de T. minutaal 20, 35 y 50% (v/v según grupo experimental, y el testigo no recibió esta enmienda. En cada maceta se sembró una plántula de C. annuum, y a la semana postsiembra se inoculó 5000 huevos de M. incognita.A las ocho semanas, se evaluaron los nódulos en sus raíces. Todas las plantas presentaron nódulos; aunque, en aquellas de los grupos experimentales el número de éstos fue menor que en las plantas testigo, con diferencia estadística significativa (p 0,05. Se concluye que el follaje de T. minutaadicionado como enmienda orgánica al 20, 35 y 50% al suelo de cultivo de plantas de C. annuum limita la nodulación radicular ocasionada por M. incognita. Lo cual sugiere su uso potencial en el control de este nematodo.The effect of the foliage of Tagetes minuta"huacatay" on Meloidogyne incognitaroot-galling on Capsicum annuum"paprika pepper" cultured in a greenhouse was researched, to obtain a control strategy for this nema-tode. Three experimental groups and one control with 12 pots each were used, which contained sterilized soil and sand (1:1. To this substrate was added cut foliage of T. minutaat 20, 35 and 50% (v/v according to the experimental group, and the control group remained without this amendment. In each pot a seedling of C. annuum was sown, and one week post-seeding was inoculated with 5000 eggs of M. incognita. Eight weeks later the root galling was evaluated. All the plants had root galling; although the number of galls in plants of the experimental
-
Wilt, F M; Miller, G C; Everett, R L; Hackett, M
1993-02-01
Senescent foliage from pines is potentially a large contributor to the total monoterpene content of the litter layer, and the availability of these compounds as phytotoxins may result from release of these compounds into the vapor phase. In order to determine the fate of several monoterpene hydrocarbons in the natural environment, we examined their concentrations in fresh, senescent, and decaying needles from 32 single-leaf pinyon pine (Pinus monophylla Torr. & Frem.: Pinaceae) trees growing at two different locations. Total monoterpene content was highest in the fresh needles (mean=5.6 ± 2.2 mg/g extracted air dry weight), but also remained relatively high in senescent needles (mean=3.6 ±1.8 mg/g extracted air dry weight), either still attached to the tree or forming the freshest layer of understory litter. Decaying needles within a dark decomposing layer of litter material 5-20 cm from the surface were found to contain much lower amounts of total monoterpenes (average: =0.12 ±0.06 mg/g extracted air dry weight). Further investigation of the fate of these compounds in the pinyon understory is required to determine if these hydrocarbons are indeed exerting phytotoxic characteristics.
-
International Nuclear Information System (INIS)
Hooper, R.P.; West, C.T.; Peters, N.E.
1990-01-01
A sparsely parameterized hydrochemical model has been developed by using data from Emerald Lake watershed, which is a 120-ha alpine catchment in Sequoia National Park, California. Greater than 90% of the precipitation to this watershed is snow; hence, snowmelt is the dominant hydrologic event. A model which uses a single alkalinity-generating mechanism, primary mineral weathering, was able to capture the pattern of solute concentrations in surface waters during snowmelt. An empirical representation of the weathering reaction, which is based on rock weathering stoichiometry and which uses discharge as a measure of residence time, was included in the model. Results of the model indicate that current deposition levels would have to be increased between three-fold and eight-fold to exhaust the alkalinity of the lake during snowmelt if their is a mild acidic pulse in the stream at the beginning of snowmelt as was observed during the study period. The acidic pulse in the inflow stream at the onset of snowmelt was less pronounced than acidic pulses observed in the meltwater draining the snowpack at a point using snow lysimeters or in the laboratory. Sulfate concentrations in the stream water were the most constant; chloride and nitrate concentrations increased slightly at the beginning of snowmelt. Additional field work is required to resolve whether an acidic meltwater pulse occurs over a large area as well as at a point or whether, due to physical and chemical processes within the snowpack, the acidic meltwater pulse is attenuated at the catchment scale. The modest data requirements of the model permit its applications to other alpine watersheds that are much less intensively studied than Emerald Lake watershed
-
Directory of Open Access Journals (Sweden)
Sisira Ediriweera
2013-12-01
Full Text Available The reflected radiance in topographically complex areas is severely affected by variations in topography; thus, topographic correction is considered a necessary pre-processing step when retrieving biophysical variables from these images. We assessed the performance of five topographic corrections: (i C correction (C, (ii Minnaert, (iii Sun Canopy Sensor (SCS, (iv SCS + C and (v the Processing Scheme for Standardised Surface Reflectance (PSSSR on the Landsat-5 Thematic Mapper (TM reflectance in the context of prediction of Foliage Projective Cover (FPC in hilly landscapes in north-eastern Australia. The performance of topographic corrections on the TM reflectance was assessed by (i visual comparison and (ii statistically comparing TM predicted FPC with ground measured FPC and LiDAR (Light Detection and Ranging-derived FPC estimates. In the majority of cases, the PSSSR method performed best in terms of eliminating topographic effects, providing the best relationship and lowest residual error when comparing ground measured FPC and LiDAR FPC with TM predicted FPC. The Minnaert, C and SCS + C showed the poorest performance. Finally, the use of TM surface reflectance, which includes atmospheric correction and broad Bidirectional Reflectance Distribution Function (BRDF effects, seemed to account for most topographic variation when predicting biophysical variables, such as FPC.
-
International Nuclear Information System (INIS)
Hooper, R.P.; West, C.T.; Peters, N.E.
1990-01-01
A simple process-oriented model, called the Alpine Lake Forecaster (ALF), was constructed using data collected from the Integrated Watershed Study of Emerald Lake, Sequoia National Park, California. ALF is able to capture the basic solute patterns during snowmelt in this alpine catchment where groundwater is a minor contributor to streamflow. It includes an empirical representation of primary mineral weathering as the only alkalinity generating mechanism. During a heavy snow year, such as the one used for calibrating the model, the model accurately simulated the surface water chemical change in response to the initial ionic pulse from the snowpack and to the dilution that occurs at peak snowmelt. Because the model does not consider cation exchange, it over-predicts the acidification during the initial period of snowmelt, and therefore is a conservative predictor. However, the minimum alkalinity observed in the main inflows to Emerald Lake and in the lake outflow is accurately simulated by the model. The representation of the lake as simply a missing volume with no additional chemical reactions is supported by the observation. The model predicts a change of 2 to 5 microequiv/L in the minimum alkalinity of the lake outflow during snowmelt if the deposition would have to increase between two and 18 times the current load-alkalinity of the lake; the precise increase depends on hydrologic conditions and on the pattern of solute release from the snowpack. An acidic rainstorm that exhausted the alkalinity of the lake was observed during summer 1984 after the lake had stratified, and is the likely cause of the acidification of Emerald Lake
-
Nesmith, Jonathan C. B.; O'Hara, Kevin L.; van Mantgem, Phillip J.; de Valpine, Perry
2010-01-01
Prescribed fire is an important tool for fuel reduction, the control of competing vegetation, and forest restoration. The accumulated fuels associated with historical fire exclusion can cause undesirably high tree mortality rates following prescribed fires and wildfires. This is especially true for sugar pine (Pinus lambertiana Douglas), which is already negatively affected by the introduced pathogen white pine blister rust (Cronartium ribicola J.C. Fisch. ex Rabenh). We tested the efficacy of raking away fuels around the base of sugar pine to reduce mortality following prescribed fire in Sequoia and Kings Canyon national parks, California, USA. This study was conducted in three prescribed fires and included 457 trees, half of which had the fuels around their bases raked away to mineral soil to 0.5 m away from the stem. Fire effects were assessed and tree mortality was recorded for three years after prescribed fires. Overall, raking had no detectable effect on mortality: raked trees averaged 30% mortality compared to 36% for unraked trees. There was a significant effect, however, between the interaction of raking and average pre-treatment forest floor fuel depth: the predicted probability of survival of a 50 cm dbh tree was 0.94 vs. 0.96 when average pre-treatment fuel depth was 0 cm for a raked and unraked tree, respectively. When average pre-treatment forest floor fuel depth was 30 cm, the predicted probability of survival for a raked 50 cm dbh tree was 0.60 compared to only 0.07 for an unraked tree. Raking did not affect mortality when fire intensity, measured as percent crown volume scorched, was very low (0% scorch) or very high (>80% scorch), but the raking treatment significantly increased the proportion of trees that survived by 9.6% for trees that burned under moderate fire intensity (1% to 80% scorch). Raking significantly reduced the likelihood of bole charring and bark beetle activity three years post fire. Fuel depth and anticipated fire intensity need
-
Directory of Open Access Journals (Sweden)
S. Ediriweera
2012-07-01
Full Text Available Quantitative retrieval of land surface biological parameters (e.g. foliage projective cover [FPC] and Leaf Area Index is crucial for forest management, ecosystem modelling, and global change monitoring applications. Currently, remote sensing is a widely adopted method for rapid estimation of surface biological parameters in a landscape scale. Topographic correction is a necessary pre-processing step in the remote sensing application for topographically complex terrain. Selection of a suitable topographic correction method on remotely sensed spectral information is still an unresolved problem. The purpose of this study is to assess the impact of topographic corrections on the prediction of FPC in hilly terrain using an established regression model. Five established topographic corrections [C, Minnaert, SCS, SCS+C and processing scheme for standardised surface reflectance (PSSSR] were evaluated on Landsat TM5 acquired under low and high sun angles in closed canopied subtropical rainforest and eucalyptus dominated open canopied forest, north-eastern Australia. The effectiveness of methods at normalizing topographic influence, preserving biophysical spectral information, and internal data variability were assessed by statistical analysis and by comparing field collected FPC data. The results of statistical analyses show that SCS+C and PSSSR perform significantly better than other corrections, which were on less overcorrected areas of faintly illuminated slopes. However, the best relationship between FPC and Landsat spectral responses was obtained with the PSSSR by producing the least residual error. The SCS correction method was poor for correction of topographic effect in predicting FPC in topographically complex terrain.
-
Directory of Open Access Journals (Sweden)
Luciene C. P. Faria
2008-06-01
Full Text Available A biologia reprodutiva de Hylocryptus rectirostris (Wied, 1831 é descrita pela primeira vez. As coletas de dados foram realizadas no período de abril de 2004 a novembro de 2005, no Parque Nacional da Serra do Cipó, Minas Gerais. Os indivíduos foram marcados com anilhas coloridas e acompanhados ao longo de duas estações reprodutivas. Ovos, ninhegos e jovens foram descritos. O sucesso reprodutivo foi avaliado em cinco categorias: construção de ninhos, ovos, ninhegos, casais e ninhos. Casos de competição por cavidades e predação também foram registrados. A atividade reprodutiva é altamente sincrônica tanto entre os casais quanto entre as estações. Foram encontrados 20 ninhos, todos construídos em barrancos localizados nas margens de rios. O período de incubação é de 17 dias e o período de ninhego varia entre 21 a 25 dias. O casal se reveza na construção do ninho, incubação e alimentação da prole, sendo que a fêmea apresenta maior desenvolvimento da placa incubatória. A porcentagem de ninhos que produziram um ou mais filhotes foi de 33% (n = 9 na estação de 2004 e 18% (n = 11 na estação de 2005. As causas dos fracassos ocorridos ao longo da atividade reprodutiva foram principalmente destruição do ninho por desabamento ou enchente do rio. Este estudo fornece conhecimentos a respeito da biologia básica de H. rectirostris e pode contribuir para futuras medidas de conservação e manejo desta espécie.Here, we provide the first description of the breeding biology of the Henna-browed Foliage-gleaner, Hylocryptus rectirostris (Wied, 1831. The foliage-gleaner was studied at the Serra do Cipó Nationa Park (Parque Nacional da Serra do Cipó, in the state of Minas Gerais, southeastern Brazil. Birds were marked with color bands and monitored through two reproductive seasons from April 2004 to November 2005. Eggs, nestlings and young are described. Breeding success was calculated for five categories: nest construction
-
Ibrahim, Taghreed A; El-Hela, Atef A; El-Hefnawy, Hala M; Al-Taweel, Areej M; Perveen, Shagufta
2017-01-01
Family Cupressaceae is the largest coniferous plant family. Essential oils of many species belonging to family Cupressaceae are known to have several biological activities specially antimicrobial activity. The essential oils from aerial parts of Calocedrus decurrens Torr., Cupressus sempervirens stricta L. and Tetraclinis articulata (Vahl) Mast. were prepared by hydrodistillation. The chemical composition of the essential oils has been elucidated by gas chromatography-mass spectroscopy analysis. The prepared essential oils were examined against selected species of Gram-positive, Gram-negative bacteria and Candida species. Broth dilution methods were used to detect minimum inhibitory concentration (MIC), minimum bactericidal concentration (MBC) and minimum fungicidal concentration (MFC). Sixteen compounds were identified in the essential oils of both Calocedrus decurrens and Cupressus sempervirens L. and fifteen compounds were identified in the essential oil of Tetraclinis articulata . δ-3-Carene (43.10%), (+)-Cedrol (74.03%) and Camphor (21.23%) were the major constituents in the essential oils of Calocedrus decurrens , Cupressus sempervirens L. and Tetraclinis articulata , respectively. The essential oils showed strong antimicrobial activities against the selected microorganisms in concentration range 0.02 3- 3.03 µL/mL. This study could contribute to the chemotaxonomic characterization of family Cupressaceae. In addition, it proved that the essential oils under investigation possess potential antimicrobial properties.
-
Energy Technology Data Exchange (ETDEWEB)
Holmes, W.B.K. [Noonee Nyrang, Wellington, NSW (Australia)
2003-01-31
Two quarries in the Basin Creek Formation of the Middle Triassic Nymboida Coal Measures have yielded numerous examples of fern-like foliage. No affiliated fertile material is available to place the fronds in a natural classification. Twenty three species in twelve genera are described as morpho-taxa in Order and Family Incertae Sedis. Plants described in this paper are: Cladophlebis conferta sp. nov., C octonerva sp. nov., C. paucinerva sp. nov., C. relallachfisp. nov., C. sinuala sp. nov., C. lenuoinnula sp. nov., Diconymba sparnosa gen. et sp. nov., Gouldianum alelhopleroides gen. et sp. nov., Leconama stachyophylla gen. et sp. nov., Micronymbopteris repens gen. et sp. nov., Nymbiella lacerata gen. et sp. nov., Nymboidiantum glossophyllum (Tenison-Woods) gen. et comb. nov., N. multilobatum gen. et sp. nov., N. elegans gen. et sp. nov., N. fractiflexum gen. et sp. nov., N. robustum gen. et sp. nov., Nymbophlebis polymorpha gen. et sp. nov., Nymbopteron dejerseyi (Retallack) gen. et comb. nov.,N. foleyi gen. et sp. nov., N. uncinatum gen. et sp. nov., Nymborhipteris radiata gen. et sp. nov., Ptilotonymba curvinervia gen. et sp. nov. and Sphenopteris speciosa sp. nov. The diversity of this new material demonstrates the remarkable recovery of Gondwana vegetation following the end-Permian extinction event.
-
International Nuclear Information System (INIS)
2000-01-01
Tanniniferous trees and shrubs are of importance in animal production because they can provide significant protein supplements, but unfortunately the amounts of tannins that they contain vary widely and largely unpredictably, and their effects on animals range from beneficial to toxicity and death. The toxic or antinutritional effects tend to occur in times of stress when a very large proportion of the diet is tanniniferous. With a better understanding of tannin properties and proper management, they could become an invaluable source of protein for strategic supplementation. As the demand for food rises, tanniniferous plants must play an increasingly important part in the diet of animals, in particular for ruminants in smallholder subsistence farming in developing countries. It is therefore critical that techniques be developed to measure and manage the anti-nutritional components that they contain. Keeping the above in mind, a Joint FAO/IAEA Co-ordinated Research Project (CRP) on 'Use of Nuclear and Related Techniques to Develop Simple Tannin Assays for Predicting and Improving the Safety and Efficiency of Feeding Ruminants on Tanniniferous Tree Foliage' has been initiated. In order to provide sound basis for this CRP, an FAO/IAEA Consultants Meeting was held in August 1997 in Vienna, at which the tanniniferous plants to be studied, the analytical methods, the test animals and the animal response evaluation techniques were defined. This publication contains methodologies for the analysis of tannins using chemical-, protein precipitation/binding- and bio-assays recommended by the consultants
-
Directory of Open Access Journals (Sweden)
Elisa Cristina Modesto
2007-10-01
Full Text Available O objetivo do experimento foi estudar os efeitos da substituição da silagem de milho (SML pela silagem do terço superior da rama de mandioca (SRM no consumo e digestibilidade dos nutrientes de vacas em lactação. Doze vacas em lactação foram alocadas em um delineamento em blocos casualizados. Os níveis de substituição da SML pela SRMforam 0, 20, 40 e 60%. Os parâmetros analisados foram: consumo de matéria seca (CMS, matéria orgânica (CMO, fibra em detergente neutro (CFDN, fibra em detergente neutro indigestível (CFDNi, digestibilidade aparente da matéria seca (DAMS, matéria orgânica(DAMO, proteína bruta (DAPB, fibra detergente neutro (DAFDN, carboidratos totais (DACT, carboidratos não fibrosos (DACNF. Foi observado que o nível de substituição da SML pela SRM não teve efeito significativo para a maioria das variáveis avaliadas (p > 0,05. No entanto, a DAPB (p The objective of the experiment was to study the effects of replacing corn silage (CS with cassava foliage silage (CFS – using the upperthird of the foliage – on intake and nutrient digestibility. Twelve lactating dairy cows were used in a randomized block design to evaluated intake and digestibility. The levels of replacement of CS with CFS were 0, 20, 40 and 60%. The parameters studied were: drymatter intake (DMI, organic matter intake (OMI, neutral detergent fiber intake (NDFI, indigestible neutral detergent fiber intake (INDFI, apparent digestibility of dry matter (ADDM, apparent digestibility of organic matter (ADOM, apparent digestibility of crude protein (ADCP, apparent digestibility of neutral detergent fiber (ADNDF, apparent digestibility of total carbohydrates (ADTC and apparent digestibility of non-fiber carbohydrates (ADNFC. The replacement of CS with different levels of the upper third ofcassava foliage silage (CFS had no effect in practically any of evaluated variables (p > 0.05. However, ADCP (p < 0.01 decreased as the levels of replacement were
-
Directory of Open Access Journals (Sweden)
Dwi Yulistiani
2015-04-01
Full Text Available A digestibility study was conducted to evaluate the effects of supplementing mulberry foliage and urea rice-bran as a source of fermentable energy and protein to 12 sheep fed diets based on urea-treated rice straw (TRS. The three dietary treatments were: T1, TRS with mulberry; T2, TRS with 50% mulberry replaced with rice bran and urea; and T3, TRS with rice bran and urea. The study was arranged in a completely randomized design with four replications for each treatment. The sheep were fed one of the three diets and the supplements were offered at 1.2% of the body weight (BW and the TRS was provided ad libitum. There were no differences (p>0.05 among the three treatment groups with respect to dry matter (DM intake (76.8±4.2 g/kg BW0.75 and DM, organic matter (OM, and crude protein (CP digestibility (55.3±1.22; 69.9±0.85; 46.3±1.65% respectively for DM, OM, and CP. The digestibility of fiber (neutral detergent fiber [NDF] and acid detergent fiber was significantly lower (p<0.05 for T3 (46.2 and 46.6 respectively compared to T1 (55.8 and 53.7 respectively and T2 (54.1 and 52.8 respectively. Nitrogen (N intake by sheep on diet T3 was significantly (p<0.05 higher than sheep fed diet T1. However, N balance did not differ among the three diets (3.0±0.32 g/d. In contrast, the rumen ammonia (NH3-N concentrations in sheep fed T2 and T3 were significantly (p<0.05 higher than in sheep fed T1. The NH3-N concentrations for all three diets were above the critical value required for optimum rumen microbial growth and synthesis. Total volatile fatty acid concentrations were highest (p<0.05 in T1 (120.3 mM, whilst the molar proportion of propionic acid was highest in T3 (36.9%. However, the microbial N supply in sheep fed T1 and T3 was similar but was significantly (p<0.05 higher than for sheep fed T2. It was concluded that mulberry foliage is a potential supplement of fermentable energy and protein for sheep fed TRS based diet. The suggested level of
-
Particle film affects black pecan aphid (Homoptera: Aphididae) on pecan.
Cottrell, Ted E; Wood, Bruce W; Reilly, Charles C
2002-08-01
Three species of aphids attack pecan foliage, Carya illinoensis (Wang.) K. Koch, and cause economic damage. We tested a kaolin-based particle film against one of these aphid species, black pecan aphid, Melanocallis caryaefoliae (Davis). Effect of particle film on host selection, adult mortality, and production of nymphs by M. caryaefoliae was tested on seedling pecans in the laboratory. Fewer M. caryaefoliae adults selected treated foliage compared with untreated foliage. A higher percentage of adults that did select treated foliage were recovered from upper leaf surfaces compared with the percentage of adults recovered from upper leaf surfaces of untreated leaves. Observations with a microscope revealed an accumulation of particle film on aphid body parts, especially on tarsi, and strongly suggests that aphid mobility was restricted. Adult mortality was higher on treated foliage and led to an overall decrease in production of nymphs on those seedlings. In addition, we measured spectral properties of treated seedling pecan foliage. Light reflectance by treated foliage was increased and absorptance decreased compared with control foliage whereas transmittance of light through control and particle film-treated leaves was similar. We did not detect any phytotoxic effect on pecan due to application of particle film.
-
Das, Adrian J.; Stephenson, Nathan L.
2013-01-01
Climate is a master controller of the structure, composition, and function of biotic communities, affecting them both directly, through physiological effects, and indirectly, by mediating biotic interactions and by influencing disturbance regimes. Sequoia and Kings Canyon National Park’s (SEKI’s) dramatic elevational changes in biotic communities -- from warm mediterranean to cold alpine -- are but one manifestation of climate’s overarching importance in shaping SEKI’s landscape. Yet humans are now altering the global climate, with measurable effects on ecosystems (IPCC 2007). Over the last few decades across the western United States, human-induced climatic changes have likely contributed to observed declines in fraction of precipitation falling as snow and snowpack water content (Mote et al. 2005, Knowles et al. 2006), advance in spring snowmelt (Stewart et al. 2005, Barnett et al. 2008), and consequent increase in area burned in wildfires (Westerling et al. 2006). In the Sierra Nevada, warming temperatures have likely contributed to observed glacial recession (Basagic 2008), uphill migration of small mammals (Moritz et al. 2008), and increasing tree mortality rates (van Mantgem and Stephenson 2007, van Mantgem et al. 2009). More substantial changes can be expected for the future (e.g., IPCC 2007). Given the central importance of climate and climatic changes, we sought to describe long-term trends in temperature and precipitation at SEKI. Time and budget constraints limited us to analyses of mean annual temperature and mean annual precipitation, using readily-available data. If funds become available in the future, further analyses will be needed to analyze trends by season, trends in daily minimum and maximum temperatures, and so on. We chose to analyze data from individual weather stations rather than use interpolated climatic data from sources such as PRISM (http://www.prism.oregonstate.edu/). In topographically complex mountainous regions with few
-
Moura, Bárbara Baêsso; Alves, Edenise Segala; Marabesi, Mauro Alexandre; de Souza, Silvia Ribeiro; Schaub, Marcus; Vollenweider, Pierre
2018-01-01
In southern Brazil, the recent increase in tropospheric ozone (O 3 ) concentrations poses an additional threat to the biodiverse but endangered and fragmented remnants of the Atlantic Forest. Given the mostly unknown sensitivity of tropical species to oxidative stress, the principal objective of this study was to determine whether the current O 3 levels in the Metropolitan Region of Campinas (MRC), downwind of São Paulo, affect the native vegetation of forest remnants. Foliar responses to O 3 of three tree species typical of the MRC forests were investigated using indoor chamber exposure experiments under controlled conditions and a field survey. Exposure to 70ppb O 3 reduced assimilation and leaf conductance but increased respiration in Astronium graveolens while gas exchange in Croton floribundus was little affected. Both A. graveolens and Piptadenia gonoacantha developed characteristic O 3 -induced injury in the foliage, similar to visible symptoms observed in >30% of trees assessed in the MRC, while C. floribundus remained asymptomatic. The underlying structural symptoms in both O 3 -exposed and field samples were indicative of oxidative burst, hypersensitive responses, accelerated cell senescence and, primarily in field samples, interaction with photo-oxidative stress. The markers of O 3 stress were thus mostly similar to those observed in other regions of the world. Further research is needed, to estimate the proportion of sensitive forest species, the O 3 impact on tree growth and stand stability and to detect O 3 hot spots where woody species in the Atlantic Forest are mostly affected. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Estimation the remaining service-lifetime of wooden structure of geothermal cooling tower
Directory of Open Access Journals (Sweden)
Effendi Tri Bahtiar
2017-06-01
Full Text Available Similar with other construction materials, wood strength is decreasing when applied by long term loading. Wooden cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd was built in 1998 and it should be evaluated to avoid sudden structural failure. Evaluation conducted through several steps: wood species identification, the physical and mechanical properties testing, and estimation for remaining service-lifetime by generating mathematical models derived from creep test and reduction of cross sectional area of the wood. Identification result that the wood are redwood (Sequoia sempervirens and Douglas fir (Pseudotsuga menziesii. The wood density value has degraded from the surface until 0.25 cm depth. Strength characteristics of the wood have considerably decreased, but the allowable stress for bending, tension parallel to grain, and shear were still higher than NDS2005 requirements. The allowable stress for compression parallel to grain was slightly lower than NDS, while compression perpendicular to grain was much lower. Average modulus of elasticity reduces become lower than the value stated by the code, but the minimum value of modulus of elasticity (Emin of redwood was still higher than the code value, while Emin of Douglas fir is slightly lower. Then, in accordance with those findings, the construction would not failure yet but the deformation and vibration will occur in higher rate than design planning. This research develops mathematical models for estimating the remaining service-lifetime of the wooden cooling tower structure in geothermal power plant based on the wood performance in resisting long term loading and its deterioration rate. The deterioration rate of wood member of cooling tower structure at Star Energy Geothermal (Wayang Windu Ltd is 0.0147 cm depth per year, so equation for the residual service life estimation is σlaterσtoday=bh2(b−0.0147T(h−0.0147T2, and σlater must be lower than allowable stress.
-
Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.
Carroll, Allyson L; Sillett, Stephen C; Kramer, Russell D
2014-01-01
Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI) helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE) have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood species have
-
Millennium-scale crossdating and inter-annual climate sensitivities of standing California redwoods.
Directory of Open Access Journals (Sweden)
Allyson L Carroll
Full Text Available Extremely decay-resistant wood and fire-resistant bark allow California's redwoods to accumulate millennia of annual growth rings that can be useful in biological research. Whereas tree rings of Sequoiadendron giganteum (SEGI helped formalize the study of dendrochronology and the principle of crossdating, those of Sequoia sempervirens (SESE have proven much more difficult to decipher, greatly limiting dendroclimatic and other investigations of this species. We overcame these problems by climbing standing trees and coring trunks at multiple heights in 14 old-growth forest locations across California. Overall, we sampled 1,466 series with 483,712 annual rings from 120 trees and were able to crossdate 83% of SESE compared to 99% of SEGI rings. Standard and residual tree-ring chronologies spanning up to 1,685 years for SESE and 1,538 years for SEGI were created for each location to evaluate crossdating and to examine correlations between annual growth and climate. We used monthly values of temperature, precipitation, and drought severity as well as summer cloudiness to quantify potential drivers of inter-annual growth variation over century-long time series at each location. SESE chronologies exhibited a latitudinal gradient of climate sensitivities, contrasting cooler northern rainforests and warmer, drier southern forests. Radial growth increased with decreasing summer cloudiness in northern rainforests and a central SESE location. The strongest dendroclimatic relationship occurred in our southernmost SESE location, where radial growth correlated negatively with dry summer conditions and exhibited responses to historic fires. SEGI chronologies showed negative correlations with June temperature and positive correlations with previous October precipitation. More work is needed to understand quantitative relationships between SEGI radial growth and moisture availability, particularly snowmelt. Tree-ring chronologies developed here for both redwood
-
Redwoods, restoration, and implications for carbon budgets
Madej, Mary Ann
2010-01-01
The coast redwoods (Sequoia sempervirens) of California have several unique characteristics that influence interactions between vegetation and geomorphic processes. Case studies, using a combination of in-channel wood surveys and an air photo inventory of landslides, illustrate current conditions in a redwood-dominated watershed undergoing restoration work, and the influence of wood loading and landslides on the carbon budget. Redwood trees have extremely large biomass (trunk wood volumes of 700 to 1000 m3) and are very decay-resistant; consequently, they have a large and persistent influence on in-channel wood loading. Large wood surveys indicate high wood loading in streams in uncut forests (0.3-0.5 m3/m2 of channel), but also show that high wood loading can persist in logged basin with unlogged riparian buffers because of the slow decay of fallen redwoods. Through a watershed restoration program, Redwood National Park increases in-channel wood loading in low-order streams, but the effectiveness of this technique has not yet been tested by a large flood. Another unique characteristic of redwood is its ability to resprout from basal burls after cutting, so that root strength may not decline as sharply following logging as in other types of forests. An air photo inventory of landslides following a large storm in 1997 indicated: 1) that in the Redwood Creek watershed the volume of material displaced by landslides in harvested areas was not related to the time elapsed since logging, suggesting that the loss of root strength was not a decisive factor in landslide initiation, 2) landslide production on decommissioned logging roads was half that of untreated roads, and 3) landslides removed an estimated 28 Mg of organic carbon/km2 from hillslopes. The carbon budget of a redwood-dominated catchment is dominated by the vegetative component, but is also influenced by the extent of mass movement, erosion control work, and in-channel storage of wood.
-
Acid mist and ozone effects on the leaf chemistry of two western conifer species
Westman, Walter E.; Temple, Patrick J.
1989-01-01
The effects of ozone and acid-mist exposures on the leaf chemistry of Jeffrey pine and giant sequoia seedlings grown in filtered-air greenhouses were investigated. Acid-mist treatments (pH 4.1, 3.4, 2.7, or 2.0) were administered for 3 h, and ozone exposures (0, 0.10, and 0.20 microliter/liter), which followed acid-mist treatments, for 4 h, each for three days a week for six to nine weeks. It was found that seedlings were more susceptible to acid-mist and acid mist/ozone combinations, than to ozone alone. Acid mist treatment resulted in higher levels of nitrogen and sulfur (both present in acid mist) as well as Na. Leaves of giant sequoia exhibited increased K and decreased Mn, while Jeffrey pine showed increases in Fe and Mn. In sequoia leaves, concentrations of Ca, Mg, and Ba decreased. Acid treatment also reduced chlorophyll b concentrations in both conifer species. Extensive changes induced by acid mist are consistent with earlier observations of changes in spectral reflectance of conifer seedlings observed after three weeks of fumigation.
-
Directory of Open Access Journals (Sweden)
Samuel Boadi
2014-01-01
Full Text Available Thaumatococcus daniellii is a wild sourced tropical understorey herb that is harvested for its foliage and fruits from which thaumatin—a proteinous sweetener—is extracted. With increased demand for natural sweeteners, uncontrolled harvesting of T. daniellii from the wild is suggested to be neither sustainable nor match industrial demands. This study determined the implication of controlled foliage harvesting of T. daniellii under a mixed indigenous tree plantation stand. T. daniellii plants within plots of dimension 3 m × 4 m were thinned to uniform foliage population of about 12 leaves/m2 and subsequently harvested at 16 weeks interval for 64 weeks at four different foliage harvesting intensities: (i no harvesting (control, (ii 25% harvest, (iii 50% harvest, and (iv 75% harvest. Data on agronomic characters and total income from the sale of fruit and harvested foliage were collected and analysed. We found that foliage harvest intensity affected (P 6 (25% ≥ 1 (50% and 0 (75%. Foliage harvest intensity also significantly (P=0.036 influenced fruit number and ranged from 11458/ha for the control to 4583/ha for the 75% harvest. Total income from fruit and foliage sales was greatest for the 50% harvest (US $ 17,191.32, followed by 75% harvest (US $ 12, 310.24 and lowest for the no harvest treatment (US $ 107.44. Thus, proper management of T. daniellii through controlled harvesting of the foliage under mixed tree plantation system could promote sustainable yield and income to farmers.
-
International Nuclear Information System (INIS)
Grant-Petersson, J.; Renwick, J.A.A.
1996-01-01
Larvae of Pieris rapae (L.) (Lepidoptera: Pieridae) and Trichoplusia ni (Huebner) (Lepidoptera: Noctuidae) were fed foliage from Arabidopsis thaliana (L.) Heynh. plants that had received a high dose of ultraviolet-B (UV-B) or from control plants. Treatments were compared using the Student independent t-test. P. rapae larvae consumed less of the foliage exposed to UV-B than control foliage. This difference as significant in older but not younger larvae, and the older P. rapae larvae fed foliage exposed to UV-B weighed significantly less. For T. ni, however, consumption and larval weights were approximately equal for UV-exposed and control foliage. No significant differences in growth rates per unit consumption on UV-exposed versus control foliage were found for either species. Chemical analysis showed that flavonoid levels increased in response to UV-B. Results suggested that UV-inducible flavonoids may act as feeding deterrents to P. rapae but not to T. ni. 56 refs., 6 figs
-
Andropogon scoparius uptake of 45Ca and production from two contrasting soil types
International Nuclear Information System (INIS)
Waller, S.S.; Dodd, J.D.
1976-01-01
Total foliage production of Andropogon scoparius was greater on the Heiden-Hunt clay soil complex (Udic chromusterts and pellusterts) than on he Tabor fine sandy loam (Udertic paleustalfs). Foliage production on both soil types increased as clipping frequency decreased. Foliage production and 45 C uptake exhibited a positive relationship with precipitation during the growing season. Total uptake and concentration were greater in the sand-grown clones than in the clay-grown clones. Foliage concentration was inversely related to stable soil Ca and reflected the ratio of radioactive to stable Ca in the soil. However, uptake at the end of the growing season was less than 0.20% of that applied on either soil type. Increased clipping frequency increased foliage 45 Ca concentration on both soil types
-
Genic microsatellites or simple sequence repeat (genic-SSR) markers were developed in boxwood (Buxus taxa) for genetic diversity analysis, identification of taxa, and to facilitate breeding. cDNA libraries were developed from mRNA extracted from leaves of Buxus sempervirens ‘Vardar Valley’ and seque...
-
Directory of Open Access Journals (Sweden)
José Paraguay Mercado
2010-12-01
Full Text Available The present work had as objective to study the increment of the leaf area of Asparagus Officinalis L., for they were used it asparagus crown with 5 yolks, to those that were applied by aspersion, different concentrations of the hormones of gibberellic acid and 6-bencilaminopurina which were applied at the 25, 60, 110 and 160 days respectively. It was found that in the different rehearsed treatments one doesn't observe differential significant in the increment of the number of plants, plant height, number of yolks and dry weight of foliage. However it was observed that the combined application of the phytohormonas in the range of 0.110 at 0.230 m of gibberllic acid and 0.037 to 0.075 m of 6-Bencilaminopurin a bigger number of yolk is achieved (13%, sprout (7%, plant height (11.3% and dry weight (7.3% in the treated plants. Concluded to continue making studies of sinergism of these two phytohormonas, gibberellic (AG3 and 6-bencilaminopurina (6-BAP, seeking to achieve adequate levels of leaf area increase of the leaf area in the asparagus.
-
Savchenko, V M; Belyaeva, S N; Govorun, M I; Pirogova, M E
The objective of the present study was to evaluate the influence of pollen of Mediterranean Cypress (Cupressus sempervirens) on the effectiveness of the spa and health resort-based treatment (SHRT) of the patients with broncho-pulmonary pathology at the southern coast of the Crimea (SCC). This article presents the results of the analysis of the data on 122 patients presenting with broncho-pulmonary pathology who received SHRT under the conditions of the Southern Coast of the Crimea. Fifty one (41.8%) of these patients suffered from chronic obstructive pulmonary disease and 71 (58.2%) ones had bronchial asthma. The whole group was comprised of 44 men (36.1%) and 78 women (63.9%). The average (median) age of the patients was 55.8 years. All the participants of the study underwent the comprehensive examination including the general medical and physical examination, complete blood count, the study of sputum cytology and immunological properties of blood including the standard characteristics, IgE and lysozyme levels), evaluation of the respiratory and locomotor (physical) functions with the use of the 6-minute walking test. The aeropollenological study of the aerial environment of the southern coast of the Crimea in the region of Yalta showed that the «bloom» of the Mediterranean Cypress occurs during the period from February till April inclusive. The highest concentrations of cypress pollen are observed in March and early April. The overall effectiveness of SHRT for the patients with broncho-pulmonary pathology arriving for the treatment at the southern coast of the Crimea from other Crimean localities does not depend on the period of «flowering» (the presence of pollen in the air) of the Mediterranean Cypress. In these patients, the termination of the spa and health resort-based treatment during the «flowering» of the Mediterranean Cypress resulted in nothing more than a strained adaptive response manifested as the altered blood leukocyte count. Such reaction
-
Quantification of tannins in tree and shrub foliage. A laboratory manual
International Nuclear Information System (INIS)
Makkar, H.P.S.
2003-01-01
tannin activity for both free and bound tannins in terms of rumen fermentation parameters; and 14 C-polyethylene glycol binding assay are also discussed. Each type of tannin responds differently in each of these assays. This variability makes it impossible to use any single method. Use of a battery of methods, therefore, is suggested; and these assays are being used in the FAO/IAEA-sponsored projects on the utilisation of tree foliage as livestock feed. Using these assays for 37 shrub and tree leaves, highly significant correlation existed between protein precipitation capacity and extractable total phenols (r = 0.87) or tannins (r = 0.83). On the other hand, a weak correlation was observed between condensed tannins (measured by the butanol-HCI method) and protein precipitation capacity (r = 0.41), which could be due to the variation in structural and biological activity of tannins. The correlations observed between extractable total phenols, tannins or condensed tannins and the tannin bioassay values based on the rumen simulation technique were similar to those obtained between extractable total phenols, tannins or condensed tannins and protein precipitation capacity. Highly significant correlations between extractable phenolics or tannins with protein precipitation capacity or the values obtained using the tannin bioassay suggest that extractable total phenolics and tannins values could be taken as a measure of biological activity of tannins. The condensed tannins values by the butanol-HCl-iron method do not appear to reflect the biological activity. From the relationships between chemical, protein precipitation and bioassays, it was postulated that tree and shrub leaves with extractable total phenol and tannin contents of approximately 4.5% and 2.0% respectively (as tannic acid equivalent) will not produce significant adverse effects on ruminant livestock. The hydrolysable tannins, measured by an HPLC and a spectrophotometric method (rhodanine), were present in all
-
Directory of Open Access Journals (Sweden)
Sri Susanti
2016-12-01
Full Text Available This research aims at investigating the proportion of several types of tree foliages leaves as animal feed in different locations and altitudes in Malang Raya. The case study was conducted in five districts of Malang Raya where were assumed as the centre of goat farms. The results showed that there were 30 types of forage used as goat feeds, both leaves of tree foliages and shrubs, or grasses, crop residues and others. Most forages (73% were leaves of tree foliages and shrubs, both legumes, and non-legumes. Tree foliage leaves were more used as goat feeds in the study area with higher altitude, whereas in the area with lower altitude, farmers also utilized grasses and crop residues. The leaves of tree foliages were Paraserianthes falcataria, Gliricidia sepium, Artocarpus heterophyllus, Leucaena leucocephala and Calliandra calothyrsus. Paraserianthes falcataria was most widely used in Klampok-Singosari (88.3%. The proportion of Calliandra calothyrsus ranged from 32 to 98%, while Gliricidia sepium was 58-98%, both were most widely used in Argoyuwono-Ampelgading. Artocarpus heterophyllus was most widely used in Wajak (90.3%, whereas Leucaena leucocephala leaf was used by all respondents (100% in Sumberdem-Wonosari. It is necessary to evaluate the quality of these tree foliage leaves to provide a better animal feed through supplementation technology. Keyword: altitudes, foliages, leave, location
-
International Nuclear Information System (INIS)
Spencer, F.S.
1984-03-01
The kinetics of tritiated water (HTO) vapour uptake into tissue-free water tritium (TFWT) and organically bound tritium (OBT) fractions of tomato, Lycopersicon esculentum Mill., cv Vendor, were investigated under controlled growing conditions. Most uptake data fitted a first-order kinetic model, C t = C ∞ (1-e -kt ), where C t is the tritium concentration at time t, Ca the steady-state concentration and k the uptake rate constant. During atmospheric-HTO exposure with clean-water irrigation in open pots the TFWT k values were 0.024 ± 0.023 h -1 for new foliage, 0.104 ± 0.067 h -1 for old foliage and 0.042 ± to 0.136 h -1 for new green fruit. OBT uptake rate constants were 20 percent less for new foliage and 76 percent less for new green fruit. Under steady-state conditions the ratio of tritium specific activities of TWFT to atmospheric HTO were 0.43 in new foliage, 0.46 in old foliage and 0.19 in green fruit. Within the plant, OBT and TFWT ratios were 0.70 for new foliage, 0.63 for old foliage (maximum) and between 0.72 and 1.92 for green fruit. The greater than unity tritium specific activity ratios in green fruit were not attributed to tritium enrichment but rather to the translocation of foliar OBT to the growing fruit which contained lower specific activity TFWT derived from soil water
-
Sial, Ashfaq A; Brunner, Jay F
2010-08-01
Studies were conducted to determine the residual toxicity of spinetoram, chlorantraniliprole, and emamectin benzoate to obliquebanded leafroller, Choristoneura rosaceana (Harris) (Lepidoptera: Tortricidae). Larvae were exposed to apple (Malus spp.) foliage collected at different intervals after an airblast sprayer application at the manufacturer-recommended field rate and half the field rate. A mortality of 100% was recorded at field rate applications of spinetoram, chlorantraniliprole, and emamectin benzoate through 59, 38, and 10 d after treatment (DAT), respectively. Significantly less foliage was consumed by C. rosaceana larvae surviving in the emamectin, chlorantraniliprole, and spinetoram treatments compared with those exposed to untreated foliage. Third-instar C. rosaceana exposed to fresh residues on terminal foliage showed 100% mortality after 5-d exposure to spinetoram residues and after 10-d exposure to chlorantraniliprole and emamectin benzoate. The effects of larval movement from foliage with fresh residues was examined by transferring neonate larvae from foliage treated with spinetoram, chlorantraniliprole, or emamectin benzoate to untreated foliage after various exposure intervals. An exposure of 1, 3, and 6 d was required for spinetoram, chlorantraniliprole, and emamectin benzoate to cause 100% mortality at the field rate, respectively. The higher the concentration of chlorantraniliprole and emamectin benzoate, the less exposure time was necessary to cause high levels of mortality in C. rosaceana neonates. Our results indicate that these novel insecticides are highly toxic to C. rosaceana larvae. Implications of these results for C. rosaceana management programs are discussed.
-
Saffell, Brandy J; Meinzer, Frederick C; Woodruff, David R; Shaw, David C; Voelker, Steven L; Lachenbruch, Barbara; Falk, Kristen
2014-03-01
Stored non-structural carbohydrates (NSCs) could play an important role in tree survival in the face of a changing climate and associated stress-related mortality. We explored the effects of the stomata-blocking and defoliating fungal disease called Swiss needle cast on Douglas-fir carbohydrate reserves and growth to evaluate the extent to which NSCs can be mobilized under natural conditions of low water stress and restricted carbon supply in relation to potential demands for growth. We analyzed the concentrations of starch, sucrose, glucose and fructose in foliage, twig wood and trunk sapwood of 15 co-occurring Douglas-fir trees expressing a gradient of Swiss needle cast symptom severity quantified as previous-year functional foliage mass. Growth (mean basal area increment, BAI) decreased by ∼80% and trunk NSC concentration decreased by 60% with decreasing functional foliage mass. The ratio of relative changes in NSC concentration and BAI, an index of the relative priority of storage versus growth, more than doubled with increasing disease severity. In contrast, twig and foliage NSC concentrations remained nearly constant with decreasing functional foliage mass. These results suggest that under disease-induced reductions in carbon supply, Douglas-fir trees retain NSCs (either actively or due to sequestration) at the expense of trunk radial growth. The crown retains the highest concentrations of NSC, presumably to maintain foliage growth and shoot extension in the spring, partially compensating for rapid foliage loss in the summer and fall.
-
MARSnet: Mission-aware Autonomous Radar Sensor Network for Future Combat Systems 12/8/06 to 12/31/09
2010-01-01
Channels are frequency dependent. It has been observed that the intervening materials, such as foliage and soil , have dielectric properties that are...equipment in a strong clutter background, such as foliage, soil cover or building has been a long-standing subject of intensive study. It is believed...foliage enviroment , and observed that the path-loss exponent is very high because it has rich scattering. Index Terms : Channel modeling, radar, UWB channel
-
Identification and quantification of glycoside flavonoids in the energy crop Albizia julibrissin
Energy Technology Data Exchange (ETDEWEB)
Lau, C.S.; Beitle, R.R.; Clausen, E.C. [University of Arkansas, Fayetteville (United States). Department of Chemical Engineering; Carrier, D.J. [University of Arkansas, Fayetteville (United States). Department of Biological and Agricultural Engineering; Bransby, D.I. [Auburn University, AL (United States). Department of Agronomy and Soils; Howard, L.R. [University of Arkansas, Fayetteville (United States). Department of Food Science; Lay, J.O. Jr.; Liyanage, R. [University of Arkansas, Fayetteville (United States). Department of Chemistry and Biochemistry
2007-01-15
Oxygen radical absorbance capacity (ORAC) values showed that methanolic extracts of Albizia julibrissin foliage displayed antioxidant activity. High performance liquid chromatography (HPLC) and mass spectrometry (MS) techniques were utilized in the identification of the compounds. The analysis conformed the presence of three compounds in A. julibrissin foliage methanolic extract: an unknown quercetin derivative with mass of 610 Da, hyperoside (quercetin-3-O-galactoside), and quercitrin quercetin-3-O-rhamnoside). Fast performance liquid chromatography (FPLC) was employed to fractionate the crude A. julibrissin foliage methanolic extract into its individual flavonoid components. The flavonoids were quantified in terms of mass and their respective contribution to the overall ORAC value. Quercetin glycosides accounted for 2.0% of total foliage. (author)
-
Directory of Open Access Journals (Sweden)
Júlio César Damasceno
2008-03-01
Full Text Available O objetivo do experimento foi estudar os efeitos da substituição da silagem de milho (SML pela silagem do terço superior da rama de mandioca (SRM no consumo e digestibilidade dos nutrientes de vacas em lactação. Doze vacas em lactação foram alocadas em um delineamento em blocos casualizados. Os níveis de substituição da SML pela SRM foram 0, 20, 40 e 60%. Os parâmetros analisados foram: consumo de matéria seca (CMS, matéria orgânica (CMO, fibra em detergente neutro (CFDN, fibra em detergente neutro indigestível (CFDNi, digestibilidade aparente da matéria seca (DAMS, matéria orgânica (DAMO, proteína bruta (DAPB, fibra detergente neutro (DAFDN, carboidratos totais (DACT, carboidratos não fibrosos (DACNF. Foi observado que o nível de substituição da SML pela SRM não teve efeito significativo para a maioria das variáveis avaliadas (p > 0,05. No entanto, a DAPB (p The objective of the experiment was to study the effects of replacing corn silage (CS with cassava foliage silage (CFS – using the upper third of the foliage – on intake and nutrient digestibility. Twelve lactating dairy cows were used in a randomized block design to evaluated intake and digestibility. The levels of replacement of CS with CFS were 0, 20, 40 and 60%. The parameters studied were: dry matter intake (DMI, organic matter intake (OMI, neutral detergent fiber intake (NDFI, indigestible neutral detergent fiber intake (INDFI, apparent digestibility of dry matter (ADDM, apparent digestibility of organic matter (ADOM, apparent digestibility of crude protein (ADCP, apparent digestibility of neutral detergent fiber (ADNDF, apparent digestibility of total carbohydrates (ADTC and apparent digestibility of non-fiber carbohydrates (ADNFC. The replacement of CS with different levels of the upper third of cassava foliage silage (CFS had no effect in practically any of evaluated variables (p > 0.05. However, ADCP (p < 0.01 decreased as the levels of replacement
-
Nađpal, Jelena D; Lesjak, Marija M; Mrkonjić, Zorica O; Majkić, Tatjana M; Četojević-Simin, Dragana D; Mimica-Dukić, Neda M; Beara, Ivana N
2018-02-15
The aim of the present study was investigation of the phenolic profile, ascorbic acid content, antioxidant, anti-acetylcholinesterase, anti-inflammatory and cytotoxic activity of rose hips and the preserves (purée and jam) of three insufficiently examined Rosa species: Rosa dumalis Bechst., R. dumetorum Thuill. and R. sempervirens L. The liquid chromatography-tandem mass spectrometry analysis resulted in quantification of 14 of the 45 phenolic compounds examined, with ellagic acid as the most dominant. Notable antioxidant activity of all three species was confirmed through several assays. Moderate inhibition of acetylcholinesterase by extracts of all investigated Rosa species was observed. Several extracts of examined Rosa species demonstrated inhibition potency towards production of some monitored eicosanoids in cyclooxygenase-1 and 12-lipoxygenase pathways. Two R. sempervirens extracts exerted cytotoxic activity against HeLa and HT-29 cell lines, but were inactive towards MRC-5 and MCF7. The results support the potential of these rose hips as food with health-promoting properties. Copyright © 2017 Elsevier Ltd. All rights reserved.
-
Biosynthesized silver nanoparticles to control fungal infections in indoor environments
Deyá, Cecilia; Bellotti, Natalia
2017-06-01
Fungi grow especially in dark and moist areas, deteriorating the indoor environment and causing infections that particularly affect immunosuppressed individuals. Antimicrobial coatings have as principal objective to prevent biofilm formation and infections by incorporation of bioactive additives. In this sense, metallic nanoparticles, such as silver, have proven to be active against different microorganisms specially bacteria. Biosynthesized method is a promising environmentally friendly option to obtain nanoparticles. The aim of this research was assess the employment of plants extracts of Aloysia triphylla (cedrón), Laurelia sempervirens (laurel) and Ruta chalepensis (ruda) to obtain silver nanoparticles to be used as an antimicrobial additive to a waterborne coating formulation. The products obtained were assessed against fungal isolates from biodeteriorated indoor coatings. The fungi were identified by conventional and molecular techniques as Chaetomium globosum and Alternaria alternate. The results revealed that the coating with silver nanoparticles obtained with L. sempervirens extract at 60 °C with a size of 9.8 nm was the most efficient against fungal biofilm development.
-
Sargın, İdris; Kaya, Murat; Arslan, Gulsin; Baran, Talat; Ceter, Talip
2015-02-01
Biosorbents have been widely used in heavy metal removal. New resources should be exploited to develop more efficient biosorbents. This study reports the preparation of three novel chitosan microcapsules from pollens of three common, wind-pollinated plants (Acer negundo, Cupressus sempervirens and Populus nigra). The microcapsules were characterized (Fourier transform infrared spectroscopy, thermogravimetric analysis, scanning electron microscopy and elemental analysis) and used in removal of heavy metal ions: Cd(II), Cr(III), Cu(II), Ni(II) and Zn(II). Their sorption capacities were compared to those of cross-linked chitosan beads without pollen grains. C. sempervirens-chitosan microcapsules exhibited better performance (Cd(II): 65.98; Cu(II): 67.10 and Zn(II): 49.55 mg g(-1)) than the other microcapsules and the cross-linked beads. A. negundo-chitosan microcapsules were more efficient in Cr(III) (70.40 mg g(-1)) removal. P. nigra-chitosan microcapsules were found to be less efficient. Chitosan-pollen microcapsules (except P. nigra-chitosan microcapsules) can be used in heavy metal removal. Copyright © 2014 Elsevier Ltd. All rights reserved.
-
Yulistiani, Dwi; Jelan, Z A; Liang, J B; Yaakub, H; Abdullah, N
2015-04-01
A digestibility study was conducted to evaluate the effects of supplementing mulberry foliage and urea rice-bran as a source of fermentable energy and protein to 12 sheep fed diets based on urea-treated rice straw (TRS). The three dietary treatments were: T1, TRS with mulberry; T2, TRS with 50% mulberry replaced with rice bran and urea; and T3, TRS with rice bran and urea. The study was arranged in a completely randomized design with four replications for each treatment. The sheep were fed one of the three diets and the supplements were offered at 1.2% of the body weight (BW) and the TRS was provided ad libitum. There were no differences (p>0.05) among the three treatment groups with respect to dry matter (DM) intake (76.8±4.2 g/kg BW(0.75)) and DM, organic matter (OM), and crude protein (CP) digestibility (55.3±1.22; 69.9±0.85; 46.3±1.65% respectively for DM, OM, and CP). The digestibility of fiber (neutral detergent fiber [NDF] and acid detergent fiber) was significantly lower (penergy and protein for sheep fed TRS based diet. The suggested level of supplementation is 1.2% of BW or 32% of the total diet since it resulted in similar effects on the intake of DM, OM, and NDF, digestibility of DM, OM, and CP, N utilization and microbial supply when compared to rice bran and urea supplementation.
-
The ASC Sequoia Programming Model
Energy Technology Data Exchange (ETDEWEB)
Seager, M
2008-08-06
In the late 1980's and early 1990's, Lawrence Livermore National Laboratory was deeply engrossed in determining the next generation programming model for the Integrated Design Codes (IDC) beyond vectorization for the Cray 1s series of computers. The vector model, developed in mid 1970's first for the CDC 7600 and later extended from stack based vector operation to memory to memory operations for the Cray 1s, lasted approximately 20 years (See Slide 5). The Cray vector era was deemed an extremely long lived era as it allowed vector codes to be developed over time (the Cray 1s were faster in scalar mode than the CDC 7600) with vector unit utilization increasing incrementally over time. The other attributes of the Cray vector era at LLNL were that we developed, supported and maintained the Operating System (LTSS and later NLTSS), communications protocols (LINCS), Compilers (Civic Fortran77 and Model), operating system tools (e.g., batch system, job control scripting, loaders, debuggers, editors, graphics utilities, you name it) and math and highly machine optimized libraries (e.g., SLATEC, and STACKLIB). Although LTSS was adopted by Cray for early system generations, they later developed COS and UNICOS operating systems and environment on their own. In the late 1970s and early 1980s two trends appeared that made the Cray vector programming model (described above including both the hardware and system software aspects) seem potentially dated and slated for major revision. These trends were the appearance of low cost CMOS microprocessors and their attendant, departmental and mini-computers and later workstations and personal computers. With the wide spread adoption of Unix in the early 1980s, it appeared that LLNL (and the other DOE Labs) would be left out of the mainstream of computing without a rapid transition to these 'Killer Micros' and modern OS and tools environments. The other interesting advance in the period is that systems were being developed with multiple 'cores' in them and called Symmetric Multi-Processor or Shared Memory Processor (SMP) systems. The parallel revolution had begun. The Laboratory started a small 'parallel processing project' in 1983 to study the new technology and its application to scientific computing with four people: Tim Axelrod, Pete Eltgroth, Paul Dubois and Mark Seager. Two years later, Eugene Brooks joined the team. This team focused on Unix and 'killer micro' SMPs. Indeed, Eugene Brooks was credited with coming up with the 'Killer Micro' term. After several generations of SMP platforms (e.g., Sequent Balance 8000 with 8 33MHz MC32032s, Allian FX8 with 8 MC68020 and FPGA based Vector Units and finally the BB&N Butterfly with 128 cores), it became apparent to us that the killer micro revolution would indeed take over Crays and that we definitely needed a new programming and systems model. The model developed by Mark Seager and Dale Nielsen focused on both the system aspects (Slide 3) and the code development aspects (Slide 4). Although now succinctly captured in two attached slides, at the time there was tremendous ferment in the research community as to what parallel programming model would emerge, dominate and survive. In addition, we wanted a model that would provide portability between platforms of a single generation but also longevity over multiple--and hopefully--many generations. Only after we developed the 'Livermore Model' and worked it out in considerable detail did it become obvious that what we came up with was the right approach. In a nutshell, the applications programming model of the Livermore Model posited that SMP parallelism would ultimately not scale indefinitely and one would have to bite the bullet and implement MPI parallelism within the Integrated Design Code (IDC). We also had a major emphasis on doing everything in a completely standards based, portable methodology with POSIX/Unix as the target environment. We decided against specialized libraries like STACKLIB for performance, but kept as many general purpose, portable math libraries as were needed by the codes. Third, we assumed that the SMPs in clusters would evolve in time to become more powerful, feature rich and, in particular, offer more cores. Thus, we focused on OpenMP, and POSIX PThreads for programming SMP parallelism. These code porting efforts were lead by Dale Nielsen, A-Division code group leader, and Randy Christensen, B-Division code group leader. Most of the porting effort revolved removing 'Crayisms' in the codes: artifacts of LTSS/NLTSS, Civic compiler extensions beyond Fortran77, IO libraries and dealing with new code control languages (we switched to Perl and later to Python). Adding MPI to the codes was initially problematic and error prone because the programmers used MPI directly and sprinkled the calls throughout the code.
-
78 FR 11899 - Notice of Realty Action: Direct Sale of Public Land in San Mateo County, CA
2013-02-20
... California Nonprofit Corporation, for the appraised fair market value. The total appraised value of both... Sempervirens Fund for the appraised fair market value of $420,000. Parcel No. 2 T. 8 S., R. 4 W., Sec. 9, NE\\1... appraised fair market value of $450,000. The areas described aggregate 80 acres, more or less, in Santa...
-
Lifescience Database Archive (English)
Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = ...jct: 64 GRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGSILFEETLY 121 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta
-
Directory of Open Access Journals (Sweden)
Přibyla Zdeněk
2016-09-01
Full Text Available The stepped-bed system, with a step-like longitudinal profile, is typical morphology in steep headwater streams. These systems are created by a series of coarse sediments or instream wood (steps with supercritical flows interspaced with finer material (forming pools with subcritical flows. In the case of well-developed steps and pools, the resulting channel-reach morphology is referred to as “step-pool” morphology. In this study, we identify a previously undescribed type of step-pool formation, the “foliaged step-pool”, in the high-gradient Stoligy Stream of the Moravskoslezské Beskydy Mountains. The defining feature of this formation is the significant presence of leaves in the step structure. The geometry of the steps and pools was measured and the parameters that characterise the distribution, amount and function of leaves acting in these areas were defined. Statistical results showed differences between non-foliaged and foliaged step-pool formations, in which the latter showed a significant increase in storage level, influencing the channel’s hydrodynamics. Particle-size analyses demonstrated that foliaged step-pool formations had finer sediment in the pools, which indicates that there are differences in sediment transport processes between foliaged and non-foliaged formations. These results offer new insights into stepped-bed and step-pool morphology, providing directions for further research on small streams in deciduous forested regions.
-
Use of three fodder trees in the feeding of goats in the subhumid tropics in Mexico.
Olivares Perez, Jaime; Aviles Nova, Francisca; Albarran Portillo, Benito; Castelan Ortega, Octavio A; Rojas Hernandez, Saul
2013-03-01
Chemical composition, in vitro gas production with and without polyethyleneglycol (PEG-4000 MW), and in vitro digestibility of dry matter (IVDMD) and organic (IVOMD) foliage from Pithecellobium dulce, Gliricidia sepium and Haematoxylum brasiletto were determined. The preference test was run for 15 days: the first 10 days as adaption period and the 5 days served as evaluation period. It was conducted in ten developing female Creole goats of 6 months old, weighing 14 ± 2.0 kg in order to determine goat preference for any of the three foliages. Productive performance of 35 male creole kids of 6 months old (14 ± 3.0 kg) was also determined by ad libitum feeding of the foliage of the tree: the 30 and 15 % of each of the P. dulce (T1, T2), G. sepium (T3, T4), and H. brasiletto (T5, T6) foliages were added to the experiment diets, while T7 served as control diet that did not contain any foliage. The crude protein (CP), total phenols (TP), condensed tannins (CT), IVDMD, and IVOMD were different among the foliages. The PEG determined the biological activity of the TP and CT of H. brasiletto. Goats preferred to consume the foliage of P. dulce because of its higher content of CP and IVDMD and low content of TP and CT. In the productive response, dry matter intake (DMI) was higher in kids fed T1 diet and was stimulated by higher IVDMD and IVOMD, which resulted in the higher daily weight gain (DWG). The contribution with TP and CT of H. brasiletto to T5 and T6 and the rejection by the animals of G. sepium in T3 and T4 explain the negative effects on the DMI and the DWG. Findings of the study suggested higher kid performance for P. dulce foliage. Possible attributes may include its better CP, low TP and CT, and higher digestibility.
-
Taliraps on koristatud ja müüdudki / Lii Sammler
Sammler, Lii, 1963-
2014-01-01
Esimest korda talirapsiga viljelusvõistlusel osalenud Väätsa Agro ja Karinu PM OÜ panustasid sordile DK 'Sequoia' ja esialgsetel andmetel korjati kuiva seemet 4-5 tonni ümber hektarilt. Vestlusest agronoomidega
-
2011-03-15
... Wilderness; 14. Emigrant Wilderness; 15. Hoover Wilderness; 16. Yosemite National Park; 17. Ansel Adams... monitor) Ansel Adams WA, Kaiser WA, John 15.5 14.9 13.6 7.1 2200 Muir WA (KAIS monitor)......... Sequoia...
-
Fall Foliage Topology Seminars
1990-01-01
This book demonstrates the lively interaction between algebraic topology, very low dimensional topology and combinatorial group theory. Many of the ideas presented are still in their infancy, and it is hoped that the work here will spur others to new and exciting developments. Among the many techniques disussed are the use of obstruction groups to distinguish certain exact sequences and several graph theoretic techniques with applications to the theory of groups.
-
Directory of Open Access Journals (Sweden)
Edvaldo Sagrilo
2006-11-01
Full Text Available The objective of this work was to study the leaf production pattern and dry matter distribution in cassava during the second plant cycle. The completely randomized experimental design with four replications was used, with five cultivars in the main plots and ten harvest times in the sub-plots. Foliage production was affected by plant age, being higher in hot periods. Leaf blades and petioles dry matter content presented a linear increase due to a progressive decrease in the amount of young leaves and ontogenetic factors. The stems provided, temporarily, carbohydrates to the plant re-growth, delaying the availability and use of storage roots dry matter. The dry matter content in the storage roots was lower during the vegetative and higher during rest period. The storage roots diameter increased considerably when the amount of leaves was higher, indicating the importance of leaf area in the cassava plant production.O experimento foi conduzido de outubro de 1997 a maio de 1999, no Noroeste do Paraná, Brasil, com o objetivo de avaliar o padrão de produção de folhas e distribuição de massa seca em 5 cultivares de mandioca, durante o segundo ciclo vegetativo. Utilizou-se o delineamento experimental em blocos casualizados, com 4 repetições, no esquema de parcelas subdivididas, estando as cultivares nas parcelas e as épocas de colheita nas subparcelas. A produção de folhas foi afetada pela idade das plantas, sendo maior nos períodos de temperatura elevada. Os teores de massa seca nos limbos foliares e pecíolos aumentaram linearmente com a idade das plantas, devido à menor proporção de folhas jovens e a fatores ontogênicos inerentes à planta. As hastes proporcionaram, temporariamente, os assimilados necessários para a reestruturação vegetativa das plantas, protelando a disponibilidade e uso dos carboidratos armazenados nas raízes. O teor de massa seca nas raízes foi menor durante o período de crescimento vegetativo e maior
-
Magnetic record associated with tree ring density: Possible climate proxy
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther; Pruner, Petr; Venhodová, Daniela; Kadlec, Jaroslav
2007-01-01
Roč. 8, - (2007), s. 1-11 ISSN 1467-4866 Institutional research plan: CEZ:AV0Z3013912 Keywords : palaeo-climatic indicator * sequoia tree * magnetic properties Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.842, year: 2007
-
PARKS OF RECREATIONAL COMPLEXES OF SUDAK CITY
Directory of Open Access Journals (Sweden)
Irina L. Potapenko
2017-01-01
Full Text Available Aim. Development of optimal paths of landscaping recreational complexes South-Eastern Crimea (Sudak for example, taking into account climatic, geographical and historical characteristics of the region. Material. Green plantings of recreational complexes have been surveyed in 2015–2016: the sanatorium "Sudak" of the Ministry of defense of the Russian Federation, the area is 26 ha; the pension "Crimean spring", an area is 10 ha; the pension "Zvezdniy", an area is 3 ha; the sanatorium "Sokol", an area is 3 ha; the Tourist and recreational complex "Sudak", an area is 17 ha. Results. Dendroflora of Sudak recreational facilities includes 151 species belonging to 90 genera and 47 families. The most represented species in the following families: Rosaceae – 27 (17,9%, Oleaceae – 12 (7,9%, Pinaceae – 12 (7,9%, Cupressaceae – 10 (6,7%, Fabaceae – 7 (4,6%. The greatest form variety is possessed by representatives of the family Cupressaceae (8, or 33,0%, the pyramidal form of cypress evergreen (Cupressus sempervirens `Pyramidalis` dominates among them. An assortment of ornamental trees and shrubs in the studied sites are quite diverse – 175 species and forms. Deciduous trees and shrubs prevail here – 60 (34,3% and 37 (21,1% species and forms respectively. There are 37 (21,1% species and forms of coniferous trees and shrubs. There are 24 (13,7% types and forms of evergreen foliage plants: shrubs – 18 (10,3%, trees – 4 (2,3%, lianas – 2 (1,1%. Main conclusions. The source of introductory material for the green construction of South-Eastern Crimea should be the representatives of families Cupressaceae, Pinaceae, Rosaceae, Oleaceae, Fabaceae those are the most adapted to the soil and climatic conditions of the region. Increasing the diversity of ornamental trees and shrubs should be achieved through the use of coniferous and evergreen plants. To create picturesque groups of plants with different emotional conten increasing the number of
-
Information needs for natural fire management planning
Parsons, David; Bancroft, Larry; Nichols, Thomas; Stohlgren, Thomas
1985-01-01
The development and implementation of an effective natural fire management program require a clear definition of goals and objectives, an ever-expanding information base, and effective program evaluation. Examples are given from Sequoia and Kings Canyon National Parks.
-
HIGH FOLIAR NITROGEN IN DESERT SHRUBS: AN IMPORTANT ECOSYSTEM TRAIT OR DEFECTIVE DESERT DOCTRINE?
Nitrogen concentrations in green and senesced leaves of perennial desert shrubs were compiled from a worldwide literature search to test the validity of the doctrine that desert shrubs produce foliage and leaf litter much richer in nitrogen than that in the foliage of plants from...
-
Directory of Open Access Journals (Sweden)
Ke-Gang Li
2013-03-01
Full Text Available Proanthocyanidins (PAs are fundamental nutritional metabolites in different types of grape products consumed by human beings. Although the biosynthesis of PAs in berry of Vitis vinifera has gained intensive investigations, the understanding of PAs in other Vitis species is limited. In this study, we report PA formation and characterization of gene expression involved in PA biosynthesis in leaves of V. bellula, a wild edible grape species native to south and south-west China. Leaves are collected at five developmental stages defined by sizes ranging from 0.5 to 5 cm in length. Analyses of thin layer chromatography (TLC and high performance liquid chromatography-photodiode array detector (HPLC-PAD show the formation of (+-catechin, (−-epicatechin, (+-gallocatechin and (−-epigallocatechin during the entire development of leaves. Analyses of butanol-HCl boiling cleavage coupled with spectrometry measurement at 550 nm show a temporal trend of extractable PA levels, which is characterized by an increase from 0.5 cm to 1.5 cm long leaves followed by a decrease in late stages. TLC and HPLC-PAD analyses identify cyanidin, delphinidin and pelargonidin produced from the cleavage of PAs in the butanol-HCl boiling, showing that the foliage PAs of V. bellula include three different types of extension units. Four cDNAs, which encode VbANR, VbDFR, VbLAR1 and VbLAR2, respectively, are cloned from young leaves. The expression patterns of VbANR and VbLAR2 but not VbLAR1 and VbDFR follow a similar trend as the accumulation patterns of PAs. Two cDNAs encoding VbMYBPA1 and VbMYB5a, the homologs of which have been demonstrated to regulate the expression of both ANR and LAR in V. vinifera, are also cloned and their expression profiles are similar to those of VbANR and VbLAR2. In contrast, the expression profiles of MYBA1 and 2 homologs involved in anthocyanin biosynthesis are different from those of VbANR and VbLAR2. Our data show that both ANR and LAR branches are
-
Energy Technology Data Exchange (ETDEWEB)
Ellsworth, D.S.; LaRoche, J.; Hendrey, G.R.
1998-03-01
A maturing loblolly pine (Pinus taeda L.) forest was exposed to elevated CO{sub 2} in the natural environment in a perturbation study conducted over three seasons using the free-air CO{sub 2} enrichment (FACE) technique. At the time measurements were begun in this study, the pine canopy was comprised entirely of foliage which had developed under elevated CO{sub 2} conditions (atmospheric CO{sub 2} {approx} 550 {micro}mol/mol{sup {minus}1}). Measurements of leaf photosynthetic responses to CO{sub 2} were taken to examine the effects of elevated CO{sub 2} on photosynthetic N nutrition in a pine canopy under elevated CO{sub 2}. Photosynthetic CO{sub 2} response curves (A-c{sub i} curves) were similar in FACE trees under elevated CO{sub 2} compared with counterpart trees in ambient plots for the first foliage cohort produced in the second season of CO{sub 2} exposure, with changes in curve form detected in the foliage cohorts subsequently produced under elevated CO{sub 2}. Differences in the functional relationship between carboxylation rate and N{sub a} suggest that for a given N{sub a} allocated among successive cohorts of foliage in the upper canopy, V{sub c max} was 17% lower in FACE versus Ambient trees. The authors also found that foliar Rubisco content per unit total protein derived from Western blot analysis was lower in late-season foliage in FACE foliage compared with ambient-grown foliage. The results illustrate a potentially important mode of physiological adjustment to growth conditions that may operate in forest canopies. Findings suggest that mature loblolly pine trees growing in the field may have the capacity for shifts in intrinsic nitrogen utilization for photosynthesis under elevated CO{sub 2} that are not dependent on changes in leaf N. Findings suggest a need for continued examination of internal feedbacks at the whole-tree and ecosystem level in forests that may influence long-term photosynthetic responses to elevated CO{sub 2}.
-
Begonia semperflorens FB08-59 and FB08-163 clonal germplasm
FB08-59 is a dark-foliage, red-flowered wax begonia clone adapted to hot humid summers. It is the product of a recurrent selection breeding procedure to combine and improve the environmental tolerances identified in B. semperflorens ’Kaylen’ and B. cucullata arenosicola into a dark-foliaged, perenn...
-
Orius insidiosus (Say) and entomopathogens as possible biological control agents for thrips
Ronald D. Oetting; Ramona J. Beshear
1991-01-01
The entomology program in ornamental floriculture at the University of Georgia places primary emphasis on commercial production of flowering and foliage plants under greenhouse conditions. Thrips management is a major part of that program. Several species of foliage and flower inhabiting species are pests on greenhouse crops. The western flower thrips, ...
-
Shoot-derived abscisic acid promotes root growth.
McAdam, Scott A M; Brodribb, Timothy J; Ross, John J
2016-03-01
The phytohormone abscisic acid (ABA) plays a major role in regulating root growth. Most work to date has investigated the influence of root-sourced ABA on root growth during water stress. Here, we tested whether foliage-derived ABA could be transported to the roots, and whether this foliage-derived ABA had an influence on root growth under well-watered conditions. Using both application studies of deuterium-labelled ABA and reciprocal grafting between wild-type and ABA-biosynthetic mutant plants, we show that both ABA levels in the roots and root growth in representative angiosperms are controlled by ABA synthesized in the leaves rather than sourced from the roots. Foliage-derived ABA was found to promote root growth relative to shoot growth but to inhibit the development of lateral roots. Increased root auxin (IAA) levels in plants with ABA-deficient scions suggest that foliage-derived ABA inhibits root growth through the root growth-inhibitor IAA. These results highlight the physiological and morphological importance, beyond the control of stomata, of foliage-derived ABA. The use of foliar ABA as a signal for root growth has important implications for regulating root to shoot growth under normal conditions and suggests that leaf rather than root hydration is the main signal for regulating plant responses to moisture. © 2015 John Wiley & Sons Ltd.
-
Analysis of forest structure using thematic mapper simulator data
Peterson, D. L.; Westman, W. E.; Brass, J. A.; Stephenson, N. J.; Ambrosia, V. G.; Spanner, M. A.
1986-01-01
The potential of Thematic Mapper Simulator (TMS) data for sensing forest structure information has been explored by principal components and feature selection techniques. In a survey of forest structural properties conducted for 123 field sites of the Sequoia National Park, the canopy closure could be well estimated (r = 0.62 to 0.69) by a variety of channel bands and band ratios, without reference to the forest type. Estimation of the basal area was less successful (r = 0.51 or less) on the average, but could be improved for certain forest types when data were stratified by floristic composition. To achieve such a stratification, individual sites were ordinated by a detrended correspondence analysis based on the canopy of dominant species. The analysis of forest structure in the Sequoia data suggests that total basal area can be best predicted in stands of lower density, and in younger even-aged managed stands.
-
Hierarchical models for informing general biomass equations with felled tree data
Brian J. Clough; Matthew B. Russell; Christopher W. Woodall; Grant M. Domke; Philip J. Radtke
2015-01-01
We present a hierarchical framework that uses a large multispecies felled tree database to inform a set of general models for predicting tree foliage biomass, with accompanying uncertainty, within the FIA database. Results suggest significant prediction uncertainty for individual trees and reveal higher errors when predicting foliage biomass for larger trees and for...
-
Directory of Open Access Journals (Sweden)
João Teodoro Padua
2009-07-01
Full Text Available Brazil is the largest world producer of cassava. Leafs and stem of cassava can be a alternative source of protein for omnivorous fish. However, the potential use is limited by the presence of high level of cyanide acid. The present study evaluated physiological responses of juvenile pacu submitted to increasing levels of the final third of the cassava foliage meal in diets. A completely randomized design was used in factorial scheme 4x2, four levels, 0, 12, 24 and 36 % of cassava foliage meal (CFM, and 2 levels of crude protein (CP, 24 % and 30 %, with three replicates. Three hundred twelve fish (55.33±6.19 g were distributed into 24 ponds of 13 m2. Results indicated that the levels of CFM inclusion affected the hemoglobin values (P<0.01, as well as the CP level (P<0.05, with interaction of these factors (P<0.01. Significant interaction among the CFM levels and CP was also observed for hematocrit, plasma protein (P<0.01 and plasma lipid (P<0.05. In the 24 % CP level was observed higher values of Hb in control and 36 % of CFM (3.51 g/dl and 3.25 g/dl respectively while with 30 % CP the control diet and 36 % CFM presented the smallest values (3.29 g/dl and 2.78 g/dl respectively. The higher level of CFM tested, inside of any protein level, had low influence on the pacu metabolism.
KEY WORDS: Cassava leaf and stem fish metabolism, pacu, P. Mesopotamicus.
O Brasil é o maior produtor mundial de mandioca, disponibilizando a rama de mandioca como fonte alternativa na alimentação de peixes onívoros. No entanto, o potencial de uso da rama é limitado pela toxidez do ácido cianídrico. Objetivou-se avaliar a resposta fisiológica do pacu alimentado com níveis crescentes da rama de mandioca. Utilizou-se delineamento inteiramente casualizado, em fatorial 4x2, quatro níveis de rama de mandioca (RM (0%, 12%, 24% e 36% e dois níveis de proteína bruta (PB (24% e 30% com três repetições. Trezentos e doze peixes (55,33±6,19 g foram -
Warren, Jeffrey M; Bassman, John H; Mattinson, D Scott; Fellman, John K; Edwards, Gerald E; Robberecht, Ronald
2002-03-01
Chromatographic analyses of foliage from several tree species illustrate the species-specific effects of UV-B radiation on both quantity and composition of foliar flavonoids. Pinus ponderosa, Quercus rubra and Pseudotsuga menziesii were field-grown under modulated ambient (1x) and enhanced (2x) biologically effective UV-B radiation. Foliage was harvested seasonally over a 3-year period, extracted, purified and the flavonoid fraction applied to a mu Bondapak/C(18) column HPLC system sampling at 254 nm. Total flavonoid concentrations in Quercus rubra foliage were more than twice (leaf area basis) that of the other species; Pseudotsuga menziesii foliage had intermediate levels and P. ponderosa had the lowest concentrations of total flavonoids. No statistically significant UV-B radiation-induced effects were found in total foliar flavonoid concentrations for any species; however, concentrations of specific compounds within each species exhibited significant treatment effects. Higher (but statistically insignificant) levels of flavonoids were induced by UV-B irradiation in 1- and 2-year-old P. ponderosa foliage. Total flavonoid concentrations in 2-year-old needles increased by 50% (1x ambient UV-B radiation) or 70% (2x ambient UV-B radiation) from that of 1-year-old tissue. Foliar flavonoids of Q. rubra under enhanced UV-B radiation tended to shift from early-eluting compounds to less polar flavonoids eluting later. There were no clear patterns of UV-B radiation effects on 1-year-old P. menziesii foliage. However, 2-year-old tissue had slightly higher foliar flavonoids under the 2x UV-B radiation treatment compared to ambient levels. Results suggest that enhanced UV-B radiation will alter foliar flavonoid composition and concentrations in forest tree species, which could impact tissue protection, and ultimately, competition, herbivory or litter decomposition.
-
Coleman, Tom W; Smith, Sheri L; Jones, Michael I; Graves, Andrew D; Strom, Brian L
2017-10-01
From 2009 to 2013, we tested four systemic insecticide formulations and five application methods against the invasive goldspotted oak borer, Agrilus auroguttatus Schaeffer (Coleoptera: Buprestidae), in California. The insecticides were evaluated in three experiments: 1) 2009 remedial applications of emamectin benzoate (stem-injection) and imidacloprid (stem-injection and soil-injection); 2) 2009-2012 emamectin benzoate and imidacloprid initially applied at different times during the dormant season with varying injection technologies; and 3) 2013 dinotefuran applied to several tree diameter size classes. Adult leaf-feeding bioassays were used to assess the impact of systemic treatments against A. auroguttatus, whereas enzyme-linked immunosorbent assays determined the quantity of the active ingredient of insecticide residues in foliage. Imidacloprid (experiment 1) persisted at elevated levels in foliage of coast live oak, Quercus agrifolia Née, for 1.5 yr following stem injections. Stem injections of emamectin benzoate (experiment 2) sometimes significantly decreased survival in adults fed foliage from treated Q. agrifolia, and both the emamectin benzoate and imidacloprid treatments reduced adult feeding in some trials. Imidacloprid residues in Q. agrifolia and California black oak, Quercus kelloggii Newb., foliage remained at elevated levels (>10 µg/g) ∼2 yr postapplication. In 2013 (experiment 3), dinotefuran residues were highest in foliage collections 2 wk postapplication and greatest in smaller diameter oaks, but insecticide treatment had no effect on survival or frass production by adults fed foliage from treated trees. Systemic injections of emamectin benzoate and imidacloprid applied during the dormant season to uninfested or lightly infested oaks can reduce adult A. auroguttatus survival and maturation feeding. Published by Oxford University Press on behalf of Entomological Society of America 2017. This work is written by (a) US Government employee
-
The overlooked biodiversity of flower-visiting invertebrates.
Directory of Open Access Journals (Sweden)
Carl W Wardhaugh
Full Text Available Estimates suggest that perhaps 40% of all invertebrate species are found in tropical rainforest canopies. Extrapolations of total diversity and food web analyses have been based almost exclusively on species inhabiting the foliage, under the assumption that foliage samples are representative of the entire canopy. We examined the validity of this assumption by comparing the density of invertebrates and the species richness of beetles across three canopy microhabitats (mature leaves, new leaves and flowers on a one hectare plot in an Australian tropical rainforest. Specifically, we tested two hypotheses: 1 canopy invertebrate density and species richness are directly proportional to the amount of resource available; and 2 canopy microhabitats represent discrete resources that are utilised by their own specialised invertebrate communities. We show that flowers in the canopy support invertebrate densities that are ten to ten thousand times greater than on the nearby foliage when expressed on a per-unit resource biomass basis. Furthermore, species-level analyses of the beetle fauna revealed that flowers support a unique and remarkably rich fauna compared to foliage, with very little species overlap between microhabitats. We reject the hypothesis that the insect fauna on mature foliage is representative of the greater canopy community even though mature foliage comprises a very large proportion of canopy plant biomass. Although the significance of the evolutionary relationship between flowers and insects is well known with respect to plant reproduction, less is known about the importance of flowers as resources for tropical insects. Consequently, we suggest that this constitutes a more important piece of the 'diversity jigsaw puzzle' than has been previously recognised and could alter our understanding of the evolution of plant-herbivore interactions and food web dynamics, and provide a better foundation for accurately estimating global species
-
Foliar moisture content of Pacific Northwest vegetation and its relation to wildland fire behavior.
James K. Agee; Clinton S. Wright; Nathan Williamson; Mark H. Huff
2002-01-01
Fotiar moisture was monitored for five conifers and associated understory vegetation in Pacific Northwest forests. Decline in foliar moisture of new foliage occurred over the dry season, while less variation was evident in older foliage. Late season foliar moisture ranged from 130 to 170%. In riparian-upland comparisons, largest differences were found for understory...
-
Foliar essential oils and deer browsing preference of Douglas-fir genotypes
M.A. Radwan
1978-01-01
Yield and composition of essential oils were compared in foliage of Douglas-fir. Five clones with different susceptibilities to deer browsing were used; foliage was collected during the dormant season. There were no qualitative differences among the oils of the different clones, but the oils differed quantitatively in all variables measured. Eight variables appeared...
-
Phytotoxic grass residues reduce germination and initial root growth of ponderosa pine
W. J. Rietveld
1975-01-01
Extracts of green foliage of Arizona fescue and mountain muhly significantly reduced germination of ponderosa pine seeds, and retarded speed of elongation and mean radicle length. Three possible routes of release of the inhibitor were investigated: (1) leaching from live foliage, (2) root exudation, and (3) overwinter leaching from dead residues. The principal route...
-
Lifescience Database Archive (English)
Full Text Available sequoia glyptostroboides PE=2 SV=1 Length = 319 Score = 261 bits (667), Expect = 3e...GLASRSAAYYQQGARFAK 183 Query: 637 WRTVV 651 WRTVV Sbjct: 184 WRTVV 188 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Meta
-
Matthew F. Winn; Philip A. Araman
2012-01-01
The USDA Forest Service Forest Inventory and Analysis (FIA) program collects crown foliage transparency estimates for individual trees on Phase 3 (P3) inventory plots. The FIA crown foliage estimate is obtained from a pair of perpendicular side views of the tree. Researchers with the USDA Forest Service Southern Research Station have developed a computer program that...
-
Physical characteristics of shrub and conifer fuels for fire behavior models
Jonathan R. Gallacher; Thomas H. Fletcher; Victoria Lansinger; Sydney Hansen; Taylor Ellsworth; David R. Weise
2017-01-01
The physical properties and dimensions of foliage are necessary inputs for some fire spread models. Currently, almost no data exist on these plant characteristics to fill this need. In this report, we measured the physical properties and dimensions of the foliage from 10 live shrub and conifer fuels throughout a 1-year period. We developed models to predict relative...
-
Doug Maguire; Alan Kanaskie; Mike McWilliams
2000-01-01
Many Douglas-fir plantations along the north coast of Oregon are exhibiting severe symptoms of Swiss needle cast disease (SNC). These symptoms include premature loss of foliage, abundant fungal pseudothecia on needles, yellowing of foliage, and apparent reduction in diameter and height growth. The development of the disease and its impacts on growth are currently being...
-
Eric A. Kuehler; Mary Anne Sword Sayer; James D. Haywood; C. Dan Andries
2004-01-01
Depending on the season and intensity of fire, as well as the phenology of foliage and new root growth, fire may damage foliage, and subsequently decrease whole-crown carbon fixation and allocation to the root system. In central Louisiana the authors investigated how season of prescribed burning affects fine-root dynamics, root carbohydrate relations, and leaf area...
-
Andrews, M. Y.; Palmer, B.; Leake, J. R.; Banwart, S. A.; Beerling, D. J.
2009-12-01
The rise of land plants in the Paleozoic is classically implicated as driving lower atmospheric CO2 levels through enhanced weathering of Ca and Mg bearing silicate minerals. However, this view overlooks the fact that plants coevolved with associated mycorrhizal fungi over this time, with many of the weathering processes usually ascribed to plants actually being driven by the combined activities of roots and mycorrhizal fungi. Here we present initial results from a novel mesocosm-scale laboratory experiment designed to allow investigation of plant-driven carbon flux and mineral weathering at different soil depths under ambient (400 ppm) and elevated (1500 ppm) atmospheric CO2. Four species of plants were chosen to address evolutionary trends in symbiotic mycorrhizal association and rooting depth on biologically driven silicate weathering under the different CO2 regimes. Gymnosperms were used to investigate potential differences in weathering capabilities of two fungal symbioses: Sequoia sempervirens and Metasequoia glyptostroboides (arbuscular mycorrhizal, AM) and Pinus sylvestris (ectomycorrhizal, EM), and the shallow rooted ancient fern, Osmunda regalis, used to provide a contrast to the three more deeply rooted trees. Plants were grown in a cylindrical mesocosm with four horizontal inserts at each depth. These inserts are a mesh-covered dual-core unit whereby an inner core containing silicate minerals can be rotated within an outer core. The mesh excludes roots from the cylinders allowing fungal-rock pairings to be examined at each depth. Each core contains either basalt or granite, each with severed (rotated cores) or intact (static cores) mycorrhizae. This system provides a unique opportunity to examine the ability of a plant to weather minerals with and without its symbiotic fungi. Preliminary results indicate marked differences in nutritional and water requirements, and response to elevated CO2 between the species. The bulk solution chemistries (p
-
Connections in wood and foliage
Kevin T. Smith
2009-01-01
Trees are networked systems that capture energy, move massive amounts of water and material, and provide the setting for human society and for the lives of many associated organisms. Tree survival depends on making and breaking the right connections within these networks.
-
Masi, Marco
2013-01-01
In recent years, numerous studies have been initiated in order to understand what are the microorganisms involved in forest plants diseases and the role played by phytotoxins produced in the pathogenesis processes. The aim of the present thesis was to study the fungi and the phytotoxins associated with canker disease of the Italian cypress (Cupressus sempervirens L.) and the branch dieback of juniper (Juniperus phoenicea L.) which are plant diseases with noteworthy social and economical impli...
-
Aboveground Tree Biomass for Pinus ponderosa in Northeastern California
Directory of Open Access Journals (Sweden)
Todd A. Hamilton
2013-03-01
Full Text Available Forest managers need accurate biomass equations to plan thinning for fuel reduction or energy production. Estimates of carbon sequestration also rely upon such equations. The current allometric equations for ponderosa pine (Pinus ponderosa commonly employed for California forests were developed elsewhere, and are often applied without consideration potential for spatial or temporal variability. Individual-tree aboveground biomass allometric equations are presented from an analysis of 79 felled trees from four separate management units at Blacks Mountain Experimental Forest: one unthinned and three separate thinned units. A simultaneous set of allometric equations for foliage, branch and bole biomass were developed as well as branch-level equations for wood and foliage. Foliage biomass relationships varied substantially between units while branch and bole biomass estimates were more stable across a range of stand conditions. Trees of a given breast height diameter and crown ratio in thinned stands had more foliage biomass, but slightly less branch biomass than those in an unthinned stand. The observed variability in biomass relationships within Blacks Mountain Experimental Forest suggests that users should consider how well the data used to develop a selected model relate to the conditions in any given application.
-
Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.
Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E
2009-10-01
Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.
-
High Sierra Ecosystems: The Role of Fish Stocking in Amphibian Declines
Kathleen Matthews
2003-01-01
With a rich diversity of aquatic habitats, including deep lakes, shallow ponds, and rushing streams, Dusy Basinin Sequoia-Kings Canyon National Parks typifies the high Sierra ecosystem where mountain yellow-legged frogs usually thrive. Yet throughout the Sierra, aquatic ecologist Kathleen Matthews found entire water basins empty of these amphibians. Comprehensive...
-
The impact of normative message types on off-trail hiking
P.L. Winter
2006-01-01
Depreciative activities and high annual visitation levels threaten the health and sustainability of the giant Sequoia. Signage is one route to managing visitor behavior. Research suggests a two-by-two conceptualization of normative messages in signs. Messages may present the "ought" (injunctive) or the "is" (descriptive) of behavior and may be...
-
Uyi, Osariyekemwen O; Zachariades, Costas; Heshula, Lelethu U; Hill, Martin P
2018-01-01
Host plant phenology (as influenced by seasonality) and light-mediated changes in the phenotypic and phytochemical properties of leaves have been hypothesised to equivocally influence insect herbivore performance. Here, we examined the effects of seasonality, through host plant phenology (late growth-season = autumn vs flowering-season = winter) and light environment (shade vs full-sun habitat) on the leaf characteristics of the invasive alien plant, Chromolaena odorata. In addition, the performance of a specialist folivore, Pareuchaetes insulata, feeding on leaves obtained from both shaded and full-sun habitats during autumn and winter, was evaluated over two generations. Foliar nitrogen and magnesium contents were generally higher in shaded plants with much higher levels during winter. Leaf water content was higher in shaded and in autumn plants. Total non-structural carbohydrate (TNC) and phosphorus contents did not differ as a function of season, but were higher in shaded foliage compared to full-sun leaves. Leaf toughness was noticeably higher on plants growing in full-sun during winter. With the exception of shaded leaves in autumn that supported the best performance [fastest development, heaviest pupal mass, and highest growth rate and Host Suitability Index (HSI) score], full-sun foliage in autumn surprisingly also supported an improved performance of the moth compared to shaded or full-sun leaves in winter. Our findings suggest that shaded and autumn foliage are nutritionally more suitable for the growth and reproduction of P. insulata. However, the heavier pupal mass, increased number of eggs and higher HSI score in individuals that fed on full-sun foliage in autumn compared to their counterparts that fed on shaded or full-sun foliage in winter suggest that full-sun foliage during autumn is also a suitable food source for larvae of the moth. In sum, our study demonstrates that seasonal and light-modulated changes in leaf characteristics can affect insect
-
Directory of Open Access Journals (Sweden)
Osariyekemwen O Uyi
Full Text Available Host plant phenology (as influenced by seasonality and light-mediated changes in the phenotypic and phytochemical properties of leaves have been hypothesised to equivocally influence insect herbivore performance. Here, we examined the effects of seasonality, through host plant phenology (late growth-season = autumn vs flowering-season = winter and light environment (shade vs full-sun habitat on the leaf characteristics of the invasive alien plant, Chromolaena odorata. In addition, the performance of a specialist folivore, Pareuchaetes insulata, feeding on leaves obtained from both shaded and full-sun habitats during autumn and winter, was evaluated over two generations. Foliar nitrogen and magnesium contents were generally higher in shaded plants with much higher levels during winter. Leaf water content was higher in shaded and in autumn plants. Total non-structural carbohydrate (TNC and phosphorus contents did not differ as a function of season, but were higher in shaded foliage compared to full-sun leaves. Leaf toughness was noticeably higher on plants growing in full-sun during winter. With the exception of shaded leaves in autumn that supported the best performance [fastest development, heaviest pupal mass, and highest growth rate and Host Suitability Index (HSI score], full-sun foliage in autumn surprisingly also supported an improved performance of the moth compared to shaded or full-sun leaves in winter. Our findings suggest that shaded and autumn foliage are nutritionally more suitable for the growth and reproduction of P. insulata. However, the heavier pupal mass, increased number of eggs and higher HSI score in individuals that fed on full-sun foliage in autumn compared to their counterparts that fed on shaded or full-sun foliage in winter suggest that full-sun foliage during autumn is also a suitable food source for larvae of the moth. In sum, our study demonstrates that seasonal and light-modulated changes in leaf characteristics can
-
Energy Technology Data Exchange (ETDEWEB)
ELLSWORTH,D.S.; LA ROCHE,J.; HENDREY,G.R.
1998-03-01
A maturing loblolly pine (Pinus taeda L.) forest was exposed to elevated CO{sub 2} in the natural environment in a perturbation study conducted over three seasons using the free-air CO{sub 2} enrichment (FACE) technique. At the time measurements were begun in this study, the pine canopy was comprised entirely of foliage which had developed under elevated CO{sub 2} conditions (atmospheric [CO{sub 2}] {approx} 550 {micro}mol mol{sup {minus}1}). Measurements of leaf photosynthetic responses to CO{sub 2} were taken to examine the effects of elevated CO{sub 2} on photosynthetic N nutrition in a pine canopy under elevated CO{sub 2}. Photosynthetic CO{sub 2} response curves (A-c{sub i} curves) were similar in FACE trees under elevated CO{sub 2} compared with counterpart trees in ambient plots for the first foliage cohort produced in the second season of CO{sub 2} exposure, with changes in curve form detected in the foliage cohorts subsequently produced under elevated CO{sub 2}. Differences in the functional relationship between carboxylation rate and N{sub a} suggest that for a given N{sub a} allocated among successive cohorts of foliage in the upper canopy, V{sub c max} was 17% lower in FACE versus Ambient trees. The authors also found that foliar Rubisco content per unit total protein derived from Western blot analysis was lower in late-season foliage in FACE foliage compared with ambient-grown foliage. The results illustrate a potentially important mode of physiological adjustment to growth conditions that may operate in forest canopies. Their findings suggest that mature loblolly pine trees growing in the field may have the capacity for shifts in intrinsic nitrogen utilization for photosynthesis under elevated CO{sub 2} that are not dependent on changes in leaf N. While carboxylation efficiency per unit N apparently decreased under elevated CO{sub 2}, photosynthetic rates in trees at elevated CO{sub 2} concentrations {approx} 550 pmol mol{sub {minus}1} are still
-
Extracting More Data from LiDAR in Forested Areas by Analyzing Waveform Shape
Directory of Open Access Journals (Sweden)
Peter Beets
2012-03-01
Full Text Available Light Detection And Ranging (LiDAR in forested areas is used for constructing Digital Terrain Models (DTMs, estimating biomass carbon and timber volume and estimating foliage distribution as an indicator of tree growth and health. All of these purposes are hindered by the inability to distinguish the source of returns as foliage, stems, understorey and the ground except by their relative positions. The ability to separate these returns would improve all analyses significantly. Furthermore, waveform metrics providing information on foliage density could improve forest health and growth estimates. In this study, the potential to use waveform LiDAR was investigated. Aerial waveform LiDAR data were acquired for a New Zealand radiata pine plantation forest, and Leaf Area Density (LAD was measured in the field. Waveform peaks with a good signal-to-noise ratio were analyzed and each described with a Gaussian peak height, half-height width, and an exponential decay constant. All parameters varied substantially across all surface types, ruling out the potential to determine source characteristics for individual returns, particularly those with a lower signal-to-noise ratio. However, pulses on the ground on average had a greater intensity, decay constant and a narrower peak than returns from coniferous foliage. When spatially averaged, canopy foliage density (measured as LAD varied significantly, and was found to be most highly correlated with the volume-average exponential decay rate. A simple model based on the Beer-Lambert law is proposed to explain this relationship, and proposes waveform decay rates as a new metric that is less affected by shadowing than intensity-based metrics. This correlation began to fail when peaks with poorer curve fits were included.
-
Fostering personal relationships with the wild: Oral history's role in recreation management
Alison Steiner; Daniel R. Williams
2017-01-01
Sequoia and Kings Canyon National Parks (SEKI) encompass much of central California's most stunning scenery. Dramatic peaks and passes, perennial snowfields, remote lake basins, alpine meadows, steep canyons, and shockingly big trees characterize the more than 800,000 acres of wild land that lie within the parks. Drought-resistant chaparral and blue oak woodlands...
-
Li, Chun-Xiang; Yang, Qun
2003-03-01
DNA sequences from 28S rDNA were used to assess relationships between and within traditional Taxodiaceae and Cupressaceae s.s. The MP tree and NJ tree generally are similar to one another. The results show that Taxodiaceae and Cupressaceae s.s. form a monophyletic conifer lineage excluding Sciadopitys. In the Taxodiaceae-Cupressaceae s.s. monophyletic group, the Taxodiaceae is paraphyletic. Taxodium, Glyptostrobus and Cryptomeria forming a clade(Taxodioideae), in which Glyptostrobus and Taxodium are closely related and sister to Cryptomeria; Sequoia, Sequoiadendron and Metasequoia are closely related to each other, forming another clade (Sequoioideae), in which Sequoia and Sequoiadendron are closely related and sister to Metasequoia; the seven genera of Cupressaceae s.s. are found to be closely related to form a monophyletic lineage (Cupressoideae). These results are basically similar to analyses from chloroplast gene data. But the relationships among Taiwania, Sequoioideae, Taxodioideae, and Cupressoideae remain unclear because of the slow evolution rate of 28S rDNA, which might best be answered by sequencing more rapidly evolving nuclear genes.
-
1988-08-01
differences between exposure t.Npes. ke examined the .TL log to deterri ne the operational status of the antenna (mi. off. multiple on and offs during the da ...Foliage insects and fruit 14 Fruit 15 Foliage insects and seeds 16 Bark insects 17 Nectar and sap 18 Aquatic vegetation 19 Aquatic invertebrates C. Habitat...Coltsfoot Chamaedaphfle calyculata Petasites palmatus Bear Berry Dandelion Arctostaphylos uva -ursi Taraxacum officinale 122 Hawkweed Hieracium sp. 123
-
Changing conditions on wilderness campsites: Seven case studies of trends over 13 to 32 years
David N. Cole
2013-01-01
This report brings together seven case studies of trends in the number and condition of wilderness campsites over periods ranging from 13 to 32 years. Case examples come from five mountainous wilderness areas in the western United States: Sequoia-Kings Canyon Wilderness in California, the Eagle Cap Wilderness in Oregon, the Frank Church-River of No Return Wilderness in...
-
Policy Evaluation: Use of the PSB-Aptitude Test as an Admission Requirement for the LVN Program.
Firstman, Aranga
A study was conducted to assess the use of the Psychological Services Bureau's Aptitude Test for Practical Nursing (PSB Aptitude Test) as an entrance requirement for the licensed vocational nurse (LVN) program at College of the Sequoias. The study sought to determine whether the PSB Aptitude Test was a valid indicator of success in the LVN…
-
Annosus Root disease of Western Conifers (FIDL)
Craig L. Schmitt; John R. Parmeter; John T. Kliejunas
2000-01-01
Annosus root disease is found on all western conifer species but is of most concern on true firs, hemlocks, and pines. Incense cedar, coast redwood and sequoia are sometimes infected in California. Western juniper is infected throughout its range. Annosus is common and causes extensive decay in old-growth western and mountain hemlock stands. Many mixed conifer stands...
-
Leaf Dynamics of Panicum maximum under Future Climatic Changes.
Britto de Assis Prado, Carlos Henrique; Haik Guedes de Camargo-Bortolin, Lívia; Castro, Érique; Martinez, Carlos Alberto
2016-01-01
Panicum maximum Jacq. 'Mombaça' (C4) was grown in field conditions with sufficient water and nutrients to examine the effects of warming and elevated CO2 concentrations during the winter. Plants were exposed to either the ambient temperature and regular atmospheric CO2 (Control); elevated CO2 (600 ppm, eC); canopy warming (+2°C above regular canopy temperature, eT); or elevated CO2 and canopy warming (eC+eT). The temperatures and CO2 in the field were controlled by temperature free-air controlled enhancement (T-FACE) and mini free-air CO2 enrichment (miniFACE) facilities. The most green, expanding, and expanded leaves and the highest leaf appearance rate (LAR, leaves day(-1)) and leaf elongation rate (LER, cm day(-1)) were observed under eT. Leaf area and leaf biomass were higher in the eT and eC+eT treatments. The higher LER and LAR without significant differences in the number of senescent leaves could explain why tillers had higher foliage area and leaf biomass in the eT treatment. The eC treatment had the lowest LER and the fewest expanded and green leaves, similar to Control. The inhibitory effect of eC on foliage development in winter was indicated by the fewer green, expanded, and expanding leaves under eC+eT than eT. The stimulatory and inhibitory effects of the eT and eC treatments, respectively, on foliage raised and lowered, respectively, the foliar nitrogen concentration. The inhibition of foliage by eC was confirmed by the eC treatment having the lowest leaf/stem biomass ratio and by the change in leaf biomass-area relationships from linear or exponential growth to rectangular hyperbolic growth under eC. Besides, eC+eT had a synergist effect, speeding up leaf maturation. Therefore, with sufficient water and nutrients in winter, the inhibitory effect of elevated CO2 on foliage could be partially offset by elevated temperatures and relatively high P. maximum foliage production could be achieved under future climatic change.
-
Forest Resources of the Caucasian Black Sea Coast: Problems and Prospects of Rational Use
Directory of Open Access Journals (Sweden)
S. M. Bebia
2015-02-01
Full Text Available More than 70 % of the Caucasian Black Sea Coast (CBSC forests grow in mountainous conditions of the Colchis phytogeographical province and perform primary environmental functions. In these forests for a long period of time excessively intense logging has been in practice, which caused serious damage to their health. The main issues of forestry here are the introduction of effective methods of harvesting, using rational technology in logging operations, restoring native forest types at past logging sites, increasing the productivity and sustainability of forests on the bioecological biogeocenotical level, and preserving the riparian-protective role of forests. In the article, the author analyzes the results of many years of research in forests of the CBSC, that consider the question of condition of forests, peculiarity the multifunctional values and priority direction forestry in them. The author also considers the basic conformity of structure and com-position of forest stands, and presents evidence about the natural renewal of logging sites in fir and beech forests. It has been established that high intensity selective logging more than 50 % canopy cover and bringing the stand after logging 0.5 and below leads to degradation of forests, except for the possibility of natural regeneration felling areas for over 70 years. The study substantiates the effectiveness of selective forms of forest management in the uneven-aged stands and the importance of a multi-purpose and sustainable use of forest resources. The study emphasizes the need for a rational technology of logging operations and silvicultural demands strict compliance with the development of cutting areas and suggests ways to improve the productivity of forests, using introduced valuable tree species. For example, Sequoia sempervirens Endl. in the plantings of forest monocultures on the Abkhazian Research Forest Experimental Station (Ochamchira at age of 50 years forms a valuable timber of
-
Chemical and morphological characteristics of key tree species of the Carpathian Mountains
International Nuclear Information System (INIS)
Mankovska, Blanka; Godzik, Barbara; Badea, Ovidiu; Shparyk, Yuri; Moravcik, Pavel
2004-01-01
Concentrations of Al, B, Ca, Cu, Fe, K, Mg, Mn, N, Na, P, S and Zn in the foliage of white fir (Abies alba), Norway spruce (Picea abies) and common beech (Fagus sylvatica) from 25 sites of the Carpathian Mts. forests (Czech Republic, Poland, Romania, Slovakia and Ukraine) are discussed in a context of their limit values. S/N ratio was different from optimum in 90% of localities when compared with the European limit values. Likewise we found increase of Fe and Cu concentrations compared with their background levels in 100% of locations. Mn concentrations were increased in 76% of localities. Mn mobilization values indicate the disturbance of physiological balance leading to the change of the ratio with Fe. SEM-investigation of foliage waxes from 25 sites in the Carpathian Mts. showed, that there is a statistically significant difference in mean wax quality. Epistomatal waxes were damaged as indicated by increased development of net and amorphous waxes. The most damaged stomata in spruce needles were from Yablunitsa, Synevir and Brenna; in fir needles from Stoliky, and in beech leaves from Mala Fatra, Morske Oko and Beregomet. Spruce needles in the Carpathian Mts. had more damaged stomata than fir needles and beech leaves. Spruce seems to be the most sensitive tree species to environmental stresses including air pollution in forests of the Carpathian Mountains. Foliage surfaces of three forest tree species contained Al, Si, Ca, Fe, Mg, K, Cl, Mn, Na, Ni and Ti in all studied localities. Presence of nutrition elements (Ca, Fe, Mg, K and Mn) on foliage surface hinders opening and closing stomata and it is not physiologically usable for tree species. - Chemical composition of foliage and structure of epicuticular waxes indicated phytotoxic effects of air pollution in many forest sites of the Carpathian Mountains
-
Economic Benefit for Cuban Laurel Thrips Biological Control.
Shogren, C; Paine, T D
2016-02-01
The Cuban laurel thrips, Gynaikothrips ficorum Marchal (Thysanoptera: Phlaeothripidae), is a critical insect pest of Ficus microcarpa in California urban landscapes and production nurseries. Female thrips feed and oviposit on young Ficus leaves, causing the expanding leaves to fold or curl into a discolored leaf gall. There have been attempts to establish specialist predator natural enemies of the thrips, but no success has been reported. We resampled the same areas in 2013-2014 where we had released Montandoniola confusa (= morguesi) Streito and Matocq (Hemiptera: Anthocoridae) in southern California in 1995 but had been unable to recover individuals in 1997-1998. Thrips galls were significantly reduced in all three of the locations in the recent samples compared with the earlier samples. M. confusa was present in all locations and appears to be providing successful biological control. The value of the biological control, the difference between street trees in good foliage condition and trees with poor foliage, was $58,766,166. If thrips damage reduced the foliage to very poor condition, the value of biological control was $73,402,683. Total cost for the project was $61,830. The benefit accrued for every dollar spent on the biological control of the thrips ranged from $950, if the foliage was in poor condition, to $1,187, if the foliage was in very poor condition. The value of urban forest is often underappreciated. Economic analyses that clearly demonstrate the very substantial rates of return on investment in successful biological control in urban forests provide compelling arguments for supporting future efforts. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
-
Directory of Open Access Journals (Sweden)
González Elena
1986-12-01
Full Text Available An anatomy study was made of following wood easy-to-root species: Aucuba japonica Thunb., Buddleja japonica Hemsley, Buxus sempervirens L., Citrus aurantium. L., Citrus limon (L. Burm. fil., Cvdonia oblonga Miller, Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L., Populus nigra L., Rhododendron ponticum L., Salix atrocinerea Brot., Salix viminalis L., Sambucus nigra L. and Symphoricarpos albus (L. S. F. Blake. It was observed the presence or absence of a discontinous sclerenchyma ring so the species studied had not a mechanical barrier to the emergence of adventitious roots. Se realizó un estudio histológico de las siguientes especies leñosas de fácil enraizamiento: Aucuba japonica Thumb, Buddleja japonica Hemsley, Buxus sempervirens L., Citrus aurantium L., Citrus limon (L. Burm, fil., Cydonia oblonga Miller, Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L. Populus nigra L., Rhododendron ponticum L., Salix atrocinerea Brot., Salix viminalis L., Sambucus nigra L. y Syrnphoricarpos albus (L. S. F. Blake. Se observó la presencia o ausencia de un anillo discontinuo de esclerénquima, por lo tanto dichas especies no poseen ningún impedimento mecánico para la emergencia de las raíces adventicias.
-
Smith, Maria S; Fridley, Jason D; Goebel, Marc; Bauerle, Taryn L
2014-01-01
Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native) versus L. sempervirens (native) and Frangula alnus (non-native) versus Rhamnus alnifolia (native), over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.
-
Directory of Open Access Journals (Sweden)
Maria S Smith
Full Text Available Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native versus L. sempervirens (native and Frangula alnus (non-native versus Rhamnus alnifolia (native, over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.
-
Cottrell, Ted E; Wood, Bruce W; Ni, Xinzhi
2010-11-01
Black pecan aphid, Melanocallis caryaefoliae (Davis) (Hemiptera: Aphididae), feeding elicits localized chlorotic injury to pecan foliage [Carya illinoinensis (Wangenh.) K Koch] and apparent acceleration of leaf senescence and defoliation. The ability of certain plant growth regulators (PGRs) (forchlorfenuron, gibberellic acid and aviglycine) to prevent M. caryaefoliae from triggering pecan leaf chlorosis and senescence-like processes was evaluated on two dates in both 2006 and 2007. Treatments were applied to orchard foliage and used in laboratory leaf-disc bioassays to assess possible reduction in aphid-elicited chlorosis and concomitant effects on aphid mortality and development. Foliage pretreated with forchlorfenuron + gibberellic acid prior to being challenged with aphids resulted in significantly less aphid-elicited chlorosis than did control or aviglycine-treated leaf discs. No PGR affected aphid mortality; however, development time was increased by forchlorfenuron + gibberellic acid in 2006 and by aviglycine + gibberellic acid on one date in 2007. Certain PGRs possess the potential for usage on pecan to protect foliar canopies from M. caryaefoliae via changes in the susceptibility of the host leaf to senescence-like factors being introduced by feeding aphids. This protective effect on host foliage and the associated suppressive effect on development of feeding aphids might also be relevant to pest management programs on other aphid-crop systems in which aphid-elicited chlorosis and senescence-like processes can limit profitability. Published 2010 by John Wiley & Sons, Ltd.
-
Nitrogen vertical distribution by canopy reflectance spectrum in winter wheat
International Nuclear Information System (INIS)
Huang, W J; Yang, Q Y; Peng, D L; Huang, L S; Zhang, D Y; Yang, G J
2014-01-01
Nitrogen is a key factor for plant photosynthesis, ecosystem productivity and leaf respiration. Under the condition of nitrogen deficiency, the crop shows the nitrogen deficiency symptoms in the bottom leaves, while excessive nitrogen will affect the upper layer leaves first. Thus, timely measurement of vertical distribution of foliage nitrogen content is critical for growth diagnosis, crop management and reducing environmental impact. This study presents a method using bi-directional reflectance difference function (BRDF) data to invert foliage nitrogen vertical distribution. We developed upper-layer nitrogen inversion index (ULNI), middle-layer nitrogen inversion index (MLNI) and bottom-layer nitrogen inversion index (BLNI) to reflect foliage nitrogen inversion at upper layer, middle layer and bottom layer, respectively. Both ULNI and MLNI were made by the value of the ratio of Modified Chlorophyll Absorption Ration Index to the second Modified Triangular Vegetation Index (MCARI/MTVI2) referred to as canopy nitrogen inversion index (CNII) in this study at ±40° and ±50°, and at ±30° and ±40° view angles, respectively. The BLNI was composed by the value of nitrogen reflectance index (NRI) at ±20° and ±30° view angles. These results suggest that it is feasible to measure foliage nitrogen vertical-layer distribution in a large scale by remote sensing
-
Composition of jojoba seeds and foliage
Energy Technology Data Exchange (ETDEWEB)
Verbiscar, A.J.; Banigan, T.F.
1978-01-01
The desert shrub jojoba (Simmondsia chinensis) may be browsed by cattle. The seeds have about 50% oil but the extracted meal is at present unsuitable for feeding. Simmondsin, the most prevalent toxin, is present in seed, 2.3%, and in husks, leaves and twigs. Seeds contained another toxin, Simmondsin 2'-ferulate. The contents of oil, protein, carbohydrate and amino acids in seed are tabulated. 13 references.
-
FLAMMABILITY OF HERBICIDE-TREATED GUAVA FOLIAGE
Guava leaves treated with herbicide were found to be less flammable than untreated green leaves or dead leaves . Differences in flammability were...determined by small-scale laboratory fires, differential thermal analysis, and thermogravimetric analysis. The herbicide-treated leaves had a higher ash
-
Cuthbertson, Andrew G S; Walters, Keith F A; Deppe, Carola
2005-08-01
The compatibility of the entomopathogenic fungus Lecanicillium muscarium and chemical insecticides used to control the second instar stages of the sweetpotato whitefly, Bemisia tabaci, was investigated. The effect on spore germination of direct exposure for 24 h to the insecticides imidacloprid, buprofezin, teflubenzuron and nicotine was determined. Only exposure to buprofezin was followed by acceptable spore germination. However, all chemicals significantly reduced spore germination when compared to a water control. Infectivity of L. muscarium in the presence of dry residues of buprofezin, teflubenzuron and nicotine (imidacloprid is a systemic pesticide) on foliage were also investigated. No significant detrimental effects on the level of control of B. tabaci was recorded when compared with fungi applied to residue free foliage on either tomato or verbena plants. Fungi in combination with imidacloprid gave higher B. tabaci mortality on verbena foliage compared to either teflubenzuron or nicotine and fungi combinations. Use of these chemical insecticides with L. muscarium in integrated control programmes for B. tabaci is discussed.
-
CSIR Research Space (South Africa)
Saidi, AT
2006-01-01
Full Text Available is the season for re-sprouting. Fresh-brown to pink leaves start to grow. The fruit pods also dry and start to burst open to release the seeds. These seasonal changes are in line with what happens in miombo woodlands elsewhere on the continent. Mafuta (2000...) describes miombo woodlands as deciduous, losing leaves in winter and developing full foliage in summer. Palmer and Pitman (1972), describe similar seasonal changes, and further observe that pink and purple new foliage of miombo woodlands presents a great...
-
ÖZCAN, Selma; BROHI, A.Raşit
2014-01-01
A pot experiment was carried out to see the effect of different foliage fertilizers (imported and domestic) on growth, dry matter yield and N, P and K contents of maize plant. The trail was conducted on randomized complete blocks design with six replications. Maize Pioneer -3377 variety was used as test plant. For normal growth of the plant 100 kg P20s/ha was applied as a triple super phosphate. According to the results, the applied all foliage fertilizers have significantly increased the dry...
-
Directory of Open Access Journals (Sweden)
D.E García
2008-09-01
was performed through foliage intake measurements, by means of a Latin square design with a 12-day evaluation period. The chemical composition (CP, CE, NDF, phenols, condensed tannins, protein precipitable tannins and total sterols and the in situ ruminal degradability (DMD and OMD of the forages were determined. The most preferred species were: P. pedicellare (327,98 g DM, L. leucocephala (325,63 g DM, M. alba (293,37 g DM, G. ulmifolia (292,48 g DM, C. tinctoria (277,18 g DM and C. alba (274, 49 g DM. The foliages of G. sepium (108,05 g DM, T. diversifolia (106,09 g DM, M. oleifera (76,28 g DM, A. indica (76,19 g DM and S. saman (58,72 g DM were moderately consumed. However, the biomass of T. gigantea (1,39 g DM was practically rejected. During the experimental period different trends were observed in the intake of each species. Nevertheless, no significant relationship was observed among the intake and chemical composition, the concentration of secondary metabolites and ruminal degradability. It is concluded that to carry out preference trials with animals for the selection of species with potential for silvopastoral systems is important.
-
International Nuclear Information System (INIS)
Cataldo, D.A.; Klepper, E.L.; Craig, D.K.
1975-01-01
A low windspeed plant exposure chamber was employed for the generation and deposition of particulate 238 Pu as nitrate, citrate, and oxide (fresh and aged) onto foliage of Phaseolus vulgaris. Physical deposition characteristics and particle sizing were routinely measured and deposition parameters calculated. At wind speeds of 0.42 cm sec -1 , deposition velocities for these compounds were of the order 10 -3 cm sec -1 with deposition rates onto exposed foliage of 0.26 to 0.52 pg 238 Pu cm -2 sec -1 . The fate of surface deposited Pu compounds with respect to chemical modification and leachability was evaluated by leaching with synthetic rainwater and 0.1 percent HNO 3 solutions. Leaching of contaminated foliage with acidified solutions resulted in a 1-to-9 fold increase in Pu removal from foliar surfaces, depending upon chemical form, as compared to rainwater. Sequential leaching of foliage at 1, 7, 14, or 21 days after contamination indicated a reduced leachability of surface deposits with residence time on the leaf. The extent of leaching and concentration of soluble component was dependent on chemical form supplied (Pu-citrate greater than -nitrate greater than -aged oxide greater than -fresh oxide). The bioavailability of Pu as measured by translocation of foliarly deposited plutonium to root and seed tissue was markedly affected by the presence of a solution vector (i.e., simulated rainfall), and also the timing of its application
-
Исследование возможности применения амаранта багряного в технологии изделий из дрожжевого теста
Simakova, Olga; Korenets, Yurii; Yudina, Tatiana; Nazarenko, Iryna; Goriainova, Iuliia
2018-01-01
It was experimentally found that additives of purple amaranth (APA) have high enzyme activity, which is proved by high activity of the amylase complex: maltose number of 5 % water extract from dry foliage of purple amaranth is 12.31±0.36 %, with addition of CaCl2 (Са2+=0.01 g/l), it is 16.0±0.35 %. The obtained results indicate the prospects of using APA for enhancing baking properties of wheat flour.We determined the required concentration of the additive of flour from dry foliage of purple ...
-
Hendrichs, J; Katsoyannos, B I; Wornoayporn, V; Hendrichs, M A
1994-09-01
Predation is probably the most important male mortality factor in insect species with courtship displays that render males performing them conspicuous targets of predators. Sexually active Mediterranean fruit fly males, Ceratitis capitata (Wied.), aggregate in leks, where they participate in agonistic encounters and engage in visual, acoustic and pheromone-calling displays to attract receptive females. The objective of this study was to assess: a) whether sexually displaying C. capitata males in leks inside host and non-host foliage are subject to predation by the most prominent predators yellow-jacket wasps, Vespula germanica (F.), and if so, b) whether olfactory, visual or auditive stimuli are used by foraging wasps in locating male C. capitata prey. Studies were carried out in a citrus orchard and surroundings on the island of Chios, Greece. Observations were conducted using perforated containers hung within mulberry, fig or citrus foliage. Living C. capitata flies of different sex and either mature or immature were placed inside. Our results show that the yellowjacket wasps have learned to associate the presence of sexually active medfly males aggregated in leks with their prey's pheromone (kairomone). Foraging wasps, flying through the crowns of host trees, responded to the odour source of C. capitata male pheromone by approaching from downwind. Even inside dense citrus tree foliage, wasps keyed in on aggregations of pheromone-calling males using olfactory stimuli. Stimuli of visual and acoustic male signalling were only used at close range, after having followed the pheromone plume close to its source. Visual cues played a greater role in directing wasp foraging under more open and exposed host foliage conditions. Odour-based foraging of wasps inside host foliage in the mid-morning hours, when medfly male lekking activities peak, shifted gradually to a more visual-based host fruit patrolling in the afternoons to capture ovipositing and feeding medfly females
-
Hooks, Cerruti R R; Wang, Koon-Hui; Meyer, Susan L F; Lekveishvili, Mariam; Hinds, Jermaine; Zobel, Emily; Rosario-Lebron, Armando; Lee-Bullock, Mason
2011-09-01
Two field trials were conducted between 2008 and 2010 in Maryland to evaluate the ability of an Italian ryegrass (IR) (Lolium multiflorum) cover crop to reduce populations of plant-parasitic nematodes while enhancing beneficial nematodes, soil mites and arthropods in the foliage of a no-till soybean (Glycine max) planting. Preplant treatments were: 1) previous year soybean stubble (SBS); and 2) herbicide-killed IR cover crop + previous year soybean stubble (referred to as IR). Heterodera glycines population densities were very low and no significant difference in population densities of H. glycines or Pratylenchus spp. were observed between IR and SBS. Planting of IR increased abundance of bacterivorous nematodes in 2009. A reverse trend was observed in 2010 where SBS had higher abundance of bacterivorous nematodes and nematode richness at the end of the cover cropping period. Italian ryegrass also did not affect insect pests on soybean foliage. However, greater populations of spiders were found on soybean foliage in IR treatments during both field trials. Potential causes of these findings are discussed.
-
Savannah River Site environmental report for 1988
Energy Technology Data Exchange (ETDEWEB)
Cummins, C.L.; Hetrick, C.S.; Stevenson, D.A. (eds.); Davis, H.A.; Martin, D.K.; Todd, J.L.
1989-01-01
During 1988, as in previous years, Savannah River Site operations had no adverse impact on the general public or the environment. Based on the SRS site-specific code, the maximum radiation dose commitment to a hypothetical individual at the SRS boundary from 1988 SRS atmospheric releases of radioactive materials was 0.46 millirem (mrem) (0.0046 millisievert (mSv)). To obtain the maximum dose, an individual would have had to reside on the SRS boundary at the location of highest dose for 24 hours per day, 365 days per year, consume a maximum amount of foliage and meat which originated from the general vicinity of the plant boundary, and drink a maximum amount of milk from cows grazing at the plant boundary. The average radiation dose commitment from atmospheric releases to the hypothetical individual on the SRS boundary in 1988 was 0.18 mrem (0. 0018 mSv). This person, unlike the maximumly exposed individual, consumes an average amount of foliage, meat, and milk which originated from the foliage and animals living at the plant boundary.
-
Directory of Open Access Journals (Sweden)
Hidetoshi Goto
Full Text Available Insect-protected soybean (Glycine max (L. Merr. was developed to protect against foliage feeding by certain Lepidopteran insects. The assessment of potential consequences of transgene introgression from soybean to wild soybean (Glycine soja Seib. et Zucc. is required as one aspect of the environmental risk assessment (ERA in Japan. A potential hazard of insect-protected soybean may be hypothesized as transfer of a trait by gene flow to wild soybean and subsequent reduction in foliage feeding by Lepidopteran insects that result in increased weediness of wild soybean in Japan. To assess this potential hazard two studies were conducted. A three-year survey of wild soybean populations in Japan was conducted to establish basic information on foliage damage caused by different herbivores. When assessed across all populations and years within each prefecture, the total foliage from different herbivores was ≤ 30%, with the lowest levels of defoliation (< 2% caused by Lepidopteran insects. A separate experiment using five levels of simulated defoliation (0%, 10%, 25%, 50% and 100% was conducted to assess the impact on pod and seed production and time to maturity of wild soybean. The results indicated that there was no decrease in wild soybean plants pod or seed number or time to maturity at defoliation rates up to 50%. The results from these experiments indicate that wild soybean is not limited by lepidopteran feeding and has an ability to compensate for defoliation levels observed in nature. Therefore, the potential hazard to wild soybean from the importation of insect-protected soybean for food and feed into Japan is negligible.
-
Evaluation of Blue Gum Chalid Infestation Woodlots in Western Kenya
International Nuclear Information System (INIS)
Otuoma, J.; Muchiri, M.N
2007-01-01
Blue gum chalcid (BGC) Leptocybe invasa is a gall-forming wasp that belongs to the insect order Hymenoptera, family Eulophidae. It attacks a wide range of Eucalyptus species mostly between the seedling stage and five years of age. BGC causes damage to eucalyptus by forming bump-shaped galls on the leaf midribs, petioles and stems.Twisted and knobbed leaves manifest severe infestation. The aim of this study was to establish the spatial distribution of BGC and extent of host plant damage in Eucalyptus woodlots in Western Kenya. The study was carried out in six permanent sampling plots in Eucalyptus woodlots in Busia, Bungoma, Kakamega and Nyando. Trees were assessed for crown damage by estimating and classifying the density of galls on the leaves into four levels of infestation: low (greater than 50% of foliage canopy with galls and no twisted or knobbed leaves), moderate (greater than 50% of foliage with galls and less than 50% of the leaves twisted and knobbed), high (greater than 50% of the leaves twisted and knobbed, galls on the twigs and some twigs deformed and severe (greater than 50% of the twigs deformed and regeneration foliage observed). An evaluation of the pests' infestation and the extent of host plant damage indicated that, 4% of the trees and severe infestation; 5% high; 20% moderate and 70% low. Approximately 1% of trees died as a result of loss of foliage attributable to severe infestation. Other observations from the study were that the severity of BGC infestation tended to decline as trees grew older and BGC infestation retarded tree growth
-
International Nuclear Information System (INIS)
Tsai, Baolong.
1989-01-01
Absorption, translocation, distribution, exudation, and guttation of 14 C-glyphosate in water hyacinth (Eichhornia crassipes) were studied. Glyphosphate entered the plant by foliage and solution treatment. Plants were harvested and separated into the following parts: treated leaf blade, treated leaf petiole, young leaf blade, young leaf petiole, old leak blade, old leaf petiole, and root. Each part was extracted with methanol. Treated leaves, which exist only in foliage treatment, were washed with water and chloroform to remove the glyphosate residues. All 14 C counting was made by liquid scintillation spectrometry. Autoradiography was used to locate 14 C-glyphosate after foliage treatment. Results indicated that glyphosate can be absorbed from the leaf surface and translocated rapidly through phloem tissues into the whole plant body. The roots of water hyacinth absorbed glyphosate without vertical transport. Guttation of glyphosate occurred in treated leaf tips. Exudation of glyphosate from roots of water hyacinth occurred within 8 hr after foliage treatment. Chlorella vulgaris, Chlamydomonas reihardii, Anabaena cylindrica, and Chroococcus turgidus were used to explore the physiological and biochemical effects of glyphosate on algae. Spectrophotometric assays were performed for algal growth, chlorophyll, carotenoids, phycobiliprotein, carbohydrate, and protein. TLC procedures and an image analyzer were used to detect the metabolites of glyphosate inside algal cells. The common visible symptom of glyphosate toxicity in all algal cells were bleaching effect and reduction of contents of carbohydrate, protein, and pigments. The results highly suggested that glyphosate injured the algal cells by destruction of photosynthetic pigments and resulted in lowering the contents of carbohydrate and protein in algal cells
-
Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Preprint)
2011-11-01
The Fluxgate Magnetometer ,” J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P. Wikswo, Jr., “A...206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12. Primdahl, F., 1979...superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in aircraft aluminum
-
Detection of Oil in Water Column, Final Report: Detection Prototype Tests
2014-07-01
nautical miles per hour) LED Light-emitting diode LISST Laser In Situ Scattering and Transmissometry LUT Look-up table μm Micron or micrometer...nozzles are attached to an electrically actuated solenoid valve. When a remotely operated switch energizes the valve, oil flows through the nozzles...smaller droplet sizes below 70 μm. Ohmsett personnel used a Sequoia Laser In Situ Scattering and Transmissometry (LISST) 100X off-the-shelf particle
-
Path Loss Analysis of WSN Wave Propagation in Vegetation
International Nuclear Information System (INIS)
Sabri, Naseer; Aljunid, S A; Ahmad, R B; Malek, M F; Salim, M S; Kamaruddin, R
2013-01-01
Deployment of a successful wireless sensor network requires precise prediction models that provide a reliable communication links of wireless nodes. Prediction models fused with foliage models provide sensible parameters of wireless nodes separation distance, antenna height, and power transmission which affect the reliability and communication coverage of a network. This paper review the line of sight and the two ray propagation models combined with the most known foliage models that cover the propagation of wireless communications in vegetative environments, using IEEE 802.15.4 standard. Simulation of models is presented and the impacts of the communication parameters, environment and vegetation have been reported.
-
Powerhouse in the foliage; Kraftwerk im Blattwerk
Energy Technology Data Exchange (ETDEWEB)
Roesch, Harald
2010-07-01
Photosynthesis, a veritable stroke of genius on the part of nature, makes the existence of higher life forms possible. If it can be optimized, it may be able to make an even greater contribution to the resolution of future energy problems. Manajit Hayer-Hartl and Ulrich Hartl are currently working on this possibility at the Max Planck Institute of Biochemistry in Martinsried. (orig.)
-
Laser-Induced Fluorescence (LIF) from plant foliage
Chappelle, Emmett W.; Williams, Darrel L.
1987-01-01
The fluorescence spectra and fluorescence induction kinetics of green plants excited at 337 nm by a laser were studied. They correlate with plant type, as well as with changes in the physiology of the plant as the result of stress. The plant types studied include herbaceous dicots, monocots, hardwoods, conifers, and algae. These plant types could be identified on the basis of differences in either the number of fluorescent bands or the relative intensity of the bands. Differences in fluorescent spectra which could be related to vigor status are observed in conifers located in an area of high atmospheric deposition. Changes in the fluorescence spectra and induction kinetics are also seen in plants grown under conditions of nutrient deficiency and drought stress.
-
Ruminal and Intestinal Digestibility of Leucaena Foliage
African Journals Online (AJOL)
pramote
2013-12-30
Dec 30, 2013 ... Keywords: Intestinal digestibility, protein fodder, mobile nylon bag, a three-step technique ... A potential strategy for increasing the quality and availability of feed for small ruminants in the dry ... to measure intestinal disappearance of DM and CP using the mobile bag method described by De Boer et al.
-
RF Metamaterials for Foliage Penetration (FOPEN) Application
2013-02-01
Approved for public release; distribution unlimited FOREWORD The Lockheed Martin Aeronautics Company (LMA) Advanced Development Program (the “ Skunk ...customized adapter plate with matching attachments to the positioner. The C-130 Shadow Harvest sensor pod replica is designed by LMA and fabricated at a
-
Development of High Resolution Eddy Current Imaging Using an Electro-Mechanical Sensor (Postprint)
2011-08-01
Primdahl, F., 1979, “The Fluxgate Magnetometer ,” J. Phys. E: Sci. Instrum., Vol. 12: 241-253. 13. A. Abedi, J. J. Fellenstein, A. J. Lucas, and J. P...Issues 1-2, Pages 203-206 (2006). 11. Ripka, P., 1992, Review of Fluxgate Sensors, Sensors and Actuators, A. 33, Elsevier Sequoia: 129-141. 12...Wikswo, Jr., “A superconducting quantum interference device magnetometer system for quantitative analysis and imaging of hidden corrosion activity in
-
Sendoya, Sebastián F; Oliveira, Paulo S
2015-03-01
Ant foraging on foliage can substantially affect how phytophagous insects use host plants and represents a high predation risk for caterpillars, which are important folivores. Ant-plant-herbivore interactions are especially pervasive in cerrado savanna due to continuous ant visitation to liquid food sources on foliage (extrafloral nectaries, insect honeydew). While searching for liquid rewards on plants, aggressive ants frequently attack or kill insect herbivores, decreasing their numbers. Because ants vary in diet and aggressiveness, their effect on herbivores also varies. Additionally, the differential occurrence of ant attractants (plant and insect exudates) on foliage produces variable levels of ant foraging within local floras and among localities. Here, we investigate how variation of ant communities and of traits among host plant species (presence or absence of ant attractants) can change the effect of carnivores (predatory ants) on herbivore communities (caterpillars) in a cerrado savanna landscape. We sampled caterpillars and foliage-foraging ants in four cerrado localities (70-460 km apart). We found that: (i) caterpillar infestation was negatively related with ant visitation to plants; (ii) this relationship depended on local ant abundance and species composition, and on local preference by ants for plants with liquid attractants; (iii) this was not related to local plant richness or plant size; (iv) the relationship between the presence of ant attractants and caterpillar abundance varied among sites from negative to neutral; and (v) caterpillars feeding on plants with ant attractants are more resistant to ant predation than those feeding on plants lacking attractants. Liquid food on foliage mediates host plant quality for lepidopterans by promoting generalized ant-caterpillar antagonism. Our study in cerrado shows that the negative effects of generalist predatory ants on herbivores are detectable at a community level, affecting patterns of abundance and
-
Transgenic potato plants expressing cry3A gene confer resistance to Colorado potato beetle.
Mi, Xiaoxiao; Ji, Xiangzhuo; Yang, Jiangwei; Liang, Lina; Si, Huaijun; Wu, Jiahe; Zhang, Ning; Wang, Di
2015-07-01
The Colorado potato beetle (Leptinotarsa decemlineata Say, CPB) is a fatal pest, which is a quarantine pest in China. The CPB has now invaded the Xinjiang Uygur Autonomous Region and is constantly spreading eastward in China. In this study, we developed transgenic potato plants expressing cry3A gene. Quantitative real-time polymerase chain reaction (qRT-PCR) analysis indicated that the cry3A gene expressed in leaves, stems and roots of the transgenic plants under the control of CaMV 35S promoter, while they expressed only in leaves and stems under the control of potato leaf and stem-specific promoter ST-LS1. The mortality of the larvae was higher (28% and 36%) on the transgenic plant line 35S1 on the 3rd and 4th days, and on ST3 (48%) on the 5th day after inoculation with instar larvae. Insect biomass accumulation on the foliage of the transgenic plant lines 35S1, 35S2 and ST3 was significantly lower (0.42%, 0.43% and 0.42%). Foliage consumption was lowest on transgenic lines 35S8 and ST2 among all plant foliage (7.47 mg/larvae/day and 12.46 mg/larvae/day). The different transgenic plant foliages had varied inhibition to larval growth. The survivors on the transgenic lines obviously were smaller than their original size and extremely weak. The transgenic potato plants with CPB resistance could be used to develop germplasms or varieties for controlling CPB damage and halting its spread in China. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.
-
Neutralization of acidic raindrops on leaves of agricultural crop and boreal forest species
Energy Technology Data Exchange (ETDEWEB)
Hutchinson, T.C.; Adams, C.M.; Gaber, B.A.
1986-10-01
The abilities of foliage of selected agricultural crop and native boreal forest species to neutralize acidic raindrops were compared. The species differed widely in their responses. Neutralization was influenced to a large extent by leaf wettability and was poorly related with species' susceptibility to foliar injury from acid rain sprayings. Little neutralization of pH 3.0 droplets occurred on very waxy leaves, e.g. cabbage (Brassica oleracea L.), due to the small contact area between the leaf surface and raindrops. In contrast, on sunflower (Helianthus annuus L.) and radish (Raphanus sativus L.) leaves, which are pubescent and easily wettable, neutralization was considerable. For all agricultural crop species examined, the pH of droplets drying on cotyledons was consistently higher than on the leaves. The pH values of raindrops were also higher when the foliage was injured by the acid rain, probably due to leakage of cellular contents. Among boreal forest species examined, bunchberry (Cornus canadensis L.) was particularly good at neutralizing natural acid rain, increasing the pH from 3.9 to 6.6 after 9 hr of foliar contact, while the response of other boreal species ranged from a final pH of 4.8 to 5.7 under the same conditions. Simulated raindrops on wild sarsaparilla (Aralia nudicaulis L.) were never neutralized but increased in acidity as they evaporated. Chemical analyses of droplets collected from foliage showed calcium (Ca) and potassium (K) to be the major cations entering the neutralized droplets. Neutralization of acidic raindrops appears to occur through two processes; solubilization of alkaline dusts and exudates on the leaf surface, and ion exchange removal of H/sup +/ by the foliage. 14 references.
-
Neutralization of acidic raindrops on leaves of agricultural crop and boreal forest species
Energy Technology Data Exchange (ETDEWEB)
Hutchinson, T.C.; Adams, C.M.; Gaber, B.A.
1986-11-01
The abilities of foliage of selected agricultural crop and native boreal forest species to neutralize acidic raindrops were compared. The species differed widely in their responses. Neutralization was influenced to a large extent by leaf wettability and was poorly related with species' susceptibility to foliar injury from acid rain sprayings. Little neutralization of pH 3.0 droplets occurred on very waxy leaves, e.g. cabbage (Brassica oleracea L.), due to the small contact area between the leaf surface and raindrops. In contrast, on sunflower (Helianthus annuus L.) and radish (Raphanus sativus L.) leaves, which are pubescent and easily wettable, neutralization was considerable. For all agricultural crop species examined, the pH of droplets drying on cotyledons was consistently higher than on the leaves. The pH values of raindrops were also higher when the foliage was injured by the acid rain, probably due to leakage of cellular contents. Among boreal forest species examined, bunchberry (Cornus canadensis L.) was particularly good at neutralizing natural acid rain, increasing the pH from 3.9 to 6.6 after 9 hr of foliar contact, while the response of other boreal species ranged from a final pH of 4.8 to 5.7 under the same conditions. Simulated raindrops on wild sarsaparilla (Aralia nudicaulis L.) were never neutralized but increased in acidity as they evaporated. Chemical analyses of droplets collected from foliage showed calcium and potassium to be the major cations entering the neutralized droplets. Neutralization of acidic raindrops appears to occur through two processes: solubilization of alkaline dusts and exudates on the leaf surface, and ion exchange removal of H/sup +/ by the foliage. 14 refs.
-
Contaminant studies in the Sierra Nevadas
Sparling, D.W.; Fellers, G.
2002-01-01
full text: Several species of anuran amphibians (frogs and toads) are experiencing severe population declines in even seemingly pristine areas of the Sierra Mountains of California. Among the most severely depressed species are the redlegged frog, the foothill and mountain yellow-legged frogs, the Yosemite toad, and the Cascades frog. Several factors, such as habitat fragmentation, introduced predators (especially fish), and disease, have been linked to these declines. But recent evidence from a USGS-led study shows that contaminants are a primary factor. During the past three years, researchers from the USGS Patuxent Wildlife Research Center, the Western Ecology Research Center, the USDA Beltsville Agriculture Research Center, and the Texas A&M University have teamed up to conduct an extensive study on airborne pesticides and their effects on amphibian populations in the Sierra Nevada Mountains. Previous work on environmental chemistry demonstrated that pesticides from the intensely agricultural Central Valley of California are being blown into the more pristine Sierra Nevada Mountains, especially around Sequoia and Yosemite National Parks. Several pesticides, including diazinon, chlorpyrifos, malathion and endosulfan, can be measured in snow, rainfall, and pond waters in these national parks. With the exception of endosulfan, these pesticides affect and even kill both invertebrates and vertebrate species by inhibiting cholinesterase, an enzyme essential to proper nervous system functioning. In the summer of 2001, we published a paper showing that these same pesticides are now found in adults and the tadpoles of Pacific treefrogs. The results of this landmark study showed that more than 50 percent of the tadpoles and adults sampled in Yosemite and Sequoia National Parks had detectable levels of diazinon or chlorpyrifos and that 86 percent of the Pacific treefrogs sampled in the Lake Tahoe region had detectable levels of endosulfan. In contrast, frogs that were
-
Psenicka, J.; Zodrow, E.L.; Mastalerz, Maria; Bek, J.
2005-01-01
Marattialean-fossil foliage, assigned to Pecopteris Brongniart, was an important and widespread floral component in Late Pennsylvanian mires, with phylogenetic affinity to extant marattialean taxa in tropical regions. Marattialean fossil taxonomy is, however, still uncertain. Specimens from the Pilsen limnic Basin, Westphalian D, Czech Republic, represent fertile marattialean foliage of Pecopteris (Asterotheca) nyranensis and Pecopteris (Asterotheca) miltonii, and sterile foliage of Pecopteris aspidioides and Pecopteris polypodioides. Taxonomic parameters for their assignments included cuticle, stomatal morphologies (studied for the first time), and in situ reproductive organs and spores. Chemotaxonomic interpretations hinge on fidelity of preservation of compounds, or molecular fragments thereof, that were synthesized by the once-living plants. This preservation state was possibly due to the thermal history (maximum temperature of 130 ??C) in the Pilsen Basin, acidic preservation conditions, lithology and facies stability. Although subtle, the four pecopterid species are differentiable from one another by combined FTIR characteristics, supporting taxonomy. The ratio of CH2/CH3 is hypothesized to be a chemotaxonomic parameter for Pennsylvanian pteridophylls, both in seed and true ferns that have previously been studied. It will, however, be supplemented by additional biochemical markers. ?? 2004 Elsevier B.V. All rights reserved.
-
Harris, Jordan Lee; Balci, Yilmaz
2015-01-01
Bacterial leaf scorch, associated with the bacterial pathogen Xylella fastidiosa, is a widely established and problematic disease of landscape ornamentals in Washington D.C. A multi-locus sequence typing analysis was performed using 10 housekeeping loci for X. fastidiosa strains in order to better understand the epidemiology of leaf scorch disease in this municipal environment. Samples were collected from 7 different tree species located throughout the District of Columbia, consisting of 101 samples of symptomatic and asymptomatic foliage from 84 different trees. Five strains of the bacteria were identified. Consistent with prior data, these strains were host specific, with only one strain associated with members of the red oak family, one strain associated with American elm, one strain associated with American sycamore, and two strains associated with mulberry. Strains found for asymptomatic foliage were the same as strains from the symptomatic foliage on individual trees. Cross transmission of the strains was not observed at sites with multiple species of infected trees within an approx. 25 m radius of one another. X. fastidiosa strain specificity observed for each genus of tree suggests a highly specialized host-pathogen relationship.
-
Measuring Leaf Area in Soy Plants by HSI Color Model Filtering and Mathematical Morphology
International Nuclear Information System (INIS)
Benalcázar, M; Padín, J; Brun, M; Pastore, J; Ballarin, V; Peirone, L; Pereyra, G
2011-01-01
There has been lately a significant progress in automating tasks for the agricultural sector. One of the advances is the development of robots, based on computer vision, applied to care and management of soy crops. In this task, digital image processing plays an important role, but must solve some important problems, like the ones associated to the variations in lighting conditions during image acquisition. Such variations influence directly on the brightness level of the images to be processed. In this paper we propose an algorithm to segment and measure automatically the leaf area of soy plants. This information is used by the specialists to evaluate and compare the growth of different soy genotypes. This algorithm, based on color filtering using the HSI model, detects green objects from the image background. The segmentation of leaves (foliage) was made applying Mathematical Morphology. The foliage area was estimated counting the pixels that belong to the segmented leaves. From several experiments, consisting in applying the algorithm to measure the foliage of about fifty plants of various genotypes of soy, at different growth stages, we obtained successful results, despite the high brightness variations and shadows in the processed images.
-
Directory of Open Access Journals (Sweden)
Jordan Lee Harris
Full Text Available Bacterial leaf scorch, associated with the bacterial pathogen Xylella fastidiosa, is a widely established and problematic disease of landscape ornamentals in Washington D.C. A multi-locus sequence typing analysis was performed using 10 housekeeping loci for X. fastidiosa strains in order to better understand the epidemiology of leaf scorch disease in this municipal environment. Samples were collected from 7 different tree species located throughout the District of Columbia, consisting of 101 samples of symptomatic and asymptomatic foliage from 84 different trees. Five strains of the bacteria were identified. Consistent with prior data, these strains were host specific, with only one strain associated with members of the red oak family, one strain associated with American elm, one strain associated with American sycamore, and two strains associated with mulberry. Strains found for asymptomatic foliage were the same as strains from the symptomatic foliage on individual trees. Cross transmission of the strains was not observed at sites with multiple species of infected trees within an approx. 25 m radius of one another. X. fastidiosa strain specificity observed for each genus of tree suggests a highly specialized host-pathogen relationship.
-
Directory of Open Access Journals (Sweden)
Meaghan J. Wilton
2017-12-01
Full Text Available To ease food insecurities in northern Canada, some remote communities started gardening initiatives to gain more access to locally grown foods. Bush beans (Phaseolus vulgaris L. and potatoes (Solanum tuberosum L. were assessed for N, P, K, Mg, and Ca concentrations of foliage as indicators of plant nutrition in a calcareous silty loam soil of northern Ontario James Bay lowlands. Crops were grown in sole cropping and intercropping configurations, with comparisons made between an open field and an agroforestry site enclosed with willow (Salix spp. trees. Foliage chemical analysis of the sites revealed an abundance of Ca, adequacies for Mg and N, and deficiencies in P and K. Intercropping bean and potato did not show significant crop–crop facilitation for nutrients. The agroforestry site showed to be a superior management practice for the James Bay lowland region, specifically for P. The agroforestry site had significantly greater P for bean plant (p = 0.024 and potato foliage (p = 0.002 compared to the open site. It is suspected that the presence of willows improve plant available P to bean and potatoes by tree root—crop root interactions and microclimate enhancements.
-
Measuring Leaf Area in Soy Plants by HSI Color Model Filtering and Mathematical Morphology
Benalcázar, M.; Padín, J.; Brun, M.; Pastore, J.; Ballarin, V.; Peirone, L.; Pereyra, G.
2011-12-01
There has been lately a significant progress in automating tasks for the agricultural sector. One of the advances is the development of robots, based on computer vision, applied to care and management of soy crops. In this task, digital image processing plays an important role, but must solve some important problems, like the ones associated to the variations in lighting conditions during image acquisition. Such variations influence directly on the brightness level of the images to be processed. In this paper we propose an algorithm to segment and measure automatically the leaf area of soy plants. This information is used by the specialists to evaluate and compare the growth of different soy genotypes. This algorithm, based on color filtering using the HSI model, detects green objects from the image background. The segmentation of leaves (foliage) was made applying Mathematical Morphology. The foliage area was estimated counting the pixels that belong to the segmented leaves. From several experiments, consisting in applying the algorithm to measure the foliage of about fifty plants of various genotypes of soy, at different growth stages, we obtained successful results, despite the high brightness variations and shadows in the processed images.
-
International Nuclear Information System (INIS)
Ben Salem, H.; Makkar, H.P.S.; Nefzaoui, A.; Abidi, S.; Hassayoun, L.
2005-01-01
Two trials were conducted to test the hypotheses that (i) feeding small amount of a tanniniferous shrub foliage (Acacia cyanophylla Lindl., acacia) increases the proportion of rumen undegradable protein, and consequently benefits growth performance in Barbarine lamb; and (ii) such positive effect depends on the timing of feeding tannin source (i.e. acacia) relative to protein source (soya bean meal, SBM). Total (TT) and condensed tannin (CT) concentrations in air-dried acacia leaves used in this study averaged 29 g tannic acid and 48 g leucocyanidin equivalents per kg dry matter (DM), respectively. In trial 1, rumen fistulated ewes received oaten hay (hay) ad libitum and 200 g SBM (D1), D1 and 100 g acacia fed with the SBM (D2, mixed strategy) or as D2, but the SBM fed 1 h later than acacia when acacia was consumed completely (D3, sequential strategy). Hay intake, diet digestibility, rumen fermentation parameters (pH, ammonia nitrogen (NH 3 -N) and total volatile fatty acids) and in situ degradation of SBM nitrogen were similar between D1 and D2 (P > 0.05). However, the sequential strategy (D3) resulted in efficient use of N as reflected by the decrease of crude protein digestibility (CPD), plasma urea, NH 3 -N concentration and in situ degradation of SBM nitrogen. In trial 2, four groups each of six Barbarine lambs (initial LW 35.3 ± 3.7 kg) received for 90 days: hay ad libitum and 200 g SBM (D1), D1 and 20 g polyethylene glycol (PEG, MW 4000) mixed with SBM (D2), D1 and 100 g acacia with the SBM fed 1 h later when acacia was completely consumed (sequential strategy) (D3) or D3 and 20 g PEG fed with the SBM (D4). Polyethylene glycol was here used to deactivate tannins. Hay intake and DM, organic matter and neutral detergent fibre digestibility were similar among dietary treatment (P > 0.05). However, supplementing lambs with SBM and acacia without PEG (D3) resulted in a significant decrease (P 0.05). However, those supplemented with acacia without PEG (D3) had
-
Stuckenberg, Peter; Wenderdel, Christoph; Zauer, Mario
2018-06-01
Swelling velocity in dependence on the anatomical cutting direction of yew [Taxus baccata L.] and boxwood [Buxus sempervirens L.] was determined at temperature of 20 °C and at relative humidity of 10% and 100%. The investigations, conducted on a microtome section level, showed a similar behaviour for specimens of both wood species. It was possible to determine that the swelling velocity for yew and boxwood increases in its anatomical cutting directions. The longitudinal direction showed the lowest value, the tangential direction, by distinction, the highest value. Furthermore, a significant influence of early wood and late wood content on the swelling velocity for yew was detected.
-
Scalable Engineering of Quantum Optical Information Processing Architectures (SEQUOIA)
2016-12-13
fast: recently, it was demonstrated experimentally that photonic cluster states can be produced deterministically by photon scattering off a lambda ...U. The CNOT gate operation corresponds to the sub- matrix of the logic states, shown in solid-color bars and marked with red axis labels. Plots (c
-
Li, Weibin; Hartmann, Henrik; Adams, Henry D; Zhang, Hongxia; Jin, Changjie; Zhao, Chuanyan; Guan, Dexin; Wang, Anzhi; Yuan, Fenghui; Wu, Jiabing
2018-06-11
Non-structural carbohydrates (NSC) play a central role in plant functioning as energy carriers and building blocks for primary and secondary metabolism. Many studies have investigated how environmental and anthropogenic changes, like increasingly frequent and severe drought episodes, elevated CO2 and atmospheric nitrogen (N) deposition, influence NSC concentrations in individual trees. However, this wealth of data has not been analyzed yet to identify general trends using a common statistical framework. A thorough understanding of tree responses to global change is required for making realistic predictions of vegetation dynamics. Here we compiled data from 57 experimental studies on 71 tree species and conducted a meta-analysis to evaluate general responses of stored soluble sugars, starch and total NSC (soluble sugars + starch) concentrations in different tree organs (foliage, above-ground wood and roots) to drought, elevated CO2 and N deposition. We found that drought significantly decreased total NSC in roots (-17.3%), but not in foliage and above-ground woody tissues (bole, branch, stem and/or twig). Elevated CO2 significantly increased total NSC in foliage (+26.2%) and roots (+12.8%), but not in above-ground wood. By contrast, total NSC significantly decreased in roots (-17.9%), increased in above-ground wood (+6.1%), but was unaffected in foliage from N fertilization. In addition, the response of NSC to three global change drivers was strongly affected by tree taxonomic type, leaf habit, tree age and treatment intensity. Our results pave the way for a better understanding of general tree function responses to drought, elevated CO2 and N fertilization. The existing data also reveal that more long-term studies on mature trees that allow testing interactions between these factors are urgently needed to provide a basis for forecasting tree responses to environmental change at the global scale.
-
Directory of Open Access Journals (Sweden)
Ania Kobylinski
2015-07-01
Full Text Available The importance of N2-fixing arboreal cyanolichens to the nitrogen (N-balance of sub-boreal interior hybrid spruce (Picea glauca × engelmannii and subalpine fir (Abies lasiocarpa forests was examined at field sites in central BC, Canada. Host trees were accessed by a single-rope climbing technique and foliage as well as arboreal macrolichen functional groups were sampled by branch height in eight random sample trees from each of two high (High Cyano and two low (Low Cyano cyanolichen abundance sites for a total of 32 sample trees. Natural abundances of stable isotopes of N (15N, 14N and carbon (13C, 12C were determined for aggregate host tree and epiphytic lichen samples, as well as representative samples of upper organic and soil horizons (Ae and Bf from beneath host trees. As expected, N2-fixing cyanolichens had 2–6-fold greater N-contents than chlorolichens and a δ15N close to atmospheric N2, while foliage and chlorolichens were more depleted in 15N. By contrast, soils at all trees and sites were 15N-enriched (positive δ15N, with declining (not significant δ15N with increased tree-level cyanolichen abundance. Lichen functional groups and tree foliage fell into three distinct groups with respect to δ13C; the tripartite cyanolichen Lobaria pulmonaria (lightest, host-tree needles (intermediate, and bipartite cyanolichens, hair (Alectoria and Bryoria spp. and chlorolichens (heaviest. Branch height of host trees was an effective predictor of needle δ13C. Our results showed a modest positive correlation between host tree foliage N and cyanolichen abundance, supporting our initial hypothesis that higher cyanolichen abundances would elevate host tree foliar N. Further study is required to determine if high cyanolichen abundance enhances host tree and/or stand-level productivity in sub-boreal forests of central BC, Canada.
-
Off-site movement of endosulfan from irrigated cotton in New South Wales.
Kennedy, I R; Sánchez-Bayo, F; Kimber, S W; Hugo, L; Ahmad, N
2001-01-01
The fate and transport of endosulfan (6,7,8,9,10,10-hexachloro-1,5, 5a,6,9,9a-hexahydro-6,9-methano-2,4,3-benzodioxathiepin 3-oxide) applied to cotton (Gossypium hirsutum L.) fields were studied throughout three consecutive years on two selected locations in New South Wales (Australia). Rates of dissipation from foliage and soil, volatilization from the field, and transport of residues in irrigation and/or storm runoff waters were measured in order to estimate a total field balance. Dissipation of endosulfan from both foliage and soil is best explained by a two-phase process rather than by a first-order decay. Half-lives of total endosulfan toxic residues (alpha- and beta-endosulfan and the sulfate product) in the first phase were 1.6 d in foliage and 7.1 d in soil, and could be explained by the rapid volatilization of the parent isomers in the first 5 d (up to 70% of endosulfan volatilizes). In the second phase, half-lives were 9.5 d in foliage and 82 d in soil, mostly due to the persistence of the sulfate product. Concentration of endosulfan residues in runoff water varied from 45 to 2.5 microg L(-1) depending on the residue levels present on field soil at the time of the irrigation or storm events. These in turn are related to the total amounts applied, the cotton canopy cover at application, and the time since last spraying. Most of the endosulfan in runoff was found in the water phase (80%), suggesting it was bound to colloidal matter. Total endosulfan residues in runoff for a whole season accounted for no more than 2% of the pesticide applied on-field.
-
O'Neill, Bridget F; Zangerl, Arthur R; Dermody, Orla; Bilgin, Damla D; Casteel, Clare L; Zavala, Jorge A; DeLucia, Evan H; Berenbaum, May R
2010-01-01
Atmospheric levels of carbon dioxide (CO2) have been increasing steadily over the last century. Plants grown under elevated CO2 conditions experience physiological changes, particularly in phytochemical content, that can influence their suitability as food for insects. Flavonoids are important plant defense compounds and antioxidants that can have a large effect on leaf palatability and herbivore longevity. In this study, flavonoid content was examined in foliage of soybean (Glycine max Linnaeus) grown under ambient and elevated levels of CO2 and subjected to damage by herbivores in three feeding guilds: leaf skeletonizer (Popillia japonica Newman), leaf chewer (Vanessa cardui Linnaeus), and phloem feeder (Aphis glycines Matsumura). Flavonoid content also was examined in foliage of soybean grown under ambient and elevated levels of O3 and subjected to damage by the leaf skeletonizer P. japonica. The presence of the isoflavones genistein and daidzein and the flavonols quercetin and kaempferol was confirmed in all plants examined, as were their glycosides. All compounds significantly increased in concentration as the growing season progressed. Concentrations of quercetin glycosides were higher in plants grown under elevated levels of CO2. The majority of compounds in foliage were induced in response to leaf skeletonization damage but remained unchanged in response to non-skeletonizing feeding or phloem-feeding. Most compounds increased in concentration in plants grown under elevated levels of O3. Insects feeding on G. max foliage growing under elevated levels of CO2 may derive additional antioxidant benefits from their host plants as a consequence of the change in ratios of flavonoid classes. This nutritional benefit could lead to increased herbivore longevity and increased damage to soybean (and perhaps other crop plants) in the future.
-
Feeding response of the silkworm, Bombyx mori, to UV irradiation of mulberry leaves
International Nuclear Information System (INIS)
Yazawa, M.; Shimizu, T.; Hirao, T.
1992-01-01
Ultraviolet irradiation of mulberry leaves caused a reduced feeding response in Bombyx mori larvae (ca. 22% reduction in consumption as compared with control). Sucrose content of the foliage decreased after exposure to UV irradiation (0.5 mW/cm 2 ) for 1 hr. Electrophysiological responses of the sensilla styloconica-I to sucrose concentration (ca. 0-80 mg/g) showed a reduced response to UV-irradiated foliage when compared with the control. From feeding, gustatory, and electrophysiological responses, as well as the measurement of sucrose contents of the leaves, we concluded that the reduced feeding response to UV-irradiated leaves is due to the reduced sucrose content of the mulberry leaves, thus reducing pleogostimulatory levels
-
Effects of Systemic Pesticides Imidacloprid and Metalaxyl on the Phyllosphere of Pepper Plants
Directory of Open Access Journals (Sweden)
Constantinos Moulas
2013-01-01
Full Text Available Microbes inhabiting the phyllosphere of crops are exposed to pesticides applied either directly onto plant foliage or indirectly through soil. Although, phyllosphere microbiology has been rapidly evolving, little is still known regarding the impact of pesticides on the epiphytic microbial community and especially on fungi. We determined the impact of two systemic pesticides (metalaxyl and imidacloprid, applied either on foliage or through soil, on the epiphytic fungal and bacterial communities via DGGE and cloning. Both pesticides induced mild effects on the fungal and the bacterial communities. The only exception was the foliage application of imidacloprid which showed a more prominent effect on the fungal community. Cloning showed that the fungal community was dominated by putative plant pathogenic ascomycetes (Erysiphaceae and Cladosporium, while a few basidiomycetes were also present. The former ribotypes were not affected by pesticides application, while selected yeasts (Cryptococcus were stimulated by the application of imidacloprid suggesting a potential role in its degradation. A less diverse bacterial community was identified in pepper plants. Metalaxyl stimulated an Enterobacteriaceae clone which is an indication of the involvement of members of this family in fungicide degradation. Further studies will focus on the isolation of epiphytic microbes which appear to be stimulated by pesticides application.
-
Use and abuse of trace metal concentrations in plant tissue for biomonitoring and phytoextraction
International Nuclear Information System (INIS)
Mertens, Jan; Luyssaert, Sebastiaan; Verheyen, Kris
2005-01-01
Some plant species accumulate trace metals from the soil in their aboveground biomass. Therefore, some scientists have concluded that these species are suitable for biomonitoring trace metal concentrations in the soil or for removing excessive trace metals from the soil by means of phytoextraction. A significant correlation between the chemical composition of foliage and soil is not a sufficient condition for using the chemical composition of foliage as a biomonitor for the quality of the soil. The chemical composition of foliage can, however, provide additional information to the traditional soil samples. The phytoextraction potential of a plant species cannot solely be evaluated on the basis of the trace metal concentrations in the plant and soil tissue. Data on the depth of the rooting zone, the density of the soil and the harvestable biomass should also be taken into account. Although plant tissue analysis is a useful tool in a wide range of studies and applications, trace metal concentrations in plant tissue cannot be viewed in isolation. Instead it should be analysed and interpreted in relation to other information such as soil concentrations, rooted zone, biomass production, etc. - Plants that accumulate soil metals in their aboveground biomass are often incorrectly considered to be suitable for monitoring soil pollution or for phytoextraction purposes
-
Field controlled experiments of mercury accumulation in crops from air and soil
Energy Technology Data Exchange (ETDEWEB)
Niu Zhenchuan [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Zhang Xiaoshan, E-mail: zhangxsh@rcees.ac.cn [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Wang Zhangwei, E-mail: wangzhw@rcees.ac.cn [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Ci Zhijia [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China)
2011-10-15
Field open top chambers (OTCs) and soil mercury (Hg) enriched experiments were employed to study the influence of Hg concentrations in air and soil on the Hg accumulation in the organs of maize (Zea mays L.) and wheat (Triticum aestivum L.). Results showed that Hg concentrations in foliages were correlated significantly (p < 0.05) with air Hg concentrations but insignificantly correlated with soil Hg concentrations, indicating that Hg in crop foliages was mainly from air. Hg concentrations in roots were generally correlated with soil Hg concentrations (p < 0.05) but insignificantly correlated with air Hg concentrations, indicating that Hg in crop roots was mainly from soil. No significant correlations were found between Hg concentrations in stems and those in air and soil. However, Hg concentrations in upper stems were usually higher than those in bottom stems, implying air Hg might have stronger influence than soil Hg on stem Hg accumulation. - Highlights: > Hg accumulation in crop organs was studied by OTCs and soil Hg enriched experiments. > Hg accumulation in foliages and roots was mainly from air and soil, respectively. > Air Hg had stronger influence than soil Hg on stem Hg accumulation. > Foliar Hg concentrations showed the trend of increase over growth stages. - Capsule Mercury accumulated in the aboveground organs of crop was mainly from the air.
-
Biodiversity of Terrestrial Ecosystems in Tropical to Temperate Australia
Directory of Open Access Journals (Sweden)
Raymond L. Specht
2012-01-01
Full Text Available During the short period of annual foliage growth in evergreen plant communities, aerodynamic fluxes (frictional, thermal, evaporative in the atmosphere as it flows over and through a plant community determine the Foliage Projective Covers and leaf attributes in overstorey and understorey strata. The number of leaves produced on each vertical foliage shoot depends on available soil water and nutrients during this growth period. The area of all leaves exposed to solar radiation determines net photosynthetic fixation of the plant community throughout the year. In turn, the species richness (number of species per hectare of both plants and resident vertebrates is determined. The species richness of unicellular algae and small multicellular isopods in permanent freshwater lagoons in Northern Australia may possibly have been increased by radiation released from nearby uranium deposits. Evolution of new angiosperms probably occurred in refugia during periods of extreme drought. When favourable climates were restored, the vegetation expanded to result in high Gamma Biodiversity (number of plant species per region but with each major plant community having essentially the same species richness (number of plant species per hectare. The probable effects of pollution and Global Warming on biodiversity in Australian ecosystems, that experience seasonal drought, are discussed.
-
International Nuclear Information System (INIS)
Specht, R. L.; Tyler, M.J.
2010-01-01
Aerodynamic fluxes (frictional, thermal, evaporative) in the atmosphere as it flows over and through a plant community determine the Foliage Projective Covers and eco-morphological attributes of new leaves developed annually in overstorey and understorey strata. The number of leaves produced on vertical foliage shoots depends on available soil water and nutrients, also ambient temperature, during this short growth season. Stem density (number of stems per hectare) and species richness (number of species per hectare) in the overstorey of major Floristic Groups are correlated with annual shoot growth (ASG, t ha-1) in that stratum. Species richness in the overstorey increases in the climatic gradient from the arid to the humid zone as well as with increasing air temperatures (about 10 degree C) from temperate to tropical Australia. Species richness in the understorey is highest in plant communities in temperate Australia, decreasing in the temperature gradient towards the tropics. As with other major plant and animal groups within an ecosystem, the species richness of Amphibia is correlated with the amount of solar energy fixed (per annum) by the major plant formation in the regional photosynthetic potential determined by the foliage shoots (ASG, t ha-1) produced annually in the overstorey.
-
Reconstructed tree fern Alethopteris zeilleri (Carboniferous, Medullosales)
Energy Technology Data Exchange (ETDEWEB)
Zodrow, Erwin L. [Department of Earth Sciences, University College of Cape Breton, Sydney, Nova, Scotia (Canada B1P 6L2)
2007-01-02
From a smaller open-pit area in the roof shale of the basal Cantabrian coal seam in Sydney Coalfield, Cape Breton Island, Nova Scotia, Canada, large amounts of the pteridosperm foliage Alethopteris zeilleri (Ragot) were found. This foliage is associated with abundant, naked medullosalean axes and dichotomies of varying sizes, up to 0.80-m long, cauline structures 0.90 m and 1.3 m long, detached ovules assigned to Pachytesta incrassata Brongniart, rare male-pollen organs of the type Dolerotheca Halle, rooted tree ferns in life position, and one specimen each of a juvenile medullosalean frond and root mantle. The fossils are compression/impression-preserved, and the foliage yielded thickly cutinized cuticles with unoriented cells (57-103 by 27-57 {mu}m) in intercostal fields. Ultimate rachises, and abaxial surfaces (excluding costal fields) show a mixture of simple and complexly-branched trichomes, and two different structural bases. These, together with fractal dimensionality of curvatures of anticlinal walls in intercostal fields, have taxonomic potential for alethopterids. The finds suggest reconstructing A. zeilleri (Ragot) as a tree, 5-7 m high, that bore both P. incrassata Brongniart and Dolerotheca-type fructifications. Its habitat was low-land coastal plains in the Pennsylvanian coal swamps of ancestral Sydney Coalfield. (author)
-
Method and apparatus for enhancing radiometric imaging
International Nuclear Information System (INIS)
Logan, R. H.; Paradish, F. J.
1985-01-01
Disclosed is a method and apparatus for enhancing target detection, particularly in the millimeter wave frequency range, through the utilization of an imaging radiometer. The radiometer, which is a passive thermal receiver, detects the reflected and emitted thermal radiation of targets within a predetermined antenna/receiver beamwidth. By scanning the radiometer over a target area, a thermal image is created. At millimeter wave frequencies, the received emissions from the target area are highly dependent on the emissivity of the target of interest. Foliage will appear ''hot'' due to its high emissivity and metals will appear cold due to their low emissivities. A noise power illuminator is periodically actuated to illuminate the target of interest. When the illuminator is actuated, the role of emissivity is reversed, namely poorly emissive targets will generally be good reflectors which in the presence of an illuminator will appear ''hot''. The highly emissive targets (such as foliage and dirt) which absorb most of the transmitted energy will appear almost the same as in a nonilluminated, passive image. Using a data processor, the intensity of the passive image is subtracted from the intensity of the illuminated, active image which thereby cancels the background foliage, dirt, etc. and the reflective metallic targets are enhanced
-
Directory of Open Access Journals (Sweden)
R. L. Specht
2010-01-01
Full Text Available Aerodynamic fluxes (frictional, thermal, evaporative in the atmosphere as it flows over and through a plant community determine the Foliage Projective Covers and eco-morphological attributes of new leaves developed annually in overstorey and understorey strata. The number of leaves produced on vertical foliage shoots depends on available soil water and nutrients, also ambient temperature, during this short growth season. Stem density (number of stems per hectare and species richness (number of species per hectare in the overstorey of major Floristic Groups are correlated with annual shoot growth (ASG, t ha−1 in that stratum. Species richness in the overstorey increases in the climatic gradient from the arid to the humid zone as well as with increasing air temperatures (about 10oC from temperate to tropical Australia. Species richness in the understorey is highest in plant communities in temperate Australia, decreasing in the temperature gradient towards the tropics. As with other major plant and animal groups within an ecosystem, the species richness of Amphibia is correlated with the amount of solar energy fixed (per annum by the major plant formation in the region—a photosynthetic potential determined by the foliage shoots (ASG, t ha−1 produced annually in the overstorey.
-
Ventura-Cordero, J; González-Pech, P G; Jaimez-Rodriguez, P R; Ortiz-Ocampo, G I; Sandoval-Castro, C A; Torres-Acosta, J F J
2018-06-01
Previous cafeteria studies suggested that a moderate natural gastrointestinal nematode (GIN) infection did not modify the resource selection of adult Criollo goats towards tannin-rich plants compared with worm-free goats. A higher infection with Haemonchus contortus could trigger a change in the resource selection behaviour towards tannin-rich foliage. Alternatively, goats might select plant species solely to meet their nutritional requirements. A cafeteria study investigated the effect of a high artificial infection with H. contortus on the feed resource selection of goats. Adult Criollo goats (37.5±4.8 kg BW) with browsing experience were distributed in two groups: the infected group (IG) with six animals artificially infected with H. contortus (6000 L3/animal); and the non-infected group (NIG) with six animals maintained worm-free. The experiment included two 5-day periods with additional 5-day adaptation period. In the first period, animals were offered foliage of five plant species with a decreasing gradient of condensed tannins (CT) (Mimosa bahamensis, Gymnopodium floribundum, Havardia albicans, Acacia pennatula, Lysiloma latisiliqum), and three plant species with negligible CT content (Leucaena leucocephala, Piscidia piscipula and Brosimum alicastrum). In the second period the foliage of B. alicastrum was withdrawn. A grain-based concentrate feed was offered daily at 1% BW in DM basis. Dry matter and nutrient intake was determined. Foliage selection of each experimental group was determined using the Chesson selection index. The H. contortus egg count per gram of faeces (EPG) was determined for infected goats twice daily. Chesson index showed a similar pattern of foliage selection on periods 1 and 2. Mean EPG of goats in IG was 2028±259 EPG during period 1 and 1 293±198 EPG during period 2 (P>0.05). During period 1, the selection pattern was highest for B. alicastrum (tannin-free), followed by a tannin-rich plant (M. bahamensis). These two plants remained
-
Rendimiento de aceite esencial en Pinus caribaea MorElet según el secado al sol y a la sombra. III
Directory of Open Access Journals (Sweden)
Rolando Quert Álvarez
2001-04-01
Full Text Available Se presentan los resultados obtenidos en la determinación del rendimiento de aceite esencial Pinus caribaea Moralet (pino macho, en función de las condiciones y tiempo de exposición al sol y a la sombra del follaje de dicha especie endémica de Cuba. El estudio se realizó con árboles existentes en áreas de la Estación Experimental Forestal de Viñales, provincia de Pinar del Río con edad de 30 a. El tamaño de muestra fue de 3 árboles y el tiempo de destilación para la extracción del aceite esencial de 3 h. Se tomaron muestra del follaje entre 1 y 20 d expuesto a las condiciones de secado, en intervalos de 1, 3, 6, 10 y 20 d. Los resultados obtenidos demostraron que el follaje expuesto a la sombra contiene un mayor porcentaje de aceite esencial que el follaje expuesto al sol, y que el tiempo de exposición al sol, influye significativamente sobre el rendimiento a partir del tercer día, mientras que en el follaje expuesto a la sombra, las diferencias se hacen significativas a partir de los 6 d.The results obtained in the determination of the yield of the essential oil from Pinus caribaea Moralet (male pine according to the conditions and time of exposure to the sun and to the shade of the foliage of this Cuban endemic species are presented. Trees of 30 years old located in the areas of the Experimental Forestal Station of Viñales, Pinar del Río province, were used in the study. The size of the sample was of 3 trees and the time of distillation for the extraction of the essential oil was of 3 hours. Specimens of the foliage were taken at intervals of 1, 3, 6, 10 and 20 days. The results obtained showed that the foliage exposed to the shade has a higher percentage of essential oil that the foliage exposed to the sun, and that the time of exposure to the sun influences significantly on the yield starting from the third day on, whereas in the foliage exposed to the shade the differences are remarkable from the sixth day on.
-
Ganteaume, A.; Jappiot, M.; Lampin, C.
2012-04-01
The increasing urbanization of Wildland-Urban Interfaces (WUI) as well as the high fire occurrence in these areas requires the assessment and the ranking of the flammability of the ornamental vegetation surrounding houses especially that planted in hedges. Thus, the flammability of seven species, among those most frequently planted in hedges in Provence (South-Eastern France), were studied at particle level and at dead surface fuel level (litters) under laboratory conditions. The flammability parameters (ignition frequency, time-to-ignition, flaming duration) of the very fine particles (live leaves and particles fire bench. Burning experiments using the epiradiator showed that live leaves of Phyllostachys sp., Photinia frasei and Prunus laurocerasus had the shortest time-to-ignition and the highest ignition frequency and flaming duration whereas Pittosporum tobira and Nerium oleander were the longest to ignite with a low frequency. Phyllostachys sp. and Nerium oleander litters were the shortest to ignite while Prunus laurocerasus litter had the lowest bulk density and long time-to-ignition, but high flame propagation. Photinia fraseri litter ignited frequently and had a high flame spread while Pittosporum tobira litter ignited the least frequently and for the shortest duration. Cupressus sempervirens litter had the highest bulk density and the longest flaming duration but the lowest flame propagation. Pyracantha coccinea litter was the longest to ignite and flame propagation was low but lasted a long time. Hierarchical cluster analysis performed on the flammability parameters of live leaves and of litters ranked the seven species in four distinct clusters from the most flammable (Prunus laurocerasus and Pyracantha coccinea) to the least flammable (Pittosporum tobira and Nerium oleander); the other species displaying two groups of intermediate flammabilities (Phyllostachys sp.- Photinia fraseri and Cupressus sempervirens ). The species with highly flammable
-
Energy Technology Data Exchange (ETDEWEB)
Ben Salem, H. [Institut National de la Recherche Agronomique de Tunisie, Laboratoire des Productions Animales et Fourrageres, Ariana (Tunisia)]. E-mail: bensalem.hichem@iresa.agrinet.tn; Makkar, H.P.S. [Animal Production and Health Section, Joint FAO/IAEA Division, International Atomic Energy Agency, Vienna (Austria); Nefzaoui, A.; Abidi, S. [Institut National de la Recherche Agronomique de Tunisie, Laboratoire des Productions Animales et Fourrageres, Ariana (Tunisia); Hassayoun, L. [Institut National de la Recherche Agronomique de Tunisie, Laboratoire des Productions Animales et Fourrageres, Ariana (Tunisia); Ecole Superieure d' Agriculture de Mateur, Mateur (Tunisia)
2005-08-19
Two trials were conducted to test the hypotheses that (i) feeding small amount of a tanniniferous shrub foliage (Acacia cyanophylla Lindl., acacia) increases the proportion of rumen undegradable protein, and consequently benefits growth performance in Barbarine lamb; and (ii) such positive effect depends on the timing of feeding tannin source (i.e. acacia) relative to protein source (soya bean meal, SBM). Total (TT) and condensed tannin (CT) concentrations in air-dried acacia leaves used in this study averaged 29 g tannic acid and 48 g leucocyanidin equivalents per kg dry matter (DM), respectively. In trial 1, rumen fistulated ewes received oaten hay (hay) ad libitum and 200 g SBM (D1), D1 and 100 g acacia fed with the SBM (D2, mixed strategy) or as D2, but the SBM fed 1 h later than acacia when acacia was consumed completely (D3, sequential strategy). Hay intake, diet digestibility, rumen fermentation parameters (pH, ammonia nitrogen (NH{sub 3}-N) and total volatile fatty acids) and in situ degradation of SBM nitrogen were similar between D1 and D2 (P > 0.05). However, the sequential strategy (D3) resulted in efficient use of N as reflected by the decrease of crude protein digestibility (CPD), plasma urea, NH{sub 3}-N concentration and in situ degradation of SBM nitrogen. In trial 2, four groups each of six Barbarine lambs (initial LW 35.3 {+-} 3.7 kg) received for 90 days: hay ad libitum and 200 g SBM (D1), D1 and 20 g polyethylene glycol (PEG, MW 4000) mixed with SBM (D2), D1 and 100 g acacia with the SBM fed 1 h later when acacia was completely consumed (sequential strategy) (D3) or D3 and 20 g PEG fed with the SBM (D4). Polyethylene glycol was here used to deactivate tannins. Hay intake and DM, organic matter and neutral detergent fibre digestibility were similar among dietary treatment (P > 0.05). However, supplementing lambs with SBM and acacia without PEG (D3) resulted in a significant decrease (P < 0.001) of CPD (0.664 versus 0.597, respectively for D1 and
-
Directory of Open Access Journals (Sweden)
Esperanza García-Gonzalo
2016-01-01
Full Text Available Predicting paper properties based on a limited number of measured variables can be an important tool for the industry. Mathematical models were developed to predict mechanical and optical properties from the corresponding paper density for some softwood papers using support vector machine regression with the Radial Basis Function Kernel. A dataset of different properties of paper handsheets produced from pulps of pine (Pinus pinaster and P. sylvestris and cypress species (Cupressus lusitanica, C. sempervirens, and C. arizonica beaten at 1000, 4000, and 7000 revolutions was used. The results show that it is possible to obtain good models (with high coefficient of determination with two variables: the numerical variable density and the categorical variable species.
-
Efeito do nitrogênio, fósforo e potássio na adubação da batatinha - Solanum tuberosum L.
Directory of Open Access Journals (Sweden)
O. J. Boock
1950-08-01
Full Text Available Five potatoes fertilizers trials were carried out. in diffeient soil types of the State of São Paulo with the purpose to study the effect of nitrogen, phosphoric acid and potash, on tuber production. It was found that nitrogen increased plant growth, intensified green color of foliage and retarded maturity. Nitrogen also increased susceptibility to fungus diseases. Phosphoric acid increased yield and shortened the vegetative period. Potassium induced a light -green color of the foliage, but otherwise had almost no influence on plant development. Phosphoric acid was the most important factor in increasing tuber production : nitrogen was second and potassium, third. A response to potassium was noticed only when this element was applied together with phosphorus and nitrogen.
-
Visual Characterization of VX Droplets on Plant Foliage
2016-07-01
droplets were dispensed onto plant leaves using a high-precision syringe. Digital photographs of the droplets were taken at intervals, saved, and...purposes of advertisement . Approved for public release; distribution is unlimited Acknowledgments The authors would like to thank Dr...alcohol (CAS no. 67-63-0) was used as an extractant. Miracle-Gro Water Soluble All Purpose Plant Food (Scotts Company; Marysville, OH) fertilizer
-
Studies on the sensitivity of several plant species to fluorine gases in Valais
Energy Technology Data Exchange (ETDEWEB)
Bolay, A; Bovay, E
1965-01-01
Analysis of apricot, apple and vine leaves showed that at leaf fluorine concentrations up to 25 p.p.m. the foliage was generally free of burns, except that of apricot which showed some damage at a level of 15 p.p.m. Between 26 and 105 p.p.m. the reactions of the foliage were variable, depending on the vegetative state of the plant and on atmospheric conditions (mainly R.H. and rainfall). Above 105 p.p.m. burns were nearly always present on apricot and vine leaves; for apple foliage the toxic level was about 160 p.p.m. The 75 plant species studied were divided into 4 categories depending on their susceptibility to fluorine damage; very susceptible species were those showing typical burning of the leaves when the fluorine content of apricot and vine leaves growing in the immediate vicinity was lower than 100 p.p.m.; susceptible species were those showing necrosis when the fluorine content of apricot leaves was slightly higher than 100 p.p.m.; species of low sensitivity showed necrosis only in heavily polluted zones; and tolerant species were those able to store over 500 p.p.m. fluorine in their leaves without showing visible damage. The very susceptible species may be used as indicators of fluorine in the atmosphere.
-
Influence of sulfurous oxide on plants
Energy Technology Data Exchange (ETDEWEB)
Schroeder, J
1872-01-01
It has been determined that of the trees living in an atmosphere containing sulfurous oxide, the conifers suffer more injuries than ordinary foliaged trees. Experiments were conducted to find the causes of injuries and their relation in these two kinds of plants. Pine and alder were chosen as test plants. It was found that 1000 square centimeters of pine leaves had absorbed 1.6 c.c. of sulfurous oxide and the same surface area of alder leaves had accumulated 7.9 c.c. of sulfurous oxide. Experiments were also conducted to determine the effects of sulfurous oxide on transpiration in plants. Two similar twigs of a sycamore were arranged so that the water transpired could be weighed. Results indicate that the ratio between the total amount of water transpired by the leaves not acted on by the sulfurous oxide and those under its influence was 3.8:1. The author concludes that the amount of sulfurous oxide absorbed by pine leaves is smaller than that absorbed by trees with ordinary foliage for equal surfaces. Since its effect on transpiration is less in the case of pine, the cause of the greater injury to pine trees in nature must be due to the accumulation of sulfur. In trees annual leaves the damage to one year's foliage would have only an indirect influence on that of the following year.
-
Field controlled experiments of mercury accumulation in crops from air and soil
International Nuclear Information System (INIS)
Niu Zhenchuan; Zhang Xiaoshan; Wang Zhangwei; Ci Zhijia
2011-01-01
Field open top chambers (OTCs) and soil mercury (Hg) enriched experiments were employed to study the influence of Hg concentrations in air and soil on the Hg accumulation in the organs of maize (Zea mays L.) and wheat (Triticum aestivum L.). Results showed that Hg concentrations in foliages were correlated significantly (p < 0.05) with air Hg concentrations but insignificantly correlated with soil Hg concentrations, indicating that Hg in crop foliages was mainly from air. Hg concentrations in roots were generally correlated with soil Hg concentrations (p < 0.05) but insignificantly correlated with air Hg concentrations, indicating that Hg in crop roots was mainly from soil. No significant correlations were found between Hg concentrations in stems and those in air and soil. However, Hg concentrations in upper stems were usually higher than those in bottom stems, implying air Hg might have stronger influence than soil Hg on stem Hg accumulation. - Highlights: → Hg accumulation in crop organs was studied by OTCs and soil Hg enriched experiments. → Hg accumulation in foliages and roots was mainly from air and soil, respectively. → Air Hg had stronger influence than soil Hg on stem Hg accumulation. → Foliar Hg concentrations showed the trend of increase over growth stages. - Capsule Mercury accumulated in the aboveground organs of crop was mainly from the air.
-
36 CFR 7.8 - Sequoia and Kings Canyon National Parks.
2010-07-01
... National Parks. (a) Dogs and cats. Dogs and cats are prohibited on any park land or trail except within one-fourth mile of developed areas which are accessible by a designated public automobile road. (b) Fishing. (1) Fishing restrictions, based on management objectives described in the parks' Resources Management...
-
Rose-Marie Muzika; Judith Engle; Catherine Parks; Boyd. Wickman
1993-01-01
Foliage was collected from paired Douglas-fir (Pseudotsuga menziesii var. glauca (Beissn.) Franco) trees characterized as either "resistant" or "susceptible" western spruce budworm (Choristoneura occidentalis Freeman (Lepidoptera: Tortricidae) attack. Resistant trees produced more...
-
International Nuclear Information System (INIS)
Dickey, C.A.; Heal, K.V.; Stidson, R.T.; Koren, R.; Schroeder, P.; Cape, J.N.; Heal, M.R.
2004-01-01
Trichloroacetic acid (TCA, CCl 3 COOH) has been associated with forest damage but the source of TCA to trees is poorly characterised. To investigate the routes and effects of TCA uptake in conifers, 120 Sitka spruce (Picea sitchensis (Bong.) Carr) saplings were exposed to control, 10 or 100 μg l -1 solutions of TCA applied twice weekly to foliage only or soil only over two consecutive 5-month growing seasons. At the end of each growing season similar elevated TCA concentrations (approximate range 200-300 ng g -1 dwt) were detected in both foliage and soil-dosed saplings exposed to 100 μg l -1 TCA solutions showing that TCA uptake can occur from both exposure routes. Higher TCA concentrations in branchwood of foliage-dosed saplings suggest that atmospheric TCA in solution is taken up indirectly into conifer needles via branch and stemwood. TCA concentrations in needles declined slowly by only 25-30% over 6 months of winter without dosing. No effect of TCA exposure on sapling growth was measured during the experiment. However at the end of the first growing season needles of saplings exposed to 10 or 100 μg l -1 foliage-applied TCA showed significantly more visible damage, higher activities of some detoxifying enzymes, lower protein contents and poorer water control than needles of saplings dosed with the same TCA concentrations to the soil. At the end of each growing season the combined TCA storage in needles, stemwood, branchwood and soil of each sapling was <6% of TCA applied. Even with an estimated half-life of tens of days for within-sapling elimination of TCA during the growing season, this indicates that TCA is eliminated rapidly before uptake or accumulates in another compartment. Although TCA stored in sapling needles accounted for only a small proportion of TCA stored in the sapling/soil system it appears to significantly affect some measures of sapling health. - TCA stored in Sitka spruce needles may affect the health of saplings
-
Diurnal and Directional Responses of Chlorophyll Fluorescence and the PRI in a Cornfield
Middleton, Elizabeth; Cheng, Y. B.; Corp, L.; Campbell, P.; Kustas, W.
2010-01-01
Determining the health and vigor of vegetation using high spectral resolution remote sensing is an important goal which has application to monitoring agriculture and ecosystem productivity and carbon exchange. Two spectral indices used to assess whether vegetation is performing near-optimally or exhibiting symptoms of environmental stress (e.g., drought or nutrient deficiency, non-optimal temperatures, etc.) are the Photochemical Reflectance Index (PRI) and solar-induced red and far-red Chlorophyll Fluorescence (Fs). Both the PRI and Fs capture the dynamics of photoprotection mechanisms within green foliage: the PRI is based on the association of the reflected radiation in the green spectrum with the xanthophyll cycle, whereas Fs measures the emitted radiation in the red and far-red spectrum. Fs was determined from retrievals in the atmospheric oxygen absorption features centered at 688 and 760 nm using a modified Fraunhofer Line Depth (FLD) method. We previously demonstrated diurnal and seasonal PRI differences for sunlit vs. shaded foliage in a conifer forest canopy, as expressed in the hotspot and darkspot of the Bidirectional Reflectance Function (BRF). In a USDA-ARS experimental field site located in Beltsville, MD, USA, measurements were acquired over a corn crop from a nadir view in 2008 with an ASD FieldSpec Pro (Analytical Spectral Devices, Inc., Boulder, CO, USA) to study the behavior of the PRI for sunlit and shaded foliage as captured in reflectance variations associated with the BRF, in a I m tall canopy in the vegetative growth stage. Those observations were compared to simulations obtained from two radiative transfer models. Measurements were then acquired to examine whether the PRI and Fs were influenced by view zenith and azimuth geometries at different times of day. Those measurements were made in 2010 with the Ocean Optics USB4000 Miniature Fiber Optic Spectrometer (Ocean Optics Inc., Dunedin, Florida, USA) at several times during the day on
-
Tai, Helen H; Worrall, Kraig; Pelletier, Yvan; De Koeyer, David; Calhoun, Larry A
2014-09-10
The Colorado potato beetle Leptinotarsa decemlineata (Say) (CPB) is a coleopteran herbivore that feeds on the foliage on Solanum species, in particular, potato. Six resistant wild Solanum species were identified, and two of these species had low levels of glycoalkaloids. Comparative analysis of the untargeted metabolite profiles of the foliage using UPLC-qTOF-MS was done to find metabolites shared between the wild species but not with Solanum tuberosum (L.) to identify resistance-related metabolites. It was found that only S. tuberosum produced the triose glycoalkaloids solanine and chaconine. Instead, the six wild species produced glycoalkaloids that shared in common tetrose sugar side chains. Additionally, there were non-glycoalkaloid metabolites associated with resistance including hydroxycoumarin and a phenylpropanoid, which were produced in all wild species but not in S. tuberosum.
-
Directory of Open Access Journals (Sweden)
Eric J B von Wettberg
Full Text Available Correlations between developmentally plastic traits may constrain the joint evolution of traits. In plants, both seedling de-etiolation and shade avoidance elongation responses to crowding and foliage shade are mediated by partially overlapping developmental pathways, suggesting the possibility of pleiotropic constraints. To test for such constraints, we exposed inbred lines of Impatiens capensis to factorial combinations of leaf litter (which affects de-etiolation and simulated foliage shade (which affects phytochrome-mediated shade avoidance. Increased elongation of hypocotyls caused by leaf litter phenotypically enhanced subsequent elongation of the first internode in response to low red:far red (R:FR. Trait expression was correlated across litter and shade conditions, suggesting that phenotypic effects of early plasticity on later plasticity may affect variation in elongation traits available to selection in different light environments.
-
Modeling tree crown dynamics with 3D partial differential equations.
Beyer, Robert; Letort, Véronique; Cournède, Paul-Henry
2014-01-01
We characterize a tree's spatial foliage distribution by the local leaf area density. Considering this spatially continuous variable allows to describe the spatiotemporal evolution of the tree crown by means of 3D partial differential equations. These offer a framework to rigorously take locally and adaptively acting effects into account, notably the growth toward light. Biomass production through photosynthesis and the allocation to foliage and wood are readily included in this model framework. The system of equations stands out due to its inherent dynamic property of self-organization and spontaneous adaptation, generating complex behavior from even only a few parameters. The density-based approach yields spatially structured tree crowns without relying on detailed geometry. We present the methodological fundamentals of such a modeling approach and discuss further prospects and applications.
-
Further Studies of Forest Structure Parameter Retrievals Using the Echidna® Ground-Based Lidar
Strahler, A. H.; Yao, T.; Zhao, F.; Yang, X.; Schaaf, C.; Wang, Z.; Li, Z.; Woodcock, C. E.; Culvenor, D.; Jupp, D.; Newnham, G.; Lovell, J.
2012-12-01
Ongoing work with the Echidna® Validation Instrument (EVI), a full-waveform, ground-based scanning lidar (1064 nm) developed by Australia's CSIRO and deployed by Boston University in California conifers (2008) and New England hardwood and softwood (conifer) stands (2007, 2009, 2010), confirms the importance of slope correction in forest structural parameter retrieval; detects growth and disturbance over periods of 2-3 years; provides a new way to measure the between-crown clumping factor in leaf area index retrieval using lidar range; and retrieves foliage profiles with more lower-canopy detail than a large-footprint aircraft scanner (LVIS), while simulating LVIS foliage profiles accurately from a nadir viewpoint using a 3-D point cloud. Slope correction is important for accurate retrieval of forest canopy structural parameters, such as mean diameter at breast height (DBH), stem count density, basal area, and above-ground biomass. Topographic slope can induce errors in parameter retrievals because the horizontal plane of the instrument scan, which is used to identify, measure, and count tree trunks, will intersect trunks below breast height in the uphill direction and above breast height in the downhill direction. A test of three methods at southern Sierra Nevada conifer sites improved the range of correlations of these EVI-retrieved parameters with field measurements from 0.53-0.68 to 0.85-0.93 for the best method. EVI scans can detect change, including both growth and disturbance, in periods of two to three years. We revisited three New England forest sites scanned in 2007-2009 or 2007-2010. A shelterwood stand at the Howland Experimental Forest, Howland, Maine, showed increased mean DBH, above-ground biomass and leaf area index between 2007 and 2009. Two stands at the Harvard Forest, Petersham, Massachusetts, suffered reduced leaf area index and reduced stem count density as the result of an ice storm that damaged the stands. At one stand, broken tops were
-
Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen
James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands
1996-01-01
We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.
-
Antioxidant and antimicrobial activities of polyphenols from ...
African Journals Online (AJOL)
USER
2010-05-17
May 17, 2010 ... population depend on them as primary health care. (Akinyemi ... The mechanism of polyphenols toxicity against microbes may be related to ... and incubated at room temperature for 3 min. ..... polyphenols in copper foliage.
-
Phytophthora obscura sp. nov., a new species of the novel Phytophthora subclade 8d
N. J. Grünwald; S. Werres; E. M. Goss; C. R. Taylor; V. J. Fieland
2012-01-01
A new Phytophthora species was detected (i) in the USA, infecting foliage of Kalmia latifolia, (ii) in substrate underneath Pieris, and (iii) in Germany in soil samples underneath Aesculus hippocastanum showing disease symptoms. The new...
-
Albizia lebbeck, Leucaena leucocephala, Morinda lucida and Senna si
African Journals Online (AJOL)
SARAH
2017-09-30
Sep 30, 2017 ... Université des Sciences et Techniques de Masuku .... corresponded to the beginning of the dry season, while ... Statistical analysis: For each foliage data of nutrient .... Arbouche Y, Arbouche HS, Arbouche F, Arbouche R,.
-
Breeding phenology of birds: mechanisms underlying seasonal declines in the risk of nest predation.
Directory of Open Access Journals (Sweden)
Kathi L Borgmann
Full Text Available Seasonal declines in avian clutch size are well documented, but seasonal variation in other reproductive parameters has received less attention. For example, the probability of complete brood mortality typically explains much of the variation in reproductive success and often varies seasonally, but we know little about the underlying cause of that variation. This oversight is surprising given that nest predation influences many other life-history traits and varies throughout the breeding season in many songbirds. To determine the underlying causes of observed seasonal decreases in risk of nest predation, we modeled nest predation of Dusky Flycatchers (Empidonax oberholseri in northern California as a function of foliage phenology, energetic demand, developmental stage, conspecific nest density, food availability for nest predators, and nest predator abundance. Seasonal variation in the risk of nest predation was not associated with seasonal changes in energetic demand, conspecific nest density, or predator abundance. Instead, seasonal variation in the risk of nest predation was associated with foliage density (early, but not late, in the breeding season and seasonal changes in food available to nest predators. Supplemental food provided to nest predators resulted in a numerical response by nest predators, increasing the risk of nest predation at nests that were near supplemental feeders. Our results suggest that seasonal changes in foliage density and factors associated with changes in food availability for nest predators are important drivers of temporal patterns in risk of avian nest predation.
-
Role of brown bears (Ursus arctos) in the flow of marine nitrogen into a terrestrial ecosystem.
Hilderbrand, G V; Hanley, Thomas A; Robbins, Charles T; Schwartz, C C
1999-12-01
We quantified the amount, spatial distribution, and importance of salmon (Oncorhynchus spp.)-derived nitrogen (N) by brown bears (Ursus arctos) on the Kenai Peninsula, Alaska. We tested and confirmed the hypothesis that the stable isotope signature (δ 15 N) of N in foliage of white spruce (Picea glauca) was inversely proportional to the distance from salmon-spawning streams (r=-0.99 and Pbrown bears, relative to their distance from a stream, were highly correlated with δ 15 N depletion of foliage across the same gradient (r=-0.98 and -0.96 and Pbrown bears were 37.2±2.9 kg/year per bear (range 23.1-56.3), of which 96% (35.7±2.7 kg/year per bear) was excreted in urine, 3% (1.1±0.1 kg/year per bear) was excreted in feces, and bear) was retained in the body. On an area basis, salmon-N redistribution rates were as high as 5.1±0.7 mg/m 2 per year per bear within 500 m of the stream but dropped off greatly with increasing distance. We estimated that 15.5-17.8% of the total N in spruce foliage within 500 m of the stream was derived from salmon. Of that, bears had distributed 83-84%. Thus, brown bears can be an important vector of salmon-derived N into riparian ecosystems, but their effects are highly variable spatially and a function of bear density.
-
International Nuclear Information System (INIS)
Rubilar, Rafael A.; Allen, H. Lee; Alvarez, Jose S.; Albaugh, Timothy J.; Fox, Thomas R.; Stape, Jose L.
2010-01-01
There is little understanding of how silvicultural treatments, during the early stages of tree development, affect allometric relationships. We developed and compared stem, branch, foliage, coarse and fine root biomass, and leaf area estimation equations, for four-year-old genetically improved radiata pine trees grown on three contrasting soil-site conditions. At each site, selected trees were destructively sampled from a control (shovel planted, no weed control, fertilized with 2 g of boron), a shovel planted + weed control (2 first years) + complete fertilization (nitrogen + phosphorus + boron 2 first years + potassium 2nd year), and a soil tillage (subsoil at 60 cm) + weed control (first 2 years) + complete fertilization treatment. Tissues were separated into foliage, branch, stem, fine and coarse roots (>2 mm). Regression equations for each tree biomass tissue versus leaf area were fit for each site and compared among treatments and sites with the same genetic material. Our results indicated that individual tree biomasses for young plantations are affected by silvicultural treatment and site growing conditions. Higher variability in estimates was found for foliage and branches due to the ephemeral nature of these components. Stem biomass equations vary less, but differences in biomass equations were found among sites and treatments. Coarse root biomass estimates were variable but less than expected, considering the gradient among sites. Similar to stem biomass, a simple positive general linear relationship between root collar diameter, or diameter at breast height with coarse roots biomass was developed across sites and treatments.
-
Breeding phenology of birds: mechanisms underlying seasonal declines in the risk of nest predation.
Borgmann, Kathi L; Conway, Courtney J; Morrison, Michael L
2013-01-01
Seasonal declines in avian clutch size are well documented, but seasonal variation in other reproductive parameters has received less attention. For example, the probability of complete brood mortality typically explains much of the variation in reproductive success and often varies seasonally, but we know little about the underlying cause of that variation. This oversight is surprising given that nest predation influences many other life-history traits and varies throughout the breeding season in many songbirds. To determine the underlying causes of observed seasonal decreases in risk of nest predation, we modeled nest predation of Dusky Flycatchers (Empidonax oberholseri) in northern California as a function of foliage phenology, energetic demand, developmental stage, conspecific nest density, food availability for nest predators, and nest predator abundance. Seasonal variation in the risk of nest predation was not associated with seasonal changes in energetic demand, conspecific nest density, or predator abundance. Instead, seasonal variation in the risk of nest predation was associated with foliage density (early, but not late, in the breeding season) and seasonal changes in food available to nest predators. Supplemental food provided to nest predators resulted in a numerical response by nest predators, increasing the risk of nest predation at nests that were near supplemental feeders. Our results suggest that seasonal changes in foliage density and factors associated with changes in food availability for nest predators are important drivers of temporal patterns in risk of avian nest predation.
-
Diet and morphology of extant and recently extinct northern bears
Mattson, David J.
1998-01-01
I examined the relationship of diets to skull morphology of extant northern bears and used this information to speculate on diets of the recently extinct cave (Ursus spelaeus) and short-faced (Arctodus simus) bears. Analyses relied upon published skull measurements and food habits of Asiatic (U. thibetanus) and American (U. americanus) black bears, polar bears (U. maritimus), various subspecies of brown bears (U. arctos), and the giant panda (Ailuropoda melanoleuca). Principal components analysis showed major trends in skull morphology related to size, crushing force, and snout shape. Giant pandas, short-faced bears, cave bears, and polar bears exhibited extreme features along these gradients. Diets of brown bears in colder, often non-forested environments were distinguished by large volumes of roots, foliage, and vertebrates, while diets of the 2 black bear species and brown bears occupying broadleaf forests contained greater volumes of mast and invertebrates and overlapped considerably. Fractions of fibrous foods in feces (foliage and roots) were strongly related to skull morphology (R2=0.97)">(R2=0.97). Based on this relationship, feces of cave and short-faced bears were predicted to consist almost wholly of foliage, roots, or both. I hypothesized that cave bears specialized in root grubbing. In contrast, based upon body proportions and features of the ursid digestive tract, I hypothesized that skull features associated with crushing force facilitated a carnivorous rather than herbivorous diet for short-faced bears.
-
FORMATION OF PARSLEY YIELD AND THE DEGREE OF ITS RESPONSIVENESS TO FOLIAR
Directory of Open Access Journals (Sweden)
E. G. Gadzhimustapaeva
2017-01-01
Full Text Available Now the actual task of organic plant cultivation is to provide the population with ecologically clean and health-care products in volumes sufficient for everyone. Recently, growth and development plant regulators are used more often to guarantee the high yield as well as a quality and marketable view of final products in zonal system of protection of leafy vegetables. The range of their efficiency can significantly vary depending on zone of cultivation. The research study on collection of leafy parsley accessions of different origin distinguished by resistance to freeze was given in the article. The morphobiological characteristics of studied accessions are given, where highly productive and yielding accession ‘k.vr494’ was selected out. The influence of chelated microelements, growth regulators and fertilizers on foliage and seed productivity has been shown in south Dagestan. The comparative trial test showed the high efficiency of liquid concentrate of organic boron, organoboron and silicon-containing micronutrient ‘Siliplant’. The total foliage productivity after three cutting was 28.8 kg. with application of concentrate of organoboron and 16.53 kg. in control. 24.74 kg. and 14.34 kg. respectively were obtained with application of Siliplant. This result showed that high yield of foliage was produced after first cutting. Out of all experimental variants the best leaf regrowth was noticed with application of Mikrovita. Leaf regrowth at intermediate cutting showed that there was a growth-stimulating action of Mikrovita and Siliplant.
-
Krupke, Christian H; Alford, Adam M; Cullen, Eileen M; Hodgson, Erin W; Knodel, Janet J; McCornack, Brian; Potter, Bruce D; Spigler, Madeline I; Tilmon, Kelley; Welch, Kelton
2017-10-01
A 2-year, multi-state study was conducted to assess the benefits of using soybean seed treated with the neonicotinoid thiamethoxam to manage soybean aphid in the upper Midwestern USA and compare this approach with an integrated pest management (IPM) approach that included monitoring soybean aphids and treating with foliar-applied insecticide only when the economic threshold was reached. Concentrations of thiamethoxam in soybean foliage were also quantified throughout the growing season to estimate the pest management window afforded by insecticidal seed treatments. Both the IPM treatment and thiamethoxam-treated seed resulted in significant reductions in cumulative aphid days when soybean aphid populations reached threshold levels. However, only the IPM treatment resulted in significant yield increases. Analysis of soybean foliage from thiamethoxam-treated seeds indicated that tissue concentrations of thiamethoxam were statistically similar to plants grown from untreated seeds beginning at the V2 growth stage, indicating that the period of pest suppression for soybean aphid is likely to be relatively short. These data demonstrate that an IPM approach, combining scouting and foliar-applied insecticide where necessary, remains the best option for treatment of soybean aphids, both in terms of protecting the yield potential of the crop and of break-even probability for producers. Furthermore, we found that thiamethoxam concentrations in foliage are unlikely to effectively manage soybean aphids for most of the pests' activity period across the region. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
-
Directory of Open Access Journals (Sweden)
Benjamin J Gosney
Full Text Available Plant genetic and ontogenetic variation can significantly impact dependent fungal and arthropod communities. However, little is known of the relative importance of these extended genetic and ontogenetic effects within a species. Using a common garden trial, we compared the dependent arthropod and fungal community on 222 progeny from two highly differentiated populations of the endangered heteroblastic tree species, Eucalyptus morrisbyi. We assessed arthropod and fungal communities on both juvenile and adult foliage. The community variation was related to previous levels of marsupial browsing, as well as the variation in the physicochemical properties of leaves using near-infrared spectroscopy. We found highly significant differences in community composition, abundance and diversity parameters between eucalypt source populations in the common garden, and these were comparable to differences between the distinctive juvenile and adult foliage. The physicochemical properties assessed accounted for a significant percentage of the community variation but did not explain fully the community differences between populations and foliage types. Similarly, while differences in population susceptibility to a major marsupial herbivore may result in diffuse genetic effects on the dependent community, this still did not account for the large genetic-based differences in dependent communities between populations. Our results emphasize the importance of maintaining the populations of this rare species as separate management units, as not only are the populations highly genetically structured, this variation may alter the trajectory of biotic colonization of conservation plantings.
-
398-IJBCS-Article- Nanema K Romaric
African Journals Online (AJOL)
User
an annual herbaceous belonging to the family of Lamiaceae . The family of .... weight was measured using a balance of 1 Kg maximum with a precision of ..... previous work, the plants with green foliage represented 55% of ... Global Facilitation.
-
Nest-site selection in the Cape Sugarbird | Burger | African Zoology
African Journals Online (AJOL)
. These bushes were characterized by relatively large leaves and dense foliage. Nests were usually placed in the central parts of bushes Nest-sites were shielded from the cold night sky, and were associated with relatively favourable air ...
-
Nigerian Journal of Biotechnology (Vol. 33)
African Journals Online (AJOL)
Ladaf 2
Screen house experiments were conducted at the Institute of Agricultural Research ... (Glomus clarum) and compost (sunflower) on the growth and yield of tomato plants. ... green foliage of this plant (Udo, 1982; John et al., tomato plants were ...
-
Energy Technology Data Exchange (ETDEWEB)
Silva, M. C.; Machado, H. N.; Neves, L.; Araujo, C.; Phillips, J. L.
2012-11-01
Plantations of Eucalyptus globulus represent the main source of wood for the pulp and paper industry in Portugal and are affected by the complex of Mycosphaerella and Teratosphaeria species (Mycosphaerella leaf disease), which is an important foliage disease worldwide. This disease affect mainly young trees with juvenile-phase foliage, causing premature defoliation, decreased growth and wood production. Species of Mycosphaerella sensu lato reported on eucalypts in Portugal are M. communis, M. heimii, M. lateralis, M. madeirae, M. marksii M. walkeri, T. africana, T. molleriana, T. nubilosa and T. parva. In order to complete the survey, symptomatic leaves were collected from Eucalyptus globulus plantations. Morphological and molecular characterization was used to give an indication of the species occurrence and most frequent species (T. nubilosa) and the composition of the MLD complex that did not change after the latest review. (Author) 28 refs.
-
Indian Academy of Sciences (India)
Unknown
It then turned to the various physical agencies that could ... experimental data from irregularly shaped and variably .... temperatures commonly run between 0°C and – 40°C. ..... Philpott J 1956 Blade tissue organization of foliage leaves of.
-
African Journals Online (AJOL)
Osondu
2014-04-08
Apr 8, 2014 ... and foliage yield obtained in this study showed that soils amended with ashed and unashed corn cob and coconut husk ... in stabilizing agricultural systems in the humid tropics is to ... covered with perforated plastic plates an.
-
National Research Council Canada - National Science Library
Martin, Chester
1997-01-01
...), yauipon is the most valuable to wildlife (Halls and Ripley 1961). Its thicket-forming characteristics make it excellent cover for many birds, and its fruits and foliage provide a year-round food source for white-tailed deer (Halls 1977...
-
Pliocene taxodiaceous fossil wood from southwestern Ukraine and its palaeoenvironmental implications
Directory of Open Access Journals (Sweden)
Yi Tiemei
2013-10-01
Full Text Available Mineralized wood collected from Late Pliocene strata near Gorbki village in the Transcarpathian region of Beregovo Kholmogor'e in southwestern Ukraine was anatomically studied and identified. The wood possesses distinctive anatomical features and has distinct growth rings with an abrupt transition from early- to late-wood. Wood consists of tracheids with 1–3 seriate, dominating bi-seriate, opposite pits on the radial walls and taxodioid cross-field pitting, indentures present. Rays are uni-seriate and 1 to 73 cells high. Ray parenchyma horizontal walls thin and smooth. Axial parenchyma distributed in early- and late-wood and is solitary and diffuse, with end walls nearly smooth or slightly nodular. The combination of features observed in the wood indicates it belongs to the conifer family Taxodiaceae and is most similar to modern Sequoia and assigned to the fossil genus Sequoioxylon. Comparison with species of Sequoioxylon show it is most similar to Sequoioxylon burejense, but ray tracheids were not found in our specimens. We describe the specimens here as Sequoioxylon cf. s. burejense noting this similarity. Extant Sequoia is distributed in the northern California coastal forest eco-region of northern California and southern Oregon in the United States where they usually grow in a unique environment with heavy seasonal precipitation (2500 mm annually, cool coastal air and fog drip. This study supplies magafossil evidence of Sequoioxylon as an element of the Late Pliocene forest community in Ukraine and indicates a climate with heavy seasonal precipitation and fog drip.
-
Trophic ecology of Lepidoptera larvae associated with woody vegetation in a savanna ecosystem
CSIR Research Space (South Africa)
Scholtz, CH
1982-06-01
Full Text Available This study represents a quantitative survey of a Lepidoptera community and deals with the trophic ecology of the 27 species of foliage-feeding Lepidoptera on the eight dominant woody plants in the Burkea africana-Eragrostis pallens savanna...
-
African Journal of Biotechnology - Vol 11, No 30 (2012)
African Journals Online (AJOL)
Propagation physiology of Juniperus phoenicea L. from Jordan using seeds and in vitro culture techniques: Baseline information for a conservation perspective ... Morphological and chemical characteristics of tomato foliage as mechanisms of resistance to Helicoverpa armigera (Hübner) (Lepidoptera: Noctuidae) larvae ...
-
African Journals Online (AJOL)
2016-11-12
Nov 12, 2016 ... experimental dairy farm at the University of Chapingo, oven dried at 55 °C, .... of action of yeast is oxygen consumption, related to the yeast high respiratory rate .... Total tract and rumen digestibility of mulberry foliage (Morus.
-
Effect of mycorrhiza and pruning regimes on seasonality of ...
African Journals Online (AJOL)
GRACE
2006-07-16
Jul 16, 2006 ... since the roots of both crop and tree will be localized in the same zone. ... water relations of infected plants (Osonubi et al., 1992). ..... means of a spring balance. ..... appreciable foliage leaf cover on cassava plants during.
-
Molecular gut-content analysis enables detection of arthropod predation with minimal disruption of ecosystem processes. Field and laboratory experiments have demonstrated that mass-collection methods, such as sweep-netting, vacuum sampling, and foliage beating, can lead to contamination of fed pred...
-
Molecular gut-content analysis enables detection of arthropod predation with minimal disruption of ecosystem processes. Field and laboratory experiments have demonstrated that mass-collection methods, such as sweep-netting, vacuum sampling, and foliage beating, can lead to contamination of fed pred...
-
African Journals Online (AJOL)
Aigbe H.I
residues were categorized into stump, stem, branch and foliage. Fresh weights of ... The findings of this study revealed that there is significant logging residues left to waste in the forest after ..... Strand, Robert F.; Schuben, Thomas H.;. McDuffie ...
-
Cicca disticha L. Syn. C. AcidaMerr. (English: Gooseberry-tree ...
Indian Academy of Sciences (India)
-size tree, which is often cultivatedfor itsfruits. Older branches show large scars where foliage branches ... Fruit is a depressed globose berry, lobed with fleshy outer and hard inner portions. The fleshy edible part of the fruit is sour and is pickled.
-
Phaeocryptopus gaeumannii is a widespread foliar parasite of Douglas-fir. Although normally innocuous, the fungus also causes the defoliating disease Swiss needle cast in heavily infected needles. The extent of P. gaeumannii colonization in Douglas-fir foliage was estimated wit...
-
Using Black Light to Find Jack-Pine Budworm Egg Masses
Daniel T. Jennings
1968-01-01
Jack pine foliage infested with jack-pine budworm egg masses was examined under two kinds of light -- black light and a combination of natural and fluorescent light. Black light significantly increased the accuracy of count but not the efficiency of examination.
-
Aerial electrostatic spray deposition and canopy penetration in cotton
Spray deposition on abaxial and adaxial leaf surfaces along with canopy penetration are essential for insect control and foliage defoliation in cotton production agriculture. Researchers have reported that electrostatically charged sprays have increased spray deposit onto these surfaces under widel...
-
Jean-Christophe Domec; Barbara Lachenbruch; Michele L. Pruyn; Rachel Spicer
2012-01-01
Introduction: Knowledge of vertical variation in hydraulic parameters would improve our understanding of individual trunk functioning and likely have important implications for modeling water movement to the leaves. Specifically, understanding how foliage area (Al), sapwood area (As), and hydraulic specific...
-
Seasonal variation in heavy metal concentration in mangrove foliage
Digital Repository Service at National Institute of Oceanography (India)
Untawale, A.G.; Wafar, S.; Bhosle, N.B.
Seasonal variation in the concentration of some heavy metals in the leaves of seven species of mangrove vegetation from Goa, revealed that maximum concentration of iron and manganese occurs during the monsoon season without any significant toxic...
-
Quality and acceptability of velvet bean ( Mucuna pruriens ) foliage ...
African Journals Online (AJOL)
The appearance, smell and texture of all the silage mixtures compromised increasing level of VBF while the pH increased. The pH of the silage varied from 3.92-7.98. Dry matter (DM), crude protein (CP) and crude fibre (CF) concentration in the silages ranged from 20.67 – 26.65, 8.02 – 15.77, 26.42 - 1926g/100g, ...
-
Influence of crop management practices on bean foliage arthropods.
Pereira, J L; Picanço, M C; Pereira, E J G; Silva, A A; Jakelaitis, A; Pereira, R R; Xavier, V M
2010-12-01
Crop management practices can affect the population of phytophagous pest species and beneficial arthropods with consequences for integrated pest management. In this study, we determined the effect of no-tillage and crop residue management on the arthropod community associated with the canopy of common beans (Phaseolus vulgaris L.). Abundance and species composition of herbivorous, detritivorous, predaceous and parasitoid arthropods were recorded during the growing seasons of 2003 and 2004 in Coimbra County, Minas Gerais State, Brazil. Arthropod diversity and guild composition were similar among crop management systems, but their abundance was higher under no-tillage relative to conventional cultivation and where residues from the preceding crop were maintained in the field. Thirty-four arthropod species were recorded, and those most representative of the impact of the crop management practices were Hypogastrura springtails, Empoasca kraemeri and Circulifer leafhoppers, and Solenopsis ants. The infestation levels of major insect-pests, especially leafhoppers (Hemiptera: Cicadellidae), was on average seven-fold lower under no-tillage with retention of crop residues relative to the conventional system with removal of residues, whereas the abundance of predatory ants (Hymenoptera: Formicidae) and springtails (Collembola: Hypogastruridae) were, respectively, about seven- and 15-fold higher in that treatment. Importantly, a significant trophic interaction among crop residues, detritivores, predators and herbivores was observed. Plots managed with no-tillage and retention of crop residues had the highest bean yield, while those with conventional cultivation and removal of the crop residues yielded significantly less beans. This research shows that cropping systems that include zero tillage and crop residue retention can reduce infestation by foliar insect-pests and increase abundance of predators and detritivores, thus having direct consequences for insect pest management.
-
Stable-carbon isotopic composition of maple sap and foliage
International Nuclear Information System (INIS)
Leavitt, S.W.; Long, A.
1985-01-01
The 13 C/ 12 C ratios of Acer grandidentatum sap sugar collected during the dormant period are compared to those of buds, leaves, and wood developed over the following growing season. As the primary carbon source for cellulose manufacture at initiation of annual growth in deciduous trees, sap sucrose would be expected to have an isotopic composition similar to first-formed cellulose. Although constancy in concentration and 13 C/ 12 C ratios of the maple sap sugar suggests any gains or losses (e.g. to maintenance metabolism) do not appreciably alter composition, the 13 C/ 12 C ratios of cellulose of the enlarging buds in the spring are quite distinct from those of the sap sugar, seemingly precluding a simple direct biochemical pathway of sap sucrose→glucose→cellulose in favor of a more complex pathway with greater likelihood of isotopic fractionation. The 13 C/ 12 C ratios of the leaves and in the growth ring were initially similar to the sap sugar but decreased steadily over the growing season. (author)
-
Stable-carbon isotope variability in tree foliage and wood
International Nuclear Information System (INIS)
Leavitt, S.W.; Long, A.
1986-01-01
This study documents variation of stable-carbon isotope ratios ( 13 C/ 12 C) in trees of genera Juniperus and Pinus under field conditions. Results are from cellulose analysis on leaves, twigs, and wood from a number of localities in the southwestern US. Substantial variability, typically 1-3%, exists among leaves, within wood (radially, vertically, circumferentially), and between individuals at a site. These results may help guide sampling in tracer-type studies with stable-carbon isotope ratios and aid in the interpretation of isotopic results from such studies
-
Influence of fungicides on gas exchange of pecan foliage
There are several fungicide chemistries used for disease control on pecan (Carya illinoinensis), but there is little or no knowledge of subtle short- or long-term side-effects of these chemistries on host physiological processes, including photosynthesis (Pn). This study quantifies the impact of se...
-
Directory of Open Access Journals (Sweden)
Joseph M Patt
Full Text Available Huanglongbing, also known as citrus greening, is a destructive disease that threatens citrus production worldwide. It is putatively caused by the phloem-limited bacterium Candidatus Liberibacter asiaticus (Las. Currently, the disease is untreatable and efforts focus on intensive insecticide use to control the vector, Asian citrus psyllid (Diaphorina citri. Emerging psyllid resistance to multiple insecticides has generated investigations into the use of exogenously applied signaling compounds to enhance citrus resistance to D. citri and Las. In the present study, we examined whether foliar applications of methyl jasmonate (MJ, a volatile signaling compound associated with the induced systemic resistance pathway, and salicylic acid, a constituent of the systemic acquired resistance pathway, would elicit the emission of defense-related volatiles in citrus foliage, and what effect this might have on the host-plant searching behavior of D. citri. Comparisons were made of volatiles emitted from growing shoots of uninfected and Las-infected 'Valencia' sweet orange (Citrus sinensis trees over two consecutive sampling days. A settling behavioral assay was used to compare psyllid attraction to MJ-treated vs. Tween-treated citrus sprigs. All three main effects, Las infection status, plant signaler application, and sampling day, influenced the proportions of individual volatile compounds emitted in different treatment groups. MJ- and SA-treated trees had higher emission rates than Tween-treated trees. Methyl salicylate (MeSA and β-caryophyllene were present in higher proportions in the volatiles collected from Las-infected + trees. On the other hand, Las-infected + MJ-treated trees emitted lower proportions of MeSA than did Las-infected + Tween-treated trees. Because MeSA is a key D. citri attractant, this result suggests that MJ application could suppress MeSA emission from Las-infected trees, an approach that could be used to discourage psyllid
-
Patt, Joseph M; Robbins, Paul S; Niedz, Randy; McCollum, Greg; Alessandro, Rocco
2018-01-01
Huanglongbing, also known as citrus greening, is a destructive disease that threatens citrus production worldwide. It is putatively caused by the phloem-limited bacterium Candidatus Liberibacter asiaticus (Las). Currently, the disease is untreatable and efforts focus on intensive insecticide use to control the vector, Asian citrus psyllid (Diaphorina citri). Emerging psyllid resistance to multiple insecticides has generated investigations into the use of exogenously applied signaling compounds to enhance citrus resistance to D. citri and Las. In the present study, we examined whether foliar applications of methyl jasmonate (MJ), a volatile signaling compound associated with the induced systemic resistance pathway, and salicylic acid, a constituent of the systemic acquired resistance pathway, would elicit the emission of defense-related volatiles in citrus foliage, and what effect this might have on the host-plant searching behavior of D. citri. Comparisons were made of volatiles emitted from growing shoots of uninfected and Las-infected 'Valencia' sweet orange (Citrus sinensis) trees over two consecutive sampling days. A settling behavioral assay was used to compare psyllid attraction to MJ-treated vs. Tween-treated citrus sprigs. All three main effects, Las infection status, plant signaler application, and sampling day, influenced the proportions of individual volatile compounds emitted in different treatment groups. MJ- and SA-treated trees had higher emission rates than Tween-treated trees. Methyl salicylate (MeSA) and β-caryophyllene were present in higher proportions in the volatiles collected from Las-infected + trees. On the other hand, Las-infected + MJ-treated trees emitted lower proportions of MeSA than did Las-infected + Tween-treated trees. Because MeSA is a key D. citri attractant, this result suggests that MJ application could suppress MeSA emission from Las-infected trees, an approach that could be used to discourage psyllid colonization during
-
Robbins, Paul S.; Niedz, Randy; McCollum, Greg; Alessandro, Rocco
2018-01-01
Huanglongbing, also known as citrus greening, is a destructive disease that threatens citrus production worldwide. It is putatively caused by the phloem-limited bacterium Candidatus Liberibacter asiaticus (Las). Currently, the disease is untreatable and efforts focus on intensive insecticide use to control the vector, Asian citrus psyllid (Diaphorina citri). Emerging psyllid resistance to multiple insecticides has generated investigations into the use of exogenously applied signaling compounds to enhance citrus resistance to D. citri and Las. In the present study, we examined whether foliar applications of methyl jasmonate (MJ), a volatile signaling compound associated with the induced systemic resistance pathway, and salicylic acid, a constituent of the systemic acquired resistance pathway, would elicit the emission of defense-related volatiles in citrus foliage, and what effect this might have on the host-plant searching behavior of D. citri. Comparisons were made of volatiles emitted from growing shoots of uninfected and Las-infected ‘Valencia’ sweet orange (Citrus sinensis) trees over two consecutive sampling days. A settling behavioral assay was used to compare psyllid attraction to MJ-treated vs. Tween-treated citrus sprigs. All three main effects, Las infection status, plant signaler application, and sampling day, influenced the proportions of individual volatile compounds emitted in different treatment groups. MJ- and SA-treated trees had higher emission rates than Tween-treated trees. Methyl salicylate (MeSA) and β-caryophyllene were present in higher proportions in the volatiles collected from Las-infected + trees. On the other hand, Las-infected + MJ-treated trees emitted lower proportions of MeSA than did Las-infected + Tween-treated trees. Because MeSA is a key D. citri attractant, this result suggests that MJ application could suppress MeSA emission from Las-infected trees, an approach that could be used to discourage psyllid colonization during
-
Directory of Open Access Journals (Sweden)
Elisa Cristina Modesto
2006-04-01
Full Text Available Avaliou-se a inclusão (0%, 10%, 20% e 30% da silagem do terço superior da rama de mandioca (STSRM para vacas da raça Holandesa alimentadas à pasto, analisando o consumo e a digestibilidade. O delineamento experimental utilizado foi o quadrado latino 4x4, e para o fator níveis de inclusão, regressão. Foram analisados: consumo de matéria orgânica (CMO, fibra em detergente neutro (CFDN, proteína bruta (PB, carboidratos totais (CCT, carboidratos não fibrosos (CNF; digestibilidade aparente da matéria orgânica (DMO, proteína bruta (DPB, fibra em detergente neutro (DFDN, carboidratos totais (DCT e carboidratos não fibrosos (DCNF. Houve efeito crescente (pThe aim of the experiment was to evaluate the intake and digestibility of Holsteins dairy cow fed with Cynodon graze and inclusion levels (0, 10, 20 e 30% of superior third of cassava foliage silage (STCFS. Eight lactating dairy cow were used in a square design 4x4 and to inclusion levels, regression was used. Thefollowing aspects were analyzed: organic matter intake (OMI, neutral detergent fiber (NDF, crude protein (CP, total carbohydrate (TC, nonfiber carbohydrate (NFC; apparent digestibility of organic matter (ADOM, crude protein (ADCP, neutral detergent fiber (ADNDF, total carbohydrate (ADTC, nonfiber carbohydrate (ADNFC. The inclusion levels of STCFS had an increasing effect (P<0.05 to total OMI, STCFS + concentrate DOI, STCFS + concentrate NDF, total CP, total TC, total NFC in kg/day and total OMI and total % live weight. The ADCP had decreasing effect (P<0.05 with the increase of inclusion levels ofSTCFS.
-
Return to the little kingdom Steve Jobs, the creation of Apple, and how it changed the world
Moritz, Michael
2010-01-01
Almost thirty years ago, Michael Moritz, then a young journalist at Time magazine, was allowed exclusive access to the inner workings of a cutting-edge technology company to tell the story of its first decade in business. The Little Kingdom: The Private Story of Apple Computer brought readers into the childhood homes of Steve Jobs and Steve Wozniak, showed how they dropped out of college and founded Apple in 1976, and charted the company's rise from basement brainstorming to colossal empire. Now, after spending almost twenty-five years at Sequoia Capital, the much admired private investm
-
International Nuclear Information System (INIS)
Montagu, K.D.; Woo, K.C.; Puangchit, L.
1999-01-01
Full text: Determining the water-use-efficiency of trees in relation lo wood production is problematic due to the sheer size of the plant and the number of years taken to produce the wood. Indirect measures of water-use-efficiency, such as carbon isotope discrimination (Δ), are therefore attractive to tree breeders wishing to select for increased water-use-efficiency. To begin to evaluate the usefulness of Δ as a selection parameter for the tropical tree Acacia auriculiformis we addressed the following questions: 1. Within the tree canopy, how variable is Δ? 2. Is there any genotypic variation in Δ? and 3. Does water availability affect genotypic variation? To address these questions we sampled foliage from pot trials and field trials of A. auriculiformis ranging in age from 3 months lo 8 years in Australia and Thailand. In 16-18m high 8-year-old trees, canopy variation in Δ was large (P>0.01). Foliage Δ values increased down the tree from 22.0 %o at the top to 24.7 %o at the base. The decrease was rapid in the lop 3 m of the canopy thus considerable care must be taken to sampling foliage from the same position in the canopy. Genotype variations in Δ was observed in seedlings and 2 year-old trees (P>0.01) but not in 8 year-old trees (P=0.60). Where genotypic variation were observed the differences between the lowest and highest values were 2.2 - 3.6 %o. Reduced water availability decreased Δ values in both pot and field studies but not in a consistent way across seedlots. Thus it would appear that the Δ of trees grown under favourable conditions does not give an indication of the Δ value which will be obtained under water-limited conditions. This complicates the use of Δ as a screening method. We have clearly shown that genotype variation occurs in A. auriculiformis in both seedlings and young field-grown trees. Considerable care is required when sampling large trees, as variation in Δ within the tree can be as large as between genotypes. The challenge
-
Chasmer, L.; Hopkinson, C.; Gynan, C.; Mahoney, C.; Sitar, M.
2015-12-01
Airborne and terrestrial lidar are increasingly used in forest attribute modeling for carbon, ecosystem and resource monitoring. The near infra-red wavelength at 1064nm has been utilised most in airborne applications due to, for example, diode manufacture costs, surface reflectance and eye safety. Foliage reflects well at 1064nm and most of the literature on airborne lidar forest structure is based on data from this wavelength. However, lidar systems also operate at wavelengths further from the visible spectrum (e.g. 1550nm) for eye safety reasons. This corresponds to a water absorption band and can be sensitive to attenuation if surfaces contain moisture. Alternatively, some systems operate in the visible range (e.g. 532nm) for specialised applications requiring simultaneous mapping of terrestrial and bathymetric surfaces. All these wavelengths provide analogous 3D canopy structure reconstructions and thus offer the potential to be combined for spatial comparisons or temporal monitoring. However, a systematic comparison of wavelength-dependent foliage profile and gap probability (index of transmittance) is needed. Here we report on two multispectral lidar missions carried out in 2013 and 2015 over conifer, deciduous and mixed stands in Ontario, Canada. The first used separate lidar sensors acquiring comparable data at three wavelengths, while the second used a single sensor with 3 integrated laser systems. In both cases, wavelenegths sampled were 532nm, 1064nm and 1550nm. The experiment revealed significant differences in proportions of returns at ground level, the vertical foliage distribution and gap probability across wavelengths. Canopy attenuation was greatest at 532nm due to photosynthetic plant tissue absorption. Relative to 1064nm, foliage was systematically undersampled at the 10% to 60% height percentiles at both 1550nm and 532nm (this was confirmed with coincident terrestrial lidar data). When using all returns to calculate gap probability, all
-
Bäck, Jaana; Taipale, Ditte; Aalto, Juho
2017-04-01
In boreal forests, deciduous trees such as birches may in future climate become more abundant due to their large biomass production capacity, relatively good resource use ability and large acclimation potential to elevated CO2 levels and warmer climate. Increase in birch abundance may lead to unpredicted consequences in atmospheric composition. Currently it is acknowledged that conifers such as Scots pine and Norway spruce are important sources for volatile organic compounds (VOCs), especially monoterpenes, throughout the year, although the strong temperature relationships implies that emissions are highest in summertime. However, the dynamics of the deciduous birch foliage VOC emissions and their relationship with environmental drivers during the development, maturation and senescence of foliage has not been well analyzed. Long-term measurements of birch, which are unfortunately very sparse, can provide very useful information for the development of biosphere-atmosphere models that simulate boreal and subarctic forested areas where birch is often a sub-canopy species, occurs as a mixture among conifers or forms even pure stands in the higher latitudes. We measured the branch level VOC emissions from a mature Silver birch with proton transfer reaction mass spectrometer during 2014 and 2015 at the SMEAR II station (Station for Measuring Ecosystem-Atmosphere Relations), southern Finland. Our results showed that the Silver birch foliage is a huge source for both short-chained volatiles such as methanol, acetaldehyde and acetone, as well as for monoterpenes. The mean emission rates from birch leaves were 5 to 10 times higher than the corresponding emissions from Scots pine shoots. We compared several semi-empirical model approaches for determining the birch foliage monoterpene standardized emission potentials, and utilized the continuous emission measurements from the two growing seasons for development of a novel algorithm which accounts for the leaf development and
-
DEFF Research Database (Denmark)
Graves, Gary R.
2017-01-01
Summary The regal moth (Citheronia regalis F.; Lepidoptera: Saturniidae) is reported for the first time feeding on foliage of the American smoketree (Cotinus obovatus Raf.; Anacardiaceae), an endemic tree with a relictual distribution on calcareous soils in the southern United States. This record...
-
Palisade Russet is a medium-late maturing, lightly russeted potato breeding clone notable for its resistance to late blight (Phytophthora infestans) infection of foliage and tuber. Palisade Russet is suitable for processing with low tuber glucose concentrations observed following long-term storage ...
-
Molecular gut-content analysis enables direct detection of arthropod predation with minimal disruption of on-going ecosystem processes. Mass-collection methods, such as sweep-netting, vacuum sampling, and foliage beating, could lead to regurgitation or even rupturing of predators along with uneaten ...
-
Landscape grown foxtail palm (Wodyetia bifurcata A.K. Irvine) trees displaying symptoms of severe foliar chlorosis, stunting, general decline and mortality reminiscent of coconut yellow decline disease were observed in Bangi, Malaysia during 2012. DNA samples from foliage tissues of 15 symptomatic ...
-
The butanol-HCl spectrophotometric assay is widely used to quantify extractable and insoluble forms of condensed tannin (CT, syn. proanthocyanidin) in foods, feeds, and foliage of herbaceous and woody plants. However, this method underestimates total CT content when applied directly to plant materia...
-
The butanol-HCl spectrophotometric assay is widely used for quantifying extractable and insoluble condensed tannins (CT, syn. proanthocyanidins) in foods, feeds, and foliage of herbaceous and woody plants, but the method underestimates total CT content when applied directly to plant material. To imp...
-
A sampling device for counting insect egg clusters and measuring vertical distribution of vegetation
Robert L. Talerico; Robert W., Jr. Wilson
1978-01-01
The use of a vertical sampling pole that delineates known volumes and position is illustrated and demonstrated for counting egg clusters of N. sertifer. The pole can also be used to estimate vertical and horizontal coverage, distribution or damage of vegetation or foliage.
-
Energy Technology Data Exchange (ETDEWEB)
Potenza, Marcos Roberto
2004-07-01
This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens
-
Energy Technology Data Exchange (ETDEWEB)
Potenza, Marcos Roberto
2004-07-01
This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens
-
International Nuclear Information System (INIS)
Potenza, Marcos Roberto
2004-01-01
This work aimed to evaluate the effect of irradiated essential oils of Eucalyptus citriodora, Eucalyptus globulus, Pinus sp., Azadirachta indica, Cymbopogon nardus, Cupressus sempervirens, Cymbopogons citratus and Juniperus communis and aqueous, hexanic and ethanolic irradiated extracts of Solanum paniculatum, Dahlia pinnata, Lycopersicon esculentum, Nephrolepis pectinata, Ruta graveolens, Ficus elastica, Lavandula angustifolia, Rhododendron simsii, Agave angustifolia, Ocimum basilicum, Allamanda cathartica, Dieffenbachia brasiliensis, Pennisetum purpureum, Annona squamosa, Coffea arabica and Hibiscus rosa-sinensis, in order to identify new substances to integrated pest management (IPM) and to observe possible effects of gamma radiation about extracts and essential oils efficiency such as increase, reduction, activation and inactivation of the same to the pest control. It evaluated the effect of contact on Sitophilus zeamais and by ingestion in Blattella germanica. To irradiation was used an experimental irradiator of Cobalt-60, type Gammacell 220. The essential oils were submitted increasing doses of gamma radiation: 2.5; 5.0; 7.5 and 10.0 kGy. The bioassay with B. germanica demonstrated efficiency between 22.0 e 30.0% and between 30.0 and 42.0%, respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation used promoted changes in essential oils of E. citriodora e E. globulus that they began to show efficiency on B. germanica nymphs besides a significant reduction of repellency. Essential oils of Pinus sp., A. indica, C. sempervirens and J. communis did not display efficiency. The essential oils of C. nardus, and C. citratus had low efficiency. The gamma radiation increased the efficiency of ethanolic extract of D. Pinnata with dose of 7.5 kGy, showing 48.0% of efficiency on B. germanica nymphs. The gamma radiation showed adverse effect on the aqueous extract of R. Graveolens
-
Three-dimensional hierarchical structures for fog harvesting.
Andrews, H G; Eccles, E A; Schofield, W C E; Badyal, J P S
2011-04-05
Conventional fog-harvesting mechanisms are effectively pseudo-2D surface phenomena in terms of water droplet-plant interactions. In the case of the Cotula fallax plant, a unique hierarchical 3D arrangement formed by its leaves and the fine hairs covering them has been found to underpin the collection and retention of water droplets on the foliage for extended periods of time. The mechanisms of water capture and release as a function of the surface 3D structure and chemistry have been identified. Of particular note is that water is retained throughout the entirety of the plant and held within the foliage itself (rather than in localized regions). Individual plant hairs form matlike structures capable of supporting water droplets; these hairs wrap around water droplets in a 3D fashion to secure them via a fine nanoscale groove structure that prevents them from easily falling to the ground.
-
Sun, Xiao; Liu, Zuojun; Zhang, Guilong; Qiu, Guannan; Zhong, Naiqin; Wu, Lifang; Cai, Dongqing; Wu, Zhengyan
2015-01-01
Traditional pesticides (TP) often do not adhere tightly to crop foliage. They can easily enter the surrounding environment through precipitation and volatilization. This can result in the pollution of the surrounding soil, water, and air. To reduce pesticide pollution, we developed a loss-control pesticide (LCP) by adding attapulgite with a nano networks structure fabricated using high energy electron beam (HEEB) irradiation and hydrothermal treatment to TP. HEEB irradiation effectively dispersed originally aggregated attapulgite through modified thermal, charge, and physical effects. Hydrothermal treatment further enhanced the dispersion of attapulgite to form nano porous networks via thermal and wet expansion effects, which are beneficial for pesticide binding. An LCP has improved retention on crop leaf surfaces. It has a higher adhesion capacity, reduced leaching and volatilization, and extended residual activity compared with the TP formulation. The treatment increases the residual activity of pesticides on crop foliage and decreases environmental pollution.
-
Directory of Open Access Journals (Sweden)
Andi Tarigan
2011-03-01
Full Text Available Twenty weaned male goats (F1 of Boer x Kacang with initial weight of 9 to 12 kg and ages ranging between 3.0 and 4.0 months were used in a study to evaluate the increasing inclusion of Indigofera sp foliage as a source of protein in diets based on chopped Brachiaria ruziziensis for growing goats. Five goats were allocated to one of four treatments in a randomised block design. The diet treatments were: T0 (control diets: B. ruziziensis (100%, T1 (85% B. ruziziensis + 15% Indigofera sp., T2 (70% B. ruziziensis + 30% Indigofera sp. T3 (55% B. ruziziensis + 45% Indigofera sp. all on DM basis. Feed (DM was offered daily at 3.5% BW. The content of CP in Indigofera sp is relatively high (258 g/kg DM, while the NDF (350.7 g/kg DM and ADF (232.2 g/ kg DM concentrations were low. The content of secondary compounds such as total phenol (8.9 g/kg DM, total tannin (0.8 g/kg DM and condensed tannin (0,5 g/kg DM were considerably low. The inclusion of Indigofera sp foliage in diets increased (P 0.05 among the T0,T1 and T2 diets and ranged from 0.08 to 0.09. It is concluded that the foliage of Indigofera sp could be used as feed supplement to supply proteins with low tannin contents. In a grass-based diets Indigofera sp colud be used at the level of 30 to 45% (DM for growing kids.
-
Direct effect of acid rain on leaf chlorophyll content of terrestrial plants in China.
Du, Enzai; Dong, Dan; Zeng, Xuetong; Sun, Zhengzhong; Jiang, Xiaofei; de Vries, Wim
2017-12-15
Anthropogenic emissions of acid precursors in China have resulted in widespread acid rain since the 1980s. Although efforts have been made to assess the indirect, soil mediated ecological effects of acid rain, a systematic assessment of the direct foliage injury by acid rain across terrestrial plants is lacking. Leaf chlorophyll content is an important indicator of direct foliage damage and strongly related to plant productivity. We synthesized data from published literature on experiments of simulated acid rain, by directly exposing plants to acid solutions with varying pH levels, to assess the direct effect of acid rain on leaf chlorophyll content across 67 terrestrial plants in China. Our results indicate that acid rain substantially reduces leaf chlorophyll content by 6.71% per pH unit across the recorded plant species. The direct reduction of leaf chlorophyll content due to acid rain exposure showed no significant difference across calcicole, ubiquist or calcifuge species, implying that soil acidity preference does not influence the sensitivity to leaf injury by acid rain. On average, the direct effects of acid rain on leaf chlorophyll on trees, shrubs and herbs were comparable. The effects, however varied across functional groups and economic use types. Specifically, leaf chlorophyll content of deciduous species was more sensitive to acid rain in comparison to evergreen species. Moreover, vegetables and fruit trees were more sensitive to acid rain than other economically used plants. Our findings imply a potential production reduction and economic loss due to the direct foliage damage by acid rain. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Régnière, Jacques; Nealis, Vincent G
2018-02-01
Conifer-feeding budworms emerge from overwintering sites as small larvae in early spring, several days before budburst, and mine old needles. These early-emerging larvae suffer considerable mortality during this foraging period as they disperse in search of available, current-year buds. Once buds flush, surviving budworms construct feeding shelters and must complete maturation before fresh host foliage senesces and lignifies later in the summer. Late-developing larvae suffer greater mortality and survivors have lower fecundity when feeding on older foliage. Thus, there is a seasonal trade-off in fitness associated with host synchrony: early-emerging budworms have a greater risk of mortality during spring dispersal but gain better access to the most nutritious foliage, while, on the other hand, late-emerging larvae incur a lower risk during the initial foraging period but must contend with rapidly diminishing resource quality at the end of the feeding period. We investigate the balance that results from these early-season and late-season synchrony fitness trade-offs using the concept of the phenological window. Parameters associated with the variation in the phenological window are used to estimate generational fitness as a function of host-plant synchrony. Because defoliation modifies these relationships, it is also included in the analysis. We show that fitness trade-offs characterizing the phenological window result in a robust synchrony relationship between budworm and host plant over a wide geographic range in southern British Columbia, Canada. © 2016 Her Majesty the Queen in Right of Canada Insect Science © 2016 Institute of Zoology, Chinese Academy of Sciences.
-
Temperature drives global patterns in forest biomass distribution in leaves, stems, and roots.
Reich, Peter B; Luo, Yunjian; Bradford, John B; Poorter, Hendrik; Perry, Charles H; Oleksyn, Jacek
2014-09-23
Whether the fraction of total forest biomass distributed in roots, stems, or leaves varies systematically across geographic gradients remains unknown despite its importance for understanding forest ecology and modeling global carbon cycles. It has been hypothesized that plants should maintain proportionally more biomass in the organ that acquires the most limiting resource. Accordingly, we hypothesize greater biomass distribution in roots and less in stems and foliage in increasingly arid climates and in colder environments at high latitudes. Such a strategy would increase uptake of soil water in dry conditions and of soil nutrients in cold soils, where they are at low supply and are less mobile. We use a large global biomass dataset (>6,200 forests from 61 countries, across a 40 °C gradient in mean annual temperature) to address these questions. Climate metrics involving temperature were better predictors of biomass partitioning than those involving moisture availability, because, surprisingly, fractional distribution of biomass to roots or foliage was unrelated to aridity. In contrast, in increasingly cold climates, the proportion of total forest biomass in roots was greater and in foliage was smaller for both angiosperm and gymnosperm forests. These findings support hypotheses about adaptive strategies of forest trees to temperature and provide biogeographically explicit relationships to improve ecosystem and earth system models. They also will allow, for the first time to our knowledge, representations of root carbon pools that consider biogeographic differences, which are useful for quantifying whole-ecosystem carbon stocks and cycles and for assessing the impact of climate change on forest carbon dynamics.
-
Bauerle, William L.; Bowden, Joseph D.
2011-01-01
A spatially explicit mechanistic model, MAESTRA, was used to separate key parameters affecting transpiration to provide insights into the most influential parameters for accurate predictions of within-crown and within-canopy transpiration. Once validated among Acer rubrum L. genotypes, model responses to different parameterization scenarios were scaled up to stand transpiration (expressed per unit leaf area) to assess how transpiration might be affected by the spatial distribution of foliage properties. For example, when physiological differences were accounted for, differences in leaf width among A. rubrum L. genotypes resulted in a 25% difference in transpiration. An in silico within-canopy sensitivity analysis was conducted over the range of genotype parameter variation observed and under different climate forcing conditions. The analysis revealed that seven of 16 leaf traits had a ≥5% impact on transpiration predictions. Under sparse foliage conditions, comparisons of the present findings with previous studies were in agreement that parameters such as the maximum Rubisco-limited rate of photosynthesis can explain ∼20% of the variability in predicted transpiration. However, the spatial analysis shows how such parameters can decrease or change in importance below the uppermost canopy layer. Alternatively, model sensitivity to leaf width and minimum stomatal conductance was continuous along a vertical canopy depth profile. Foremost, transpiration sensitivity to an observed range of morphological and physiological parameters is examined and the spatial sensitivity of transpiration model predictions to vertical variations in microclimate and foliage density is identified to reduce the uncertainty of current transpiration predictions. PMID:21617246
-
Directory of Open Access Journals (Sweden)
Rafael Murillo
2015-11-01
Full Text Available Tissue samples from aerial biomass compartments (bark, wood, primary and secondary branches, and foliage were taken from 16 dominant trees of teak in plantations of the Panama Canal watershed, whose volume yield ranged between 9.4 and 13.3 m3 ha-1. year-1 at ages 3 and 18 years, respectively, growing in clayey, red, and acid Ultisols. Wet and dry weight of the different tissues was measured and subsamples taken to be analyzed for macronutrients (N, K, Ca, Mg, P and S and micronutrients (Fe, Mn, Zn, Cu and B. Regression analyses allowed to relate nutrients accumulation with tree age. Dry biomass of the wood was 59.6% (C.V. 5% of total dry biomass, while primary branches, bark, foliage, and secondary branches represented 16.6, 9.4, 7.9, and 6.5, respectively. Larger concentrations of macronutrients were Ca (2.01% found in the bark, and N in the foliage (1.98%. As for micronutrients, larger concentrations were found in the bark, in the order of Fe (767 mg.kg-1, Mn (60 mg.kg-1 and Zn (50 mg.kg-1. At 18 years of age accumulation of macronutrients was 15.9 kg. tree-1 (7.3 kg Ca, 3.9 kg N, 2.6 kg K, 1.0 kg Mg, 0.7 kg P and 0.4 kg S and 124 g of micronutrients (89 g Fe, 18 g Zn, 9 g B, 5 g Mn and 3 g Cu.
-
El-Shenawy, Z; Mansour, M A; El-Behrawi, S
1978-01-01
The highly pathogenic isolate stimulated the emergence of the squash seedlings first, caused, however, the highest death rate of the seedlings finally. Fusarium isolates and their culture filtrates inhibited the respiratory rate of squash plants significantly. However, F. oxysporum isolates inhibited respiration more than F. solani isolates. Seasonal changes of respiration decline show that the respiratory rate decreased with plant growth in the case of infested soil and of plants injected with culture filtrates. However, spraying Fusarium culture filtrates on the foliage gave opposite results when the plants grew older. Fusarium solani isolates decreased nitrogen content of squash stems and leaves, while F. oxysporum isolates gave reverse results. Injecting Fusarium culture filtrate into the plant decreased nitrogen content of both stems and leaves, while spraying the foliage with the filtrates increased nitrogen content more than that of the control. Phosphorus content of the stems of squash plants, sown in infested soil, was less than in the control when the plants were treated with F. solani and higher when they were treated with F. oxysporum isolates. On the other hand, the phosphorus content of squash leaves was higher than in the control. In the case of injected plants, however, the phosphorus content in stems and leaves was equal to that of the control or less, and with sprayed plants it was higher than in the control. Infesting the soil with Fusarium isolates and spraying the foliage with their culture filtrates increased potassium content of squash stems and leaves, while injecting the filtrates into the plants decreased potassium content of both stems and leaves.
-
Herbivory and the cycling of nitrogen and phosphorus in isolated California oak trees
David Y. Hollinger
1986-01-01
Nitrogen and phosphorus flow in litterfall and throughfall were studied in two California Quercus species (the evergreen Q.agrifolia and deciduous Q. lobata) before, during, and after an outbreak of the California oak moth, Phryganidia californica. All of the foliage of both oak species was...
-
Iftikhar, Sehrish; Shahid, Ahmad A.; Halim, Sobia A.; Wolters, Pieter J.; Vleeshouwers, Vivianne G.A.A.; Khan, Ajmal; Al-Harrasi, Ahmed; Ahmad, Shahbaz
2017-01-01
Alternaria blight is an important foliage disease caused by Alternaria solani. The enzyme Succinate dehydrogenase (SDH) is a potential drug target because of its role in tricarboxylic acid cycle. Hence targeting Alternaria solani SDH enzyme could be efficient tool to design novel fungicides against
-
Kimberly F. Wallin; Tanya M. Latty; Darrell W. Ross
2011-01-01
We studied the adult ambulatory response of the predator, Laricobius nigrinus Fender (Coleoptera: Derodontidae), to odors from its prey, Adelges tsugae Annand, the hemlock woolly adelgid, and foliage of hemlock woolly adelgid, host hemlocks (Tsuga spp.), and other conifers. Both the predator and hemlock woolly...
-
The soybean (Glycine max (L.) Merr.) chlorophyll deficient line MinnGold is a spontaneous mutant characterized by yellow foliage. Map-based cloning and transgenic complementation revealed that the mutant phenotype is caused by a non-synonymous nucleotide substitution in the third exon of a Mg-chelat...
-
Superantenna made of transformation media
International Nuclear Information System (INIS)
Leonhardt, Ulf; Tyc, Tomas
2008-01-01
We show how transformation media can make a superantenna that is either completely invisible or focuses incoming light into a needle-sharp beam. Our idea is based on representing three-dimensional space as a foliage of sheets and performing two-dimensional conformal maps on each sheet.
-
Steve Tjosvold; David Chambers; Sylvia Mori
2013-01-01
The objective of our research was to determine the environmental conditions and lesion age favorable for Phytophthora ramorum sporulation under field conditions. For 2 years, new camellia, rhododendron, and California bay laurel (Umbellaria californica (Hook. & Arn.) Nutt.) nursery stock were seasonally inoculated (every 3 months) on foliage....
-
KUPSnet: Knowledge-based Ubiquitous and Persistent Sensor Network Testbed for Threat Assessment
2010-09-16
surements were taken in Holliston, MA. The data used in this paper were measured in November. The foliage is made up of both deciduous and conifer trees...This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction
-
Mark E. Fenn
1991-01-01
Some possible factors causing enhanced litter decomposition in high-pollution sites in the San Bernardino Mountains of southern California were investigated. Nitrogen concentration of soil, as well as foliage and litter of ponderosa pine (Pinus ponderosa Laws.) and Jeffrey pine (Pinus jeffreyi Grev. & Balf.) were greater in...
-
Direct effect of acid rain on leaf chlorophyll content of terrestrial plants in China
Du, Enzai; Dong, Dan; Zeng, Xuetong; Sun, Zhengzhong; Jiang, Xiaofei; Vries, de Wim
2017-01-01
Anthropogenic emissions of acid precursors in China have resulted in widespread acid rain since the 1980s. Although efforts have been made to assess the indirect, soil mediated ecological effects of acid rain, a systematic assessment of the direct foliage injury by acid rain across terrestrial
-
Superantenna made of transformation media
Energy Technology Data Exchange (ETDEWEB)
Leonhardt, Ulf; Tyc, Tomas [School of Physics and Astronomy, University of St Andrews, North Haugh, St Andrews KY16 9SS, Scotland (United Kingdom)], E-mail: ulf@st-andrews.ac.uk
2008-11-15
We show how transformation media can make a superantenna that is either completely invisible or focuses incoming light into a needle-sharp beam. Our idea is based on representing three-dimensional space as a foliage of sheets and performing two-dimensional conformal maps on each sheet.
-
Role of brown bears (Ursus arctos) in the flow of marine nitrogen into a terrestrial ecosystem.
Grant V. Hilderbrand; Thomas A. Hanley; Charles T. Robbins; Charles C. Schwartz
1999-01-01
We quantified the amount, spatial distribution, and importance of salmon (Oncorhynchus spp.)-derived nitrogen (N) by brown bears (Ursus arctos) on the Kenai Peninsula, Alaska. We tested and confirmed the hypothesis that the stable isotope signature (δ15N) of N in foliage of white spruce (
-
Phylloplane bacteria increase the negative impact of food limitation on insect fitness
Olson, Grant L.; Myers, Judith H.; Hemerik, Lia; Cory, Jenny S.
2017-01-01
1. When populations of herbivorous insects increase in density, they can alter the quantity or quality of their food. The impacts of diet-related stressors on insect fitness have been investigated singly, but not simultaneously. 2. Foliage quantity and quality of red alder, Alnus rubra, were
-
Diet and time-activity budget of White-backed Mousebirds Colius ...
African Journals Online (AJOL)
Mousebirds (Coliiformes) are unusual in having an exclusively vegetarian diet that includes substantial foliage and by using huddling and sunning to assist thermoregulation. Although previous studies have identified plant species and plant parts consumed by mousebirds, the relative importance of different food types in the ...
-
While Utetheisa ornatrix larvae are able to develop through feeding only on foliage of its hostplants in the genus Crotalaria, in later instars they are attracted to seeds as a richer source of alkaloids. Recently, it was demonstrated that seeds receive different degrees of mechanical protection fro...
-
Litter as seedbed: interactions between the soil, seedlings and litter of kauri (Agathis australis)
Verkaik, E.
2006-01-01
Plants have important impacts upon soil processes such as nutrient mineralisation and organic matter dynamics. They might even enhance their own fitness by improving soil quality or by making the soil less favourable for competing species. In the latter strategy, tannins in plant foliage might be
-
A physical theory of focus development in plant disease
Zawolek, M.W.
1989-01-01
Chapter 1. The 'diffusion theory' of focus development in plant disease is introduced. Foci develop in space and time. The theory applies primarily to air-borne fungal diseases of the foliage.
Chapter 2. The contents of the present volume are outlined.
Chapter 3. The
-
7 CFR 457.135 - Onion crop insurance provisions.
2010-01-01
... Basic Provisions with (1) controlling (2) etc. 1. Definitions Damaged onion production. Storage type... method and production practice. Harvest. Removal of the onions from the field after topping and lifting... production. Onions of recoverable size and condition, with excess dirt and foliage material removed and that...
-
Michael G. Ryan; Jose Luiz Stape; Dan Binkley; Sebastiao Fonseca; Rodolfo A. Loos; Ernesto N. Takahashi; Claudio R. Silva; Sergio R. Silva; Rodrigo E. Hakamada; Jose Mario Ferreira; Augusto M. N. Lima; Jose Luiz Gava; Fernando P. Leite; Helder B. Andrade; Jacyr M. Alves; Gualter G. C. Silva
2010-01-01
Wood production varies substantially with resource availability, and the variation in wood production can result from several mechanisms: increased photosynthesis, and changes in partitioning of photosynthesis to wood production, belowground flux, foliage production or respiration. An understanding of the mechanistic basis for patterns in wood production...
-
Sampling methods of Myllocerus undecimpustulatus undatus (Coleoptera: Curculionidae) adults
An exotic weevil Myllocerus undecimpustulatus undatus Marshall was first found in south Florida in 1995. The adults have a broad host range that includes foliage of fruit trees, ornamentals and vegetables, but little is known about their basic biology, including larval host plants. Studies were co...
-
F. Temel; G.R. Johnson; J.K. Stone
2004-01-01
This study examined 108 15-year-old Douglas-fir (Pseudotsuga menziesii var. menziesii trees to investigate whether trees exhibiting less severe Swiss needle cast (SNC) symptoms were more resistant (had less fungal colonization) or more tolerant (maintained healthy foliage under similar infection levels). Trees were sampled from...
-
PNRI mutant variety: Cordyline 'Afable'
International Nuclear Information System (INIS)
Aurigue, Fernando B.
2012-01-01
Cordyline 'Afable', registered by the Philippine Nuclear Research Institute as NSIC 2009 Or-83, is an induced mutant developed from Cordyline 'Kiwi' by treating stem cuttings with acute gamma radiation from a Cobalt-60 source. The new mutant is identical to Cordyline 'Kiwi' in growth habit but differs in foliage color, and exhibits field resistance to Phytophthora sp., a fungus that causes leaf blight and rot in Ti plants. Results of this mutation breeding experiment showed that leaf color was altered by gamma irradiation and resistance to fungal diseases was improved. It also demonstrated how mutations that occur in nature may be generated artificially. Propagation of cordyline 'Afable' is true-to-type by vegetative propagation methods, such as separation of suckers and offshoots, shoot tip cutting, and top cutting. Aside from landscaping material, terrarium or dish-garden plant, it is ideal as containerized plant for indoor and outdoor use. The leaves or shoots may be harvested as cut foliage for flower arrangements. (author)
-
Detecting changes in insect herbivore communities along a pollution gradient
Energy Technology Data Exchange (ETDEWEB)
Eatough Jones, Michele [Department of Entomology, University of California Riverside, Riverside, CA 92521 (United States)]. E-mail: michele.eatough@ucr.edu; Paine, Timothy D. [Department of Entomology, University of California Riverside, Riverside, CA 92521 (United States)]. E-mail: timothy.paine@ucr.edu
2006-10-15
The forests surrounding the urban areas of the Los Angeles basin are impacted by ozone and nitrogen pollutants arising from urban areas. We examined changes in the herbivore communities of three prominent plant species (ponderosa pine, California black oak and bracken fern) at six sites along an air pollution gradient. Insects were extracted from foliage samples collected in spring, as foliage reached full expansion. Community differences were evaluated using total herbivore abundance, richness, Shannon-Weiner diversity, and discriminant function analysis. Even without conspicuous changes in total numbers, diversity or richness of herbivores, herbivore groups showed patterns of change that followed the air pollution gradient that were apparent through discriminant function analysis. For bracken fern and oak, chewing insects were more dominant at high pollution sites. Oak herbivore communities showed the strongest effect. These changes in herbivore communities may affect nutrient cycling in forest systems. - Differences in insect herbivore communities were associated with an ambient air pollution gradient in the mixed conifer forest outside the Los Angeles area.
-
Energy Technology Data Exchange (ETDEWEB)
Bronson, D.R. [Wyoming Univ., Laramie, WY (United States). Dept. of Renewable Resources; Gower, S.T. [Wisconsin Univ., Madison, WI (United States). Dept. of Forest Ecology and Management
2010-04-15
Substantial increases in climatic temperatures may cause boreal forests to become a carbon source. An improved understanding of the effect of climatic warming on photosynthesis and autotrophic respiration is needed in order to determine the impact of temperature increases on net carbon balances. This study measured the light-saturated photosynthesis foliage respiration and stem respiration of black spruce in heated and control plots during a 3-year period at a site located in Thompson, Manitoba. Greenhouses and soil-heating cables were used to maintain air and soil temperatures at 5 degrees C above ambient air and soil temperatures. Studies were conducted to determine the influence of soil and air warming; soil-only warming; and greenhouses maintained at ambient temperatures. The study showed that treatment differences for photosynthesis, foliage respiration, and stem respiration were not significant over the 3-year period. Results suggested that black spruce may not have significant changes in photosynthesis or respiration rates in warmer climates. 38 refs., 3 tabs., 4 figs.
-
Detecting changes in insect herbivore communities along a pollution gradient
International Nuclear Information System (INIS)
Eatough Jones, Michele; Paine, Timothy D.
2006-01-01
The forests surrounding the urban areas of the Los Angeles basin are impacted by ozone and nitrogen pollutants arising from urban areas. We examined changes in the herbivore communities of three prominent plant species (ponderosa pine, California black oak and bracken fern) at six sites along an air pollution gradient. Insects were extracted from foliage samples collected in spring, as foliage reached full expansion. Community differences were evaluated using total herbivore abundance, richness, Shannon-Weiner diversity, and discriminant function analysis. Even without conspicuous changes in total numbers, diversity or richness of herbivores, herbivore groups showed patterns of change that followed the air pollution gradient that were apparent through discriminant function analysis. For bracken fern and oak, chewing insects were more dominant at high pollution sites. Oak herbivore communities showed the strongest effect. These changes in herbivore communities may affect nutrient cycling in forest systems. - Differences in insect herbivore communities were associated with an ambient air pollution gradient in the mixed conifer forest outside the Los Angeles area
-
A comparison of 137Cs radioactivity in localized evergreen and deciduous plant species
International Nuclear Information System (INIS)
Rangel, R.C.
1996-05-01
A vegetation study at the Comanche Peak Steam Electric Station (CPSES) near Glen Rose, Texas was conducted in 1991 and 1992. The CPSES is a commercial nuclear power plant owned and operated by Texas Utilities Electric of Dallas, Texas. The US Nuclear Regulatory Commission (USNRC) requires the CPSES to routinely sample broadleaf vegetation in place of milk samples. Few commercial dairies exist in the vicinity. Broadleaf tree species are scarce because the climate and local limestone geology have produced a dry rolling hill topography. An evergreen juniper is the dominant tree species. Few broadleaves during the winter season have hindered year-round sampling. This study compares the environmental 137 Cs concentrations between broadleaf and evergreen foliage at CPSES. Soil 137 Cs concentrations from each vegetation location were also compared to the foliage 137 Cs concentrations. The study's objective was to determine if the deciduous and evergreen vegetation 137 Cs concentrations are statistically the same
-
Directory of Open Access Journals (Sweden)
Bahram Momen
2014-03-01
Full Text Available A preliminary step to understand the impact of possible rise in temperature on carbon dynamics of forests is to examine the temperature elasticity of key processes involved in carbon fixation in forest trees. For seedling and mature ponderosa pines of three genotypes, we used a response-surface methodology and ANOVA to evaluate changes in maximum net photosynthesis (An max, and corresponding light (LAn max and temperature (TAn max to diurnal and seasonal changes in ambient temperature during summer and autumn. As seasonal ambient temperature decreased: (1 An max did not change in seedlings or mature trees, (2 LAn max did not change in mature trees, but it decreased for current-yr foliage of seedlings from 964 to 872 µmol photons m-2 s-1, and (3 TAn max did not change in seedlings but it decreased in mature trees for both current- and one-yr-old foliage, from 26.8 to 22.2, and 24.6 to 21.7 C, respectively.
-
Aqueous leachate from western red cedar: effects on some aquatic organisms
Energy Technology Data Exchange (ETDEWEB)
Peters, G B; Dawson, H J; Hrutfiord, B F; Whitney, R R
1976-01-01
Water-soluble extractives from western red cedar heartwood, bark, and foliage were investigated for their toxicity to aquatic organisms. The heartwood lignins and bark extractives were found to be moderately toxic, but the foliage terpenes and heartwood tropolones were more toxic, causing 50% mortality to coho salmon (Oncorhynchus kisutch) fry at 0.33 and 2.7 mg/liter, respectively. Tropolones were significantly less toxic to invertebrates than to free-swimming stages of the fish tested. Fry were found to be the stage of development of coho salmon (O. kisutch) most sensitive to the tropolones, and eyed eggs the least sensitive. Sensitivity of the coho fry to tropolones was moderated by previous sublethal exposure or the presence of a chelatable cation. Results from field studies and a leaching study indicate that directly releasing cedar leachate from landfills or allowing logging debris to enter streams should be avoided. 13 references, 3 figures, 2 tables.
-
A comparison of {sup 137}Cs radioactivity in localized evergreen and deciduous plant species
Energy Technology Data Exchange (ETDEWEB)
Rangel, R.C.
1996-05-01
A vegetation study at the Comanche Peak Steam Electric Station (CPSES) near Glen Rose, Texas was conducted in 1991 and 1992. The CPSES is a commercial nuclear power plant owned and operated by Texas Utilities Electric of Dallas, Texas. The US Nuclear Regulatory Commission (USNRC) requires the CPSES to routinely sample broadleaf vegetation in place of milk samples. Few commercial dairies exist in the vicinity. Broadleaf tree species are scarce because the climate and local limestone geology have produced a dry rolling hill topography. An evergreen juniper is the dominant tree species. Few broadleaves during the winter season have hindered year-round sampling. This study compares the environmental {sup 137}Cs concentrations between broadleaf and evergreen foliage at CPSES. Soil {sup 137}Cs concentrations from each vegetation location were also compared to the foliage {sup 137}Cs concentrations. The study`s objective was to determine if the deciduous and evergreen vegetation {sup 137}Cs concentrations are statistically the same.
-
Frost sensitivity and nutrient status in a fertilized Norway spruce stand in Denmark
DEFF Research Database (Denmark)
Jönsson, A. M.; Ingerslev, M.; Raulund-Rasmussen, K.
2004-01-01
by an index of injury, based on conductivity measurements of ion leakage from needles. Despite fertilization, all trees indicated N, P and K deficiency. The foliage, collected in late winter, was generally not very frost sensitive, but foliage from trees with the lowest K and P status were more sensitive......The aim of this study was to assess the effect of the N, P and K status on frost sensitivity of Norway spruce needles in a fertilization experiment situated in a nutrient poor 29-year-old Picea abies stand in western Denmark. The relative difference in frost sensitivity among trees was assessed...... to frost, and the current year needles were more sensitive than the second and third year needles. The advancement of bud burst was assessed in May. Trees with a relatively high N concentration in the current year needles had a more advanced bud burst than trees with a lower N concentration, increasing...
-
Cobalt accumulation and circulation by blackgum trees
International Nuclear Information System (INIS)
Thomas, W.A.
1975-01-01
Blackgum (Nyssa sylvatica Marsh.) trees accumulate far greater concentrations of cobalt in mature foliage than do other species on the same site (363 ppM in ash of blackgum, compared with about 3 ppM by mockernut hickory and about 1 ppM by red maple, tulip tree, and white oak). Cobalt concentrations in dormant woody tissues of blackgum also significantly exceed those in the other four species. Inoculation of six blackgums with 60 Co revealed that cobalt remains mobile in the trees for at least 3 years. Foliar concentrations of stable cobalt increase uniformly until senescence. In late August, foliage accounts for only 9 percent of total tree weight but 57 percent of total tree cobalt. Losses of cobalt from trees occur almost entirely by leaf abscission, and the loss rates of weight and cobalt from decomposing litter are similar. Retention of cobalt in the biologically active soil layers perpetuates zones of cobalt concentration created by this species in woodlands
-
INVESTIGATION OF PARALLAX ISSUES FOR MULTI-LENS MULTISPECTRAL CAMERA BAND CO-REGISTRATION
Directory of Open Access Journals (Sweden)
J. P. Jhan
2017-08-01
Full Text Available The multi-lens multispectral cameras (MSCs, such as Micasense Rededge and Parrot Sequoia, can record multispectral information by each separated lenses. With their lightweight and small size, which making they are more suitable for mounting on an Unmanned Aerial System (UAS to collect high spatial images for vegetation investigation. However, due to the multi-sensor geometry of multi-lens structure induces significant band misregistration effects in original image, performing band co-registration is necessary in order to obtain accurate spectral information. A robust and adaptive band-to-band image transform (RABBIT is proposed to perform band co-registration of multi-lens MSCs. First is to obtain the camera rig information from camera system calibration, and utilizes the calibrated results for performing image transformation and lens distortion correction. Since the calibration uncertainty leads to different amount of systematic errors, the last step is to optimize the results in order to acquire a better co-registration accuracy. Due to the potential issues of parallax that will cause significant band misregistration effects when images are closer to the targets, four datasets thus acquired from Rededge and Sequoia were applied to evaluate the performance of RABBIT, including aerial and close-range imagery. From the results of aerial images, it shows that RABBIT can achieve sub-pixel accuracy level that is suitable for the band co-registration purpose of any multi-lens MSC. In addition, the results of close-range images also has same performance, if we focus on the band co-registration on specific target for 3D modelling, or when the target has equal distance to the camera.
-
Nagler, P. L.; Dennison, P. E.; Hultine, K. R.; van Riper, C.; Glenn, E. P.
2008-12-01
feet above the ground at two saltcedar-dominated sap flow sites along the Dolores River. These two sites have both been defoliated by the saltcedar leaf beetle, but in 2007 these sites refoliated at different rates, 0-25 percent and 75 percent respectively. 2008 was a critical year to be able to capture changes in the post-infestation regrowth period (measuring quantity and quality of foliage), rates of change, extent of change, replacement vegetation (canopy components, native vs. non- native, grasses vs. shrubs vs. trees), surface reflectance changes (canopy cover), and avian habitat use. Continued ground and remote sensing estimation of ET will allow assessment of potential water salvage resulting from biocontrol of tamarisk.
-
Inheritance in a Diallel Crossing Experiment with Longleaf Pine
E. B. Snyder; Gene Namkoong
1978-01-01
Seven-year-old progeny from crosses among 13 randomly selected parent trees provided genetic information on 51 growth, form, foliage, branch, bud, and pest resistance traits. Presented are he&abilities, phenotypic and genotypic variances, covariances, General Combining Ability (GCA), Specific Combining Ability (SCA), and environmental. correlations for all measured...
-
Timothy A. Martin; Eric J. Jokela
2002-01-01
While nutrient availability is a dominant factor controlling leaf area development and pine productivity in the southeastern USA, few studies have explored the long-term interactions among nutrient inputs, canopy foliage production, and aboveground biomass production. In order to address these questions, the Intensive Management Practices Assessment Center (IMPAC)...
-
Crown Release Increases Diameter Growth and Bole Sprouting of Pole-Size Yellow Birch
Gayne G. Erdmann; Ralph M. Jr. Peterson
1971-01-01
During the second and third years after release, dominant, codominant, and intermediate pole-size yellow birch grew nearly twice as fast in diameter as unreleased poles. Growth rates were also related to foliage density. Epicormic sprouting was increased by crown release but most sprouting occured in the second log.
-
Concentration on Callus Induction in Sugarcane
African Journals Online (AJOL)
protocols for in vitro micro propagation of sugarcane through callus culture from foliage leaves (Bugun et al., ... protocol for specific genotypes. Sucrose is the most important type of sugar produced from sugarcane. ... laboratories via plant tissue culture technique. (Lorenzo and Ganzalez, 1998). This allows for an extended ...
-
Experiments in rooting bishop pine (Pinus muricata D. Don) cuttings
Constance I. Millar
1987-01-01
Presented here are results of rooting studies using hedges established from juvenile seedlings of "blue" and "green" foliaged bishop pine (Pinus muricata D. Don) from Mendocino and Sonoma Counties, California. Rootability, averaged over all clones and all setting dates, was 88%. The average time for 50% of the...
-
Ulyshen Michael
2011-01-01
Studies on the vertical distribution patterns of arthropods in temperate deciduous forests reveal highly stratified (i.e., unevenly vertically distributed) communities. These patterns are determined by multiple factors acting simultaneously, including: (1) time (forest age, season, time of day); (2) forest structure (height, vertical foliage complexity, plant surface...
-
Food for early succession birds: relationships among arthropods, shrub vegetation, and soil
Richard N. Conner; Daniel Saenz; D. Brent Burt
2006-01-01
During spring and early summer, shrub- and herbaceous-level vegetation provides nesting and foraging habitat for many shrub-habitat birds. We examined relationships among arthropod biomass and abundance, foliage leaf surface area and weight, vegetation ground cover, soil characteristics, relative humidity, and temperature to evaluate what factors may influence...
-
Delonix regia Rat. (Gulmohar) is a highly ornamental tree largely ...
Indian Academy of Sciences (India)
Delonix regia Rat. (Gulmohar) is a highly ornamental tree largely cultivated on roadsides and in gardens for its beautiful foliage and scarlet red (lowers. Gulmohar trees in full bloom and new leaves dominate other flora in summer months. The infusion of flowers is used in bronchitis, asthma and malaria.
-
Regrowth of cocksfoot, Dactylis glomerata (L.) in response to ...
African Journals Online (AJOL)
Frequent clipping of Dactylis glomerata after 15-, 30- and 45-day regrowth periods showed that higher foliage yields and better root development are obtained after the longer periods of regrowth. While these longer periods of regrowth, larger quantities of available carbohydrates were translocated to the roots. Clipping at ...
-
One might conclude the soil is a more congenial arena for using entomopathogenic fungi (EPF) than the phylloplane. No ultraviolet light, no rainfall washing conidia from foliage, no rapid attenuation of conidial deposits by rapid plant canopy expansion. The soil is cool, damp and dark – perfect fo...
-
Individual tree crown modeling and change detection from airborne lidar data
Xiao, W.; Xu, Sudan; Oude Elberink, S.J.; Vosselman, G.
2016-01-01
Light detection and ranging (lidar) provides a promising way of detecting changes of trees in three-dimensional (3-D) because laser beams can penetrate through the foliage and therefore provide full coverage of trees. The aim is to detect changes in trees in urban areas using multitemporal airborne
-
Directory of Open Access Journals (Sweden)
Smail Aazza
2011-09-01
Full Text Available The commercial essential oils of Citrus aurantium L., Cupressus sempervirens L., Eucalyptus globulus Labill., Foeniculum vulgare Mill. and Thymus vulgaris L., isolated by steam distillation by a company of Morocco were evaluated in terms of in vitro antioxidant activity through several methods. In vitro acetylcholinesterase inhibitory activity was also determined. Citrus limon (L. Burm. f. oil was also studied, but it was obtained by peel expression. The best antioxidant was T. vulgaris oil, independent of the method used, mainly due to the presence of the phenolic monoterpenes thymol and carvacrol, which when studied as single compounds also presented the best activities. Concerning the acetylcholinesterase inhibition activity, E. globulus was the most effective. Nevertheless its main components 1,8-cineole and limonene were not the most active, a feature that corresponded to d-3-carene.
-
Energy Technology Data Exchange (ETDEWEB)
Bellmann, H J; Schuettler, J; Jakisch, E
1981-11-01
This paper discusses the occurrence of silicified tree trunks and stumps in the Boehlen brown coal field. The trees, mainly Taxodium and Sequoia 25 million years old, are located within the top brown coal seam of the deposit and present a major obstacle to excavator operation, together with other forms of so-called 'brown coal quartzite'. The quartz of the silicified trees occurs as opal, cryptocrystalline quartz and low temperature quartz. The separate removal and disposal of this wood as well as efforts made to use selected wood as raw material are briefly summarized. Various products for interior house decoration have been manufactured from the wood. (4 refs.)
-
Smart grids are advancing, light and supple
International Nuclear Information System (INIS)
Petitot, Pauline
2016-01-01
While indicating some innovations produced by the Greenlys laboratory (SmartScan to localize losses by means of smart counters, a system for grid self-healing, Sequoia to manage a low voltage network, a tool for the prediction of photovoltaic production in real time), and also the main smart grid projects in France (Nice Grid, Solenn, SoGrid, Smart Electric Lyon, Poste intelligent, Greenlys, Smart Grids Vendee, BienVEnu), this article comments the emergence of several experiments on smart grids in France, the first drawn conclusions and recommendations. Some issues for this new architecture are discussed: the active demand management, cut-offs and flexibility, and the search for profitability
-
Beltrán, William; Wunderle, Joseph M.
2014-01-01
Abstract The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis–Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L. , Bucida buceras L. , Pithecellobium dulce , and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora , (Swartz) De Candolle, Pi. dulce , Leucaena leucocephala , and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. PMID:25502036
-
Losses of Sr/sup 90/, Sr/sup 89/, and I/sup 131/ from fallout-contaminated plants
Energy Technology Data Exchange (ETDEWEB)
Martin, W E
1964-11-01
During the early period following local fallout, and during periods of maximal worldwide fallout, the entry of radionuclides into terrestrial food-chains is due primarily to the external contamination of plants and secondarily to the uptake of radionuclides from contaminated soil. Studies were undertaken to estimate the rates of radionuclide loss from fallout-contaminated vegetation and hence from the diets of herbivores living in a fallout field. On the fifth, fifteenth, thirtieth, and sixtieth days after an underground nuclear explosion (Operation Sedan) at the Nevada Test Site, plant samples were collected from twenty representative locations in the fallout field and analyzed to determined the concentrations (pc/g dry wt) of /sup 90/Sr, /sup 89/Sr, and /sup 131/I at the times of collections. While the radioactive half lives of /sup 90/Sr, /sup 89/Sr, and /sup 131/I are approximately 27.7 years, 53 days, and 8.04 days respectively, their average effective half-lives on fallout-contaminated plants, during the period from 5 to 30 days after the detonation, were 27.8 days, 17.8 days, and 5.0 days respectively. Losses of /sup 90/Sr were attributed to radioactive decay and to the removal of fallout particles and foliage by wind and/or other mechanical disturbances. Losses of /sup 90/Sr and /sup 89/Sr were attributed to radioactive decay and to the removal of fallout particles and foliage by wind and/or other mechanical disturbances. Losses of /sup 131/I were attributed to radioactive decay, to mechanical disturbance, and to the vaporization of /sup 131/I from the fallout particles retained on foliage.
-
Yanai, Ruth D.; Driscoll, Charles T.; Montesdeoca, Mario; Smith, Kevin T.
2018-01-01
Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1–2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems. PMID:29684081
-
Yang, Yang; Yanai, Ruth D; Driscoll, Charles T; Montesdeoca, Mario; Smith, Kevin T
2018-01-01
Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1-2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems.
-
Sobieszczyk, Steven; Keith, Mackenzie K.; Rounds, Stewart A.; Goldman, Jami H.
2014-01-01
For this study, we explored the amount, type, and distribution of foliar biomass that is deposited annually as leaf litter to Fanno Creek and its floodplain in Portland, Oregon, USA. Organic matter is a significant contributor to the decreased dissolved oxygen concentrations observed in Fanno Creek each year and leaf litter is amongst the largest sources of organic matter to the stream channel and floodplain. Using a combination of field measurements and light detection and ranging (LiDAR) point cloud data, the annual foliar biomass was estimated for 13 stream reaches along the creek. Biomass estimates were divided into two sets: (1) the annual foliage available from the entire floodplain overstory canopy, and (2) the annual foliage overhanging the stream, which likely contributes leaf litter directly to the creek each year. Based on these computations, an estimated 991 (±22%) metric tons (tonnes, t) of foliar biomass is produced annually above the floodplain, with about 136 t (±24%) of that foliage falling directly into Fanno Creek. The distribution of foliar biomass varies by reach, with between 150 and 640 t/km2 produced along the floodplain and between 400 and 1100 t/km2 available over the channel. Biomass estimates vary by reach based primarily on the density of tree cover, with forest-dominant reaches containing more mature deciduous trees with broader tree canopies than either wetland or urban-dominant reaches, thus supplying more organic material to the creek. By quantifying the foliar biomass along Fanno Creek we have provided a reach-scale assessment of terrestrial organic matter loading, thereby providing land managers useful information for planning future restoration efforts.
-
Directory of Open Access Journals (Sweden)
Král Jan
2015-09-01
Full Text Available The structure and health status of waterlogged or peaty spruce (Picea abies [L.] Karst. forests in the summit parts of the Krkonoše Mts. in the Czech Republic were studied in 1979–2014. The objective was to evaluate the stand structure, dead wood, trend of the health status and productivity on four permanent research plots (PRP in relation to air pollution (SO2 and NOx concentrations and climatic conditions (temperatures and precipitation amounts. Stand structure was evaluated on the base of the measured parameters of individual trees on PRP. The health status of trees was evaluated according to foliage, and their vitality was assessed according to their radial growth documented by dendrochronological analyses. The radial growth was negatively correlated with SO2 and NOx concentrations. Stand dynamics during the observation period was characterised by increased tree mortality, the presence of dead wood and reduction of stand density from 1983 to 1992, while the most severe impairment of health status and stand stability occurred in 1982–1987. The foliage mass of living trees has been gradually increasing since 1988, but no pronounced improvement of tree vitality was documented after the decrease in SO2 concentration. However, particularly physiologically weakened spruce trees were attacked by the European spruce bark beetle (Ips typographus. The process of forest damage is manifested not only by foliage reduction but also by symptoms of various necroses on the assimilatory organs. In terms of climatic data, the weather in April had the most important effect on radial growth. Diameter increment showed positive statistically significant correlation with temperature in growing season, but the precipitation effect was low.
-
Carbon density and distribution of six Chinese temperate forests
Institute of Scientific and Technical Information of China (English)
无
2010-01-01
Quantifying forest carbon(C) storage and distribution is important for forest C cycling studies and terrestrial ecosystem modeling.Forest inventory and allometric approaches were used to measure C density and allocation in six representative temperate forests of similar stand age(42-59 years old) and growing under the same climate in northeastern China.The forests were an aspen-birch forest,a hardwood forest,a Korean pine plantation,a Dahurian larch plantation,a mixed deciduous forest,and a Mongolian oak forest.There were no significant differences in the C densities of ecosystem components(except for detritus) although the six forests had varying vegetation compositions and site conditions.However,the differences were significant when the C pools were normalized against stand basal area.The total ecosystem C density varied from 186.9 tC hm-2 to 349.2 tC hm-2 across the forests.The C densities of vegetation,detritus,and soil ranged from 86.3-122.7 tC hm-2,6.5-10.5 tC hm-2,and 93.7-220.1 tC hm-2,respectively,which accounted for 39.7% ± 7.1%(mean ± SD),3.3% ± 1.1%,and 57.0% ± 7.9% of the total C densities,respectively.The overstory C pool accounted for > 99% of the total vegetation C pool.The foliage biomass,small root(diameter < 5mm) biomass,root-shoot ratio,and small root to foliage biomass ratio varied from 2.08-4.72 tC hm-2,0.95-3.24 tC hm-2,22.0%-28.3%,and 34.5%-122.2%,respectively.The Korean pine plantation had the lowest foliage production efficiency(total biomass/foliage biomass:22.6 g g-1) among the six forests,while the Dahurian larch plantation had the highest small root production efficiency(total biomass/small root biomass:124.7 g g-1).The small root C density decreased with soil depth for all forests except for the Mongolian oak forest,in which the small roots tended to be vertically distributed downwards.The C density of coarse woody debris was significantly less in the two plantations than in the four naturally regenerated forests.The variability
-
Wang, L.; Ibrom, A.; Korhonen, J. F. J.; Arnoud Frumau, K. F.; Wu, J.; Pihlatie, M.; Schjoerring, J. K.
2012-07-01
Seasonal and spatial variations in foliar nitrogen (N) parameters were investigated in three European forests with different tree species, viz. beech (Fagus sylvatica L.), Douglas fir (Pseudotsuga menziesii, Mirb., Franco) and Scots pine (Pinus sylvestris L.) in Denmark, The Netherlands and Finland, respectively. This was done in order to obtain information about functional acclimation, tree internal N conservation and its relevance for both ecosystem internal N cycling and foliar N exchange with the atmosphere. Leaf N pools generally showed much higher seasonal variability in beech trees than in the coniferous canopies. The concentrations of N and chlorophyll in the beech leaves were synchronized with the seasonal course of solar radiation implying close physiological acclimation, which was not observed in the coniferous needles. During phases of intensive N metabolism in the beech leaves, the NH4+ concentration rose considerably. This was compensated for by a strong pH decrease resulting in relatively low Γ values (ratio between tissue NH4+ and H+). The Γ values in the coniferous were even smaller than in beech, indicating low probability of NH3 emissions from the foliage to the atmosphere as an N conserving mechanism. The reduction in foliage N content during senescence was interpreted as N re-translocation from the senescing leaves into the rest of the trees. The N re-translocation efficiency (ηr) ranged from 37 to 70% and decreased with the time necessary for full renewal of the canopy foliage. Comparison with literature data from in total 23 tree species showed a general tendency for ηr to on average be reduced by 8% per year the canopy stays longer, i.e. with each additional year it takes for canopy renewal. The boreal pine site returned the lowest amount of N via foliage litter to the soil, while the temperate Douglas fir stand which had the largest peak canopy N content and the lowestηr returned the highest amount of N to the soil. These results
-
Directory of Open Access Journals (Sweden)
L. Wang
2013-02-01
Full Text Available Seasonal and spatial variations in foliar nitrogen (N parameters were investigated in three European forests with different tree species, viz. beech (Fagus sylvatica L., Douglas fir (Pseudotsuga menziesii (Mirb. Franco and Scots pine (Pinus sylvestris L. growing in Denmark, the Netherlands and Finland, respectively. The objectives were to investigate the distribution of N pools within the canopies of the different forests and to relate this distribution to factors and plant strategies controlling leaf development throughout the seasonal course of a vegetation period. Leaf N pools generally showed much higher seasonal and vertical variability in beech than in the coniferous canopies. However, also the two coniferous tree species behaved very differently with respect to peak summer canopy N content and N re-translocation efficiency, showing that generalisations on tree internal vs. ecosystem internal N cycling cannot be made on the basis of the leaf duration alone. During phases of intensive N turnover in spring and autumn, the NH4+ concentration in beech leaves rose considerably, while fully developed green beech leaves had relatively low tissue NH4+, similar to the steadily low levels in Douglas fir and, particularly, in Scots pine. The ratio between bulk foliar concentrations of NH4+ and H+, which is an indicator of the NH3 emission potential, reflected differences in foliage N concentration, with beech having the highest values followed by Douglas fir and Scots pine. Irrespectively of the leaf habit, i.e. deciduous versus evergreen, the majority of the canopy foliage N was retained within the trees. This was accomplished through an effective N re-translocation (beech, higher foliage longevity (fir or both (boreal pine forest. In combination with data from a literature review, a general relationship of decreasing N re
-
Effects of silviculture on neotropical migratory birds in central and southeastern oak pine forests
James G. Dickson; Frank R. Thompson; Richard N. Conner; Kathleen E. Franzreb
1993-01-01
Avian communities that are associated with forest habitat attributes are affected by silvicultural and other stand influences. Some species have specific habitat requirements, whereas others occupy a broad range of vegetative conditions. In general, bird species richness and density are positively related to stand foliage volume and diversity. Bird density and...
-
Effects of elevated CO2 leaf diet on gypsy moth (Lepidoptera: Lymantriidae) respiration rates
Anita R. Foss; William J. Mattson; Terry M. Trier
2013-01-01
Elevated levels of CO2 affect plant growth and leaf chemistry, which in turn can alter host plant suitability for insect herbivores. We examined the suitability of foliage from trees grown from seedlings since 1997 at Aspen FACE as diet for the gypsy moth (Lymantria dispar L.) Lepidoptera: Lymantriidae: paper birch (...
-
Descriptive statistics of tree crown condition in the Northeastern United States
KaDonna C. Randolph; Randall S. Morin; Jim Steinman
2010-01-01
The U.S. Forest Service Forest Inventory and Analysis (FIA) Program uses visual assessments of tree crown condition to monitor changes and trends in forest health. This report describes four crown condition indicators (crown dieback, crown density, foliage transparency, and sapling crown vigor) measured in Connecticut, Delaware, Maine, Maryland, Massachusetts, New...
-
Comparison of Monterey pine stress in urban and natural forests
David J. Nowak; Joe R. McBride
1991-01-01
Monterey pine street trees within Carmel, California and its immediate vicinity, as well as forest-grown Monterey pine within adjacent natural stands, were sampled with regard to visual stress characteristics, and various environmental and biological variables. Two stress indices were computed, one hypothesized before data collection was based on relative foliage...