WorldWideScience

Sample records for semaphorin 3e sema3e

  1. Infantile hemangioma-derived stem cells and endothelial cells are inhibited by class 3 semaphorins

    International Nuclear Information System (INIS)

    Nakayama, Hironao; Huang, Lan; Kelly, Ryan P.; Oudenaarden, Clara R.L.; Dagher, Adelle; Hofmann, Nicole A.; Moses, Marsha A.; Bischoff, Joyce; Klagsbrun, Michael

    2015-01-01

    Class 3 semaphorins were discovered as a family of axon guidance molecules, but are now known to be involved in diverse biologic processes. In this study, we investigated the anti-angiogenic potential of SEMA3E and SEMA3F (SEMA3E&F) in infantile hemangioma (IH). IH is a common vascular tumor that involves both vasculogenesis and angiogenesis. Our lab has identified and isolated hemangioma stem cells (HemSC), glucose transporter 1 positive (GLUT1 + ) endothelial cells (designated as GLUT1 sel cells) based on anti-GLUT1 magnetic beads selection and GLUT1-negative endothelial cells (named HemEC). We have shown that these types of cells play important roles in hemangiogenesis. We report here that SEMA3E inhibited HemEC migration and proliferation while SEMA3F was able to suppress the migration and proliferation in all three types of cells. Confocal microscopy showed that stress fibers in HemEC were reduced by SEMA3E&F and that stress fibers in HemSC were decreased by SEMA3F, which led to cytoskeletal collapse and loss of cell motility in both cell types. Additionally, SEMA3E&F were able to inhibit vascular endothelial growth factor (VEGF)-induced sprouts in all three types of cells. Further, SEMA3E&F reduced the level of p-VEGFR2 and its downstream p-ERK in HemEC. These results demonstrate that SEMA3E&F inhibit IH cell proliferation and suppress the angiogenic activities of migration and sprout formation. SEMA3E&F may have therapeutic potential to treat or prevent growth of highly proliferative IH. - Highlights: • SEMA3E&F reduce actin stress fibers and induce cytoskeletal collapse in HemEC. • SEMA3E&F inhibit angiogenic activities of HemEC. • SEMA3E&F can interrupt the VEGF-A-VEGFR2-ERK signaling pathway in HemEC. • Plexin D1 and NRP2 are induced during HemSC/GLUT1 sel -to-EC differentiation

  2. Infantile hemangioma-derived stem cells and endothelial cells are inhibited by class 3 semaphorins

    Energy Technology Data Exchange (ETDEWEB)

    Nakayama, Hironao [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Surgery, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Division of Cell Growth and Tumor Regulation, Proteo-Science Center, Ehime University, Toon, Ehime 791-0295 (Japan); Huang, Lan [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Surgery, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Kelly, Ryan P.; Oudenaarden, Clara R.L. [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Dagher, Adelle; Hofmann, Nicole A.; Moses, Marsha A. [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Surgery, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Bischoff, Joyce, E-mail: joyce.bischoff@childrens.harvard.edu [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Surgery, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Klagsbrun, Michael, E-mail: michael.klagsbrun@childrens.harvard.edu [Vascular Biology Program, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Surgery, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States); Department of Pathology, Boston Children' s Hospital, Harvard Medical School, Boston, MA 02115 (United States)

    2015-08-14

    Class 3 semaphorins were discovered as a family of axon guidance molecules, but are now known to be involved in diverse biologic processes. In this study, we investigated the anti-angiogenic potential of SEMA3E and SEMA3F (SEMA3E&F) in infantile hemangioma (IH). IH is a common vascular tumor that involves both vasculogenesis and angiogenesis. Our lab has identified and isolated hemangioma stem cells (HemSC), glucose transporter 1 positive (GLUT1{sup +}) endothelial cells (designated as GLUT1{sup sel} cells) based on anti-GLUT1 magnetic beads selection and GLUT1-negative endothelial cells (named HemEC). We have shown that these types of cells play important roles in hemangiogenesis. We report here that SEMA3E inhibited HemEC migration and proliferation while SEMA3F was able to suppress the migration and proliferation in all three types of cells. Confocal microscopy showed that stress fibers in HemEC were reduced by SEMA3E&F and that stress fibers in HemSC were decreased by SEMA3F, which led to cytoskeletal collapse and loss of cell motility in both cell types. Additionally, SEMA3E&F were able to inhibit vascular endothelial growth factor (VEGF)-induced sprouts in all three types of cells. Further, SEMA3E&F reduced the level of p-VEGFR2 and its downstream p-ERK in HemEC. These results demonstrate that SEMA3E&F inhibit IH cell proliferation and suppress the angiogenic activities of migration and sprout formation. SEMA3E&F may have therapeutic potential to treat or prevent growth of highly proliferative IH. - Highlights: • SEMA3E&F reduce actin stress fibers and induce cytoskeletal collapse in HemEC. • SEMA3E&F inhibit angiogenic activities of HemEC. • SEMA3E&F can interrupt the VEGF-A-VEGFR2-ERK signaling pathway in HemEC. • Plexin D1 and NRP2 are induced during HemSC/GLUT1{sup sel}-to-EC differentiation.

  3. Changes in expression of Class 3 Semaphorins and their receptors during development of the rat retina and superior colliculus.

    Science.gov (United States)

    Sharma, Anil; LeVaillant, Chrisna J; Plant, Giles W; Harvey, Alan R

    2014-07-26

    Members of the Semaphorin 3 family (Sema3s) influence the development of the central nervous system, and some are implicated in regulating aspects of visual system development. However, we lack information about the timing of expression of the Sema3s with respect to different developmental epochs in the mammalian visual system. In this time-course study in the rat, we document for the first time changes in the expression of RNAs for the majority of Class 3 Semaphorins (Sema3s) and their receptor components during the development of the rat retina and superior colliculus (SC). During retinal development, transcript levels changed for all of the Sema3s examined, as well as Nrp2, Plxna2, Plxna3, and Plxna4a. In the SC there were also changes in transcript levels for all Sema3s tested, as well as Nrp1, Nrp2, Plxna1, Plxna2, Plxna3, and Plxna4a. These changes correlate with well-established epochs, and our data suggest that the Sema3s could influence retinal ganglion cell (RGC) apoptosis, patterning and connectivity in the maturing retina and SC, and perhaps guidance of RGC and cortical axons in the SC. Functionally we found that SEMA3A, SEMA3C, SEMA3E, and SEMA3F proteins collapsed purified postnatal day 1 RGC growth cones in vitro. Significantly this is a developmental stage when RGCs are growing into and within the SC and are exposed to Sema3 ligands. These new data describing the overall temporal regulation of Sema3 expression in the rat retina and SC provide a platform for further work characterising the functional impact of these proteins on the development and maturation of mammalian visual pathways.

  4. Differential endothelial transcriptomics identifies semaphorin 3G as a vascular class 3 semaphorin.

    Science.gov (United States)

    Kutschera, Simone; Weber, Holger; Weick, Anja; De Smet, Frederik; Genove, Guillem; Takemoto, Minoru; Prahst, Claudia; Riedel, Maria; Mikelis, Constantinos; Baulande, Sylvain; Champseix, Catherine; Kummerer, Petra; Conseiller, Emmanuel; Multon, Marie-Christine; Heroult, Melanie; Bicknell, Roy; Carmeliet, Peter; Betsholtz, Christer; Augustin, Hellmut G

    2011-01-01

    To characterize the role of a vascular-expressed class 3 semaphorin (semaphorin 3G [Sema3G]). Semaphorins have been identified as axon guidance molecules. Yet, they have more recently also been characterized as attractive and repulsive regulators of angiogenesis. Through a transcriptomic screen, we identified Sema3G as a molecule of angiogenic endothelial cells. Sema3G-deficient mice are viable and exhibit no overt vascular phenotype. Yet, LacZ expression in the Sema3G locus revealed intense arterial vascular staining in the angiogenic vasculature, starting at E9.5, which was detectable throughout adolescence and downregulated in adult vasculature. Sema3G is expressed as a full-length 100-kDa secreted molecule that is processed by furin proteases to yield 95- and a 65-kDa Sema domain-containing subunits. Full-length Sema3G binds to NP2, whereas processed Sema3G binds to NP1 and NP2. Expression profiling and cellular experiments identified autocrine effects of Sema3G on endothelial cells and paracrine effects on smooth muscle cells. Although the mouse knockout phenotype suggests compensatory mechanisms, the experiments identify Sema3G as a primarily endothelial cell-expressed class 3 semaphorin that controls endothelial and smooth muscle cell functions in autocrine and paracrine manners, respectively.

  5. Semaphorin 3A: A Potential Target for Low Back Pain.

    Science.gov (United States)

    Yin, Pengbin; Lv, Houchen; Zhang, Lihai; Zhang, Licheng; Tang, Peifu

    2015-01-01

    Low back pain is a common disorder. Pathological innervation and intervertebral disc degeneration are two major factors associated with this disease. Semaphorin 3A, originally known for its potent inhibiting effect on axonal outgrowth, is recently found to correlate with disease activity and histological features in some skeletal disorders. Based on its effects on innervation and vascularization, as well as enzyme secretion, we presume that semaphorin 3A may act as a potential target for low back pain.

  6. Semaphorin 3A, A Potential Target for Low Back Pain.

    Directory of Open Access Journals (Sweden)

    Pengbin eYin

    2015-11-01

    Full Text Available Low back pain is a common disorder. Pathological innervation and intervertebral disc degeneration are two major factors associated with this disease. Semaphorin 3A, originally known for its potent inhibiting effect on axonal outgrowth, is recently found to correlate with disease activity and histological features in some skeletal disorders. Based on its effects on innervation and vascularization, as well as enzyme secretion, we presume that semaphorin 3A may act as a potential target for low back pain.

  7. Prostate cancer cells induce osteoblastic differentiation via semaphorin 3A.

    Science.gov (United States)

    Liu, Fuzhou; Shen, Weiwei; Qiu, Hao; Hu, Xu; Zhang, Chao; Chu, Tongwei

    2015-03-01

    Prostate cancer metastasis to bone is the second most commonly diagnosed malignant disease among men worldwide. Such metastatic disease is characterized by the presence of osteoblastic bone lesions, and is associated with high rates of mortality. However, the various mechanisms involved in prostate cancer-induced osteoblastic differentiation have not been fully explored. Semaphorin 3A (Sema 3A) is a newly identified regulator of bone metabolism which stimulates differentiation of pre-osteoblastic cells under physiological conditions. We investigated in this study whether prostate cancer cells can mediate osteoblastic activity through Sema 3A. We cultured osteoprogenitor MC3T3-E1 cells in prostate cancer-conditioned medium, and analyzed levels of Sema 3A protein in diverse prostate cancer cell lines to identify cell lines in which Sema 3A production showed a positive correlation with osteo-stimulation. C4-2 cells were stably transfected with Sema 3A short hairpin RNA to further determine whether Sema 3A contributes to the ability of C4-2 cells to induce osteoblastic differentiation. Down-regulation of Sema 3A expression decreased indicators of C4-2 CM-induced osteoblastic differentiation, including alkaline phosphatase production and mineralization. Additionally, silencing or neutralizing Sema 3A in C4-2 cells resulted in diminished β-catenin expression in osteogenitor MC3T3-E1 cells. Our results suggest that prostate cancer-induced osteoblastic differentiation is at least partially mediated by Sema 3A, and may be regulated by the β-catenin signalling pathway. Sema 3A may represent a novel target for treatment of prostate cancer-induced osteoblastic lesions. © 2014 Wiley Periodicals, Inc.

  8. Vesicular trafficking of semaphorin 3A is activity-dependent and differs between axons and dendrites

    NARCIS (Netherlands)

    de Wit, Joris; Toonen, Ruud F; Verhaagen, J.; Verhage, Matthijs

    Secreted semaphorins act as guidance cues in the developing nervous system and may have additional functions in mature neurons. How semaphorins are transported and secreted by neurons is poorly understood. We find that endogenous semaphorin 3A (Sema3A) displays a punctate distribution in axons and

  9. Reduced Sympathetic Innervation in Endometriosis is Associated to Semaphorin 3C and 3F Expression.

    Science.gov (United States)

    Scheerer, Claudia; Frangini, Sergio; Chiantera, Vito; Mechsner, Sylvia

    2017-09-01

    Endometriosis is a chronic inflammatory disease and one of the most common causes of pelvic pain. The mechanisms underlying pain emergence or chronic inflammation during endometriosis remain unknown. Several chronic inflammatory diseases including endometriosis show reduced amounts of noradrenergic nerve fibers. The source of the affected innervation is still unclear. Semaphorins represent potential elicitors, due to their known role as axonal guidance cues, and are suggested as nerve repellent factors in different chronic inflammatory diseases. Therefore, semaphorins might influence the progress of neuroinflammatory mechanisms during endometriosis. Here, we analyzed the noradrenergic innervation and the expression of the specific semaphorins and receptors possibly involved in the neuroimmunomodulation in endometriosis. Our studies revealed an affected innervation and a significant increase of semaphorins and their receptors in peritoneal endometriotic tissue. Thereby, the expression of the receptors was identified on the membrane of noradrenergic nerve fibers and vessels. Macrophages and activated fibroblasts were found in higher density levels and additionally express semaphorins in peritoneal endometriotic tissue. Inflammation leads to an increased release of immune cells, which secrete a variety of inflammatory factors capable of affecting innervation. Therefore, our data suggests that the chronic inflammatory condition in endometriosis might contribute to the increase of semaphorins, which could possibly affect the innervation in peritoneal endometriosis.

  10. The Role Of Semaphorin 3A In The Skeletal System.

    Science.gov (United States)

    Tang, Peifu; Yin, Pengbin; Lv, Houchen; Zhang, Licheng; Zhang, Lihai

    2015-01-01

    Semaphorin 3A (Sema3A), characterized by a conserved N-terminal "Sema" domain, was originally described as an axon guidance molecule. Recent research indicates that it performs a critical function in the skeletal system. This review highlights recent advances in understanding of the role of Sema3A in the skeletal system as a regulator of bone metabolism and as a potential drug target for bone disease therapy. We summarize Sema3A functions in osteoblastogenesis and osteoclastogenesis, as well as in innervation, and we discuss its multifunctional role in various bone diseases such as osteoporosis and low back pain. Despite limited research in this field, our aim is to promote further understanding of the function of Sema3A in the skeletal system.

  11. Semaphorin-Plexin Signaling Controls Mitotic Spindle Orientation during Epithelial Morphogenesis and Repair

    DEFF Research Database (Denmark)

    Xia, Jingjing; Swiercz, Jakub M.; Bañón-Rodríguez, Inmaculada

    2015-01-01

    Morphogenesis, homeostasis, and regeneration of epithelial tissues rely on the accurate orientation of cell divisions, which is specified by the mitotic spindle axis. To remain in the epithelial plane, symmetrically dividing epithelial cells align their mitotic spindle axis with the plane. Here, we...... show that this alignment depends on epithelial cell-cell communication via semaphorin-plexin signaling. During kidney morphogenesis and repair, renal tubular epithelial cells lacking the transmembrane receptor Plexin-B2 or its semaphorin ligands fail to correctly orient the mitotic spindle, leading...... to severe defects in epithelial architecture and function. Analyses of a series of transgenic and knockout mice indicate that Plexin-B2 controls the cell division axis by signaling through its GTPase-activating protein (GAP) domain and Cdc42. Our data uncover semaphorin-plexin signaling as a central...

  12. Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Heli; Juo, Z. Sean; Shim, Ann Hye-Ryong; Focia, Pamela J.; Chen, Xiaoyan; Garcia, K. Christopher; He, Xiaolin (Stanford-MED); (NWU)

    2010-10-18

    Repulsive signaling by Semaphorins and Plexins is crucial for the development and homeostasis of the nervous, immune, and cardiovascular systems. Sema7A acts as both an immune and a neural Semaphorin through PlexinC1, and A39R is a Sema7A mimic secreted by smallpox virus. We report the structures of Sema7A and A39R complexed with the Semaphorin-binding module of PlexinC1. Both structures show two PlexinC1 molecules symmetrically bridged by Semaphorin dimers, in which the Semaphorin and PlexinC1 {beta} propellers interact in an edge-on, orthogonal orientation. Both binding interfaces are dominated by the insertion of the Semaphorin's 4c-4d loop into a deep groove in blade 3 of the PlexinC1 propeller. A39R appears to achieve Sema7A mimicry by preserving key Plexin-binding determinants seen in the mammalian Sema7A complex that have evolved to achieve higher affinity binding to the host-derived PlexinC1. The complex structures support a conserved Semaphorin-Plexin recognition mode and suggest that Plexins are activated by dimerization.

  13. Urinary semaphorin 3A correlates with diabetic proteinuria and mediates diabetic nephropathy and associated inflammation in mice

    NARCIS (Netherlands)

    Mohamed, Riyaz; Ranganathan, Punithavathi; Jayakumar, Calpurnia; Nauta, Ferdau L.; Gansevoort, Ron T.; Weintraub, Neal L.; Brands, Michael; Ramesh, Ganesan

    2014-01-01

    Semaphorin 3A (sema3A) was recently identified as an early diagnostic biomarker of acute kidney injury. However, its role as a biomarker and/or mediator of chronic kidney disease (CKD) related to diabetic nephropathy is unknown. We examined the expression of sema3A in diabetic animal models and in

  14. Anatomy of rat semaphorin III/collapsin-1 mRNA expression and relationship to developing nerve tracts during neuroembryogenesis

    NARCIS (Netherlands)

    Giger, Roman J; Wolfer, D P; De Wit, G M; Verhaagen, J

    1996-01-01

    Semaphorin III/collapsin-1 (semaIII/coll-1) is a chemorepellent that exhibits a repulsive effect on growth cones of dorsal root ganglion neurons. To identify structures that express semaIII/coll-1 in developing mammals, we cloned the rat homologue and performed in situ hybridization on embryonic,

  15. Cdc42 and RhoA reveal different spatio-temporal dynamics upon local stimulation with Semaphorin-3A

    Directory of Open Access Journals (Sweden)

    Federico eIseppon

    2015-08-01

    Full Text Available Small RhoGTPases, such as Cdc42 and RhoA, are key players in integrating external cues and intracellular signaling pathways that regulate growth cone (GC motility. Indeed, Cdc42 is involved in actin polymerization and filopodia formation, whereas RhoA induces GC collapse and neurite retraction through actomyosin contraction. In this study we employed Förster Resonance Energy Transfer (FRET microscopy to study the spatio-temporal dynamics of Cdc42 and RhoA in GCs in response to local Semaphorin-3A stimulation obtained with lipid vesicles filled with Semaphorin-3A and positioned near the selected GC using optical tweezers. We found that Cdc42 and RhoA were activated at the leading edge of NG108-15 neuroblastoma cells during spontaneous cycles of protrusion and retraction, respectively. The release of Semaphorin-3A brought to a progressive activation of RhoA within 30 seconds from the stimulus in the central region of the GC that collapsed and retracted. In contrast, the same stimulation evoked waves of Cdc42 activation propagating away from the stimulated region. A more localized stimulation obtained with Sema3A coated beads placed on the GC, led to Cdc42 active waves that propagated in a retrograde manner with a mean period of 70 seconds, and followed by GC retraction. Therefore, Semaphorin-3A activates both Cdc42 and RhoA with a complex and different spatial-temporal dynamics.

  16. Semaphorin 3 C drives epithelial-to-mesenchymal transition, invasiveness, and stem-like characteristics in prostate cells.

    Science.gov (United States)

    Tam, Kevin J; Hui, Daniel H F; Lee, Wilson W; Dong, Mingshu; Tombe, Tabitha; Jiao, Ivy Z F; Khosravi, Shahram; Takeuchi, Ario; Peacock, James W; Ivanova, Larissa; Moskalev, Igor; Gleave, Martin E; Buttyan, Ralph; Cox, Michael E; Ong, Christopher J

    2017-09-13

    Prostate cancer (PCa) is among the most commonly-occurring cancers worldwide and a leader in cancer-related deaths. Local non-invasive PCa is highly treatable but limited treatment options exist for those with locally-advanced and metastatic forms of the disease underscoring the need to identify mechanisms mediating PCa progression. The semaphorins are a large grouping of membrane-associated or secreted signalling proteins whose normal roles reside in embryogenesis and neuronal development. In this context, semaphorins help establish chemotactic gradients and direct cell movement. Various semaphorin family members have been found to be up- and down-regulated in a number of cancers. One family member, Semaphorin 3 C (SEMA3C), has been implicated in prostate, breast, ovarian, gastric, lung, and pancreatic cancer as well as glioblastoma. Given SEMA3C's roles in development and its augmented expression in PCa, we hypothesized that SEMA3C promotes epithelial-to-mesenchymal transition (EMT) and stem-like phenotypes in prostate cells. In the present study we show that ectopic expression of SEMA3C in RWPE-1 promotes the upregulation of EMT and stem markers, heightened sphere-formation, and cell plasticity. In addition, we show that SEMA3C promotes migration and invasion in vitro and cell dissemination in vivo.

  17. A novel podocyte gene, semaphorin 3G, protects glomerular podocyte from lipopolysaccharide-induced inflammation.

    Science.gov (United States)

    Ishibashi, Ryoichi; Takemoto, Minoru; Akimoto, Yoshihiro; Ishikawa, Takahiro; He, Peng; Maezawa, Yoshiro; Sakamoto, Kenichi; Tsurutani, Yuya; Ide, Shintaro; Ide, Kana; Kawamura, Harukiyo; Kobayashi, Kazuki; Tokuyama, Hirotake; Tryggvason, Karl; Betsholtz, Christer; Yokote, Koutaro

    2016-05-16

    Kidney diseases including diabetic nephropathy have become huge medical problems, although its precise mechanisms are still far from understood. In order to increase our knowledge about the patho-physiology of kidney, we have previously identified >300 kidney glomerulus-enriched transcripts through large-scale sequencing and microarray profiling of the mouse glomerular transcriptome. One of the glomerulus-specific transcripts identified was semaphorin 3G (Sema3G) which belongs to the semaphorin family. The aim of this study was to analyze both the in vivo and in vitro functions of Sema3G in the kidney. Sema3G was expressed in glomerular podocytes. Although Sema3G knockout mice did not show obvious glomerular defects, ultrastructural analyses revealed partially aberrant podocyte foot processes structures. When these mice were injected with lipopolysaccharide to induce acute inflammation or streptozotocin to induce diabetes, the lack of Sema3G resulted in increased albuminuria. The lack of Sema3G in podocytes also enhanced the expression of inflammatory cytokines including chemokine ligand 2 and interleukin 6. On the other hand, the presence of Sema3G attenuated their expression through the inhibition of lipopolysaccharide-induced Toll like receptor 4 signaling. Taken together, our results surmise that the Sema3G protein is secreted by podocytes and protects podocytes from inflammatory kidney diseases and diabetic nephropathy.

  18. Varicose and cheerio collaborate with pebble to mediate semaphorin-1a reverse signaling in Drosophila.

    Science.gov (United States)

    Jeong, Sangyun; Yang, Da-Som; Hong, Young Gi; Mitchell, Sarah P; Brown, Matthew P; Kolodkin, Alex L

    2017-09-26

    The transmembrane semaphorin Sema-1a acts as both a ligand and a receptor to regulate axon-axon repulsion during neural development. Pebble (Pbl), a Rho guanine nucleotide exchange factor, mediates Sema-1a reverse signaling through association with the N-terminal region of the Sema-1a intracellular domain (ICD), resulting in cytoskeletal reorganization. Here, we uncover two additional Sema-1a interacting proteins, varicose (Vari) and cheerio (Cher), each with neuronal functions required for motor axon pathfinding. Vari is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins, members of which can serve as scaffolds to organize signaling complexes. Cher is related to actin filament cross-linking proteins that regulate actin cytoskeleton dynamics. The PDZ domain binding motif found in the most C-terminal region of the Sema-1a ICD is necessary for interaction with Vari, but not Cher, indicative of distinct binding modalities. Pbl/Sema-1a-mediated repulsive guidance is potentiated by both vari and cher Genetic analyses further suggest that scaffolding functions of Vari and Cher play an important role in Pbl-mediated Sema-1a reverse signaling. These results define intracellular components critical for signal transduction from the Sema-1a receptor to the cytoskeleton and provide insight into mechanisms underlying semaphorin-induced localized changes in cytoskeletal organization.

  19. The axonal guidance cue semaphorin 3C contributes to alveolar growth and repair.

    Directory of Open Access Journals (Sweden)

    Arul Vadivel

    Full Text Available Lung diseases characterized by alveolar damage such as bronchopulmonary dysplasia (BPD in premature infants and emphysema lack efficient treatments. Understanding the mechanisms contributing to normal and impaired alveolar growth and repair may identify new therapeutic targets for these lung diseases. Axonal guidance cues are molecules that guide the outgrowth of axons. Amongst these axonal guidance cues, members of the Semaphorin family, in particular Semaphorin 3C (Sema3C, contribute to early lung branching morphogenesis. The role of Sema3C during alveolar growth and repair is unknown. We hypothesized that Sema3C promotes alveolar development and repair. In vivo Sema3C knock down using intranasal siRNA during the postnatal stage of alveolar development in rats caused significant air space enlargement reminiscent of BPD. Sema3C knock down was associated with increased TLR3 expression and lung inflammatory cells influx. In a model of O2-induced arrested alveolar growth in newborn rats mimicking BPD, air space enlargement was associated with decreased lung Sema3C mRNA expression. In vitro, Sema3C treatment preserved alveolar epithelial cell viability in hyperoxia and accelerated alveolar epithelial cell wound healing. Sema3C preserved lung microvascular endothelial cell vascular network formation in vitro under hyperoxic conditions. In vivo, Sema3C treatment of hyperoxic rats decreased lung neutrophil influx and preserved alveolar and lung vascular growth. Sema3C also preserved lung plexinA2 and Sema3C expression, alveolar epithelial cell proliferation and decreased lung apoptosis. In conclusion, the axonal guidance cue Sema3C promotes normal alveolar growth and may be worthwhile further investigating as a potential therapeutic target for lung repair.

  20. Semaphorin6A acts as a gate keeper between the central and the peripheral nervous system

    Directory of Open Access Journals (Sweden)

    Sadhu Rejina

    2007-12-01

    Full Text Available Abstract Background During spinal cord development, expression of chicken SEMAPHORIN6A (SEMA6A is almost exclusively found in the boundary caps at the ventral motor axon exit point and at the dorsal root entry site. The boundary cap cells are derived from a population of late migrating neural crest cells. They form a transient structure at the transition zone between the peripheral nervous system (PNS and the central nervous system (CNS. Ablation of the boundary cap resulted in emigration of motoneurons from the ventral spinal cord along the ventral roots. Based on its very restricted expression in boundary cap cells, we tested for a role of Sema6A as a gate keeper between the CNS and the PNS. Results Downregulation of Sema6A in boundary cap cells by in ovo RNA interference resulted in motoneurons streaming out of the spinal cord along the ventral roots, and in the failure of dorsal roots to form and segregate properly. PlexinAs interact with class 6 semaphorins and are expressed by both motoneurons and sensory neurons. Knockdown of PlexinA1 reproduced the phenotype seen after loss of Sema6A function both at the ventral motor exit point and at the dorsal root entry site of the lumbosacral spinal cord. Loss of either PlexinA4 or Sema6D function had an effect only at the dorsal root entry site but not at the ventral motor axon exit point. Conclusion Sema6A acts as a gate keeper between the PNS and the CNS both ventrally and dorsally. It is required for the clustering of boundary cap cells at the PNS/CNS interface and, thus, prevents motoneurons from streaming out of the ventral spinal cord. At the dorsal root entry site it organizes the segregation of dorsal roots.

  1. Netrin-1 and semaphorin 3A predict the development of acute kidney injury in liver transplant patients.

    Directory of Open Access Journals (Sweden)

    Lidia Lewandowska

    Full Text Available Acute kidney injury (AKI is a serious complication after liver transplantation. Currently there are no validated biomarkers available for early diagnosis of AKI. The current study was carried out to determine the usefulness of the recently identified biomarkers netrin-1 and semaphorin 3A in predicting AKI in liver transplant patients. A total of 63 patients' samples were collected and analyzed. AKI was detected at 48 hours after liver transplantation using serum creatinine as a marker. In contrast, urine netrin-1 (897.8 ± 112.4 pg/mg creatinine, semaphorin 3A (847.9 ± 93.3 pg/mg creatinine and NGAL (2172.2 ± 378.1 ng/mg creatinine levels were increased significantly and peaked at 2 hours after liver transplantation but were no longer significantly elevated at 6 hours after transplantation. The predictive power of netrin-1, as demonstrated by the area under the receiver-operating characteristic curve for diagnosis of AKI at 2, 6, and 24 hours after liver transplantation was 0.66, 0.57 and 0.59, respectively. The area under the curve for diagnosis of AKI was 0.63 and 0.65 for semaphorin 3A and NGAL at 2 hr respectively. Combined analysis of two or more biomarkers for simultaneous occurrence in urine did not improve the AUC for the prediction of AKI whereas the AUC was improved significantly (0.732 only when at least 1 of the 3 biomarkers in urine was positive for predicting AKI. Adjusting for BMI, all three biomarkers at 2 hours remained independent predictors of AKI with an odds ratio of 1.003 (95% confidence interval: 1.000 to 1.006; P = 0.0364. These studies demonstrate that semaphorin 3A and netrin-1 can be useful early diagnostic biomarkers of AKI after liver transplantation.

  2. Semaphorin7A and its receptors: pleiotropic regulators of immune cell function, bone homeostasis, and neural development.

    Science.gov (United States)

    Jongbloets, Bart C; Ramakers, Geert M J; Pasterkamp, R Jeroen

    2013-03-01

    Semaphorins form a large, evolutionary conserved family of cellular guidance signals. The semaphorin family contains several secreted and transmembrane proteins, but only one GPI-anchored member, Semaphorin7A (Sema7A). Although originally identified in immune cells, as CDw108, Sema7A displays widespread expression outside the immune system. It is therefore not surprising that accumulating evidence supports roles for this protein in a wide variety of biological processes in different organ systems and in disease. Well-characterized biological effects of Sema7A include those during bone and immune cell regulation, neuron migration and neurite growth. These effects are mediated by two receptors, plexinC1 and integrins. However, most of what is known today about Sema7A signaling concerns Sema7A-integrin interactions. Here, we review our current knowledge of Sema7A function and signaling in different organ systems, highlighting commonalities between the cellular effects and signaling pathways activated by Sema7A in different cell types. Furthermore, we discuss a potential role for Sema7A in disease and provide directions for further research. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Oxycodone Self-Administration Induces Alterations in Expression of Integrin, Semaphorin and Ephrin Genes in the Mouse Striatum

    Directory of Open Access Journals (Sweden)

    Vadim Yuferov

    2018-06-01

    Full Text Available Oxycodone is one a commonly used medication for pain, and is also a widely abused prescription opioid, like other short-acting MOPr agonists. Neurochemical and structural adaptations in brain following chronic MOPr-agonist administration are thought to underlie pathogenesis and persistence of opiate addiction. Many axon guidance molecules, such as integrins, semaphorins, and ephrins may contribute to oxycodone-induced neuroadaptations through alterations in axon-target connections and synaptogenesis, that may be implicated in the behaviors associated with opiate addiction. However, little is known about this important area. The aim of this study is to investigate alterations in expression of selected integrin, semaphorin, ephrins, netrin, and slit genes in the nucleus accumbens (NAc and caudate putamen (CPu of mice following extended 14-day oxycodone self-administration (SA, using RNAseq.Methods: Total RNA from the NAc and CPu were isolated from adult male C57BL/6J mice within 1 h after the last session of oxycodone in a 14-day self-administration paradigm (4h/day, 0.25 mg/kg/infusion, FR1 or from yoked saline controls. Gene expressions were examined using RNA sequencing (RNA-Seq technology. RNA-Seq libraries were prepared using Illumina's TruSeq® Stranded Total RNA LT kit. The reads were aligned to the mouse reference genome (version mm10 using STAR. DESeq2 was applied to the counts of protein coding genes to estimate the fold change between the treatment groups. False Discovery Rate (FDR q < 0.1 were used to select genes that have a significant expression change. For selection of a subset of genes related to axon guidance pathway, REACTOME was used.Results: Among 38 known genes of the integrin, semaphorin, and ephrin gene families, RNA-seq data revealed up-regulation of six genes in the NAc: heterodimer receptor, integrins Itgal, Itgb2, and Itgam, and its ligand semaphorin Sema7a, two semaphorin receptors, plexins Plxnd1 and Plxdc1. There was

  4. The role of semaphorin 4D as a potential biomarker for antiangiogenic therapy in colorectal cancer

    Directory of Open Access Journals (Sweden)

    Ding X

    2016-03-01

    Full Text Available Xiaojie Ding,1,2,* Lijuan Qiu,1,2,* Lijuan Zhang,3 Juemin Xi,1,2 Duo Li,1,2 Xinwei Huang,1,2 Yujiao Zhao,1,2 Xiaodang Wang,1,2 Qiangming Sun1,2 1Institute of Medical Biology, Chinese Academy of Medical Sciences and Peking Union Medical College, 2Molecular Epidemiology Joint Laboratory, Yunnan Key Laboratory of Vaccine Research & Development on Severe Infectious Diseases, 3Department of Pathology, The Third Affiliated Hospital of Kunming Medical University (Yunnan Provincial Tumor Hospital, Kunming, People’s Republic of China*These authors contributed equally to this workBackground: Semaphorin 4D (Sema4D belongs to the class IV semaphorins, and accumulating evidence has indicated that its elevated level may be one strategy by which tumors evade current antiangiogenic therapies. The biological roles of Sema4D in colorectal cancer (CRC, however, remain largely undefined. This study was designed to investigate the effects of Sema4D on tumor angiogenesis and growth in CRC, especially in different vascular endothelial growth factor (VEGF backgrounds.Methods: The expression of Sema4D in human CRC was evaluated by immunohistochemical analysis of tumors and their matching normal control tissues. The expression level of Sema4D and VEGF was investigated in different CRC cell lines. To evaluate the contributions of Sema4D to tumor-induced angiogenesis, two CRC cell lines with opposite VEGF backgrounds were infected with lentiviruses expressing Sema4D or Sema4D short hairpin RNA, followed by in vitro migration and in vivo tumor angiogenic assays.Results: Immunohistochemical analysis of human CRC revealed high levels of Sema4D in a cell surface pattern. In all, 84.85% of CRC samples analyzed exhibited moderate to strong Sema4D expression. The positive ratios of Sema4D staining for well, moderately, and poorly differentiated cancers were 71.43%, 96.67%, and 77.27%, respectively. Sema4D is highly expressed in five different CRC cell lines, while VEGF

  5. Semaphorin 4D induces vaginal epithelial cell apoptosis to control mouse postnatal vaginal tissue remodeling

    Science.gov (United States)

    ITO, TAKUJI; BAI, TAO; TANAKA, TETSUJI; YOSHIDA, KENJI; UEYAMA, TAKASHI; MIYAJIMA, MASAYASU; NEGISHI, TAKAYUKI; KAWASAKI, TAKAHIKO; TAKAMATSU, HYOTA; KIKUTANI, HITOSHI; KUMANOGOH, ATSUSHI; YUKAWA, KAZUNORI

    2015-01-01

    The opening of the mouse vaginal cavity to the skin is a postnatal tissue remodeling process that occurs at approximately five weeks of age for the completion of female genital tract maturation at puberty. The tissue remodeling process is primarily composed of a hormonally triggered apoptotic process predominantly occurring in the epithelium of the distal section of the vaginal cavity. However, the detailed mechanism underlying the apoptotic induction remains to be elucidated. In the present study, it was observed that the majority of BALB/c mice lacking the class 4 semaphorin, semaphorin 4D (Sema4D), developed imperforate vagina and hydrometrocolpos resulting in a perpetually unopened vaginal cavity regardless of a normal estrogen level comparable with that in wild-type (WT) mice. Administration of β-estradiol to infant Sema4D-deficient (Sema4D−/−) mice did not induce precocious vaginal opening, which was observed in WT mice subjected to the same β-estradiol administration, excluding the possibility that the closed vaginal phenotype was due to insufficient estrogen secretion at the time of vaginal opening. In order to assess the role of Sema4D in the postnatal vaginal tissue remodeling process, the expression of Sema4D and its receptor, plexin-B1, was examined as well as the level of apoptosis in the vaginal epithelia of five-week-old WT and Sema4D−/− mice. Immunohistochemical analyses confirmed the localization of Sema4D and plexin-B1 in the mouse vaginal epithelia. Terminal deoxynucleotidyl transferase dUTP nick end labeling assay and immunohistochemistry detecting activated caspase-3 revealed significantly fewer apoptotic cells in situ in the vaginal mucosa of five-week-old Sema4D−/− mice compared with WT mice. The addition of recombinant Sema4D to Sema4D−/− vaginal epithelial cells in culture significantly enhanced apoptosis of the vaginal epithelial cells, demonstrating the apoptosis-inducing activity of Sema4D. The experimental reduction of

  6. Co-immobilization of semaphorin3A and nerve growth factor to guide and pattern axons.

    Science.gov (United States)

    McCormick, Aleesha M; Jarmusik, Natalie A; Leipzig, Nic D

    2015-12-01

    Immobilization of axon guidance cues offers a powerful tissue regenerative strategy to control the presentation and spatial location of these biomolecules. We use our previously developed immobilization strategy to specifically tether recombinant biotinylated nerve growth factor (bNGF) and biotinylated semaphorin3A (bSema3A) to chitosan films as an outgrowth and guidance platform. DRG neurite length and number for a range of single cues of immobilized bNGF or bSema3A were examined to determine a concentration response. Next single and dual cues of bNGF and bSema3A were immobilized and DRG guidance was assessed in response to a step concentration change from zero. Overall, immobilized groups caused axon extension, retraction and turning depending on the ratio of bNGF and bSema3A immobilized in the encountered region. This response indicated the exquisite sensitivity of DRG axons to both attractive and repulsive tethered cues. bSema3A concentrations of 0.10 and 0.49 ng/mm(2), when co-immobilized with bNGF (at 0.86 and 0.43 ng/mm(2) respectively), caused axons to turn away from the co-immobilized region. Immunocytochemical analysis showed that at these bSema3A concentrations, axons inside the co-immobilized region display microtubule degradation and breakdown of actin filaments. At the lowest bSema3A concentration (0.01 ng/mm(2)) co-immobilized with a higher bNGF concentration (2.16 ng/mm(2)), neurite lengths are shorter in the immobilized area, but bNGF dominates the guidance mechanism as neurites are directed toward the immobilized region. Future applications can pattern these cues in various geometries and gradients in order to better modulate axon guidance in terms of polarity, extension and branching. Nervous system formation and regeneration requires key molecules for guiding the growth cone and nervous system patterning. In vivo these molecules work in conjunction with one another to modulate axon guidance, and often they are tethered to limit spatial

  7. Semaphorin 4D induces vaginal epithelial cell apoptosis to control mouse postnatal vaginal tissue remodeling.

    Science.gov (United States)

    Ito, Takuji; Bai, Tao; Tanaka, Tetsuji; Yoshida, Kenji; Ueyama, Takashi; Miyajima, Masayasu; Negishi, Takayuki; Kawasaki, Takahiko; Takamatsu, Hyota; Kikutani, Hitoshi; Kumanogoh, Atsushi; Yukawa, Kazunori

    2015-02-01

    The opening of the mouse vaginal cavity to the skin is a postnatal tissue remodeling process that occurs at approximately five weeks of age for the completion of female genital tract maturation at puberty. The tissue remodeling process is primarily composed of a hormonally triggered apoptotic process predominantly occurring in the epithelium of the distal section of the vaginal cavity. However, the detailed mechanism underlying the apoptotic induction remains to be elucidated. In the present study, it was observed that the majority of BALB/c mice lacking the class 4 semaphorin, semaphorin 4D (Sema4D), developed imperforate vagina and hydrometrocolpos resulting in a perpetually unopened vaginal cavity regardless of a normal estrogen level comparable with that in wild‑type (WT) mice. Administration of β‑estradiol to infant Sema4D‑deficient (Sema4D‑/‑) mice did not induce precocious vaginal opening, which was observed in WT mice subjected to the same β‑estradiol administration, excluding the possibility that the closed vaginal phenotype was due to insufficient estrogen secretion at the time of vaginal opening. In order to assess the role of Sema4D in the postnatal vaginal tissue remodeling process, the expression of Sema4D and its receptor, plexin‑B1, was examined as well as the level of apoptosis in the vaginal epithelia of five‑week‑old WT and Sema4D‑/‑ mice. Immunohistochemical analyses confirmed the localization of Sema4D and plexin‑B1 in the mouse vaginal epithelia. Terminal deoxynucleotidyl transferase dUTP nick end labeling assay and immunohistochemistry detecting activated caspase‑3 revealed significantly fewer apoptotic cells in situ in the vaginal mucosa of five‑week‑old Sema4D‑/‑ mice compared with WT mice. The addition of recombinant Sema4D to Sema4D‑/‑ vaginal epithelial cells in culture significantly enhanced apoptosis of the vaginal epithelial cells, demonstrating the apoptosis‑inducing activity of Sema4D. The

  8. mTORC1 is a critical mediator of oncogenic Semaphorin3A signaling

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Daisuke; Kawahara, Kohichi; Maeda, Takehiko, E-mail: maeda@nupals.ac.jp

    2016-08-05

    Aberration of signaling pathways by genetic mutations or alterations in the surrounding tissue environments can result in tumor development or metastasis. However, signaling molecules responsible for these processes have not been completely elucidated. Here, we used mouse Lewis lung carcinoma cells (LLC) to explore the mechanism by which the oncogenic activity of Semaphorin3A (Sema3A) signaling is regulated. Sema3A knockdown by shRNA did not affect apoptosis, but decreased cell proliferation in LLCs; both the mammalian target of rapamycin complex 1 (mTORC1) level and glycolytic activity were also decreased. In addition, Sema3A knockdown sensitized cells to inhibition of oxidative phosphorylation by oligomycin, but conferred resistance to decreased cell viability induced by glucose starvation. Furthermore, recombinant SEMA3A rescued the attenuation of cell proliferation and glycolytic activity in LLCs after Sema3A knockdown, whereas mTORC1 inhibition by rapamycin completely counteracted this effect. These results demonstrate that Sema3A signaling exerts its oncogenic effect by promoting an mTORC1-mediated metabolic shift from oxidative phosphorylation to aerobic glycolysis. -- Highlights: •Sema3A knockdown decreased proliferation of Lewis lung carcinoma cells (LLCs). •Sema3A knockdown decreased mTORC1 levels and glycolytic activity in LLCs. •Sema3A knockdown sensitized cells to inhibition of oxidative phosphorylation. •Sema3A promotes shift from oxidative phosphorylation to aerobic glycolysis via mTORC1.

  9. Decreased Expression of Semaphorin3A/Neuropilin-1 Signaling Axis in Apical Periodontitis

    Directory of Open Access Journals (Sweden)

    Ying Lin

    2017-01-01

    Full Text Available Apical periodontitis (AP is a chronic infection of endodontic origin accompanied with bone destruction around the apical region. Semaphorin3A (Sema3A and neuropilin-1 (Nrp1 are regarded as a pair of immune regulators in bone metabolism. In this study, we firstly investigated the expression pattern of Sema3A/Nrp1 in apical periodontitis and its correlation with bone destruction. Using rat animal model, we analysed the level of mandibular bone destruction and the expression of Sema3A/Nrp1 on days 0, 7, 14, 21, 28, and 35 after pulp exposure. In addition, clinical samples from apical periodontitis patients were obtained to analyse the expression of Sema3A/Nrp1. These results indicated that the bone destruction level expanded from days 7 to 35. The number of positive cells and level of mRNA expression of Sema3A/Nrp1 were significantly decreased from days 7 to 35, with a negative correlation with bone destruction. Moreover, expression of Sema3A/Nrp1 in the AP group was reduced compared to the control group of clinical samples. In conclusion, decreased expression of Sema3A/Nrp1 was observed in periapical lesions and is potentially involved in the bone resorption of the periapical area, suggesting that Sema3A/Nrp1 may contribute to the pathological development of apical periodontitis.

  10. Mutation of Semaphorin-6A disrupts limbic and cortical connectivity and models neurodevelopmental psychopathology.

    LENUS (Irish Health Repository)

    2011-01-01

    Psychiatric disorders such as schizophrenia and autism are characterised by cellular disorganisation and dysconnectivity across the brain and can be caused by mutations in genes that control neurodevelopmental processes. To examine how neurodevelopmental defects can affect brain function and behaviour, we have comprehensively investigated the consequences of mutation of one such gene, Semaphorin-6A, on cellular organisation, axonal projection patterns, behaviour and physiology in mice. These analyses reveal a spectrum of widespread but subtle anatomical defects in Sema6A mutants, notably in limbic and cortical cellular organisation, lamination and connectivity. These mutants display concomitant alterations in the electroencephalogram and hyper-exploratory behaviour, which are characteristic of models of psychosis and reversible by the antipsychotic clozapine. They also show altered social interaction and deficits in object recognition and working memory. Mice with mutations in Sema6A or the interacting genes may thus represent a highly informative model for how neurodevelopmental defects can lead to anatomical dysconnectivity, resulting, either directly or through reactive mechanisms, in dysfunction at the level of neuronal networks with associated behavioural phenotypes of relevance to psychiatric disorders. The biological data presented here also make these genes plausible candidates to explain human linkage findings for schizophrenia and autism.

  11. Semaphorin-1a is required for Aedes aegypti embryonic nerve cord development.

    Directory of Open Access Journals (Sweden)

    Morgan Haugen

    Full Text Available Although mosquito genome projects have uncovered orthologues of many known developmental regulatory genes, extremely little is known about mosquito development. In this study, the role of semaphorin-1a (sema1a was investigated during vector mosquito embryonic ventral nerve cord development. Expression of sema1a and the plexin A (plexA receptor are detected in the embryonic ventral nerve cords of Aedes aegypti (dengue vector and Anopheles gambiae (malaria vector, suggesting that Sema1a signaling may regulate mosquito nervous system development. Analysis of sema1a function was investigated through siRNA-mediated knockdown in A. aegypti embryos. Knockdown of sema1a during A. aegypti development results in a number of nerve cord phenotypes, including thinning, breakage, and occasional fusion of the longitudinal connectives, thin or absent commissures, and general distortion of the nerve cord. Although analysis of Drosophila melanogaster sema1a loss-of-function mutants uncovered many similar phenotypes, aspects of the longitudinal phenotypes differed between D. melanogaster and A. aegypti. The results of this investigation suggest that Sema1a is required for development of the insect ventral nerve cord, but that the developmental roles of this guidance molecule have diverged in dipteran insects.

  12. Anti-proliferative effects of gold nanoparticles functionalized with Semaphorin 3F

    Science.gov (United States)

    Tan, Gamze; Onur, Mehmet Ali

    2017-08-01

    The new vessel formations play a vital role in growth and spread of cancer. Current anti-angiogenic therapies, predominantly based on vascular endothelial growth factor (VEGF) inhibition, can inhibit vascular development; however, they are usually ineffective against the primary tumor occurrence. The aim of this study was to assess anti-angiogenic effects of gold nanoparticles (AuNPs) functionalized with Semaphorin (Sema) 3F protein. The polyethylene glycol (PEG)-coated AuNPs were covalently functionalized with Sema 3F and labeled with the TAMRA fluorescent dye. The effect of the NPs on human umbilical vein endothelial cells (HUVECs) is probed in the way of internalization and viability assays. AuNP-Sema 3F bioconjugates showed great endothelial cell uptake. AuNP-Sema 3F bioconjugates reduced VEGF165-induced endothelial cell proliferation more effectively than Sema 3F alone, suggesting that the therapeutic effects of Sema 3F can be improved by conjugation to AuNPs. Also, no significant toxicity effect was induced by bioconjugates. This is the first study that reports a covalent binding of full length Sema 3F to NPs. The exogenously administration of Sema 3F, which has both anti-angiogenic and anti-tumoral activity, to tumor vasculature via a carrying platform may not only lead to more effective anti-angiogenic treatment but also may make current approach more applicable in clinical use like drug delivery system. [Figure not available: see fulltext.

  13. Endothelial Semaphorin 7A promotes inflammation in seawater aspiration-induced acute lung injury.

    Science.gov (United States)

    Zhang, Minlong; Wang, Li; Dong, Mingqing; Li, Zhichao; Jin, Faguang

    2014-10-28

    Inflammation is involved in the pathogenesis of seawater aspiration-induced acute lung injury (ALI). Although several studies have shown that Semaphorin 7A (SEMA7A) promotes inflammation, there are limited reports regarding immunological function of SEMA7A in seawater aspiration-induced ALI. Therefore, we investigated the role of SEMA7A during seawater aspiration-induced ALI. Male Sprague-Dawley rats were underwent seawater instillation. Then, lung samples were collected at an indicated time for analysis. In addition, rat pulmonary microvascular endothelial cells (RPMVECs) were cultured and then stimulated with 25% seawater for indicated time point. After these treatments, cells samples were collected for analysis. In vivo, seawater instillation induced lung histopathologic changes, pro-inflammation cytokines release and increased expression of SEMA7A. In vitro, seawater stimulation led to pro-inflammation cytokine release, cytoskeleton remodeling and increased monolayer permeability in pulmonary microvascular endothelial cells. In addition, knockdown of hypoxia-inducible factor (HIF)-1α inhibited the seawater induced increase expression of SEMA7A. Meanwhile, knockdown of SEMA7A by specific siRNA inhibited the seawater induced aberrant inflammation, endothelial cytoskeleton remodeling and endothelial permeability. These results suggest that SEMA7A is critical in the development of lung inflammation and pulmonary edema in seawater aspiration-induced ALI, and may be a therapeutic target for this disease.

  14. Semaphorin3A, Neuropilin-1, and PlexinA1 are required for lymphatic valve formation.

    Science.gov (United States)

    Bouvrée, Karine; Brunet, Isabelle; Del Toro, Raquel; Gordon, Emma; Prahst, Claudia; Cristofaro, Brunella; Mathivet, Thomas; Xu, Yunling; Soueid, Jihane; Fortuna, Vitor; Miura, Nayoki; Aigrot, Marie-Stéphane; Maden, Charlotte H; Ruhrberg, Christiana; Thomas, Jean Léon; Eichmann, Anne

    2012-08-03

    The lymphatic vasculature plays a major role in fluid homeostasis, absorption of dietary lipids, and immune surveillance. Fluid transport depends on the presence of intraluminal valves within lymphatic collectors. Defective formation of lymphatic valves leads to lymphedema, a progressive and debilitating condition for which curative treatments are currently unavailable. How lymphatic valve formation is regulated remains largely unknown. We investigated if the repulsive axon guidance molecule Semaphorin3A (Sema3A) plays a role in lymphatic valve formation. We show that Sema3A mRNA is expressed in lymphatic vessels and that Sema3A protein binds to lymphatic valves expressing the Neuropilin-1 (Nrp1) and PlexinA1 receptors. Using mouse knockout models, we show that Sema3A is selectively required for lymphatic valve formation, via interaction with Nrp1 and PlexinA1. Sema3a(-/-) mice exhibit defects in lymphatic valve formation, which are not due to abnormal lymphatic patterning or sprouting, and mice carrying a mutation in the Sema3A binding site of Nrp1, or deficient for Plxna1, develop lymphatic valve defects similar to those seen in Sema3a(-/-) mice. Our data demonstrate an essential direct function of Sema3A-Nrp1-PlexinA1 signaling in lymphatic valve formation.

  15. Semaphorin 5A inhibits synaptogenesis in early postnatal- and adult-born hippocampal dentate granule cells.

    Science.gov (United States)

    Duan, Yuntao; Wang, Shih-Hsiu; Song, Juan; Mironova, Yevgeniya; Ming, Guo-li; Kolodkin, Alex L; Giger, Roman J

    2014-10-14

    Human SEMAPHORIN 5A (SEMA5A) is an autism susceptibility gene; however, its function in brain development is unknown. In this study, we show that mouse Sema5A negatively regulates synaptogenesis in early, developmentally born, hippocampal dentate granule cells (GCs). Sema5A is strongly expressed by GCs and regulates dendritic spine density in a cell-autonomous manner. In the adult mouse brain, newly born Sema5A-/- GCs show an increase in dendritic spine density and increased AMPA-type synaptic responses. Sema5A signals through PlexinA2 co-expressed by GCs, and the PlexinA2-RasGAP activity is necessary to suppress spinogenesis. Like Sema5A-/- mutants, PlexinA2-/- mice show an increase in GC glutamatergic synapses, and we show that Sema5A and PlexinA2 genetically interact with respect to GC spine phenotypes. Sema5A-/- mice display deficits in social interaction, a hallmark of autism-spectrum-disorders. These experiments identify novel intra-dendritic Sema5A/PlexinA2 interactions that inhibit excitatory synapse formation in developmentally born and adult-born GCs, and they provide support for SEMA5A contributions to autism-spectrum-disorders.

  16. Expression of neuroimmune semaphorins 4A and 4D and their receptors in the lung is enhanced by allergen and vascular endothelial growth factor

    Directory of Open Access Journals (Sweden)

    Keegan Achsah D

    2011-05-01

    Full Text Available Abstract Background Semaphorins were originally identified as molecules regulating a functional activity of axons in the nervous system. Sema4A and Sema4D were the first semaphorins found to be expressed on immune cells and were termed "immune semaphorins". It is known that Sema4A and Sema4D bind Tim-2 and CD72 expressed on leukocytes and PlexinD1 and B1 present on non-immune cells. These neuroimmune semaphorins and their receptors have been shown to play critical roles in many physiological and pathological processes including neuronal development, immune response regulation, cancer, autoimmune, cardiovascular, renal, and infectious diseases. However, the expression and regulation of Sema4A, Sema4D, and their receptors in normal and allergic lungs is undefined. Results Allergen treatment and lung-specific vascular endothelial growth factor (VEGF expression induced asthma-like pathologies in the murine lungs. These experimental models of allergic airway inflammation were used for the expression analysis of immune semaphorins and their receptors employing immunohistochemistry and flow cytometry techniques. We found that besides accessory-like cells, Sema4A was also detected on bronchial epithelial and smooth muscle cells, whereas Sema4D expression was high on immune cells such as T and B lymphocytes. Surprisingly, under inflammation various cell types including macrophages, lymphocytes, and granulocytes in the lung expressed Tim-2, a previously defined marker for Th2 cells. CD72 was found on lung immune, inflammatory, and epithelial cells. Bronchial epithelial cells were positive for both plexins, whereas some endothelial cells selectively expressed Plexin D1. Plexin B1 expression was also detected on lung DC. Both allergen and VEGF upregulated the expression of neuroimmune semaphorins and their receptors in the lung tissue. However, the lung tissue Sema4A-Tim2 expression was rather weak, whereas Sema4D-CD72 ligand-receptor pair was vastly

  17. Role of Neuropilin-1/Semaphorin-3A signaling in the functional and morphological integrity of the cochlea.

    Directory of Open Access Journals (Sweden)

    Pezhman Salehi

    2017-10-01

    Full Text Available Neuropilin-1 (Nrp1 encodes the transmembrane cellular receptor neuropilin-1, which is associated with cardiovascular and neuronal development and was within the peak SNP interval on chromosome 8 in our prior GWAS study on age-related hearing loss (ARHL in mice. In this study, we generated and characterized an inner ear-specific Nrp1 conditional knockout (CKO mouse line because Nrp1 constitutive knockouts are embryonic lethal. In situ hybridization demonstrated weak Nrp1 mRNA expression late in embryonic cochlear development, but increased expression in early postnatal stages when cochlear hair cell innervation patterns have been shown to mature. At postnatal day 5, Nrp1 CKO mice showed disorganized outer spiral bundles and enlarged microvessels of the stria vascularis (SV but normal spiral ganglion cell (SGN density and presynaptic ribbon body counts; however, we observed enlarged SV microvessels, reduced SGN density, and a reduction of presynaptic ribbons in the outer hair cell region of 4-month-old Nrp1 CKO mice. In addition, we demonstrated elevated hearing thresholds of the 2-month-old and 4-month-old Nrp1 CKO mice at frequencies ranging from 4 to 32kHz when compared to 2-month-old mice. These data suggest that conditional loss of Nrp1 in the inner ear leads to progressive hearing loss in mice. We also demonstrated that mice with a truncated variant of Nrp1 show cochlear axon guidance defects and that exogenous semaphorin-3A, a known neuropilin-1 receptor agonist, repels SGN axons in vitro. These data suggest that Neuropilin-1/Semaphorin-3A signaling may also serve a role in neuronal pathfinding in the developing cochlea. In summary, our results here support a model whereby Neuropilin-1/Semaphorin-3A signaling is critical for the functional and morphological integrity of the cochlea and that Nrp1 may play a role in ARHL.

  18. Grb2 mediates semaphorin-4D-dependent RhoA inactivation.

    Science.gov (United States)

    Sun, Tianliang; Krishnan, Rameshkumar; Swiercz, Jakub M

    2012-08-01

    Signaling through the semaphorin 4D (Sema4D) receptor plexin-B1 is modulated by its interaction with tyrosine kinases ErbB-2 and Met. In cells expressing the plexin-B1-ErbB-2 receptor complex, ligand stimulation results in the activation of small GTPase RhoA and stimulation of cellular migration. By contrast, in cells expressing plexin-B1 and Met, ligand stimulation results in an association with the RhoGTPase-activating protein p190 RhoGAP and subsequent RhoA inactivation--a process that involves the tyrosine phosphorylation of plexin-B1 by Met. Inactivation of RhoA is necessary for Sema4D-mediated inhibition of cellular migration. It is, however, unknown how plexin-B1 phosphorylation regulates RhoGAP interaction and activity. Here we show that the activation of plexin-B1 by Sema4D and its subsequent tyrosine phosphorylation by Met creates a docking site for the SH2 domain of growth factor receptor bound-2 (Grb2). Grb2 is thereby recruited into the plexin-B1 receptor complex and, through its SH3 domain, interacts with p190 RhoGAP and mediates RhoA deactivation. Phosphorylation of plexin-B1 by Met and the recruitment of Grb2 have no effect on the R-RasGAP activity of plexin-B1, but are required for Sema4D-induced, RhoA-dependent antimigratory effects of Sema4D on breast cancer cells. These data show Grb2 as a direct link between plexin and p190-RhoGAP-mediated downstream signaling.

  19. Semaphorin 3A Induces Odontoblastic Phenotype in Dental Pulp Stem Cells.

    Science.gov (United States)

    Yoshida, S; Wada, N; Hasegawa, D; Miyaji, H; Mitarai, H; Tomokiyo, A; Hamano, S; Maeda, H

    2016-10-01

    In cases of pulp exposure due to deep dental caries or severe traumatic injuries, existing pulp-capping materials have a limited ability to reconstruct dentin-pulp complexes and can result in pulpectomy because of their low potentials to accelerate dental pulp cell activities, such as migration, proliferation, and differentiation. Therefore, the development of more effective therapeutic agents has been anticipated for direct pulp capping. Dental pulp tissues are enriched with dental pulp stem cells (DPSCs). Here, the authors investigated the effects of semaphorin 3A (Sema3A) on various functions of human DPSCs in vitro and reparative dentin formation in vivo in a rat dental pulp exposure model. Immunofluorescence staining revealed expression of Sema3A and its receptor Nrp1 (neuropilin 1) in rat dental pulp tissue and human DPSC clones. Sema3A induced cell migration, chemotaxis, proliferation, and odontoblastic differentiation of DPSC clones. In addition, Sema3A treatment of DPSC clones increased β-catenin nuclear accumulation, upregulated expression of the FARP2 gene (FERM, RhoGEF, and pleckstrin domain protein 2), and activated Rac1 in DPSC clones. Furthermore, in the rat dental pulp exposure model, Sema3A promoted reparative dentin formation with dentin tubules and a well-aligned odontoblast-like cell layer at the dental pulp exposure site and with novel reparative dentin almost completely covering pulp tissue at 4 wk after direct pulp capping. These findings suggest that Sema3A could play an important role in dentin regeneration via canonical Wnt/β-catenin signaling. Sema3A might be an alternative agent for direct pulp capping, which requires further study. © International & American Associations for Dental Research 2016.

  20. Regulation of semaphorin 4D expression and cell proliferation of ovarian cancer by ERalpha and ERbeta

    Directory of Open Access Journals (Sweden)

    Y. Liu

    Full Text Available Ovarian cancer is one of the most common malignancies in women. Semaphorin 4D (sema 4D is involved in the progress of multiple cancers. In the presence of estrogen-like ligands, estrogen receptors (ERα and ERβ participate in the progress of breast and ovarian cancers by transcriptional regulation. The aim of the study was to investigate the role of sema 4D and elucidate the regulatory pattern of ERα and ERβ on sema 4D expression in ovarian cancers. Sema 4D levels were up-regulated in ovarian cancer SKOV-3 cells. Patients with malignant ovarian cancers had significantly higher sema 4D levels than controls, suggesting an oncogene role of sema 4D in ovarian cancer. ERα expressions were up-regulated in SKOV-3 cells compared with normal ovarian IOSE80 epithelial cells. Conversely, down-regulation of ERβ was observed in SKOV-3 cells. Forced over-expression of ERα and ERβ in SKOV-3 cells was manipulated to establish ERα+ and ERβ+ SKOV-3 cell lines. Incubation of ERα+ SKOV-3 cells with ERs agonist 17β-estradiol (E2 significantly enhanced sema 4D expression and rate of cell proliferation. Incubated with E2, ERβ+ SKOV-3 cells showed lower sema 4D expression and cell proliferation. Blocking ERα and ERβ activities with ICI182-780 inhibitor, sema 4D expressions and cell proliferation of ERα+ and ERβ+ SKOV-3 cells were recovered to control levels. Taken together, the data showed that sema 4D expression was positively correlated with the progress of ovarian cancer. ERα positively regulated sema 4D expression and accelerated cell proliferation. ERβ negatively regulated sema 4D expression and inhibited cell multiplication.

  1. Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells.

    Science.gov (United States)

    Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D

    2017-01-01

    The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

  2. Peripheral nerve injury fails to induce growth of lesioned ascending dorsal column axons into spinal cord scar tissue expressing the axon repellent Semaphorin3A

    NARCIS (Netherlands)

    Pasterkamp, R Jeroen; Anderson, Patrick N; Verhaagen, J

    We have investigated the hypothesis that the chemorepellent Semaphorin3A may be involved in the failure of axonal regeneration after injury to the ascending dorsal columns of adult rats. Following transection of the thoracic dorsal columns, fibroblasts in the dorsolateral parts of the lesion site

  3. Transcription of a novel mouse semaphorin gene, M-semaH, correlates with the metastatic ability of mouse tumor cell lines

    DEFF Research Database (Denmark)

    Christensen, C R; Klingelhöfer, Jörg; Tarabykina, S

    1998-01-01

    identified a novel member of the semaphorin/collapsin family in the two metastatic cell lines. We have named it M-semaH. Northern hybridization to a panel of tumor cell lines revealed transcripts in 12 of 12 metastatic cell lines but in only 2 of 6 nonmetastatic cells and none in immortalized mouse...

  4. Repulsive guidance cue semaphorin 3A in urine predicts the progression of acute kidney injury in adult patients from a mixed intensive care unit.

    Science.gov (United States)

    Doi, Kent; Noiri, Eisei; Nangaku, Masaomi; Yahagi, Naoki; Jayakumar, Calpurnia; Ramesh, Ganesan

    2014-01-01

    Predicting the development of acute kidney injury (AKI) in the critical care setting is challenging. Although several biomarkers showed somewhat satisfactory performance for detecting established AKI even in a heterogeneous disease-oriented population, identification of new biomarkers that predict the development of AKI accurately is urgently required. A single-center prospective observational cohort study was undertaken to evaluate for the first time the reliability of the newly identified biomarker semaphorin 3A for AKI diagnosis in heterogeneous intensive care unit populations. In addition to five urinary biomarkers of L-type fatty acid-binding protein (L-FABP), neutrophil gelatinase-associated lipocalin (NGAL), IL-18, albumin and N-acetyl-β-d-glucosaminidase (NAG), urinary semaphorin 3A was measured at intensive care unit (ICU) admission. Three hundred thirty-nine critically ill adult patients were recruited for this study. Among them, 131 patients (39%) were diagnosed with AKI by the RIFLE criteria and 66 patients were diagnosed as AKI at post-ICU admission (later-onset AKI). Eighty-four AKI patients showed worsening severity during 1 week observation (AKI progression). Although L-FABP, NGAL and IL-18 showed significantly higher area under the curve (AUC)-receiver operating characteristic (ROC) values than semaphorin 3A in detecting established AKI, semaphorin 3A was able to detect later-onset AKI and AKI progression with similar AUC-ROC values compared with the other five biomarkers [AUC-ROC (95% CI) for established AKI 0.64 (0.56-0.71), later-onset AKI 0.71 (0.64-0.78), AKI progression 0.71 (0.64-0.77)]. Urinary semaphorin 3A was not increased in non-progressive established AKI, while the other biomarkers were elevated regardless of further progression. Finally, sepsis did not have any impact on semaphorin 3A while the other urinary biomarkers were increased with sepsis. Semaphorin 3A is a new biomarker of AKI which may have a distinct predictive use for

  5. A new impedance based approach to test the activity of recombinant protein--Semaphorins as a test case.

    Science.gov (United States)

    Birger, Anastasya; Besser, Elazar; Reubinoff, Benjamin; Behar, Oded

    2015-10-01

    The biological activity of a recombinant protein is routinely measured using a bioassay such as an enzyme assay. However, many proteins have no enzymatic activity and in many cases it is difficult to devise a simple and reliable approach to test their activity. Semaphorins, Ephrins, Slits, Netrins or amylin-assisted proteins have numerous activities affecting many systems and cell types in the human body. Most of them are also able to induce rapid cytoskeleton changes at least in some cell types. We assumed therefore, that such proteins might be tested based on their ability to modulate the cytoskeleton. Here we tested a number of semaphorins in an impedance based label-free platform that allows for dynamic monitoring of subtle morphological and adhesive changes. This system has proved to be a very fast, sensitive and effective way to monitor and determine the activity of such proteins. Furthermore we showed that it is possible to customize a cell-protein system by transfecting the cells with specific receptors and test the cell response following the addition of the recombinant ligand protein. Since other protein families such as Ephrins and Netrins can also influence the cytoskeleton of some cells, this approach may be applicable to a large number of proteins. Copyright © 2015 Elsevier GmbH. All rights reserved.

  6. Expression of semaphorin 3A in the rat corneal epithelium during wound healing

    International Nuclear Information System (INIS)

    Morishige, Naoyuki; Ko, Ji-Ae; Morita, Yukiko; Nishida, Teruo

    2010-01-01

    The neural guidance protein semaphorin 3A (Sema3A) is expressed in corneal epithelial cells of the adult rat. We have now further investigated the localization of Sema3A in the normal rat corneal epithelium as well as changes in its expression pattern during wound healing after central corneal epithelial debridement. The expression pattern of Sema3A was compared with that of the tight-junction protein zonula occludens-1 (ZO-1), the gap-junction protein connexin43 (Cx43), or the cell proliferation marker Ki67. Immunofluorescence analysis revealed that Sema3A was present predominantly in the membrane of basal and wing cells of the intact corneal epithelium. The expression of Sema3A at the basal side of basal cells was increased in the peripheral epithelium compared with that in the central region. Sema3A was detected in all layers at the leading edge of the migrating corneal epithelium at 6 h after central epithelial debridement. The expression of Sema3A was markedly up-regulated in the basal and lateral membranes of columnar basal cells apparent in the thickened, newly healed epithelium at 1 day after debridement, but it had largely returned to the normal pattern at 3 days after debridement. The expression of ZO-1 was restricted to superficial epithelial cells and remained mostly unchanged during the wound healing process. The expression of Cx43 in basal cells was down-regulated at the leading edge of the migrating epithelium but was stable in the remaining portion of the epithelium. Ki67 was not detected in basal cells of the central epithelium at 1 day after epithelial debridement, when Sema3A was prominently expressed. Immunoblot analysis showed that the abundance of Sema3A in the central cornea was increased 1 day after epithelial debridement, whereas that of ZO-1 or Cx43 remained largely unchanged. This increase in Sema3A expression was accompanied by up-regulation of the Sema3A coreceptor neuropilin-1. Our observations have thus shown that the expression of

  7. Semaphorin 3A controls allergic and inflammatory responses in experimental allergic conjunctivitis

    Directory of Open Access Journals (Sweden)

    Junmi Tanaka

    2015-02-01

    Full Text Available AIM: To assess the efficacy of topical Semaphorin-3A (SEMA3A in the treatment of allergic conjunctivitis. METHODS: Experimental allergic conjunctivitis (EAC mice model induced by short ragweed pollen (SRW in 4-week-old of BALB/c mice, mice were evaluated using haematoxylin and eosin (H&E staining, immunofluorescence and light microscope photographs. Early phase took the samples in 24h after instillation and late phase took the samples between 4 to 14d after the start of treatment. The study use of topical SEMA3A (10 U, 100 U, 1000 U eye drops and subconjunctival injection of SEMA3A with same concentration. For comparison, five types of allergy eyedrops were quantified using clinical characteristics. RESULTS: Clinical score of composite ocular symptoms of the mice treated with SEMA3A were significantly decreased both in the immediate phase and the late phase compared to those treated with commercial ophthalmic formulations and non-treatment mice. SEMA3A treatment attenuates infiltration of eosinophils entering into conjunctiva in EAC mice. The score of eosinophil infiltration in the conjunctiva of SEMA3A 1000 U-treated group were significantly lower than low-concentration of SEMA3A treated groups and non-treated group. SEMA3A treatment also suppressed T-cell proliferation in vitro and decreased serum total IgE levels in EAC mice. Moreover, Treatment of SEMA3A suppressed Th2-related cytokines (IL-5, IL-13 and IL-4 and pro-inflammatory cytokines (IFN-γ, IL-17 and TNF-α release, but increased regulatory cytokine IL-10 concentration in the conjunctiva of EAC mice. CONCLUSIONS: SEMA3A as a biological agent, showed the beneficial activity in ocular allergic processes with the less damage to the intraocular tissue. It is expected that SEMA3A may be contributed in patients with a more severe spectrum of refractory ocular allergic diseases including allergic conjunctivitis in the near future.

  8. A PKC-dependent recruitment of MMP-2 controls semaphorin-3A growth-promoting effect in cortical dendrites.

    Directory of Open Access Journals (Sweden)

    Bertrand Gonthier

    Full Text Available There is increasing evidence for a crucial role of proteases and metalloproteinases during axon growth and guidance. In this context, we recently described a functional link between the chemoattractive Sema3C and Matrix metalloproteinase 3 (MMP3. Here, we provide data demonstrating the involvement of MMP-2 to trigger the growth-promoting effect of Sema3A in cortical dendrites. The in situ analysis of MMP-2 expression and activity is consistent with a functional growth assay demonstrating in vitro that the pharmacological inhibition of MMP-2 reduces the growth of cortical dendrites in response to Sema3A. Hence, our results suggest that the selective recruitment and activation of MMP-2 in response to Sema3A requires a PKC alpha dependent mechanism. Altogether, we provide a second set of data supporting MMPs as effectors of the growth-promoting effects of semaphorins, and we identify the potential signalling pathway involved.

  9. Scaling laws in (e,3e) processes

    International Nuclear Information System (INIS)

    Gasaneo, G; Rodriguez, K V; Ancarani, L U; Cappello, C Dal; Charpentier, I

    2009-01-01

    We study the double ionization of helium-like ions by impact of electrons with high incident energy. Within the isoelectronic sequence, an approximate scaling law for (e,3e) differential cross sections is proposed and confirmed by calculations. The latter are performed using 14-parameters Hylleraas-like wave functions to represent the bound electrons in the initial channel, plane waves for the fast incoming and scattered electrons, and a continuum distorted wave approach for the two ejected electrons in the final channel.

  10. Upregulation of Long Noncoding RNA Small Nucleolar RNA Host Gene 18 Promotes Radioresistance of Glioma by Repressing Semaphorin 5A

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Rong [Department of Radiation Oncology, Nanfang Hospital, Southern Medical University, Guangzhou, Guangdong (China); Department of Radiation Oncology, Fujian Medical University Union Hospital, Fuzhou, Fujian (China); Yao, Qiwei [Department of Radiation Oncology, Nanfang Hospital, Southern Medical University, Guangzhou, Guangdong (China); Department of Radiation Oncology, Teaching Hospital of Fujian Medical University, Fujian Provincial Cancer Hospital, Fuzhou, Fujian (China); Ren, Chen; Liu, Ying; Yang, Hongli; Xie, Guozhu; Du, Shasha [Department of Radiation Oncology, Nanfang Hospital, Southern Medical University, Guangzhou, Guangdong (China); Yang, Kaijun [Department of Neurosurgery, Nanfang Hospital, Southern Medical University, Guangzhou, Guangdong (China); Yuan, Yawei, E-mail: yuanyawei2015@outlook.com [Department of Radiation Oncology, Nanfang Hospital, Southern Medical University, Guangzhou, Guangdong (China); Department of Radiation Oncology, Cancer Hospital Center of Guangzhou Medical University, Guangzhou, Guangdong (China)

    2016-11-15

    Purpose: Although increasing evidence has shown that long noncoding RNAs play an important regulatory role in carcinogenesis and tumor progression, little is known about the role of small nucleolar RNA host gene 18 (SNHG18) in cancer. The goal of this study was to investigate the expression of SNHG18 and its clinical significance in glioma. Methods and Materials: Differences in the lncRNA expression profile between M059K and M059J cells were assessed by lncRNA expression microarray analysis. The expression and localization of SNHG18 in glioma cells or tissues was evaluated by quantitative reverse transcription-polymerase chain reaction (qRT-PCR) and in situ hybridization (ISH), respectively. the clinical associations of SNHG18 in glioma was evaluated by qRT-PCR, ISH and immunohistochemistry. The role of SNHG18 in glioma radiosensitivity was evaluated by colony formation assays, immunofluorescence, Western blot and tumor growth inhibition study. Results: The present study investigated the clinical associations of SNHG18 and its role in glioma. Our results showed that the expression of SNHG18 was remarkably upregulated in clinical glioma tissues compared with normal brain tissues. SNHG18 expression was associated with the clinical tumor grade and correlated negatively with isocitrate dehydrogenase 1 mutation. In addition, knockdown of SNHG18 with short hairpin RNA suppressed the radioresistance of glioma cells, and transgenic expression of SNHG18 had the opposite effect. Furthermore, xenograft tumors grown from cells with SNHG18 deletion were more radiosensitive than tumors grown from control cells. Further studies revealed that SNHG18 promotes radioresistance by inhibiting semaphorin 5A and that inhibition of semaphorin 5A expression abrogated the radiosensitizing effect caused by SNHG18 deletion. Conclusions: Our findings provide new insights into the role of SNHG18 in glioma and suggest its potential as a target for glioma therapy.

  11. Upregulation of Long Noncoding RNA Small Nucleolar RNA Host Gene 18 Promotes Radioresistance of Glioma by Repressing Semaphorin 5A

    International Nuclear Information System (INIS)

    Zheng, Rong; Yao, Qiwei; Ren, Chen; Liu, Ying; Yang, Hongli; Xie, Guozhu; Du, Shasha; Yang, Kaijun; Yuan, Yawei

    2016-01-01

    Purpose: Although increasing evidence has shown that long noncoding RNAs play an important regulatory role in carcinogenesis and tumor progression, little is known about the role of small nucleolar RNA host gene 18 (SNHG18) in cancer. The goal of this study was to investigate the expression of SNHG18 and its clinical significance in glioma. Methods and Materials: Differences in the lncRNA expression profile between M059K and M059J cells were assessed by lncRNA expression microarray analysis. The expression and localization of SNHG18 in glioma cells or tissues was evaluated by quantitative reverse transcription-polymerase chain reaction (qRT-PCR) and in situ hybridization (ISH), respectively. the clinical associations of SNHG18 in glioma was evaluated by qRT-PCR, ISH and immunohistochemistry. The role of SNHG18 in glioma radiosensitivity was evaluated by colony formation assays, immunofluorescence, Western blot and tumor growth inhibition study. Results: The present study investigated the clinical associations of SNHG18 and its role in glioma. Our results showed that the expression of SNHG18 was remarkably upregulated in clinical glioma tissues compared with normal brain tissues. SNHG18 expression was associated with the clinical tumor grade and correlated negatively with isocitrate dehydrogenase 1 mutation. In addition, knockdown of SNHG18 with short hairpin RNA suppressed the radioresistance of glioma cells, and transgenic expression of SNHG18 had the opposite effect. Furthermore, xenograft tumors grown from cells with SNHG18 deletion were more radiosensitive than tumors grown from control cells. Further studies revealed that SNHG18 promotes radioresistance by inhibiting semaphorin 5A and that inhibition of semaphorin 5A expression abrogated the radiosensitizing effect caused by SNHG18 deletion. Conclusions: Our findings provide new insights into the role of SNHG18 in glioma and suggest its potential as a target for glioma therapy.

  12. The Mu3e Tile Detector

    Energy Technology Data Exchange (ETDEWEB)

    Eckert, Hans Patrick

    2015-05-06

    The Mu3e experiment is designed to search for the lepton flavour violating decay μ→e{sup +}e{sup +}e{sup -} with a sensitivity of one in 10{sup 16} decays. An observation of such a decay would be a clear sign of physics beyond the Standard Model. Achieving the targeted sensitivity requires a high precision detector with excellent momentum, vertex and time resolution. The Mu3e Tile Detector is a highly granular sub-detector system based on scintillator tiles with Silicon Photomultiplier (SiPM) readout, and aims at measuring the timing of the muon decay products with a resolution of better than 100 ps. This thesis describes the development of the Tile Detector concept and demonstrates the feasibility of the elaborated design. In this context, a comprehensive simulation framework has been developed, in order to study and optimise the detector performance. The central component of this framework is a detailed simulation of the SiPM response. The simulation model has been validated in several measurements and shows good agreement with the data. Furthermore, a 16-channel prototype of a Tile Detector module has been constructed and operated in an electron beam. In the beam tests, a time resolution up to 56 ps has been achieved, which surpasses the design goal. The simulation and measurement results demonstrate the feasibility of the developed Tile Detector design and show that the required detector performance can be achieved.

  13. Frequent deletion of 3p21.1 region carrying semaphorin 3G and aberrant expression of the genes participating in semaphorin signaling in the epithelioid type of malignant mesothelioma cells.

    Science.gov (United States)

    Yoshikawa, Yoshie; Sato, Ayuko; Tsujimura, Tohru; Morinaga, Tomonori; Fukuoka, Kazuya; Yamada, Shusai; Murakami, Aki; Kondo, Nobuyuki; Matsumoto, Seiji; Okumura, Yoshitomo; Tanaka, Fumihiro; Hasegawa, Seiki; Hashimoto-Tamaoki, Tomoko; Nakano, Takashi

    2011-12-01

    Array-based comparative genomic hybridization analysis was performed on 21 malignant mesothelioma (MM) samples (16 primary cell cultures and 5 cell lines) and two reactive mesothelial hyperplasia (RM) primary cell cultures. The RM samples did not have any genomic losses or gains. In MM samples, deletions in 1p, 3p21, 4q, 9p21, 16p13 and 22q were detected frequently. We focused on 3p21 because this deletion was specific to the epithelioid type. Especially, a deletion in 3p21.1 region carrying seven genes including SEMA3G was found in 52% of MM samples (11 of 14 epithelioid samples). The allele loss of 3p21.1 might be a good marker for the epithelioid MM. A homozygous deletion in this region was detected in two MM primary cell cultures. A heterozygous deletion detected in nine samples contained the 3p21.1 region and 3p21.31 one carrying the candidate tumor suppressor genes such as semaphorin 3F (SEMA3F), SEMA3B and Ras association (RalGDS/AF-6) domain family member 1 (RASSF1A). SEMA3B, 3F and 3G are class 3 semaphorins and inhibit growth by competing with vascular endothelial growth factor (VEGF) through binding to neuropilin. All MM samples downregulated the expression of more than one gene for SEMA3B, 3F and 3G when compared with Met5a, a normal pleura-derived cell line. Moreover, in 12 of 14 epithelioid MM samples the expression level of SEMA3A was lower than that in Met5a and the two RM samples. An augmented expression of VEGFA was detected in half of the MM samples. The expression ratio of VEGFA/SEMA3A was significantly higher in the epithelioid MMs than in Met5a, RMs and the non-epithelioid MMs. Our data suggest that the downregulated expression of SEMA3A and several SEMA3s results in a loss of inhibitory activities in tumor angiogenesis and tumor growth of VEGFA; therefore, it may play an important role on the pathogenesis of the epithelioid type of MM.

  14. Semaphorin 3G Provides a Repulsive Guidance Cue to Lymphatic Endothelial Cells via Neuropilin-2/PlexinD1.

    Science.gov (United States)

    Liu, Xinyi; Uemura, Akiyoshi; Fukushima, Yoko; Yoshida, Yutaka; Hirashima, Masanori

    2016-11-22

    The vertebrate circulatory system is composed of closely related blood and lymphatic vessels. It has been shown that lymphatic vascular patterning is regulated by blood vessels during development, but its molecular mechanisms have not been fully elucidated. Here, we show that the artery-derived ligand semaphorin 3G (Sema3G) and the endothelial cell receptor PlexinD1 play a role in lymphatic vascular patterning. In mouse embryonic back skin, genetic inactivation of Sema3G or PlexinD1 results in abnormal artery-lymph alignment and reduced lymphatic vascular branching. Conditional ablation in mice demonstrates that PlexinD1 is primarily required in lymphatic endothelial cells (LECs). In vitro analyses show that Sema3G binds to neuropilin-2 (Nrp2), which forms a receptor complex with PlexinD1. Sema3G induces cell collapse in an Nrp2/PlexinD1-dependent manner. Our findings shed light on a molecular mechanism by which LECs are distributed away from arteries and form a branching network during lymphatic vascular development. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

  15. The association between semaphorin 3A levels and gluten-free diet in patients with celiac disease.

    Science.gov (United States)

    Kessel, Aharon; Lin, Chen; Vadasz, Zahava; Peri, Regina; Eiza, Nasren; Berkowitz, Drora

    2017-11-01

    Celiac disease (CD) is an inflammatory disease affecting the small intestine. We aim to assess serum level and expression of semaphorin 3A (Sema3A) on T regulatory (Treg) cells in CD patients. Twenty-six newly diagnosed celiac patients, 13 celiac patients on a gluten-free diet and 16 healthy controls included in the study. Sema3A protein level in the serum of celiac patients was significantly higher compared to healthy group (7.17±1.8ng/ml vs. 5.67±1.5ng/ml, p=0.012). Sema3A expression on Treg cells was statistically lower in celiac patients compared to healthy subjects (p=0.009) and significantly lower in celiac patients compared to celiac patients on gluten free diet (p=0.04). Negative correlation was found between Sema3A on Teg cells and the level of IgA anti-tTG antibodies (r=-0.346, p<0.01) and anti-DGP (r=-0.448, p<0.01). This study suggests involvement of the Sema3A in the pathogenesis of CD. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. The axon guidance molecule semaphorin 3F is a negative regulator of tumor progression and proliferation in ileal neuroendocrine tumors

    Science.gov (United States)

    Vercherat, Cécile; Blanc, Martine; Lepinasse, Florian; Gadot, Nicolas; Couderc, Christophe; Poncet, Gilles; Walter, Thomas; Joly, Marie-Odile; Hervieu, Valérie; Scoazec, Jean-Yves; Roche, Colette

    2015-01-01

    Gastro-intestinal neuroendocrine tumors (GI-NETs) are rare neoplasms, frequently metastatic, raising difficult clinical and therapeutic challenges due to a poor knowledge of their biology. As neuroendocrine cells express both epithelial and neural cell markers, we studied the possible involvement in GI-NETs of axon guidance molecules, which have been shown to decrease tumor cell proliferation and metastatic dissemination in several tumor types. We focused on the role of Semaphorin 3F (SEMA3F) in ileal NETs, one of the most frequent subtypes of GI-NETs. SEMA3F expression was detected in normal neuroendocrine cells but was lost in most of human primary tumors and all their metastases. SEMA3F loss of expression was associated with promoter gene methylation. After increasing endogenous SEMA3F levels through stable transfection, enteroendocrine cell lines STC-1 and GluTag showed a reduced proliferation rate in vitro. In two different xenograft mouse models, SEMA3F-overexpressing cells exhibited a reduced ability to form tumors and a hampered liver dissemination potential in vivo. This resulted, at least in part, from the inhibition of mTOR and MAPK signaling pathways. This study demonstrates an anti-tumoral role of SEMA3F in ileal NETs. We thus suggest that SEMA3F and/or its cellular signaling pathway could represent a target for ileal NET therapy. PMID:26447612

  17. Axon guidance in the developing ocular motor system and Duane retraction syndrome depends on Semaphorin signaling via alpha2-chimaerin

    Science.gov (United States)

    Ferrario, Juan E.; Baskaran, Pranetha; Clark, Christopher; Hendry, Aenea; Lerner, Oleg; Hintze, Mark; Allen, James; Chilton, John K.; Guthrie, Sarah

    2012-01-01

    Eye movements depend on correct patterns of connectivity between cranial motor axons and the extraocular muscles. Despite the clinical importance of the ocular motor system, little is known of the molecular mechanisms underlying its development. We have recently shown that mutations in the Chimaerin-1 gene encoding the signaling protein α2-chimaerin (α2-chn) perturb axon guidance in the ocular motor system and lead to the human eye movement disorder, Duane retraction syndrome (DRS). The axon guidance cues that lie upstream of α2-chn are unknown; here we identify candidates to be the Semaphorins (Sema) 3A and 3C, acting via the PlexinA receptors. Sema3A/C are expressed in and around the developing extraocular muscles and cause growth cone collapse of oculomotor neurons in vitro. Furthermore, RNAi knockdown of α2-chn or PlexinAs in oculomotor neurons abrogates Sema3A/C-dependent growth cone collapse. In vivo knockdown of endogenous PlexinAs or α2-chn function results in stereotypical oculomotor axon guidance defects, which are reminiscent of DRS, whereas expression of α2-chn gain-of-function constructs can rescue PlexinA loss of function. These data suggest that α2-chn mediates Sema3–PlexinA repellent signaling. We further show that α2-chn is required for oculomotor neurons to respond to CXCL12 and hepatocyte growth factor (HGF), which are growth promoting and chemoattractant during oculomotor axon guidance. α2-chn is therefore a potential integrator of different types of guidance information to orchestrate ocular motor pathfinding. DRS phenotypes can result from incorrect regulation of this signaling pathway. PMID:22912401

  18. Disruption of Aedes aegypti olfactory system development through chitosan/siRNA nanoparticle targeting of semaphorin-1a.

    Directory of Open Access Journals (Sweden)

    Keshava Mysore

    Full Text Available Despite the devastating impact of mosquito-borne illnesses on human health, surprisingly little is known about mosquito developmental biology, including development of the olfactory system, a tissue of vector importance. Analysis of mosquito olfactory developmental genetics has been hindered by a lack of means to target specific genes during the development of this sensory system. In this investigation, chitosan/siRNA nanoparticles were used to target semaphorin-1a (sema1a during olfactory system development in the dengue and yellow fever vector mosquito Aedes aegypti. Immunohistochemical analyses and anterograde tracing of antennal sensory neurons, which were used to track the progression of olfactory development in this species, revealed antennal lobe defects in sema1a knockdown fourth instar larvae. These findings, which correlated with a larval odorant tracking behavioral phenotype, identified previously unreported roles for Sema1a in the developing insect larval olfactory system. Analysis of sema1a knockdown pupae also revealed a number of olfactory phenotypes, including olfactory receptor neuron targeting and projection neuron defects coincident with a collapse in the structure and shape of the antennal lobe and individual glomeruli. This study, which is to our knowledge the first functional genetic analysis of insect olfactory development outside of D. melanogaster, identified critical roles for Sema1a during Ae. aegypti larval and pupal olfactory development and advocates the use of chitosan/siRNA nanoparticles as an effective means of targeting genes during post-embryonic Ae. aegypti development. Use of siRNA nanoparticle methodology to understand sensory developmental genetics in mosquitoes will provide insight into the evolutionary conservation and divergence of key developmental genes which could be exploited in the development of both common and species-specific means for intervention.

  19. Chemoenzymatically prepared konjac ceramide inhibits NGF-induced neurite outgrowth by a semaphorin 3A-like action

    Directory of Open Access Journals (Sweden)

    Seigo Usuki

    2016-03-01

    Full Text Available Dietary sphingolipids such as glucosylceramide (GlcCer are potential nutritional factors associated with prevention of metabolic syndrome. Our current understanding is that dietary GlcCer is degraded to ceramide and further metabolized to sphingoid bases in the intestine. However, ceramide is only found in trace amounts in food plants and thus is frequently taken as GlcCer in a health supplement. In the present study, we successfully prepared konjac ceramide (kCer using endoglycoceramidase I (EGCase I. Konjac, a plant tuber, is an enriched source of GlcCer (kGlcCer, and has been commercialized as a dietary supplement to improve dry skin and itching that are caused by a deficiency of epidermal ceramide. Nerve growth factor (NGF produced by skin cells is one of the itch factors in the stratum corneum of the skin. Semaphorin 3A (Sema 3A has been known to inhibit NGF-induced neurite outgrowth of epidermal nerve fibers. It is well known that the itch sensation is regulated by the balance between NGF and Sema 3A. In the present study, while kGlcCer did not show an in vitro inhibitory effect on NGF-induced neurite outgrowth of PC12 cells, kCer was demonstrated to inhibit a remarkable neurite outgrowth. In addition, the effect of kCer was similar to that of Sema 3A in cell morphological changes and neurite retractions, but different from C2-Ceramide. kCer showed a Sema 3A-like action, causing CRMP2 phosphorylation, which results in a collapse of neurite growth cones. Thus, it is expected that kCer is an advanced konjac ceramide material that may have neurite outgrowth-specific action to relieve uncontrolled and serious itching, in particular, from atopic eczema.

  20. Autocrine Semaphorin3A signaling is essential for the maintenance of stem-like cells in lung cancer

    International Nuclear Information System (INIS)

    Yamada, Daisuke; Takahashi, Kensuke; Kawahara, Kohichi; Maeda, Takehiko

    2016-01-01

    Cancer stem-like cells (CSCs) exist in tumor tissues composed of heterogeneous cell population and are characterized by their self-renewal capacity and tumorigenicity. Many studies demonstrate that eradication of CSCs prevents development and recurrences of tumor; yet, molecules critical for the maintenance of CSCs have not been completely understood. We previously reported that Semaphorin3A (Sema3a) knockdown suppressed the tumorigenicity and proliferative capacity of Lewis lung carcinoma (LLC) cells. Therefore, we identified Sema3a as an essential factor for the establishment or maintenance of CSCs derived from LLC (LLC-stem cell). shRNA against Sema3a was introduced into LLC cells to establish a LLC-stem cell line and its effects on tumorigenesis, sphere formation, and mTORC1 activity were tested. Sema3a knockdown completely abolished tumorigenicity and the sphere-formation and self-renewal ability of LLC-stem cells. The Sema3a knockdown was also associated with decreased expression of mRNA for stem cell markers. The self-renewal ability abolished by Sema3a knockdown could not be recovered by exogenous addition of recombinant SEMA3A. In addition, the activity of mammalian target of rapamycin complex 1 (mTORC1) and the expression of its substrate p70S6K1 were also decreased. These results demonstrate that Sema3a is a potential therapeutic target in eradication of CSCs. - Highlights: • Sema3a enhances tumorigenic capacity of cancer stem-like cells. • Sema3a is essential for the maintenance of cancer stem-like cells. • Sema3a can be a therapeutic target to eradicate cancer stem-like cells.

  1. GPM GROUND VALIDATION KICT NEXRAD MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validaiton KICT NEXRAD MC3E dataset was collected from April 22, 2011 to June 6, 2011 for the Midlatitude Continental Convective Clouds Experiment...

  2. GPM GROUND VALIDATION PAWNEE RADAR MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Pawnee radar data for the Midlatitude Continental Convective Clouds Experiment (MC3E) held in Oklahoma were collected on May 24, 2011 to support the CHILL radar...

  3. GPM GROUND VALIDATION CHILL RADAR MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The CHILL radar data for the Midlatitude Continental Convective Clouds Experiment (MC3E) held in Oklahoma were collected while the NASA ER-2 aircraft conducted a...

  4. Increased urine semaphorin-3A is associated with renal damage in hypertensive patients with chronic kidney disease: a nested case-control study.

    Science.gov (United States)

    Viazzi, Francesca; Ramesh, Ganesan; Jayakumar, Calpurnia; Leoncini, Giovanna; Garneri, Debora; Pontremoli, Roberto

    2015-06-01

    Semaphorins are guidance proteins implicated in several processes such as angiogenesis, organogenesis, cell migration, and cytokine release. Experimental studies showed that semaphorin-3a (SEMA3A) administration induces transient massive proteinuria, podocyte foot process effacement and endothelial cell damage in healthy animals. While SEMA3A signaling has been demonstrated to be mechanistically involved in experimental diabetic glomerulopathy and in acute kidney injury, to date its role in human chronic kidney disease (CKD) has not been investigated. To test the hypothesis that SEMA3A may play a role in human CKD, we performed a cross-sectional, nested, case-control study on 151 matched hypertensive patients with and without CKD. SEMA3A was quantified in the urine (USEMA) by ELISA. Glomerular filtration rate was estimated (eGFR) by the CKD-EPI formula and albuminuria was measured as albumin-to-creatinine ratio (ACR). USEMA levels were positively correlated with urine ACR (p = 0.001) and serum creatinine (p < 0.001). USEMA was higher in patients with both components of renal damage as compared to those with only one and those with normal renal function (p < 0.007 and <0.001, respectively). The presence of increased USEMA levels (i.e. top quartile) entailed a fourfold higher risk of combined renal damage (p < 0.001) and an almost twofold higher risk of macroalbuminuria (p = 0.005) or of reduced eGFR, even adjusting for confounding factors (p = 0.002). USEMA is independently associated with CKD in both diabetic and non diabetic hypertensive patients. Further studies may help clarify the mechanisms underlying this association and possibly the pathogenic changes leading to the development of CKD.

  5. Semaphorin7A promotes tumor growth and exerts a pro-angiogenic effect in macrophages of mammary tumor-bearing mice

    Directory of Open Access Journals (Sweden)

    Ramon eGarcia-Areas

    2014-02-01

    Full Text Available Semaphorins, a large family of molecules involved in the axonal guidance and development of the nervous system, have been recently shown to have both angiogenic and anti-angiogenic properties. Specifically, semaphorin 7A (SEMA7A has been reported to have a chemotactic activity in neurogenesis, and to be an immune modulator via it binding to α1β1integrins. Additionally, SEMA7A has been shown to promote chemotaxis of monocytes, inducing them to produce proinflammatory mediators. In this study we explored the role of SEMA7A in the tumoral context. We show that SEMA7A is highly expressed by DA-3 murine mammary tumor cells in comparison to normal mammary cells (EpH4, and that peritoneal macrophages from mammary tumor-bearing mice also express SEMA7A at higher levels compared to peritoneal macrophages derived from normal control mice. We also show that murine macrophages treated with recombinant murine SEMA7A significantly increased their expression of proangiogenic molecules, such as CXCL2/MIP-2. Gene silencing of SEMA7A in peritoneal elicited macrophages from DA-3 tumor-bearing mice resulted in decreased CXCL2 expression. Mice implanted with SEMA7A silenced tumor cells showed decreased angiogenesis in the tumors compared to the wild type tumors. Furthermore, peritoneal elicited macrophages from mice bearing SEMA7A-silenced tumors produce significantly (p< 0.01 lower levels of angiogenic proteins, such as MIP-2, CXCL1 and MMP-9, compared to macrophages from control DA-3 mammary tumors. We postulate that SEMA7A derived from mammary carcinomas may serve as a monocyte chemoattractant and skew monocytes into a pro-tumorigenic phenotype. A putative relationship between tumor-derived SEMA7A and monocytes could prove valuable in establishing new research avenues towards unraveling important tumor-host immune interactions in breast cancer patients.

  6. The Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Mark P.; Petersen, Walt A.; Bansemer, Aaron; Bharadwaj, Nitin; Carey, Larry; Cecil, D. J.; Collis, Scott M.; Del Genio, Anthony D.; Dolan, Brenda A.; Gerlach, J.; Giangrande, Scott; Heymsfield, Andrew J.; Heymsfield, Gerald; Kollias, Pavlos; Lang, T. J.; Nesbitt, Steve W.; Neumann, Andrea; Poellot, M. R.; Rutledge, Steven A.; Schwaller, Mathew R.; Tokay, Ali; Williams, C. R.; Wolff, D. B.; Xie, Shaocheng; Zipser, Edward J.

    2016-10-18

    The Midlatitude Continental Convective Clouds Experiment (MC3E), a field program jointly led by the U.S. Department of Energy’s Atmospheric Radiation Measurement program and the NASA Global Precipitation Measurement (GPM) Mission, was conducted in south-central Oklahoma during April – May 2011. MC3E science objectives were motivated by the need to improve understanding of midlatitude continental convective cloud system lifecycles, microphysics, and GPM precipitation retrieval algorithms. To achieve these objectives a multi-scale surface- and aircraft-based in situ and remote sensing observing strategy was employed. A variety of cloud and precipitation events were sampled during the MC3E, of which results from three deep convective events are highlighted. Vertical structure, air motions, precipitation drop-size distributions and ice properties were retrieved from multi-wavelength radar, profiler, and aircraft observations for an MCS on 11 May. Aircraft observations for another MCS observed on 20 May were used to test agreement between observed radar reflectivities and those calculated with forward-modeled reflectivity and microwave brightness temperatures using in situ particle size distributions and ice water content. Multi-platform observations of a supercell that occurred on 23 May allowed for an integrated analysis of kinematic and microphysical interactions. A core updraft of 25 ms-1 supported growth of hail and large rain drops. Data collected during the MC3E campaign is being used in a number of current and ongoing research projects and is available through the DOE ARM and NASA data archives.

  7. Mechanics and cooling of the Mu3e detector

    Energy Technology Data Exchange (ETDEWEB)

    Austermuehl, Rene Philipp; Henkelmann, Lars; Herkert, Adrian; Ng, Yanwing [Physikalisches Institut, Uni Heidelberg (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    The Mu3e experiment will search for the charged lepton flavour violating decay μ{sup +} → e{sup +}e{sup -}e{sup +}, which is suppressed to unobservable levels in the Standard Model. A signal would be a clear sign of new physics. The aim is to reach a sensitivity for the branching ratio of 10{sup -16}, which requires high momentum resolution. Since the muons will decay at rest on target, the energy of the decay electrons will be E≤53 MeV. In this energy regime the momentum resolution is limited by multiple scattering in the detector material. Therefore, the Mu3e detector, including support structure and services, has to consist of as little material as possible in the active region. The main component of the detector is a pixel tracker consisting of four barrels of high voltage monolithic active pixel sensors (HV-MAPS) that can be thinned to 50 μm. A power consumption of 400 mW/cm{sup 2} is expected. To keep the material budget low, it is planned to cool with gaseous helium. In this talk results of computational fluid dynamics simulations of the Mu3e cooling system and experimental tests concerning the detector's stability against flow-induced vibrations are presented.

  8. Flex-prints for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Dittmeier, Sebastian [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    Mu3e is a novel experiment dedicated to the search for the charged lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a targeted sensitivity of a branching ratio (BR) down to 10{sup -16}. Within the standard model of particle physics this process is extremely suppressed to BR<10{sup -54}. Thus, any observation would be a clear sign for new physics beyond the standard model. The Mu3e detector consists of a silicon pixel tracking detector using the novel HV-MAPS (High Voltage Monolithic Active Pixel Sensor) technology to measure the momentum of the decay products, and scintillating fibres and tiles for precise timing. The pixel sensors are thinned to 50 μ m to achieve a material budget of about 0.1% radiation length per tracking layer. The pixel sensors are powered and connected to readout frontend boards using custom designed flex-prints, which are low material interconnects with a high signal density. We present studies of high speed data transmission up to 3.2 Gb/s over flex-print prototypes produced in-house. The design of the flex-prints for the Mu3e detector will be discussed. A 3-layer design including power, ground and slow control distribution, as well as 9 1.25 Gb/s data transmission lines for the readout of the pixel sensors is foreseen.

  9. Immobilization of chitosan film containing semaphorin 3A onto a microarc oxidized titanium implant surface via silane reaction to improve MG63 osteogenic differentiation

    Directory of Open Access Journals (Sweden)

    Fang K

    2014-10-01

    Full Text Available Kaixiu Fang,1,* Wen Song,2,* Lifeng Wang,1 Sen Jia,3 Hongbo Wei,1 Shuai Ren,1 Xiaoru Xu,1 Yingliang Song1 1State Key Laboratory of Military Stomatology, Department of Implant Dentistry, School of Stomatology, Fourth Military Medical University, Xi’an, People’s Republic of China; 2State Key Laboratory of Military Stomatology, Department of Prosthetic Dentistry, School of Stomatology, Fourth Military Medical University, Xi’an, People’s Republic of China; 3State Key Laboratory of Military Stomatology, Department of Oral and Maxillofacial Surgery, School of Stomatology, Fourth Military Medical University, Xi’an, People’s Republic of China *These authors contributed equally to this work Abstract: Improving osseointegration of extensively used titanium (Ti implants still remains a main theme in implantology. Recently, grafting biomolecules onto a Ti surface has attracted more attention due to their direct participation in the osseointegration process around the implant. Semaphorin 3A (Sema3A is a new proven osteoprotection molecule and is considered to be a promising therapeutic agent in bone diseases, but how to immobilize the protein onto a Ti surface to acquire a long-term effect is poorly defined. In our study, we tried to use chitosan to wrap Sema3A (CS/Sema and connect to the microarc oxidized Ti surface via silane glutaraldehyde coupling. The microarc oxidization could formulate porous topography on a Ti surface, and the covalently bonded coating was homogeneously covered on the ridges between the pores without significant influence on the original topography. A burst release of Sema3A was observed in the first few days in phosphate-buffered saline and could be maintained for >2 weeks. Coating in phosphate-buffered saline containing lysozyme was similar, but the release rate was much more rapid. The coating did not significantly affect cellular adhesion, viability, or cytoskeleton arrangement, but the osteogenic-related gene

  10. The hypoxia-inducible factor-responsive proteins semaphorin 4D and vascular endothelial growth factor promote tumor growth and angiogenesis in oral squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Hua; Yang, Ying-Hua [Department of Oncology and Diagnostic Sciences, University of Maryland Dental School, 650W. Baltimore Street, 7-North, Baltimore, MD 21201 (United States); Binmadi, Nada O. [Department of Oncology and Diagnostic Sciences, University of Maryland Dental School, 650W. Baltimore Street, 7-North, Baltimore, MD 21201 (United States); Department of Oral Basic and Clinical Sciences, King Abdulaziz University, Jeddah 21589 (Saudi Arabia); Proia, Patrizia [Department of Oncology and Diagnostic Sciences, University of Maryland Dental School, 650W. Baltimore Street, 7-North, Baltimore, MD 21201 (United States); Department of Sports Science (DISMOT), University of Palermo, Via Eleonora Duse 2 90146, Palermo (Italy); Basile, John R., E-mail: jbasile@umaryland.edu [Department of Oncology and Diagnostic Sciences, University of Maryland Dental School, 650W. Baltimore Street, 7-North, Baltimore, MD 21201 (United States); Greenebaum Cancer Center, 22S. Greene Street, Baltimore, MD 21201 (United States)

    2012-08-15

    Growth and metastasis of solid tumors requires induction of angiogenesis to ensure the delivery of oxygen, nutrients and growth factors to rapidly dividing transformed cells. Through either mutations, hypoxia generated by cytoreductive therapies, or when a malignancy outgrows its blood supply, tumor cells undergo a change from an avascular to a neovascular phenotype, a transition mediated by the hypoxia-inducible factor (HIF) family of transcriptional regulators. Vascular endothelial growth factor (VEGF) is one example of a gene whose transcription is stimulated by HIF. VEGF plays a crucial role in promoting tumor growth and survival by stimulating new blood vessel growth in response to such stresses as chemotherapy or radiotherapy-induced hypoxia, and it therefore has become a tempting target for neutralizing antibodies in the treatment of advanced neoplasms. Emerging evidence has shown that the semaphorins, proteins originally associated with control of axonal growth and immunity, are regulated by changes in oxygen tension as well and may play a role in tumor-induced angiogenesis. Through the use of RNA interference, in vitro and in vivo angiogenesis assays and tumor xenograft experiments, we demonstrate that expression of semaphorin 4D (SEMA4D), which is under the control of the HIF-family of transcription factors, cooperates with VEGF to promote tumor growth and vascularity in oral squamous cell carcinoma (OSCC). We use blocking antibodies to show that targeting SEMA4D function along with VEGF could represent a novel anti-angiogenic therapeutic strategy for the treatment of OSCC and other solid tumors. -- Highlights: Black-Right-Pointing-Pointer Similar to VEGF, SEMA4D promotes angiogenesis in vitro and in vivo. Black-Right-Pointing-Pointer Both VEGF and SEMA4D are produced by OSCC cells in a HIF-dependent manner. Black-Right-Pointing-Pointer These factors combine to elicit a robust pro-angiogenic phenotype in OSCC. Black-Right-Pointing-Pointer Anti-SEMA4D

  11. The hypoxia-inducible factor-responsive proteins semaphorin 4D and vascular endothelial growth factor promote tumor growth and angiogenesis in oral squamous cell carcinoma

    International Nuclear Information System (INIS)

    Zhou, Hua; Yang, Ying-Hua; Binmadi, Nada O.; Proia, Patrizia; Basile, John R.

    2012-01-01

    Growth and metastasis of solid tumors requires induction of angiogenesis to ensure the delivery of oxygen, nutrients and growth factors to rapidly dividing transformed cells. Through either mutations, hypoxia generated by cytoreductive therapies, or when a malignancy outgrows its blood supply, tumor cells undergo a change from an avascular to a neovascular phenotype, a transition mediated by the hypoxia-inducible factor (HIF) family of transcriptional regulators. Vascular endothelial growth factor (VEGF) is one example of a gene whose transcription is stimulated by HIF. VEGF plays a crucial role in promoting tumor growth and survival by stimulating new blood vessel growth in response to such stresses as chemotherapy or radiotherapy-induced hypoxia, and it therefore has become a tempting target for neutralizing antibodies in the treatment of advanced neoplasms. Emerging evidence has shown that the semaphorins, proteins originally associated with control of axonal growth and immunity, are regulated by changes in oxygen tension as well and may play a role in tumor-induced angiogenesis. Through the use of RNA interference, in vitro and in vivo angiogenesis assays and tumor xenograft experiments, we demonstrate that expression of semaphorin 4D (SEMA4D), which is under the control of the HIF-family of transcription factors, cooperates with VEGF to promote tumor growth and vascularity in oral squamous cell carcinoma (OSCC). We use blocking antibodies to show that targeting SEMA4D function along with VEGF could represent a novel anti-angiogenic therapeutic strategy for the treatment of OSCC and other solid tumors. -- Highlights: ► Similar to VEGF, SEMA4D promotes angiogenesis in vitro and in vivo. ► Both VEGF and SEMA4D are produced by OSCC cells in a HIF-dependent manner. ► These factors combine to elicit a robust pro-angiogenic phenotype in OSCC. ► Anti-SEMA4D blocking antibody inhibits Plexin-B1 activation. ► SEMA4D is a valid anti-angiogenic target in the

  12. 3E model for a small HEPP design

    International Nuclear Information System (INIS)

    Tesnjak, S.; Krznaric, M.; Buinac, R.; Lipovaca, N.

    2012-01-01

    Small HEPPs in every electric power system are classified as renewable energy sources. The 3E model works out fundamental power characteristics of small HEPPs, analyzes their impact on the environment and explains the financial analysis of costs, revenues, and economic methods of evaluating the project. The advantages of small HEPPs include low distribution costs, no negative impact on the environment unlike large HEPPs, and lower maintenance costs. All the above benefits depend on the proper choice of the power plant equipment, object design, as well as advantages and disadvantages in every particular situation. (Authors)

  13. Synapsin III Acts Downstream of Semaphorin 3A/CDK5 Signaling to Regulate Radial Migration and Orientation of Pyramidal Neurons In Vivo

    Directory of Open Access Journals (Sweden)

    Laura E. Perlini

    2015-04-01

    Full Text Available Synapsin III (SynIII is a phosphoprotein that is highly expressed at early stages of neuronal development. Whereas in vitro evidence suggests a role for SynIII in neuronal differentiation, in vivo evidence is lacking. Here, we demonstrate that in vivo downregulation of SynIII expression affects neuronal migration and orientation. By contrast, SynIII overexpression affects neuronal migration, but not orientation. We identify a cyclin-dependent kinase-5 (CDK5 phosphorylation site on SynIII and use phosphomutant rescue experiments to demonstrate its role in SynIII function. Finally, we show that SynIII phosphorylation at the CDK5 site is induced by activation of the semaphorin-3A (Sema3A pathway, which is implicated in migration and orientation of cortical pyramidal neurons (PNs and is known to activate CDK5. Thus, fine-tuning of SynIII expression and phosphorylation by CDK5 activation through Sema3A activity is essential for proper neuronal migration and orientation.

  14. Superfluid H3e in globally isotropic random media

    Science.gov (United States)

    Ikeda, Ryusuke; Aoyama, Kazushi

    2009-02-01

    Recent theoretical and experimental studies of superfluid H3e in aerogels with a global anisotropy created, e.g., by an external stress have definitely shown that the A -like phase with an equal-spin pairing in such aerogel samples is in the Anderson-Brinkman-Morel (ABM) (or axial) pairing state. In this paper, the A -like phase of superfluid H3e in globally isotropic aerogel is studied in detail by assuming a weakly disordered system in which singular topological defects are absent. Through calculation of the free energy, a disordered ABM state is found to be the best candidate of the pairing state of the globally isotropic A -like phase. Further, it is found through a one-loop renormalization-group calculation that the coreless continuous vortices (or vortex-Skyrmions) are irrelevant to the long-distance behavior of disorder-induced textures, and that the superfluidity is maintained in spite of lack of the conventional superfluid long-range order. Therefore, the globally isotropic A -like phase at weak disorder is, like in the case with a globally stretched anisotropy, a glass phase with the ABM pairing and shows superfluidity.

  15. Track based alignment of the Mu3e detector

    Energy Technology Data Exchange (ETDEWEB)

    Hartenstein, Ulrich [Institut fuer Kernphysik, Universitaet Mainz (Germany)

    2016-07-01

    The Mu3e experiment searches for the lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a sensitivity goal for the branching fraction of better than 10{sup -16}. This process is heavily supressed in the standard model of particle physics (BR < 10{sup -50}) which makes an observation of this decay a clear indication of new physics. For track reconstruction, four barrel shaped layers consisting of about 3000 high-voltage monolithic active pixel sensors (HV-MAPS) are used. The position, orientation and possible deformations of these sensors must be known to greater precision than the assembly tolerances. A track based alignment via the General Broken Lines fit and the Millepede-II algorithm will be used to achieve this precision in the final detector. The talk discusses a study of the required alignment precision and preparations for aligning the detector using a detailed simulation.

  16. Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

    2010-04-10

    The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available.

  17. Fast optical readout for Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Qinhua [Institut fuer Kernphysik, Universitaet Mainz, Mainz (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    Charged lepton flavour violation is highly suppressed in the Standard Model, which results in a prediction for the branching ratio of μ{sup +}→e{sup +}e{sup +}e{sup -} below O(10{sup -54}). The Mu3e experiment will search for this rare decay with a sensitivity of 10{sup -16}. An observation would be a clear sign for new physics. A high muon stopping rate of 2.10{sup 9} Hz is required so that sufficient statistics can be accumulated in about one year of data taking. The high event rate and the requirement of a full online track reconstruction demand a fast readout system which should provide a bandwidth above 1 Tbit/s. Reconfigurable devices, namely FPGAs, can easily parallelise the data processing, so it becomes possible to sort, merge, pack and route the data with low latency at high throughput. Optical fibres are the only option for the interconnection between different FPGA-based boards. The fibres also reduce the crosstalk and signal attenuation, especially over long distance links. As part of the readout system prototyping, firmware for synchronous merging of different data streams is being developed. In addition, the optical links have been tested and show a bit error rate below O(10{sup -16}) at 6.4 Gbit/s for a single fibre.

  18. Tax and Semaphorin 4D Released from Lymphocytes Infected with Human Lymphotropic Virus Type 1 and Their Effect on Neurite Growth.

    Science.gov (United States)

    Quintremil, Sebastián; Alberti, Carolina; Rivera, Matías; Medina, Fernando; Puente, Javier; Cartier, Luis; Ramírez, Eugenio; Tanaka, Yuetsu; Valenzuela, M Antonieta

    2016-01-01

    Human lymphotropic virus type 1 (HTLV-1) is a retrovirus causing HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP), a neurodegenerative central nervous system (CNS) axonopathy. This virus mainly infects CD4(+) T lymphocytes without evidence of neuronal infection. Viral Tax, secreted from infected lymphocytes infiltrated in the CNS, is proposed to alter intracellular pathways related to axonal cytoskeleton dynamics, producing neurological damage. Previous reports showed a higher proteolytic release of soluble Semaphorin 4D (sSEMA-4D) from CD4(+) T cells infected with HTLV-1. Soluble SEMA-4D binds to its receptor Plexin-B1, activating axonal growth collapse pathways in the CNS. In the current study, an increase was found in both SEMA-4D in CD4(+) T cells and sSEMA-4D released to the culture medium of peripheral blood mononuclear cells (PBMCs) from HAM/TSP patients compared to asymptomatic carriers and healthy donors. After a 16-h culture, infected PBMCs showed significantly higher levels of CRMP-2 phosphorylated at Ser(522). The effect was blocked either with anti-Tax or anti-SEMA-4D antibodies. The interaction of Tax and sSEMA-4D was found in secreted medium of PBMCs in patients, which might be associated with a leading role of Tax with the SEMA-4D-Plexin-B1 signaling pathway. In infected PBMCs, the migratory response after transwell assay showed that sSEMA-4D responding cells were CD4(+)Tax(+) T cells with a high CRMP-2 pSer(522) content. In the present study, the participation of Tax-sSEMA-4D in the reduction in neurite growth in PC12 cells produced by MT2 (HTLV-1-infected cell line) culture medium was observed. These results lead to the participation of plexins in the reported effects of infected lymphocytes on neuronal cells.

  19. Semaphorin4D Drives CD8+ T-Cell Lesional Trafficking in Oral Lichen Planus via CXCL9/CXCL10 Upregulations in Oral Keratinocytes.

    Science.gov (United States)

    Ke, Yao; Dang, Erle; Shen, Shengxian; Zhang, Tongmei; Qiao, Hongjiang; Chang, Yuqian; Liu, Qing; Wang, Gang

    2017-11-01

    Chemokine-mediated CD8 + T-cell recruitment is an essential but not well-established event for the persistence of oral lichen planus (OLP). Semaphorin 4D (Sema4D)/CD100 is implicated in immune dysfunction, chemokine modulation, and cell migration, which are critical aspects for OLP progression, but its implication in OLP pathogenesis has not been determined. In this study, we sought to explicate the effect of Sema4D on human oral keratinocytes and its capacity to drive CD8 + T-cell lesional trafficking via chemokine modulation. We found that upregulations of sSema4D in OLP tissues and blood were positively correlated with disease severity and activity. In vitro observation revealed that Sema4D induced C-X-C motif chemokine ligand 9/C-X-C motif chemokine ligand 10 production by binding to plexin-B1 via protein kinase B-NF-κB cascade in human oral keratinocytes, which elicited OLP CD8 + T-cell migration. We also confirmed using clinical samples that elevated C-X-C motif chemokine ligand 9/C-X-C motif chemokine ligand 10 levels were positively correlated with sSema4D levels in OLP lesions and serum. Notably, we determined matrix metalloproteinase-9 as a new proteolytic enzyme for the cleavage of sSema4D from the T-cell surface, which may contribute to the high levels of sSema4D in OLP lesions and serum. Our findings conclusively revealed an amplification feedback loop involving T cells, chemokines, and Sema4D-dependent signal that promotes OLP progression. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  20. Climate Change Communicators: The C3E3 Project

    Science.gov (United States)

    Sharif, H. O.; Joseph, J.

    2013-12-01

    The University of Texas at San Antonio (UTSA), San Antonio College (SAC), and the University of North Dakota (UND) have partnered with NASA to provide underrepresented undergraduates from UTSA, SAC, and other community colleges climate-related research and education experiences through the Climate Change Communication: Engineer, Environmental science, and Education (C3E3) project. The program aims to develop a robust response to climate change by providing K-16 climate change education; enhance the effectiveness of K-16 education particularly in engineering and other STEM disciplines by use of new instructional technologies; increase the enrollment in engineering programs and the number of engineering degrees awarded by showing engineering's usefulness in relation to the much-discussed contemporary issue of climate change; increase persistence in STEM degrees by providing student research opportunities; and increase the ethnic diversity of those receiving engineering degrees and help ensure an ethnically diverse response to climate change. Students participated in the second summer internship funded by the project. More than 60 students participated in guided research experiences aligned with NASA Science Plan objectives for climate and Earth system science and the educational objectives of the three institutions. The students went through training in modern media technology (webcasts), and in using this technology to communicate the information on climate change to others, especially high school students, culminating in production of webcasts on investigating the aspects of climate change using NASA data. Content developed is leveraged by NASA Earth observation data and NASA Earth system models and tools. Several departments are involved in the educational program.

  1. Midlatitude Continental Convective Clouds Experiment (MC3E)

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

    2010-04-01

    Convective processes play a critical role in the Earth’s energy balance through the redistribution of heat and moisture in the atmosphere and subsequent impacts on the hydrologic cycle. Global observation and accurate representation of these processes in numerical models is vital to improving our current understanding and future simulations of Earth’s climate system. Despite improvements in computing power, current operational weather and global climate models are unable to resolve the natural temporal and spatial scales that are associated with convective and stratiform precipitation processes; therefore, they must turn to parameterization schemes to represent these processes. In turn, the physical basis for these parameterization schemes needs to be evaluated for general application under a variety of atmospheric conditions. Analogously, space-based remote sensing algorithms designed to retrieve related cloud and precipitation information for use in hydrological, climate, and numerical weather prediction applications often rely on physical “parameterizations” that reliably translate indirectly related instrument measurements to the physical quantity of interest (e.g., precipitation rate). Importantly, both spaceborne retrieval algorithms and model convective parameterization schemes traditionally rely on field campaign data sets as a basis for evaluating and improving the physics of their respective approaches. The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States

  2. GPM GROUND VALIDATION NCAR CLOUD MICROPHYSICS PARTICLE PROBES MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation NCAR Cloud Microphysics Particle Probes MC3E dataset was collected during the Midlatitude Continental Convective Clouds Experiment (MC3E),...

  3. GPM GROUND VALIDATION OKLAHOMA CLIMATOLOGICAL SURVEY MESONET MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation Oklahoma Climatological Survey Mesonet MC3E data were collected during the Midlatitude Continental Convective Clouds Experiment (MC3E) in...

  4. GPM GROUND VALIDATION NOAA S-BAND PROFILER MINUTE DATA MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation NOAA S-Band Profiler Minute Data MC3E dataset was gathered during the Midlatitude Continental Convective Clouds Experiment (MC3E) in...

  5. GPM GROUND VALIDATION COMPOSITE SATELLITE OVERPASSES MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation Composite Satellite Overpasses MC3E dataset provides satellite overpasses from the AQUA satellite during the Midlatitude Continental...

  6. (e,3e) collisions on He in the quasi-dipolar regime

    International Nuclear Information System (INIS)

    Taouil, I.; Lahmam-Bennani, A.; Duguet, A.

    1999-01-01

    We report the first measurement of the angular distributions of the two ejected electrons following electron impact double ionization of helium, using a multi-parameter (e,3e) spectrometer. The high incident energy of these experiments allows comparison with photo-double ionization results. Comparison is also made with existing (e,3e) theoretical calculations. (orig.)

  7. Data of evolutionary structure change: 1RAAA-3E2PM [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1RAAA-3E2PM 1RAA 3E2P A M ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQ----... 1RAA A 1RAAA KANPQ----PELLK 1 1RAA A 1RAAA... 345 ILE CA 291 1RAA A 1RAAA...dbChain> 1RAAA TEFSGNVPVLN HHHH

  8. GPM GROUND VALIDATION CONICAL SCANNING MILLIMETER-WAVE IMAGING RADIOMETER (COSMIR) MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation Conical Scanning Millimeter-wave Imaging Radiometer (COSMIR) MC3E dataset used the Conical Scanning Millimeter-wave Imaging Radiometer...

  9. GPM GROUND VALIDATION NASA MICRO RAIN RADAR (MRR) MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation NASA Micro Rain Radar (MRR) MC3E dataset was collected by a Micro Rain Radar (MRR), which is a vertically pointing Doppler radar which...

  10. GPM GROUND VALIDATION NASA ER-2 NAVIGATION DATA MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation NASA ER-2 Navigation Data MC3E dataset contains information recorded by an on board navigation recorder (NavRec). In addition to typical...

  11. Scaling of cross-sections for asymmetric (e,3e) process on helium ...

    Indian Academy of Sciences (India)

    , India ... (e, 3e) process; five-fold differential cross-section; scaling; helium isoelec- tronic ions. ... ration and experimental control of the target and the intensity related problems make the measurements extremely difficult. The scaling laws of ...

  12. GPM GROUND VALIDATION NOAA UHF 449 PROFILER RAW DATA SPC FORMAT MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The NOAA UHF 449 Profiler Raw SPC foramt data was collected during the NASA supported Midlatitude Continental Convective Clouds Experiment (MC3E). The Ultra High...

  13. GPM GROUND VALIDATION NOAA UHF 449 PROFILER RAW DATA SPC FORMAT MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation NOAA UHF 449 Profiler Raw Data SPC Format MC3E dataset was collected during the NASA supported Midlatitude Continental Convective Clouds...

  14. GPM GROUND VALIDATION SATELLITE SIMULATED ORBITS MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The GPM Ground Validation Satellite Simulated Orbits MC3E dataset is available in the Orbital database , which takes account for the atmospheric profiles, the...

  15. GPM GROUND VALIDATION NOAA S-BAND PROFILER ORIGINAL DWELL DATA MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The S-band Profiler Original Dwell dataset in the netCDF format was gathered during the Midlatitude Continental Convective Clouds Experiment (MC3E) in Oklahoma...

  16. Calcification of MC3T3-E1 cells on titanium and zirconium.

    Science.gov (United States)

    Umezawa, Takayuki; Chen, Peng; Tsutsumi, Yusuke; Doi, Hisashi; Ashida, Maki; Suzuki, Shoichi; Moriyama, Keiji; Hanawa, Takao

    2015-01-01

    To confirm similarity of hard tissue compatibility between titanium and zirconium, calcification of MC3T3-E1 cells on titanium and zirconium was evaluated in this study. Mirror-polished titanium (Ti) and zirconium (Zr) disks and zirconium-sputter deposited titanium (Zr/Ti) were employed in this study. The surface of specimens were characterized using scanning electron microscopy and X-ray diffraction. Then, the cellular proliferation, differentiation and calcification of MC3T3-E1 cells on specimens were investigated. The surface of Zr/Ti was much smoother and cleaner than those of Ti and Zr. The proliferation of the cell was the same among three specimens, while the differentiation and calcification on Zr/Ti were faster than those on Ti and Zr. Therefore, Ti and Zr showed the identical hard tissue compatibility according to the evaluation with MC3T3-E1 cells. Sputter deposition may improve cytocompatibility.

  17. Re-engineering and evaluation of anti-DNA autoantibody 3E10 for therapeutic applications.

    Science.gov (United States)

    Rattray, Zahra; Dubljevic, Valentina; Rattray, Nicholas J W; Greenwood, Deanne L; Johnson, Caroline H; Campbell, James A; Hansen, James E

    2018-02-12

    A key challenge in the development of novel chemotherapeutics is the design of molecules capable of selective toxicity to cancer cells. Antibodies have greater target specificity compared to small molecule drugs, but most are unable to penetrate cells, and predominantly target extracellular antigens. A nuclear-penetrating anti-DNA autoantibody isolated from the MRL/lpr lupus mouse model, 3E10, preferentially localizes to tumors, inhibits DNA repair, and selectively kills cancer cells with defects in DNA repair. A murine divalent single chain variable fragment of 3E10 with mutations for improved DNA binding affinity, 3E10 (D31N) di-scFv, has previously been produced in P. pastoris and yielded promising pre-clinical findings, but is unsuitable for clinical testing. The present study reports the design, expression and testing of a panel of humanized 3E10 (D31N) di-scFvs, some of which contain CDR substitution. These variants were expressed in a modified CHO system and evaluated for their physicochemical attributes and ability to penetrate nuclei to selectively cause DNA damage accumulation in and kill cancer cells with DNA repair defects. Secondary structure was conserved and most variants retained the key characteristics of the murine 3E10 (D31N) di-scFv produced in P. pastoris. Moreover, several variants with CDR substitutions outperformed the murine prototype. In conclusion, we have designed several humanized variants of 3E10 (D31N) di-scFv that have potential for application as monotherapy or conjugates for targeted nuclear drug delivery. Copyright © 2018 Elsevier Inc. All rights reserved.

  18. Divalent Metal Ions Induced Osteogenic Differentiation of MC3T3E1

    Science.gov (United States)

    Wang, Guoshou; Su, Wenta; Chen, Pohung; Huang, Teyang

    2017-12-01

    Biomaterial scaffolds blended with biochemical signal molecules with adequate osteoinductive and osteoconductive properties have attracted significant interest in bone tissue engineering regeneration. The divalent metal ions can gradually release from the scaffold into the culture medium and then induced osteoblastic differentiation of MC3T3E1. These MC3T3E1 cells expressed high activity of alkaline phosphatase, bone-related gene expression of collagen type I, Runx2, osteopontin, osteocalcin, and significantly enhanced deposited minerals on scaffold after 21 days of culture. This experiment provided a useful inducer for osteogenic differentiation in bone repair.

  19. 3E. Climate policy plan Delft, Netherlands, 2003-2012. Effectiveness, Efficiency, Energy Consumption

    International Nuclear Information System (INIS)

    2003-09-01

    The 3E: Klimaatplan Delft; (Delft Climate Plan)' is the Delft interpretation of the Kyoto Convention, and is furthermore in line with the objectives of '3D: Duurzaamheidsplan Delft 2000-2003; (2002-2003 Delft Sustainability Plan)'. 3E stands for: effective, efficient energy consumption. The principal objective is an annual reduction of 33,500 tons of CO2 emissions, compared to 1999. This level of reduction should be realised not later than by 2012 (the final year of the plan period). On the basis of the Climate Scan performed by Novem, the largest environmental gain appears to come from (re-)construction processes and the use of sustainable energy [nl

  20. Occupational Analysis Products: Operations Management- AFSC 3E6X1 (CD-ROM)

    Science.gov (United States)

    computer laser optical disc (CD-ROM); 4 3/4 in.; 23.4 MB. SYSTEMS DETAIL NOTE: ABSTRACT: This is a report of an occupational survey of the Operations ... Management (AFSC 3E6X1, OSSN 2560, Feb 04) career ladder, conducted by the Occupational Analysis Flight, AFOMS. The OSR reports the findings of current

  1. The I3E Model for Embedding Education for Sustainability within Higher Education Institutions

    Science.gov (United States)

    Cebrián, Gisela

    2018-01-01

    This paper presents an evidence-based model (the I3E model) for embedding education for sustainability (EfS) within a higher education institution. This model emerged from a doctoral research that examined organisational learning and change processes at the University of Southampton to build EfS into the university curriculum. The researcher aimed…

  2. Osteogenic gene expression of murine osteoblastic (MC3T3-E1) cells under cyclic tension

    International Nuclear Information System (INIS)

    Kao, C T; Chen, C C; Cheong, U-I; Liu, S L; Huang, T H

    2014-01-01

    Low-level laser therapy (LLLT) can promote cell proliferation. The remodeling ability of the tension side of orthodontic teeth affects post-orthodontic stability. The purpose of the present study was to investigate the osteogenic effects of LLLT on osteoblast-like cells treated with a simulated tension system that provides a mechanical tension regimen. Murine osteoblastic (MC3T3-E1) cells were cultured in a Flexcell strain unit with programmed loads of 12% elongation at a frequency of 0.5 Hz for 24 and 48 h. The cultured cells were treated with a low-level diode laser using powers of 5 J and 10 J. The proliferation of MC3T3-E1 cells was determined using the Alamar Blue assay. The expression of osteogenic genes (type I collagen (Col-1), osteopontin (OPN), osteocalcin (OC), osteoprotegerin (OPG), receptor activator of nuclear factor kappa B ligand (RANKL), bone morphologic protein (BMP-2), and bone morphologic protein (BMP-4)) in MC3T3-E1 cells was analyzed using reverse transcription polymerase chain reaction (RT-PCR). The data were analyzed using one-way analysis of variance. The proliferation rate of tension-cultured MC3T3-E1 cells under 5 J and 10 J LLLT increased compared with that of the control group (p < 0.05). Prominent mineralization of the MC3T3-E1 cells was visible using a von Kossa stain in the 5 J LLLT group. Osteogenic genes (Col-1, OC, OPG and BMP-2) were significantly expressed in the MC3T3-E1 cells treated with 5 J and 10 J LLLT (p < 0.05). LLLT in tension-cultured MC3T3-E1 cells showed synergistic osteogenic effects, including increases in cell proliferation and Col-1, OPN, OC, OPG and BMP-2 gene expression. LLLT might be beneficial for bone remodeling on the tension side of orthodontics. (paper)

  3. Track reconstruction for the Mu3e experiment based on a novel Multiple Scattering fit

    Directory of Open Access Journals (Sweden)

    Kozlinskiy Alexandr

    2017-01-01

    Full Text Available The Mu3e experiment is designed to search for the lepton flavor violating decay μ+ → e+e+e−. The aim of the experiment is to reach a branching ratio sensitivity of 10−16. In a first phase the experiment will be performed at an existing beam line at the Paul-Scherrer Institute (Switzerland providing 108 muons per second, which will allow to reach a sensitivity of 2 · 10−15. The muons with a momentum of about 28 MeV/c are stopped and decay at rest on a target. The decay products (positrons and electrons with energies below 53MeV are measured by a tracking detector consisting of two double layers of 50 μm thin silicon pixel sensors. The high granularity of the pixel detector with a pixel size of 80 μm × 80 μm allows for a precise track reconstruction in the high multiplicity environment of the Mu3e experiment, reaching 100 tracks per reconstruction frame of 50 ns in the final phase of the experiment. To deal with such high rates and combinatorics, the Mu3e track reconstruction uses a novel fit algorithm that in the simplest case takes into account only the multiple scattering, which allows for a fast online tracking on a GPU based filter farm. An implementation of the 3-dimensional multiple scattering fit based on hit triplets is described. The extension of the fit that takes into account energy losses and pixel size is used for offline track reconstruction. The algorithm and performance of the offline track reconstruction based on a full Geant4 simulation of the Mu3e detector are presented.

  4. Data acquisition at the front-end of the Mu3e pixel detector

    Energy Technology Data Exchange (ETDEWEB)

    Perrevoort, Ann-Kathrin [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    The Mu3e experiment - searching for the lepton-flavour violating decay of the muon into three electrons at an unprecedented sensitivity of one in 10{sup 16} decays - is based on a pixel tracking detector. The sensors are High-Voltage Monolithic Active Pixel Sensors, a technology which allows for very fast and thin detectors, and thus is an ideal fit for Mu3e where the trajectories of low-momentum electrons at high rates are to be measured. The detector will consist of about 275 million pixels and will be operated at up to 10{sup 9} muon stops per second. Therefore, a fast and trigger-less data readout is required. The pixel sensors feature zero-suppressed data output via high-speed serial links. The data is then buffered and sorted by time on a FPGA on the front-end before being processed to the following readout stage. In this talk, the readout of the Mu3e pixel detector at the front-end is introduced. Furthermore, a first firmware implementation of this concept in a beam telescope consisting of the current pixel sensor prototype MuPix7 is presented.

  5. The 'O3E' Project : Raising awareness on natural hazards at school

    Science.gov (United States)

    Berenguer, Jean-Luc

    2010-05-01

    Earthquakes may be traumatic events and as many other environmental emergencies, like storm or floods, may cause more damages than expected when who experiences the phenomena does not know how to behave in the fall. Provided that it is always not feasible to rely on prediction when dealing with earthquakes or extreme meteorological events, preparedness proves to be an efficient (and certainly the most recommendable and cheap) way to face emergencies. Education and training are thus two ingredients to help citizens to perceive the scientific information formerly confined in the laboratories, in particular in the domain of the environmental risk. The "O3E" innovative project (European Educational Observatory for Environment) is established after 12 years (1996-2008) of regional and national original programs for education ("Sismometers at School" in France and Swiss, "Edurisk" in Italy and "ClimAtscope" in Switzerland). The project is born to promote a responsible behaviour of citizens in front of the evolution of a society where scientific information is promptly available. The objective of this program is to create a school network in the Alpine and Mediterranean areas equipped with environmental sensors of an educational vocation. The data on the ground motion (seismometers), the temperatures and precipitations (weather stations), the flows of rivers (hydrogeology) recorded in the schools and processed by the students are collected on dedicated servers and then made available through Internet to the entire community. This network "O3E", once installed, is the starting point of activities. Indeed, various general objectives are pursued: - To promote the applied sciences and new technologies. - To put in network the actors of Education and formative teachning. - To develop the sense of the autonomy and the responsibility in the young people. - To reinforce and develop relationships with regional partners of the educational and university fields. - To support a

  6. Lysophosphatidic acid induces chemotaxis in MC3T3-E1 osteoblastic cells

    Energy Technology Data Exchange (ETDEWEB)

    Masiello, Lisa M.; Fotos, Joseph S.; Galileo, Deni S.; Karin, Norm J.

    2006-07-01

    Lysophosphatidic acid (LPA) is a bioactive lipid that has pleiotropic effects on a variety of cell types and enhances the migration of endothelial and cancer cells, but it is not known if this lipid can alter osteoblast motility. We performed transwell migration assays using MC3T3-E1 osteoblastic cells and found LPA to be a potent chemotactic agent. Quantitative time-lapse video analysis of osteoblast migration after wounds were introduced into cell monolayers indicated that LPA stimulated both migration velocity and the average migration distance per cell. LPA also elicited substantial changes in cell shape and actin cytoskeletal structure; lipid-treated cells contained fewer stress fibers and displayed long membrane processes that were enriched in F-actin. Quantitative RT-PCR analysis showed that MC3T3-E1 cells express all four known LPA-specific G protein-coupled receptors (LPA1-LPA4) with a relative mRNA abundance of LPA1 > LPA4 > LPA2 >> LPA3. LPA-induced changes in osteoblast motility and morphology were antagonized by both pertussis toxin and Ki16425, a subtype-specific blocker of LPA1 and LPA3 receptor function. Cell migration in many cell types is linked to changes in intracellular Ca2+. Ki16425 also inhibited LPA-induced Ca2+ signaling in a dose-dependent manner, suggesting a link between LPA-induced Ca2+ transients and osteoblast chemotaxis. Our data show that LPA stimulates MC3T3-E1 osteoblast motility via a mechanism that is linked primarily to the G protein-coupled receptor LPA1.

  7. Technique of measuring and evaluating the R3E dia. 112 experimental fuel element

    International Nuclear Information System (INIS)

    Stanc, S.; Badiar, S.

    1974-10-01

    The charging is considered of the R3E experimental fuel element having a diameter of 112 mm which will serve the simultaneous temperature measurement on 15 sites and neutron flux measurement on 7 sites aimed at verifying the improved R3-type fuel element with extended cladding and a new toroidal spacing. The temperature will be measured using jacket thermocouples while neutron flux will be measured by self-powered detectors. The methods are described of checking the measuring chain by determining the loop resistance of the thermocouples and SPN detectors in order to verify the correctness of the measured data. (J.B.)

  8. Coplanar (e, 3e) differential cross-section of He atom

    CERN Document Server

    Choubisa, R; Sud, K K

    2003-01-01

    We present in this paper the results of our calculation of five-fold differential cross-section (FDCS) for (e, 3e) process on He atom in low momentum transfer and high electron impact energy in shake-off mechanism. The formalism has been developed in Born approximation using plane waves. Byron and Joachain as well as Le Sech and correlated BBK-type wave functions respectively for incident and scattered. bound and ejected electrons. The angular distribution of FDCS of our calculation is presented in various modes of coplanar geometry and comparison is made with the available experimental data. We observe that the present calculation is able to reproduce the trend of the experimental data. However, it differs in magnitude from the experiment. The present theory does not predict four-peak structure in summed mutual angle mode for lower excess ejected electron energies. We also discuss the importance of momentum transfer, post-collision interaction (PCI) and ion participation in the (e, 3e) process in constant th...

  9. Pixel sensor evaluation and online event selection for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bruch, Dorothea vom

    2017-10-27

    Despite having survived numerous experimental tests, the standard model of particle physics is not a complete description of nature. The Mu3e experiment tests theories beyond the standard model by searching for the lepton flavour violating decay μ→e{sup +}e{sup -}e{sup +}, aiming at a branching ratio sensitivity of 2.10{sup -15} in a first phase of the experiment. A high precision magnetic spectrometer combined with scintillation detectors will measure the momenta, vertices and timing of the decay products of 1.10{sup 8} μ/s stopped on a target. In this work, a prototype of the high voltage monolithic active pixel sensor envisaged for the spectrometer was characterised. With an efficiency >99% and a time resolution of 14 ns, it meets the requirements imposed on the final sensor. Furthermore, an online signal selection process was developed and implemented on a graphics processing unit (GPU), keeping 98% of signal decays, while reducing the data rate of 80 Gbit/s by a factor of 140; resulting in a rate that can be stored to disk. With the computing performance achieved on the GPU, the selection process can run on the hardware planned for the experiment. Both the online selection and the silicon sensor are key aspects for the success of Mu3e.

  10. Plutonium-burn high temperature gas-cooled reactor for 3E+3S

    International Nuclear Information System (INIS)

    Okamoto, Koji

    2015-01-01

    The Nuclear Energy Development in Japan is facing a very difficult conditions after Fukushima-Daiichi NPP Accident. Nuclear Energy has strong advantages on 3E, i.e., Energy security, Economical efficiency and Environment. However, people does not believe the Safety 'S' of Nuclear Energy, now. The disadvantage of 'S' overrides the advantages of '3E'. In Nuclear Energy, 'S' is expanded into 3S, i.e., Safety, Security and Safeguards. Especially, the management of Plutonium inventory in Spent Fuel generated by the NPP operation is very important in the viewpoints of non-proliferation. The high-temperature gas cooled reactor (HTGR) is the solution of these disadvantages of '3S' in Nuclear Energy. The fuel of HTGR is composed by 1 mm spherical fuel particle, i.e., TRISO made by fuel, graphite and silicon-carbide. The silicon-carbide can confine the fission products in any conditions of fuel life cycle, i.e., during operation, accidents and disposal for 1 million years. The confinement of the radioactive materials can be confirmed by the TRISO. The HTGR core has strong negative feedback for temperature. So, the fission automatically stopped at the accidental conditions, such as loss of flow and LOCA. Also, the residual heat can be cooled by the radiation heat transfer to reactor vessel wall. The HTGR system usually has passive vessel wall cooling system. When the passive cooling system had been failed, the heat can be transferred to the land by heat conductions, and fuel does not reach the SiC broken temperature. The fission chain reaction has been stopped automatically by negative feedback, i.e., physics. The residual heat had been cooled automatically by radiation. The radioactive materials had been confined automatically by silicon-carbide. The HTGR is superior for 'S' safety. Plutonium can be burned by the HTGR. In the viewpoints of non-proliferation, the fuel should be made by YSZ-PuO 2 , stabilized buffer

  11. Damage of DNA by Low Energy Electrons (< 3 eV)

    International Nuclear Information System (INIS)

    Bald, Ilko; Illenberger, Eugen; Kopyra, Janina

    2012-01-01

    Recent experiments on low energy electron attachment to DNA and its components in the condensed phase and in the gas phase are reviewed and analysed. From different condensed phase experiments the sensitivity of DNA towards low energy electrons is well documented and strand breaks in DNA are observed at subexcitation energies (< 3 eV) and also in ultrafast electron transfer experiments involving electrons in presolvated states. Gas phase experiments indicate that all building blocks of DNA (the nucleobases, the sugar and the phosphate moiety) undergo resonant dissociative electron attachment (DEA) in the subexcitation regime which may ultimately lead to strand breaks. From very recent gas phase experiments on an entire nucleotide it can be concluded that most strand breaks result from direct electron attachment to the DNA backbone, but also initial electron capture by the nucleobase following electron transfer to the backbone contributes.

  12. Complete chemical transformation of a molecular film by subexcitation electrons (<3 eV).

    Science.gov (United States)

    Balog, Richard; Illenberger, Eugen

    2003-11-21

    The potential of slow electrons to act as a soft tool to control a chemical reaction in the condensed phase is demonstrated. By setting the energy of a well defined electron beam to values below 3 eV, the surface of a thin film of 1,2-C(2)F(4)C(l2) molecules can completely be transformed into molecular chlorine (and by-products, possibly perfluorinated polymers). At higher energies (>6 eV) some equilibrium state between product and educt composition can be achieved, however, accompanied by a gradual overall degradation of the film. The effect of complete transformation is based on both the selectivity and particular energy dependence of the initial step of the reaction which is dissociative electron attachment to C(2)F(4)C(l2), but also the fact that the initial molecule is efficiently decomposed by subexcitation electrons while the product C(l2) is virtually unaffected.

  13. 1-,2-,3-e - Engaging All Exceptional Students in Science, Technology, Engineering and Mathematics (STEM)

    Science.gov (United States)

    Runyon, C. R.; Hall, C.; Baber, M.

    2013-12-01

    There are more than 50 million Americans with disabilities, approximately half of whom are students in a mainstreamed classroom. The National Association for Gifted Children estimates that approximately 3 million of those, 6% of the student population, are academically gifted, and 150,000 - 300,000 students of those are twice or triple exceptional (2e and 3e, respectively). The 2e and 3e refers to intellectually gifted children who also have some form(s) of disability. Unfortunately most schools in the US identify children by their giftedness or by their disability, but rarely by both. An apparent trend with 2e children, particularly when autism is paired with gifted, is that students identify with their disability instead of their strengths. 2e students have shown a propensity for interests in the science and technology fields. Few specialized programs and/or resources in STEM exist to engage and involve these exceptional students and fewer still is the number of faculty and staff trained to work with the twice and triple exceptionalities. Palmetto Scholars Academy (PSA), Charleston, SC a school for gifted and talented, provides a differentiated program to meet the educational needs of gifted learners, while also addressing the students' social/emotional needs. The Brown/MIT NASA Lunar Science Institute, in conjunction with the NASA South Carolina Space Grant Consortium, is working directly with educators from the PSA to identify what kinds of materials they need and what mediums work best for the different student (cap)abilities. This partnership will provide a means of 'consciousness raising' for teachers to help students develop their strengths and educators will gain a new understanding of 2e and 3e that will transfer into better instruction. One technique being implemented is the use of STEM-oriented engineering and technology design challenges and problem solving. These tasks allow students to use a variety of integrative and multi-disciplinary skills for

  14. Structure of the Human FANCL RING-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection

    Science.gov (United States)

    Hodson, Charlotte; Purkiss, Andrew; Miles, Jennifer Anne; Walden, Helen

    2014-01-01

    Summary The combination of an E2 ubiquitin-conjugating enzyme with an E3 ubiquitin-ligase is essential for ubiquitin modification of a substrate. Moreover, the pairing dictates both the substrate choice and the modification type. The molecular details of generic E3-E2 interactions are well established. Nevertheless, the determinants of selective, specific E3-E2 recognition are not understood. There are ∼40 E2s and ∼600 E3s giving rise to a possible ∼24,000 E3-E2 pairs. Using the Fanconi Anemia pathway exclusive E3-E2 pair, FANCL-Ube2T, we report the atomic structure of the FANCL RING-Ube2T complex, revealing a specific and extensive network of additional electrostatic and hydrophobic interactions. Furthermore, we show that these specific interactions are required for selection of Ube2T over other E2s by FANCL. PMID:24389026

  15. Heating, Ventilation, Air Conditioning, and Refrigeration (HVAC/R), AFSC 3E1X1. OSSN 2368

    National Research Council Canada - National Science Library

    1999-01-01

    Survey Coverage: The Heating, Ventilation, Air Conditioning, and Refrigeration (HVAC/R) career ladder, AFSC 3E1X1, was surveyed to gather data needed to guide the development and evaluation of training...

  16. [Clinical significance of signal transduction and activators of transcription 3, E-cadherin and vimentin in colon cancer].

    Science.gov (United States)

    Zhang, Chao; Xu, Jian-Hua; Liu, Tao; Cui, Hao

    2011-03-01

    To evaluate the clinical significance of STAT3, E-cadherin and vimentin in colon cancer. Samples of colon cancer tissue and adjacent normal tissue were procured from 70 patients with colon cancer. The expressions of STAT3, E-cadherin and vimentin were detected by immunohistochemistry. Associations of clinicopathological characteristics and these three factors were evaluated. STAT3, E-cadherin, vimentin were positive in 74.3%,32.9%, and 78.6% in the colon cancer tissues, respectively, and were 15.7%, 82.9%, and 12.9% in normal colon mucosa tissues, respectively. They were correlated with tumor differentiation, depth of invasion, lymph node metastasis, and TNM staging(Pcolon cancer. The expressions of STAT3, E-cadherin and vimentin may serve as prognostic indicators for patients with colon cancer.

  17. Online track and vertex reconstruction on GPUs for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bruch, Dorothea vom [Institut fuer Kernphysik, Johannes Gutenberg-Universitaet Mainz (Germany); Collaboration: Mu3e-Collaboration

    2016-07-01

    The Mu3e experiment searches for the lepton flavour violating decay μ → eee, aiming at a branching ratio sensitivity better than 10{sup -16}.To reach this sensitivity, muon rates above 10{sup 9} μ/s are required. A high precision silicon tracking detector combined with excellent timing resolution from scintillating fibers and tiles will measure the momenta, vertices and timing of the decay products of muons stopped in the target to suppress background. The trigger-less readout system will deliver about 100 GB/s of zero-suppressed data. A network of optical links and switching FPGAs sends the complete detector data for a time slice to one node of the filter farm. An FPGA inside the filter farm PC transfers the event data to the GPU via PCIe direct memory access. The GPU finds and fits tracks using a 3D tracking algorithm for multiple scattering dominated resolution. In a second step, a three track vertex fit is performed, allowing for a reduction of the output data rate to below 100 MB/s by removing combinatorial background. The talk discusses the data flow from the FPGA to the GPU as well as the implementation and performance of the track and vertex fits on the GPU.

  18. Deviations between experimental and theoretical results in Ar (e, 3e) double ionization

    International Nuclear Information System (INIS)

    Jia, C C; Lahmam-Bennani, A; Cappello, C Dal; Duguet, A; Avaldi, L

    2003-01-01

    The coplanar (e, 3e) relative cross sections for double ionization of argon have been measured at an electron impact energy of E 0 = 561.4 eV and under equal energy sharing among the two 'ejected' electrons, E b = E c = 9 eV. The scattering angle is fixed to θ a = 1.5 degrees, corresponding to a momentum transfer K=0.4 au to the target. The experimental results have been compared with calculations in the first Born approximation, which include only first-order processes in the target-projectile interaction. The comparison shows severe deviations between the experimental and theoretical results. These deviations are much larger than the ones previously observed in helium under comparable kinematics. To fill this gap between theory and experiment, a decisive improvement in the theory is needed. This can be achieved by improving the first-order calculations and by including higher-order processes such as the two-step mechanism, or even new mechanisms, for instance the simultaneous ejection of the pair of target electrons. (letter to the editor)

  19. Reaction (γ,2e) and (e,3e) as probe of electron correlation in atoms

    International Nuclear Information System (INIS)

    Amusia, M.Y.

    1995-01-01

    Cross sections of the (γ,2e) and (e,3e) reactions contain information about the two vacancy-energy spectrum and electron-pair correlations in initial and final states of the target atom. Physical pictures of these processes are presented for two- and many-electron atoms. The simplest mechanisms are discussed, demonstrating some features which await experimental confirmation. Attention is given to high photon energy and the relativistic energy region of these reactions. The energy distribution of outgoing relativistic electrons is qualitatively different from the nonrelativistic case. The origin and types of corrections to the simplest mechanisms, and possible means of their detection, are discussed. In addition, the role of different resonances: shape, giant, autoionizational, and Feshbach-type are considered. Results of calculations are compared with experimental data, mainly on double photoionization cross sections. Different possible objects as targets for the reactions are considered, including negative ions, excited atoms, molecules, and clusters. The modification of these reactions due to photon emission is discussed. The future of the domain is outlined

  20. Reactions (γ,2e) and (e,3e) as probes of electronic correlations in atoms

    International Nuclear Information System (INIS)

    Amusia, M.Ya.

    1993-01-01

    Cross sections of the (γ,2e) and (e,3e) reactions carry information on two vacancy energy spectrum and on electron pair correlations in initial and final states of the target atom. Physical pictures of these processes are presented for two- and many-electron atoms. Simplest mechanisms of them are discussed, demonstrating some features which are waiting for experimental confirmation. Attention is given to high photon energy and even to relativistic energy region of these reactions. The energy distribution of outgoing relativistic electrons is qualitatively different from what it is for the nonrelativistic case. Origin and types of corrections to the simplest mechanisms and possible means of their detection are discussed. Role of different resonances: shape, giant, autoionizational, and Feschbach-type are considered. Results of calculations are compared with experimental data, mainly on double photoionization cross sections. Different possible objects as targets for the reactions are mentioned, including negative ions, excited atoms, molecules and clusters. Modification of the type of these reactions due to rather probable emission of the photon is discussed. Future of the domain is outlined. (orig.)

  1. Track and vertex reconstruction on GPUs for the Mu3e experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bruch, Dorothea vom; Kozlinskiy, Alexandr [Physikalisches Institut, Universitaet Heidelberg (Germany); Berger, Niklaus [Institut fuer Kernphysik, Universitaet Mainz (Germany); Collaboration: Mu3e-Collaboration

    2015-07-01

    The Mu3e experiment searches for the lepton flavour violating decay μ → eee, aiming at a branching ratio sensitivity better than 10{sup -16}. To reach this sensitivity, muon rates above 10{sup 9} μ/s are required. A high precision silicon pixel tracking detector combined with excellent timing resolution from scintillating fibers and tiles will measure the momenta, vertices and timing of the decay products of muons stopped in the target to suppress background. The trigger-less readout system will deliver about 100 GB/s of zero-suppressed data. A network of optical links and switching FPGAs sends the complete detector data for a time slice to one node of the filter farm. An FPGA inside the filter farm PC transfers the event data to the GPU via PCIe direct memory access. The GPU finds and fits tracks using a 3D tracking algorithm for multiple scattering dominated resolution. In a second step, a three track vertex fit is performed, allowing for a reduction of the output data rate to below 100 MB/s by removing combinatorial background. The talk discusses the implementation of the fits on the GPU, which processes 10{sup 10} combinations of hits from three layers per second.

  2. Tuned in to the Earth from the classroom with `O3E' european project

    Science.gov (United States)

    Berenguer, J.; Courboulex, F.; Tocheport, A.; Eva, C.; Ferretti, G.; Solarino, S.; Giardini, D.; Sornette, A.; Ponzone, M.; Cremonini, R.; Virieux, J.

    2010-12-01

    In lines with diverse initiatives regarding scientific culture and education, the ‘O3E’ experience (http://O3E.geoazur.eu) has set up a permanent educational network of schools in the Alpine and Mediterranean areas, building an exchange of knowledge on natural risks prevention. The “O3E” innovative project (European Educational Observatory for Environment) is established after 12 years (1996-2008) of regional and national original programs for education (“Seismometers at School” in France and Swiss, “Edurisk” in Italy and “ClimAtscope” in Switzerland). The project is born to promote a responsible behavior of citizens in front of the evolution of a society where scientific information is promptly available. Since 2008, a school network in the Alpine and Mediterranean areas has been equipped with environmental sensors of an educational vocation. The data on the ground motion (seismometers), the temperatures and precipitations (weather stations), the flows of rivers (hydrogeology) recorded in the schools and processed by the students are collected on dedicated servers and then made available through internet to the entire community. This network “O3E”, once installed, is the starting point of activities for students. Indeed, various general objectives are pursued: - To promote the applied sciences and new technologies. - To put in network the actors of Education and formative teaching. - To develop the sense of the autonomy and the responsibility in the young people. - To reinforce and develop relationships with regional partners of the educational and university fields. - To support a rational awakening for the prevention of the natural risks Teachers from this network can share experiences and produce new didactic tools for the classroom. This collaborative work could illustrate the conjugated efforts of researchers and teachers for a better education and awareness of the risk culture especially in young populations. Some student’s and

  3. Effect of acetaminophen on osteoblastic differentiation and migration of MC3T3-E1 cells.

    Science.gov (United States)

    Nakatsu, Yoshihiro; Nakagawa, Fumio; Higashi, Sen; Ohsumi, Tomoko; Shiiba, Shunji; Watanabe, Seiji; Takeuchi, Hiroshi

    2018-02-01

    N-acetyl-p-aminophenol (APAP, acetaminophen, paracetamol) is a widely used analgesic/antipyretic with weak inhibitory effects on cyclooxygenase (COX) compared to non-steroidal anti-inflammatory drugs (NSAIDs). The mechanism of action of APAP is mediated by its metabolite that activates transient receptor potential channels, including transient receptor potential vanilloid 1 (TRPV1) and TRP ankyrin 1 (TRPA1) or the cannabinoid receptor type 1 (CB1). However, the exact molecular mechanism and target underlying the cellular actions of APAP remain unclear. Therefore, we investigated the effect of APAP on osteoblastic differentiation and cell migration, with a particular focus on TRP channels and CB1. Effects of APAP on osteoblastic differentiation and cell migration of MC3T3-E1, a mouse pre-osteoblast cell line, were assessed by the increase in alkaline phosphatase (ALP) activity, and both wound-healing and transwell-migration assays, respectively. APAP dose-dependently inhibited osteoblastic differentiation, which was well correlated with the effects on COX activity compared with other NSAIDs. In contrast, cell migration was promoted by APAP, and this effect was not correlated with COX inhibition. None of the agonists or antagonists of TRP channels and the CB receptor affected the APAP-induced cell migration, while the effect of APAP on cell migration was abolished by down-regulating TRPV4 gene expression. APAP inhibited osteoblastic differentiation via COX inactivation while it promoted cell migration independently of previously known targets such as COX, TRPV1, TRPA1 channels, and CB receptors, but through the mechanism involving TRPV4. APAP may have still unidentified molecular targets that modify cellular functions. Copyright © 2017 Institute of Pharmacology, Polish Academy of Sciences. Published by Elsevier B.V. All rights reserved.

  4. Developing Learning Model P3E to Improve Students’ Critical Thinking Skills of Islamic Senior High School

    Science.gov (United States)

    Bahtiar; Rahayu, Y. S.; Wasis

    2018-01-01

    This research aims to produce P3E learning model to improve students’ critical thinking skills. The developed model is named P3E, consisting of 4 (four) stages namely; organization, inquiry, presentation, and evaluation. This development research refers to the development stage by Kemp. The design of the wide scale try-out used pretest-posttest group design. The wide scale try-out was conducted in grade X of 2016/2017 academic year. The analysis of the results of this development research inludes three aspects, namely: validity, practicality, and effectiveness of the model developed. The research results showed; (1) the P3E learning model was valid, according to experts with an average value of 3.7; (2) The completion of the syntax of the learning model developed obtained 98.09% and 94.39% for two schools based on the assessment of the observers. This shows that the developed model is practical to be implemented; (3) the developed model is effective for improving students’ critical thinking skills, although the n-gain of the students’ critical thinking skills was 0.54 with moderate category. Based on the results of the research above, it can be concluded that the developed P3E learning model is suitable to be used to improve students’ critical thinking skills.

  5. Ghrelin inhibits the apoptosis of MC3T3-E1 cells through ERK and AKT signaling pathway

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Qiu-Hua; Liu, Yuan; Wu, Shan-Shan; Cui, Rong-Rong; Yuan, Ling-Qing, E-mail: allenylq@hotmail.com; Liao, Er-Yuan, E-mail: eyliao@21cn.com

    2013-11-01

    Ghrelin is a 28-amino-acid peptide that acts as a natural endogenous ligand of the growth hormone secretagogue receptor (GHSR) and strongly stimulates the release of growth hormone from the hypothalamus–pituitary axis. Previous studies have identified the important physiological effects of ghrelin on bone metabolism, such as regulating proliferation and differentiation of osteoblasts, independent of GH/IGF-1 axis. However, research on effects and mechanisms of ghrelin on osteoblast apoptosis is still rare. In this study, we identified expression of GHSR in MC3T3-E1 cells and determined the effects of ghrelin on the apoptosis of osteoblastic MC3T3-E1 cells and the mechanism involved. Our data demonstrated that ghrelin inhibited the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, as determined by terminal deoxynucleotidyl transferase-mediated deoxyribonucleotide triphosphate nick end-labeling (TUNEL) and ELISA assays. Moreover, ghrelin upregulated Bcl-2 expression and downregulated Bax expression in a dose-dependent manner. Our study also showed decreased activated caspase-3 activity under the treatment of ghrelin. Further study suggested that ghrelin stimulated the phosphorylation of ERK and AKT. Pretreatment of cells with the ERK inhibitor PD98059, PI3K inhibitor LY294002, and GHSR-siRNA blocked the ghrelin-induced activation of ERK and AKT, respectively; however, ghrelin did not stimulate the phosphorylation of p38 or JNK. PD90859, LY294002 and GHSR-siRNA attenuated the anti-apoptosis effect of ghrelin in MC3T3-E1 cells. In conclusion, ghrelin inhibits the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, which may be mediated by activating the GHSR/ERK and GHSR/PI3K/AKT signaling pathways. - Highlights: • We explored the effects of ghrelin on serum deprivation-induced MC3T3-E1 cells apoptosis. • Both ELISA and TUNEL were used to detect the apoptosis. • The receptor of ghrelin, GHSR, was expressed in MC3T3-E1

  6. Ghrelin inhibits the apoptosis of MC3T3-E1 cells through ERK and AKT signaling pathway

    International Nuclear Information System (INIS)

    Liang, Qiu-Hua; Liu, Yuan; Wu, Shan-Shan; Cui, Rong-Rong; Yuan, Ling-Qing; Liao, Er-Yuan

    2013-01-01

    Ghrelin is a 28-amino-acid peptide that acts as a natural endogenous ligand of the growth hormone secretagogue receptor (GHSR) and strongly stimulates the release of growth hormone from the hypothalamus–pituitary axis. Previous studies have identified the important physiological effects of ghrelin on bone metabolism, such as regulating proliferation and differentiation of osteoblasts, independent of GH/IGF-1 axis. However, research on effects and mechanisms of ghrelin on osteoblast apoptosis is still rare. In this study, we identified expression of GHSR in MC3T3-E1 cells and determined the effects of ghrelin on the apoptosis of osteoblastic MC3T3-E1 cells and the mechanism involved. Our data demonstrated that ghrelin inhibited the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, as determined by terminal deoxynucleotidyl transferase-mediated deoxyribonucleotide triphosphate nick end-labeling (TUNEL) and ELISA assays. Moreover, ghrelin upregulated Bcl-2 expression and downregulated Bax expression in a dose-dependent manner. Our study also showed decreased activated caspase-3 activity under the treatment of ghrelin. Further study suggested that ghrelin stimulated the phosphorylation of ERK and AKT. Pretreatment of cells with the ERK inhibitor PD98059, PI3K inhibitor LY294002, and GHSR-siRNA blocked the ghrelin-induced activation of ERK and AKT, respectively; however, ghrelin did not stimulate the phosphorylation of p38 or JNK. PD90859, LY294002 and GHSR-siRNA attenuated the anti-apoptosis effect of ghrelin in MC3T3-E1 cells. In conclusion, ghrelin inhibits the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, which may be mediated by activating the GHSR/ERK and GHSR/PI3K/AKT signaling pathways. - Highlights: • We explored the effects of ghrelin on serum deprivation-induced MC3T3-E1 cells apoptosis. • Both ELISA and TUNEL were used to detect the apoptosis. • The receptor of ghrelin, GHSR, was expressed in MC3T3-E1

  7. Protective effect of Edaravone against hypoxia-induced cytotoxicity in osteoblasts MC3T3-E1 cells.

    Science.gov (United States)

    Cao, Bo; Chai, Chunxiang; Zhao, Sishun

    2015-12-01

    Edaravone is a newly developed clinical medicine for the treatment of acute cerebral infarction. Reduced blood supply to bones (hypoxia) has been involved in the pathological development of osteoporosis. In this study, we investigated the effect of Edaravone and its latent mechanism on hypoxia-induced cell toxicity in MC3T3-E1 cells. Cell viability was determined by the 3-(4,5-dimethyl-thiazol-2yl)-2,5-diphenyl tetrazolium bromide (MTT) assay. Intracellular reactive oxygen species (ROS) and nitric oxide (NO) were determined by the fluorescence dyes 2',7'-dichlorofluorescein diacetate (DCFH-DA) and 4-amino-5-methylamino-2',7'-difluorofluorescein diacetate (DAF-FM DA), respectively. mRNA and proteins were determined by real-time polymerase chain reaction and Western blot analysis, respectively. Edaravone significantly restored the hypoxia-induced reduction of MC3T3-E1 cell viability and inhibited lactate dehydrogenase release. In addition, we found that Edaravone inhibits the generation of ROS and NO. Hoechst staining results indicated that the nuclear condensation characteristic of apoptosis was increased in MC3T3-E1 cells after hypoxia exposure, which was significantly suppressed by Edaravone treatment. Mechanistically, we found that Edaravone markedly reduced the expression of cleaved caspase-3 and blunted the release of cytochrome c. These findings strongly suggested that Edaravone suppresses hypoxia-induced cytotoxicity in MC3T3-E1 cells. The pleiotropic effects of Edaravone on hypoxia exposure in osteoblasts suggest potential antiosteoporosis mechanisms of Edaravone. © 2015 International Union of Biochemistry and Molecular Biology.

  8. TK3 eBook software to author, distribute, and use electronic course content for medical education.

    Science.gov (United States)

    Morton, David A; Foreman, K Bo; Goede, Patricia A; Bezzant, John L; Albertine, Kurt H

    2007-03-01

    The methods for authoring and distributing course content are undergoing substantial changes due to advancement in computer technology. Paper has been the traditional method to author and distribute course content. Paper enables students to personalize content through highlighting and note taking but does not enable the incorporation of multimedia elements. Computers enable multimedia content but lack the capability of the user to personalize the content. Therefore, we investigated TK3 eBooks as a potential solution to incorporate the benefits of both paper and computer technology. The objective of our study was to assess the utility of TK3 eBooks in the context of authoring and distributing dermatology course content for use by second-year medical students at the University of Utah School of Medicine during the spring of 2004. We incorporated all dermatology course content into TK3 eBook format. TK3 eBooks enable students to personalize information through tools such as "notebook," "hiliter," "stickies," mark pages, and keyword search. Students were given the course content in both paper and eBook formats. At the conclusion of the dermatology course, students completed a questionnaire designed to evaluate the effectiveness of the eBooks compared with paper. Students perceived eBooks as an effective way to distribute course content and as a study tool. However, students preferred paper over eBooks to take notes during lecture. In conclusion, the present study demonstrated that eBooks provide a convenient method for authoring, distributing, and using course content but that students preferred paper to take notes during lecture.

  9. Functional expression of 5-HT{sub 2A} receptor in osteoblastic MC3T3-E1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Hirai, Takao; Kaneshige, Kota; Kurosaki, Teruko [Department of Molecular Pharmacology, Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, 1 Gakuen-cho, Fukuyama, Hiroshima 729-0292 (Japan); Nishio, Hiroaki, E-mail: nishio@fupharm.fukuyama-u.ac.jp [Department of Molecular Pharmacology, Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, 1 Gakuen-cho, Fukuyama, Hiroshima 729-0292 (Japan)

    2010-05-28

    In the previous study, we reported the gene expression for proteins related to the function of 5-hydroxytryptamine (5-HT, serotonin) and elucidated the expression patterns of 5-HT{sub 2} receptor subtypes in mouse osteoblasts. In the present study, we evaluated the possible involvement of 5-HT receptor subtypes and its inactivation system in MC3T3-E1 cells, an osteoblast cell line. DOI, a 5-HT{sub 2A} and 5-HT{sub 2C} receptor selective agonist, as well as 5-HT concentration-dependently increased proliferative activities of MC3T3-E1 cells in their premature period. This effect of 5-HT on cell proliferation were inhibited by ketanserin, a 5-HT{sub 2A} receptor specific antagonist. Moreover, both DOI-induced cell proliferation and phosphorylation of ERK1 and 2 proteins were inhibited by PD98059 and U0126, selective inhibitors of MEK in a concentration-dependent manner. Furthermore, treatment with fluoxetine, a 5-HT specific re-uptake inhibitor which inactivate the function of extracellular 5-HT, significantly increased the proliferative activities of MC3T3-E1 cells in a concentration-dependent manner. Our data indicate that 5-HT fill the role for proliferation of osteoblast cells in their premature period. Notably, 5-HT{sub 2A} receptor may be functionally expressed to regulate mechanisms underlying osteoblast cell proliferation, at least in part, through activation of ERK/MAPK pathways in MC3T3-E1 cells.

  10. Enhancing osteogenic differentiation of MC3T3-E1 cells by immobilizing RGD onto liquid crystal substrate

    International Nuclear Information System (INIS)

    Wu, Shaopeng; Yang, Xiaohui; Li, Wenqiang; Du, Lin; Zeng, Rong; Tu, Mei

    2017-01-01

    To understand the effects of GRGDF modification on MC3T3-E1 cell behavior, we cultured these cells onto a biomimetic liquid crystalline matrix modified with GRGDF peptide (OPC-GA-RGD). Successful immobilization of GRGDF on the liquid crystalline surface was verified by fluorescent labeling, attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and X-ray photoelectron spectroscopy (XPS). OPC-GA-RGDs retained its liquid crystalline feature after surface modification. The RGD-immobilized OPC substrate was hardly beneficial to initial cell adhesion but could support long-term cell survival. The enhancement in cell proliferation did not correlate with RGD density. The lower GRGDF density immobilized on the liquid crystalline OPC matrix (OPC-GA-RGD3) promoted cell adhesion, proliferation, ALP expression level and mineralization, suggesting that both the viscoelasticity-based mechanical stimuli and receptor/ligand-based biochemical cue synergistically modulate MC3T3-E1 cell behavior. - Highlight: • A novel type of GRGDF-immobilized liquid crystalline matrices was fabricated and served as a substrate for the in vitro culture of MC3T3-E1 cells. • The lower RGD density might provide a better condition for initial cell adhesion and proliferation, up-regulation of ALP expression levels, and mineralization. • The intrinsic liquid crystalline feature of OPC matrix, instead of RGD efficiency, promoted initial cell adhesion. • Properties of the liquid crystalline OPC matrix together with the stable receptor-ligand binging synergistically modulated MC3T3-E1 cell behavior.

  11. Enhancing osteogenic differentiation of MC3T3-E1 cells by immobilizing RGD onto liquid crystal substrate

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Shaopeng; Yang, Xiaohui; Li, Wenqiang; Du, Lin; Zeng, Rong; Tu, Mei, E-mail: tumei@jnu.edu.cn

    2017-02-01

    To understand the effects of GRGDF modification on MC3T3-E1 cell behavior, we cultured these cells onto a biomimetic liquid crystalline matrix modified with GRGDF peptide (OPC-GA-RGD). Successful immobilization of GRGDF on the liquid crystalline surface was verified by fluorescent labeling, attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and X-ray photoelectron spectroscopy (XPS). OPC-GA-RGDs retained its liquid crystalline feature after surface modification. The RGD-immobilized OPC substrate was hardly beneficial to initial cell adhesion but could support long-term cell survival. The enhancement in cell proliferation did not correlate with RGD density. The lower GRGDF density immobilized on the liquid crystalline OPC matrix (OPC-GA-RGD3) promoted cell adhesion, proliferation, ALP expression level and mineralization, suggesting that both the viscoelasticity-based mechanical stimuli and receptor/ligand-based biochemical cue synergistically modulate MC3T3-E1 cell behavior. - Highlight: • A novel type of GRGDF-immobilized liquid crystalline matrices was fabricated and served as a substrate for the in vitro culture of MC3T3-E1 cells. • The lower RGD density might provide a better condition for initial cell adhesion and proliferation, up-regulation of ALP expression levels, and mineralization. • The intrinsic liquid crystalline feature of OPC matrix, instead of RGD efficiency, promoted initial cell adhesion. • Properties of the liquid crystalline OPC matrix together with the stable receptor-ligand binging synergistically modulated MC3T3-E1 cell behavior.

  12. Collagen-derived dipeptide prolyl-hydroxyproline promotes differentiation of MC3T3-E1 osteoblastic cells

    International Nuclear Information System (INIS)

    Kimira, Yoshifumi; Ogura, Kana; Taniuchi, Yuri; Kataoka, Aya; Inoue, Naoki; Sugihara, Fumihito; Nakatani, Sachie; Shimizu, Jun; Wada, Masahiro; Mano, Hiroshi

    2014-01-01

    Highlights: • Pro-Hyp did not affect MC3T3-E1 cell proliferation and matrix mineralization. • Pro-Hyp significantly increased alkaline phosphatase activity. • Pro-Hyp significantly upregulated gene expression of Runx2, Osterix, and Col1α1. - Abstract: Prolyl-hydroxyproline (Pro-Hyp) is one of the major constituents of collagen-derived dipeptides. The objective of this study was to investigate the effects of Pro-Hyp on the proliferation and differentiation of MC3T3-E1 osteoblastic cells. Addition of Pro-Hyp did not affect MC3T3-E1 cell proliferation and matrix mineralization but alkaline phosphatase activity was significantly increased. Furthermore, cells treated with Pro-Hyp significantly upregulated gene expression of Runx2, Osterix, and Col1α1. These results indicate that Pro-Hyp promotes osteoblast differentiation. This study demonstrates for the first time that Pro-Hyp has a positive effect on osteoblast differentiation with upregulation of Runx2, Osterix, and Collα1 gene expression

  13. Ginsenoside Re Promotes Osteoblast Differentiation in Mouse Osteoblast Precursor MC3T3-E1 Cells and a Zebrafish Model

    Directory of Open Access Journals (Sweden)

    Hye-Min Kim

    2016-12-01

    Full Text Available Bone homeostasis is tightly regulated to balance bone formation and bone resorption. Many anabolic drugs are used as bone-targeted therapeutic agents for the promotion of osteoblast-mediated bone formation or inhibition of osteoclast-mediated bone resorption. Previous studies showed that ginsenoside Re has the effect of the suppression of osteoclast differentiation in mouse bone-marrow derived macrophages and zebrafish. Herein, we investigated whether ginsenoside Re affects osteoblast differentiation and mineralization in in vitro and in vivo models. Mouse osteoblast precursor MC3T3-E1 cells were used to investigate cell viability, alkaline phosphatase (ALP activity, and mineralization. In addition, we examined osteoblastic signaling pathways. Ginsenoside Re affected ALP activity without cytotoxicity, and we also observed the stimulation of osteoblast differentiation through the activation of osteoblast markers including runt-related transcription factor 2, type 1 collagen, ALP, and osteocalcin in MC3T3-E1 cells. Moreover, Alizarin red S staining indicated that ginsenoside Re increased osteoblast mineralization in MC3T3-E1 cells and zebrafish scales compared to controls. These results suggest that ginsenoside Re promotes osteoblast differentiation as well as inhibits osteoclast differentiation, and it could be a potential therapeutic agent for bone diseases.

  14. Synthesis of polypyrrole nanowires with positive effect on MC3T3-E1 cell functions through electrical stimulation

    Energy Technology Data Exchange (ETDEWEB)

    He, Yuan; Wang, Shihui [Department of Biomaterials, College of Materials, Xiamen University, Xiamen 361005 (China); Mu, Jing, E-mail: mujing@picb.ac.cn [Department of Biomaterials, College of Materials, Xiamen University, Xiamen 361005 (China); Chinese Academy of Sciences-Max Planck Partner Institute for Computational Biology, Shanghai Institutes for Biological Sciences, Chinese Academy of Science, Shanghai 200031 (China); Dai, Lingfeng [Department of Biomaterials, College of Materials, Xiamen University, Xiamen 361005 (China); Zhang, Zhong [Department of Stomatology, The Affiliated Zhongshan Hospital of Xiamen University, Xiamen 361005 (China); Sun, Yanan; Shi, Wei [Department of Biomaterials, College of Materials, Xiamen University, Xiamen 361005 (China); Ge, Dongtao, E-mail: gedt@xmu.edu.cn [Department of Biomaterials, College of Materials, Xiamen University, Xiamen 361005 (China)

    2017-02-01

    Conducting polymer polypyrrole (PPy) possesses good biocompatibility and conductivity and has been used as functional coatings in bone tissue regeneration. In this study, a cholic acid doped PPy nanowires (PPy NWs) coating was electrochemically polymerized on the surface of titanium (Ti). The porous intertwined PPy NWs coating exhibited excellent electrical conductivity and electrochemical activity, better hydrophilicity and higher surface energy. In vitro cell experiments demonstrated that the PPy NWs coating together with a 10 μA substrate-mediate electrical stimulation (ES) was capable to positive regulate the functions of MC3T3-E1 such as cell adhesion, proliferation and differentiation. Further long-term functions of cell tests including alkaline phosphatase (ALP) activity, bone-carboxyglutamic acid-containing protein (BGP) and calcium deposition were all thoroughly increased. These confirmed that the combination of PPy NWs and ES could accelerate MC3T3-E1 cells mature and osteogenesis. Hence, the PPy NWs coating was an electro bioactive coating and may have potential applications in the treatment of bone damage repairing and regeneration with ES. - Highlights: • The porous PPy nanowire coating was electrochemically polymerized on Ti. • PPy NWs had good electrical conductivity, electrochemical stability and hydrophilicity. • Pure PPy NWs with ES could obviously promote the growth and cell functions of MC3T3-E1.

  15. Synthesis of polypyrrole nanowires with positive effect on MC3T3-E1 cell functions through electrical stimulation

    International Nuclear Information System (INIS)

    He, Yuan; Wang, Shihui; Mu, Jing; Dai, Lingfeng; Zhang, Zhong; Sun, Yanan; Shi, Wei; Ge, Dongtao

    2017-01-01

    Conducting polymer polypyrrole (PPy) possesses good biocompatibility and conductivity and has been used as functional coatings in bone tissue regeneration. In this study, a cholic acid doped PPy nanowires (PPy NWs) coating was electrochemically polymerized on the surface of titanium (Ti). The porous intertwined PPy NWs coating exhibited excellent electrical conductivity and electrochemical activity, better hydrophilicity and higher surface energy. In vitro cell experiments demonstrated that the PPy NWs coating together with a 10 μA substrate-mediate electrical stimulation (ES) was capable to positive regulate the functions of MC3T3-E1 such as cell adhesion, proliferation and differentiation. Further long-term functions of cell tests including alkaline phosphatase (ALP) activity, bone-carboxyglutamic acid-containing protein (BGP) and calcium deposition were all thoroughly increased. These confirmed that the combination of PPy NWs and ES could accelerate MC3T3-E1 cells mature and osteogenesis. Hence, the PPy NWs coating was an electro bioactive coating and may have potential applications in the treatment of bone damage repairing and regeneration with ES. - Highlights: • The porous PPy nanowire coating was electrochemically polymerized on Ti. • PPy NWs had good electrical conductivity, electrochemical stability and hydrophilicity. • Pure PPy NWs with ES could obviously promote the growth and cell functions of MC3T3-E1.

  16. Expressão da CASPASE-3 e CD-34 no adenocarcinoma de próstata

    Directory of Open Access Journals (Sweden)

    Vicente Paulo da Motta

    Full Text Available OBJETIVO: 1. Avaliar em qual percentual as células tumorais se marcam com caspase-3 e CD-34; 2. quantificá-los nas células tumorais; 3. verificar correlação entre quantificação e grau de malignidade tumoral; 4. correlacioná-los entre si. MÉTODOS: Estudaram-se 38 blocos com adenocarcinoma, classificados por Gleason e marcação imunoistoquímica para caspase-3 e CD-34. As proteínas imunomarcadas foram quantificadas no software Immuno do Sistema Samba 4000 de citofotometria de imagem, pelo índice de marcagem e densidade óptica. RESULTADOS: Imunomarcou-se 25 lâminas para caspase-3 e 34 para CD-34. As quantificações da caspase-3 para o índice de marcagem foram acima de 50 em 76% e, para densidade óptica, abaixo de 50 para 96%. Em relação ao CD-34, índice de marcagem foi acima de 50 em 59% e densidade óptica abaixo de 50 em 56%. As correlações entre expressões dos marcadores e a gravidade do tumor, assim como entre os marcadores, não evidenciaram significância estatística. Não se mostrou relação de expressão com o score de Gleason. CONCLUSÃO: A presença caspase-3 e CD-34 foi de 73,5% e 100%, respectivamente; 2. caspase-3 e CD-34 apresentaram alta expressão do índice de marcagem, e baixa para densidade óptica; 3. não houve correlação entre as quantificações com a classificação de Gleason; 4. não houve correlação das expressões dos dois marcadores entre si.

  17. ClC-3 Promotes Osteogenic Differentiation in MC3T3-E1 Cell After Dynamic Compression.

    Science.gov (United States)

    Wang, Dawei; Wang, Hao; Gao, Feng; Wang, Kun; Dong, Fusheng

    2017-06-01

    ClC-3 chloride channel has been proved to have a relationship with the expression of osteogenic markers during osteogenesis, persistent static compression can upregulate the expression of ClC-3 and regulate osteodifferentiation in osteoblasts. However, there was no study about the relationship between the expression of ClC-3 and osteodifferentiation after dynamic compression. In this study, we applied dynamic compression on MC3T3-E1 cells to detect the expression of ClC-3, runt-related transcription factor 2 (Runx2), bone morphogenic protein-2 (BMP-2), osteopontin (OPN), nuclear-associated antigen Ki67 (Ki67), and proliferating cell nuclear antigen (PCNA) in biopress system, then we investigated the expression of these genes after dynamic compression with Chlorotoxin (specific ClC-3 chloride channel inhibitor) added. Under transmission electron microscopy, there were more cell surface protrusions, rough surfaced endoplasmic reticulum, mitochondria, Golgi apparatus, abundant glycogen, and lysosomes scattered in the cytoplasm in MC3T3-E1 cells after dynamic compression. The nucleolus was more obvious. We found that ClC-3 was significantly up-regulated after dynamic compression. The compressive force also up-regulated Runx2, BMP-2, and OPN after dynamic compression for 2, 4 and 8 h. The proliferation gene Ki67 and PCNA did not show significantly change after dynamic compression for 8 h. Chlorotoxin did not change the expression of ClC-3 but reduced the expression of Runx2, BMP-2, and OPN after dynamic compression compared with the group without Cltx added. The data from the current study suggested that ClC-3 may promotes osteogenic differentiation in MC3T3-E1 cell after dynamic compression. J. Cell. Biochem. 118: 1606-1613, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  18. Nano-hydroxyapatite particles induce apoptosis on MC3T3-E1 cells and tissue cells in SD rats

    Science.gov (United States)

    Wang, Liting; Zhou, Gang; Liu, Haifeng; Niu, Xufeng; Han, Jingyun; Zheng, Lisha; Fan, Yubo

    2012-04-01

    While the advantages of nanomaterials are being increasingly recognized, their potential toxicity is drawing more and more attention and concern. In this study, we explore the toxicity mechanism of 20-30 nm rod-shaped hydroxyapatite (HA) nanoparticles in vitro and in vivo. The nanoparticles were prepared by precipitation and characterized by IR, XRD and TEM. Concentrations of 0 μg mL-1, 10 μg mL-1, 100 μg mL-1, 1 mg mL-1, and 10 mg mL-1 were applied to the MC3T3-E1 cells for viability (MTT-test). Based on the characteristic differences of the two methods of cell death, the morphological features of the MC3T3-E1 cell line co-cultured with nano-hydroxyapatite (n-HA) (10 mg mL-1) for 24 h were also observed by TEM. Furthermore, important serum biochemical markers and histopathological examinations were used to evaluate the potential toxicological effect of n-HA on the major organs of SD rats injected intraperitoneally with n-HA (33.3 mg kg-1 body weight). In the results, we found cell growth inhibition and apoptosis in MC3T3-E1 cells co-cultured with n-HA. Moreover, apoptosis but not necrosis was illustrated in liver and renal tissue by using histopathology slices and serum biochemical markers. It suggests that apoptosis may be the possible mechanism of n-HA toxicity and provides a better understanding of the biocompatibility of nanomaterials applied in human bone repair.

  19. The NPOESS Preparatory Project Science Data Segment (SDS) Data Depository and Distribution Element (SD3E) System Architecture

    Science.gov (United States)

    Ho, Evelyn L.; Schweiss, Robert J.

    2008-01-01

    The National Polar-orbiting Operational Environmental Satellite System (NPOESS) Preparatory Project (NPP) Science Data Segment (SDS) will make daily data requests for approximately six terabytes of NPP science products for each of its six environmental assessment elements from the operational data providers. As a result, issues associated with duplicate data requests, data transfers of large volumes of diverse products, and data transfer failures raised concerns with respect to the network traffic and bandwidth consumption. The NPP SDS Data Depository and Distribution Element (SD3E) was developed to provide a mechanism for efficient data exchange, alleviate duplicate network traffic, and reduce operational costs.

  20. Distributed Systems 3/e

    NARCIS (Netherlands)

    Tanenbaum, A.S.; van Steen, M.R.

    2016-01-01

    For this third edition of "Distributed Systems," the material has been thoroughly revised and extended, integrating principles and paradigms into nine chapters: 1. Introduction 2. Architectures 3. Processes 4. Communication 5. Naming 6. Coordination 7. Replication 8. Fault tolerance 9. Security A

  1. Data quick filtration algorithm in an experiment on the search of μ-3e decay at ARES spectrometer

    International Nuclear Information System (INIS)

    Evtukhovich, P.G.

    1985-01-01

    The objective of the paper in the development of the program operating under a real-time mode. The program reduced drastically the initial information flow in the experiment on the μ-3e decay search due to quick identification of charged particle tracks conducted using the ARES spectrometer. The possibility of such identification is based on the comparison of event track (after each unit start) with reference tracks. Among the totality of wires being in action in all chambers, the program selects those wires which produce tracks similar to reference ones. After the ''sewing-in'' procedure, which enables to detect spiral tracks, the picture of the event is completely reconstructed and selection of particles is conducted through the criterion of particle number. The program testing on semulated μ-3e events allows to define the program speed and selection efficiency. The mean time of analys is of one event is about 5 ms, the selection efficiency is approximately 83% at a severe criterion of particle number

  2. Linarin isolated from Buddleja officinalis prevents hydrogen peroxide-induced dysfunction in osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Kim, Young Ho; Lee, Young Soon; Choi, Eun Mi

    2011-01-01

    The flowers and leaves buds of Buddleja officinalis MAXIM (Buddlejaceae) are used to treat eye troubles, hernia, gonorrhea and liver troubles in Asia. To elucidate the protective effects of linarin isolated from B. officinalis on the response of osteoblast to oxidative stress, osteoblastic MC3T3-E1 cells were pre-incubated with linarin for 1h before treatment with 0.3mM H(2)O(2) for 48h, and markers of osteoblast function and oxidative damage were examined. Linarin significantly (P<0.05) increased cell survival, alkaline phosphatase (ALP) activity, collagen content, calcium deposition, and osteocalcin secretion and decreased the production of receptor activator of nuclear factor-kB ligand (RANKL), protein carbonyl (PCO), and malondialdehyde (MDA) of osteoblastic MC3T3-E1 cells in the presence of hydrogen peroxide. These results demonstrate that linarin can protect osteoblasts against hydrogen peroxide-induced osteoblastic dysfunction and may exert anti-resorptive actions, at least in part, via the reduction of RANKL and oxidative damage. 2011 Elsevier Inc. All rights reserved.

  3. The NPOESS Preparatory Project (NPP) Science Data Segment (SDS) Data Depository and Distribution Element (SD3E) System Architecture

    Science.gov (United States)

    Ho, Evelyn L.; Schweiss, Robert J.

    2008-01-01

    The National Polar-orbiting Operational Environmental Satellite System (NPOESS), the U.S. Government's future low-Earth orbiting satellite system, will monitor global weather and environmental conditions. Serving as a risk reduction for NPOESS, the NPOESS Preparatory Project (NPP) will provide remotely sensed atmospheric, land, ocean, ozone, and sounder data that will serve the meteorological and global climate change scientific communities. The National Aeronautics and Space Administration (NASA) NPP Science Data Segment's (SDS) primary role is to independently assess the quality of the NPP science and environmental data records for their ability to support climate research. The SDS is composed of nine elements; an input element that receives data from the operational agencies and acts as a buffer, a calibration analysis element, five elements devoted to measurement based quality assessment, an element used to test algorithmic improvements, and an element that provides overall science direction. Each element requires a set of sensor specific science data products for their evaluation. There are four NPP sensors that will be flown on the NPP observatory. They are the Visible Infrared Imagining Radiometer Suite (VIIRS), the Advanced Technology Microwave Sounder (ATMS), the Cross-Track Infrared Sounder (CrIS), and the Ozone Mapper/Profiler Suite (OMPS). It is estimated that these four sensors combined will make daily data requests for approximately six terabytes of NPP science products from the operational data providers. As a result, issues associated with duplicate data requests, data transfers of large volumes of diverse products, and data transfer failures raised concerns with respect to the network traffic and bandwidth consumption. Therefore, a central data broker system for receiving and buffering data requests and data products for the SDS was developed. The data element for this system is called the SDS Data Depository and Distribution Element (SD3E). It

  4. The O3E program: Innovative educational and communication tools for better face natural hazards and emergencies

    Science.gov (United States)

    Berenguer, Jean Luc; Solarino, Stefano; Corboulex, Françoise; Ponzone, Monica; Cremonini, Roberto; Eva, Claudio; Eva, Elena; Ferretti, Gabriele; Leputh, Jessica; Barroux, Emmanuel; Sornette, Anne; Luyet, Vincent; Bosset, Henry

    2010-05-01

    As dramatically reminded during the last days by the Haiti disaster, earthquakes are traumatic events as storms or floods. They cause more damages when population don't have the knowledge of these phenomena and doesn't know how to deal with it. Presently, it's not possible to predict an earthquakes or extreme meteorological events. Preparation stay the best and efficient way to save life. Education and training are two essential ingredients to help the population to perceive the scientific information formerly confined in the laboratories, in particular in the domain of the environmental risk. The "O3E" innovative Project (European Observatory for Education and Environment) is established after 10 years (1997-2007) of regional, national and international programs ("Sismos of the Schools", "Rinamed Medocc"), and from Italian and Swiss experiences concerning environment tools for education. This project with cooperation between scientists of France, Italy and Switzerland, is born to promote a responsible behavior of young citizens by means of scientific information about natural risks. ARGAL (Agency for Geological Risk in the Latin Arc - France) operates the administrative and technical coordination. The first innovative output of O3E is the creation of a school network in the Alpine and Mediterranean areas equipped with environmental sensors installed direct into the educational buildings. The data by seismometers, weather stations, river's flows and soil moisture, recorded in the schools and processed by the students, are collected on dedicated servers and then made available through a internet platform to the entire educational community. By means of coordinated activities of critical analysis of data, their comparison with the information available through other media, the awareness about the importance of knowledge and evaluation of reliable data about their own territory is promoted. This equipment's network "O3E," is the starting point of many other activities

  5. Engine 3E. NO{sub x} reduction by means of homogenisation of mixtures inside combustion chambers. Final report; Engine 3E. NO{sub x}-Reduktion durch Homogenisierung des Gemisches in Brennkammern. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Zarzalis, N.; Homann; Schubert

    1999-11-05

    This is the final report of the Technology Project 'NO{sub x} reduction by means of homogenisation of mixtures inside combustion chambers', which is part of the Engine 3E 2010 programme of the BMBF, which was to promote research in aircraft engineering. In this project, technologies were developed to achieve a 60% reduction of NO{sub x} emissions as compared to ICAO '95 in an annular combustion chamber in realistic operating conditions where the emissions of substances oher than NO{sub x} were to be of the same level as the emissions of modern jet drives. Further, the design of the new combustion chamber was to be conventional in order to retain the possibility of converting existing propulsion systems to the new technology. [German] Diese Notiz enthaelt den Abschlussbericht des Technologievorhabens 'NO{sub x}-Reduktion durch Homogenisierung des Gemisches in Brennkammern'. Das Vorhaben ist Teil des Luftfahrtfoerderprogramms Engine 3E 2010 der Bundesregierung und wird vom Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie (BMBF) unter dem Foerderkennzeichen 20T9540 gefoerdert. Das Programm wurde am 01. Juli 1995 begonnen und endete am 30. Juni 1999. Entsprechend dem Foerderantrag wurden in dem Vorhaben Einzeltechnologien erarbeitet, die erforderlich sind, um eine 60% Reduktion der NO{sub x}-Emissionen gegenueber ICAO '95 in einer Ringbrennkammer unter realistischen Betriebsbedingungen zu demonstrieren, wobei die restlichen Emissionen das Emissionsniveau moderner Triebwerke nicht ueberschreiten sollten. Darueber hinaus sollte das aeussere Design der zu entwickelnden Brennkammer sind von konventionellen Brennkammern nicht unterscheiden, um die Moeglichkeit der Umruestung von alten Triebwerken mit der Brennkammern der neuen Technologie offen zu halten. (orig.)

  6. Compte-rendu de la 3e conférence internationale sur les glucosinolates « Glucosinolates and beyond »

    Directory of Open Access Journals (Sweden)

    Quinsac Alain

    2015-01-01

    Full Text Available La 3e conférence internationale sur les glucosinolates, intitulée « Glucosinolates and beyond », a rassemblé plus d’une centaine de participants à Wageningen aux Pays-Bas, du 12 au 15 Octobre 2014. Le programme a été organisé en quatre sessions couvrant la recherche fondamentale sur l’origine et la biosynthèse des glucosinolates au cours de l’évolution, et les applications concrètes en santé humaine et agriculture. Près de 90 communications orales et posters, portant sur les récents progrès et les questions émergentes pour les recherches futures ont été présentés.

  7. Synthesis of chiral pyrazolo[4,3-e][1,2,4]triazine sulfonamides with tyrosinase and urease inhibitory activity.

    Science.gov (United States)

    Mojzych, Mariusz; Tarasiuk, Paweł; Kotwica-Mojzych, Katarzyna; Rafiq, Muhammad; Seo, Sung-Yum; Nicewicz, Michał; Fornal, Emilia

    2017-12-01

    A new series of sulfonamide derivatives of pyrazolo[4,3-e][1,2,4]triazine with chiral amino group has been synthesized and characterized. The compounds were tested for their tyrosinase and urease inhibitory activity. Evaluation of prepared derivatives demonstrated that compounds (8b) and (8j) are most potent mushroom tyrosinase inhibitors whereas all of the obtained compounds showed higher urease inhibitory activity than the standard thiourea. The compounds (8a), (8f) and (8i) exhibited excellent enzyme inhibitory activity with IC 50 0.037, 0.044 and 0.042 μM, respectively, while IC 50 of thiourea is 20.9 μM.

  8. Advancing non-equilibrium ARPES experiments by a 9.3 eV coherent ultrafast photon source

    Energy Technology Data Exchange (ETDEWEB)

    Cilento, F., E-mail: federico.cilento@elettra.eu [Elettra – Sincrotrone Trieste S.C.p.A., Strada Statale 14, km 163.5, Trieste 34149 (Italy); C.N.R. – I.O.M., Strada Statale 14, km 163.5, Trieste 34149 (Italy); Crepaldi, A. [Elettra – Sincrotrone Trieste S.C.p.A., Strada Statale 14, km 163.5, Trieste 34149 (Italy); Manzoni, G.; Sterzi, A. [Universitá degli Studi di Trieste, Via A. Valerio 2, Trieste 34127 (Italy); Zacchigna, M. [C.N.R. – I.O.M., Strada Statale 14, km 163.5, Trieste 34149 (Italy); Bugnon, Ph.; Berger, H. [Institute of Condensed Matter Physics, Ecole Polytechnique Fédérale de Lausanne (EPFL), CH-1015 Lausanne (Switzerland); Parmigiani, F. [Elettra – Sincrotrone Trieste S.C.p.A., Strada Statale 14, km 163.5, Trieste 34149 (Italy); Universitá degli Studi di Trieste, Via A. Valerio 2, Trieste 34127 (Italy); International Faculty, University of Köln, 50937 Köln (Germany)

    2016-02-15

    The quest for investigating the non-equilibrium dynamics of the band structure of strongly-correlated materials over their entire Brillouin zone is a primary objective. However, the actual ultrafast UV light sources are not suitable for addressing several critical questions in the field. Here we report on a novel light source generating sub-250 fs, 9.3 eV photon energy light pulses at 250 kHz repetition rate, obtained via third-harmonic generation in Xe of frequency-doubled 50 fs laser pulses at 1.55 eV. By reporting the measured band dispersion of a Cu(111) crystal and the non-equilibrium dynamics of the Bi{sub 2}Se{sub 3} topological insulator, we prove that this source is suitable for studying the non-equilibrium dynamics of the entire Fermi surface of several complex materials, with high signal statistics and limited space-charge effect.

  9. Effect of injection molded micro-structured polystyrene surfaces on proliferation of MC3T3-E1 cells

    Directory of Open Access Journals (Sweden)

    G. Lucchetta

    2015-04-01

    Full Text Available In this work, osteoinductive micro-pillared polystyrene surfaces were mass-produced for bone replacement applications, by means of the micro injection molding process. Firstly, the molding process parameters were optimized with a two-level, three-factor central composite face-centered plan to increase the quality of polystyrene micro pillars replication and to maximize the pillars height uniformity over the molded part. Secondly, osteoblastic MC3T3-E1 cells adhesion and proliferation on the replicated substrates were assessed as a function of micro topography parameters, such as pillars diameter, aspect ratio and spacing. Cell morphology and proliferation were evaluated through MTS test after 1, 3 and 7 days from seeding. The experimental results showed that cells adhesion and proliferation is more positively promoted on micro-pillared surfaces compared to flat surfaces, but no correlations were observed between cell proliferation and pillar diameter and spacing.

  10. Graphene Oxide Hybridized nHAC/PLGA Scaffolds Facilitate the Proliferation of MC3T3-E1 Cells

    Science.gov (United States)

    Liang, Chunyong; Luo, Yongchao; Yang, Guodong; Xia, Dan; Liu, Lei; Zhang, Xiaomin; Wang, Hongshui

    2018-01-01

    Biodegradable porous biomaterial scaffolds play a critical role in bone regeneration. In this study, the porous nano-hydroxyapatite/collagen/poly(lactic-co-glycolic acid)/graphene oxide (nHAC/PLGA/GO) composite scaffolds containing different amount of GO were fabricated by freeze-drying method. The results show that the synthesized scaffolds possess a three-dimensional porous structure. GO slightly improves the hydrophilicity of the scaffolds and reinforces their mechanical strength. Young's modulus of the 1.5 wt% GO incorporated scaffold is greatly increased compared to the control sample. The in vitro experiments show that the nHAC/PLGA/GO (1.5 wt%) scaffolds significantly cell adhesion and proliferation of osteoblast cells (MC3T3-E1). This present study indicates that the nHAC/PLGA/GO scaffolds have excellent cytocompatibility and bone regeneration ability, thus it has high potential to be used as scaffolds in the field of bone tissue engineering.

  11. Adiponectin and AMP kinase activator stimulate proliferation, differentiation, and mineralization of osteoblastic MC3T3-E1 cells

    Directory of Open Access Journals (Sweden)

    Yamauchi Mika

    2007-11-01

    Full Text Available Abstract Background Adiponectin is a key mediator of the metabolic syndrome that is caused by visceral fat accumulation. Adiponectin and its receptors are known to be expressed in osteoblasts, but their actions with regard to bone metabolism are still unclear. In this study, we investigated the effects of adiponectin on the proliferation, differentiation, and mineralization of osteoblastic MC3T3-E1 cells. Results Adiponectin receptor type 1 (AdipoR1 mRNA was detected in the cells by RT-PCR. The adenosine monophosphate-activated protein kinase (AMP kinase was phosphorylated by both adiponectin and a pharmacological AMP kinase activator, 5-amino-imidazole-4-carboxamide-riboside (AICAR, in the cells. AdipoR1 small interfering RNA (siRNA transfection potently knocked down the receptor mRNA, and the effect of this knockdown persisted for as long as 10 days after the transfection. The transfected cells showed decreased expressions of type I collagen and osteocalcin mRNA, as determined by real-time PCR, and reduced ALP activity and mineralization, as determined by von Kossa and Alizarin red stainings. In contrast, AMP kinase activation by AICAR (0.01–0.5 mM in wild-type MC3T3-E1 cells augmented their proliferation, differentiation, and mineralization. BrdU assay showed that the addition of adiponectin (0.01–1.0 μg/ml also promoted their proliferation. Osterix, but not Runx-2, appeared to be involved in these processes because AdipoR1 siRNA transfection and AICAR treatments suppressed and enhanced osterix mRNA expression, respectively. Conclusion Taken together, this study suggests that adiponectin stimulates the proliferation, differentiation, and mineralization of osteoblasts via the AdipoR1 and AMP kinase signaling pathways in autocrine and/or paracrine fashions.

  12. Genes Responsive to Low-Intensity Pulsed Ultrasound in MC3T3-E1 Preosteoblast Cells

    Directory of Open Access Journals (Sweden)

    Yoshiaki Tabuchi

    2013-11-01

    Full Text Available Although low-intensity pulsed ultrasound (LIPUS has been shown to enhance bone fracture healing, the underlying mechanism of LIPUS remains to be fully elucidated. Here, to better understand the molecular mechanism underlying cellular responses to LIPUS, we investigated gene expression profiles in mouse MC3T3-E1 preosteoblast cells exposed to LIPUS using high-density oligonucleotide microarrays and computational gene expression analysis tools. Although treatment of the cells with a single 20-min LIPUS (1.5 MHz, 30 mW/cm2 did not affect the cell growth or alkaline phosphatase activity, the treatment significantly increased the mRNA level of Bglap. Microarray analysis demonstrated that 38 genes were upregulated and 37 genes were downregulated by 1.5-fold or more in the cells at 24-h post-treatment. Ingenuity pathway analysis demonstrated that the gene network U (up contained many upregulated genes that were mainly associated with bone morphology in the category of biological functions of skeletal and muscular system development and function. Moreover, the biological function of the gene network D (down, which contained downregulated genes, was associated with gene expression, the cell cycle and connective tissue development and function. These results should help to further clarify the molecular basis of the mechanisms of the LIPUS response in osteoblast cells.

  13. In vitro behavior of MC3T3-E1 preosteoblast with different annealing temperature titania nanotubes.

    Science.gov (United States)

    Yu, W Q; Zhang, Y L; Jiang, X Q; Zhang, F Q

    2010-10-01

    Titanium oxide nanotube layers by anodization have excellent potential for dental implants because of good bone cell promotion. It is necessary to evaluate osteoblast behavior on different annealing temperature titania nanotubes for actual implant designs.  Scanning Electron Microscopy, X-Ray polycrystalline Diffractometer (XRD), X-ray photoelectron Spectroscope, and Atomic Force Microscopy (AFM) were used to characterize the different annealing temperature titania nanotubes. Confocal laser scanning microscopy, MTT, and Alizarin Red-S staining were used to evaluate the MC3T3-E1 preosteoblast behavior on different annealing temperature nanotubes.  The tubular morphology was constant when annealed at 450°C and 550°C, but collapsed when annealed at 650°C. XRD exhibited the crystal form of nanotubes after formation (amorphous), after annealing at 450°C (anatase), and after annealing at 550°C (anatase/rutile). Annealing led to the complete loss of fluorine on nanotubes at 550°C. Average surface roughness of different annealing temperature nanotubes showed no difference by AFM analysis. The proliferation and mineralization of preostoblasts cultured on anatase or anatase/rutile nanotube layers were shown to be significantly higher than smooth, amorphous nanotube layers.  Annealing can change the crystal form and composition of nanotubes. The nanotubes after annealing can promote osteoblast proliferation and mineralization in vitro. © 2010 John Wiley & Sons A/S.

  14. arXiv The MuPix System-on-Chip for the Mu3e Experiment

    CERN Document Server

    Augustin, Heiko

    2017-02-11

    Mu3e is a novel experiment searching for charged lepton flavor violation in the rare decay $\\mu^+ \\rightarrow e^+e^-e^+$. Decay vertex position, decay time and particle momenta have to be precisely measured in order to reject both accidental and physics background. A silicon pixel tracker based on $50\\,\\mu$m thin high voltage monolithic active pixel sensors (HV-MAPS) in a 1 T solenoidal magnetic field provides precise vertex and momentum information. The MuPix chip combines pixel sensor cells with integrated analog electronics and a periphery with a complete digital readout. The MuPix7 is the first HV-MAPS prototype implementing all functionalities of the final sensor including a readout state machine and high speed serialization with 1.25 Gbit/s data output, allowing for a streaming readout in parallel to the data taking. The observed efficiency of the MuPix7 chip including the full readout system is $\\geq99\\%$ in a high rate test beam.

  15. Traf2 interacts with Smad4 and regulates BMP signaling pathway in MC3T3-E1 osteoblasts

    International Nuclear Information System (INIS)

    Shimada, Koichi; Ikeda, Kyoko; Ito, Koichi

    2009-01-01

    Bone morphogenetic proteins (BMPs) play important roles in osteoblast differentiation and maturation. In mammals, the BMP-induced receptor-regulated Smads form complexes with Smad4. These complexes translocate and accumulate in the nucleus, where they regulate the transcription of various target genes. However, the function of Smad4 remains unclear. We performed a yeast two-hybrid screen using Smad4 as bait and a cDNA library derived from bone marrow, to indentify the proteins interacting with Smad4. cDNA clones for Tumor necrosis factor (TNF) receptor-associated factor 2 (Traf2) were identified, and the interaction between the endogenous proteins was confirmed in the mouse osteoblast cell line MC3T3-E1. To investigate the function of Traf2, we silenced it with siRNA. The level of BMP-2 protein in the medium, the expression levels of the Bmp2 gene and BMP-induced transcription factor genes, including Runx2, Dlx5, Msx2, and Sp7, and the phosphorylated-Smad1 protein level were increased in cells transfected with Traf2 siRNA. The nuclear accumulation of Smad1 increased with TNF-α stimulation for 30 min at Traf2 silencing. These results suggest that the TNF-α-stimulated nuclear accumulation of Smad1 may be dependent on Traf2. Thus, the interaction between Traf2 and Smad4 may play a role in the cross-talk between TNF-α and BMP signaling pathways.

  16. The effects of low dose X-irradiation on osteoblastic MC3T3-E1 cells in vitro

    Directory of Open Access Journals (Sweden)

    Xu Wei

    2012-06-01

    Full Text Available Abstract Background It has been indicated that moderate or high dose of X-irradiation could delay fracture union and cause osteoradionecrosis, in part, mediated by its effect on proliferation and differentiation of osteoblasts. However, whether low dose irradiation (LDI has similar roles on osteoblasts is still unknown. In this study, we investigated whether and to what extent LDI could affect the proliferation, differentiation and mineralization of osteoblasts in vitro. Methods The MC3T3-E1 cells were exposed to single dose of X-irradiation with 0, 0.1, 0.5, 1.0 Gy respectively. Cell proliferation, apoptosis, alkaline phosphatase (ALP activity, and mineralization was evaluated by methylthiazoletetrazolium (MTT and bromodeoxyuridine (BrdU assay, flow cytometry, ALP viability kit and von Kossa staining, respectively. Osteocalcin (OCN and core-binding factor α1 (Cbfα1 expressions were measured by real time-PCR and western blot, respectively. Results The proliferation of the cells exposed to 2.0 Gy was significantly lower than those exposed to ≤1.0 Gy (p  Conclusions LDI have different effects on proliferation and differentiation of osteoblasts from those of high dose of X-irradiation, which might suggest that LDI could lead to promotion of frature healing through enhancing the differentiation and mineralization of osteoblasts.

  17. Effect of hierarchical pore structure on ALP expression of MC3T3-E1 cells on bioglass films.

    Science.gov (United States)

    Yu, Cuixia; Zhuang, Junjun; Dong, Lingqing; Cheng, Kui; Weng, Wenjian

    2017-08-01

    Hierarchical porous bioglass films on the tantalum were designed to enhance osteointegration of metallic implants. The films were prepared by a sol-gel method using P123 as the mesopore template and polystyrene microsphere as the nanopore template. The films with 5.4nm mesopores and 100nm nanopores (MBG-100) elicited an obviously elongated morphology of the cultured MC3T3-E1 cells, as a result, a higher alkaline phosphatase level was expressed. It is suggested that the nanopores play an important role in regulating cellular behavior by initial protein adsorption through nanopore curvatures. The mesopores were proven very effective for loading rhBMP-2, and the rhBMP-2 loaded on MBG-100 films showed a better function of enhancing osteogenic differentiation, which is attributed to that the nanopore structure could expedite rhBMP-2 release and provide a microenvironment for intensifying the interaction of rhBMP-2 with the cells. Hence, the cell osteogenic differentiation can be enhanced by hierarchical porous bioglass films through both the porous structure and rhBMP-2 induction. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. High-voltage pixel detectors in commercial CMOS technologies for ATLAS, CLIC and Mu3e experiments

    CERN Document Server

    Peric,I et al.

    2013-01-01

    High-voltage particle detectors in commercial CMOS technologies are a detector family that allows implementation of low-cost, thin and radiation-tolerant detectors with a high time resolution. In the R/D phase of the development, a radiation tolerance of 1015 neq=cm2 , nearly 100% detection efficiency and a spatial resolution of about 3 μm were demonstrated. Since 2011 the HV detectors have first applications: the technology is presently the main option for the pixel detector of the planned Mu3e experiment at PSI (Switzerland). Several prototype sensors have been designed in a standard 180 nm HV CMOS process and successfully tested. Thanks to its high radiation tolerance, the HV detectors are also seen at CERN as a promising alternative to the standard options for ATLAS upgrade and CLIC. In order to test the concept, within ATLAS upgrade R/D, we are currently exploring an active pixel detector demonstrator HV2FEI4; also implemented in the 180 nm HV process.

  19. Latent Heating Profiles Derived from ARM Radar Observations in MC3E and GoAmazon Field Campaigns

    Science.gov (United States)

    Min, Q.; Li, R.; Mu, Z.; Giangrande, S. E.; Wang, Y.

    2016-12-01

    Atmosphere latent heating (LH) is released through water phase change processes in the atmosphere. There is a physical connection between LH rate and updraft velocity (ω) inside clouds. In this study, we develop a new LH algorithm based on a quantified LH-ω relationship found in cloud resolving model (CRM) simulations. The self-consistency check with CRM simulations shows that the retrievals correctly replicate the main features of LH profiles, including their total and individual components (i.e. condensation-evaporation heating rate, deposition-sublimation heating rate, and freezing-melting heating rate). Further, the algorithm is applied to real cases from the DOE-ARM MC3E and GoAmazon2014/6 Field Campaigns using available UHF (915 and 1290 MHz) zenith radar retrievals of vertical velocity and rain rate as input. The retrieved LH profiles in the deep convective rains show positive heating throughout the column, the LH profiles in the stratiform rains with well-defined bright-band showing clear dipole patterns with positive heating above and negative cooling below the freezing level. The altitudes of maximum heating in the widespread stratiform regimes are clearly higher than those found within deep convective regions. Overall, these Latent heating rate profiles, as an important geophysical quantity of interest, can provide useful climate diagnostic data, and ultimately, constraints for model-based analyses of large-scale heating distributions.

  20. High-voltage pixel detectors in commercial CMOS technologies for ATLAS, CLIC and Mu3e experiments

    CERN Document Server

    Peric, Ivan; Backhaus, Malte; Barbero, Marlon; Benoit, Mathieu; Berger, Niklaus; Bompard, Frederic; Breugnon, Patrick; Clemens, Jean-Claude; Dannheim, Dominik; Dierlamm, Alexander; Feigl, Simon; Fischer, Peter; Fougeron, Denis; Garcia-Sciveres, Maurice; Heim, Timon; Hügging, Fabian; Kiehn, Moritz; Kreidl, Christian; Krüger, Hans; La Rosa, Alessandro; Liu, Jian; Lütticke, Florian; Mariñas, Carlos; Meng, Lingxin; Miucci, Antonio; Münstermann, Daniel; Nguyen, Hong Hanh; Obermann, Theresa; Pangaud, Patrick; Perrevoort, Ann-Kathrin; Rozanov, Alexandre; Schöning, André; Schwenker, Benjamin; Wiedner, Dirk

    2013-01-01

    High-voltage particle detectors in commercial CMOS technologies are a detector family that allows implementation of low-cost, thin and radiation-tolerant detectors with a high time resolution. In the R/D phase of the development, a radiation tolerance of 10 15 n eq = cm 2 , nearly 100% detection ef fi ciency and a spatial resolution of about 3 μ m were demonstrated. Since 2011 the HV detectors have fi rst applications: the technology is presently the main option for the pixel detector of the planned Mu3e experiment at PSI (Switzerland). Several prototype sensors have been designed in a standard 180 nm HV CMOS process and successfully tested. Thanks to its high radiation tolerance, the HV detectors are also seen at CERN as a promising alternative to the standard options for ATLAS upgrade and CLIC. In order to test the concept, within ATLAS upgrade R/D, we are currently exploring an active pixel detector demonstrator HV2FEI4; also implemented in the 180 nm HV process

  1. Biomass Smoke Influences on Deep Convection during the 2011 Midlatitude Continental Convective Clouds Experiment (MC3E)

    Science.gov (United States)

    Dong, X.; Logan, T.; Xi, B.

    2015-12-01

    Three deep convective cloud cases were selected during the 2011 Mid-Latitude Continental Convective Clouds Experiment (MC3E). Although biomass burning smoke advected from Mexico and Central America was the dominant source of cloud condensation nuclei (CCN) for deep convective cloud formation, the 11 May, 20 May, and 23 May cases exhibited different convective characteristics. The convection in the 11 May and 23 May cases formed in smoke laden environments in the presence of convective available potential energy (CAPE) values exceeding 1000 m2 s-2 and 3000 m2 s-2 along with low-level (0-1 km) shear of 10.3 m s-1 and 5.1 m s-1, respectively. The 11 May case had linear convection while the 23 May case featured discrete supercells. The 20 May case featured elevated linear convection that formed in a more moist environment with cleaner aerosol conditions, weak CAPE (9 km) suggesting a warm rain suppression mechanism caused by a combination of strong aerosol loading, large CAPE, and weak low-level wind shear. The observed results for the 20 May and 23 May cases agree well with recent modeling studies that simulated the convection and precipitation in these cases. Furthermore, the modeling of the 11 May case is suggested since the abundant amount of smoke CCN did not greatly enhance the overall precipitation amount and could be a possible aerosol-induced precipitation suppression case.

  2. MC3T3-E1 cell response to stainless steel 316L with different surface treatments

    International Nuclear Information System (INIS)

    Zhang, Hongyu; Han, Jianmin; Sun, Yulong; Huang, Yongling; Zhou, Ming

    2015-01-01

    In the present study, stainless steel 316L samples with polishing, aluminum oxide blasting, and hydroxyapatite (HA) coating were prepared and characterized through a scanning electron microscope (SEM), optical interferometer (surface roughness, Sq), contact angle, surface composition and phase composition analyses. Osteoblast-like MC3T3-E1 cell adhesion on the samples was investigated by cell morphology using a SEM (4 h, 1 d, 3 d, 7 d), and cell proliferation was assessed by MTT method at 1 d, 3 d, and 7 d. In addition, adsorption of bovine serum albumin on the samples was evaluated at 1 h. The polished sample was smooth (Sq: 1.8 nm), and the blasted and HA coated samples were much rougher (Sq: 3.2 μm and 7.8 μm). Within 1 d of incubation, the HA coated samples showed the best cell morphology (e.g., flattened shape and complete spread), but there was no significant difference after 3 d and 7 d of incubation for all the samples. The absorbance value for the HA coated samples was the highest after 1 d and 3 d of incubation, indicating better cell viability. However, it reduced to the lowest value at 7 d. Protein adsorption on the HA coated samples was the highest at 1 h. The results indicate that rough stainless steel surface improves cell adhesion and morphology, and HA coating contributes to superior cell adhesion, but inhibits cell proliferation. - Highlights: • Rough stainless steel surface improves cell adhesion and proliferation. • HA coating results in superior cell morphology and cell attachment. • HA coating inhibits osteoblast cell proliferation after 7 d of incubation

  3. MC3T3-E1 cell response to stainless steel 316L with different surface treatments

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hongyu [State Key Laboratory of Tribology, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China); Han, Jianmin, E-mail: siyanghan@163.com [Dental Materials Laboratory, National Engineering Laboratory for Digital and Material Technology of Stomatology, Peking University School and Hospital of Stomatology, Beijing 100081 (China); Sun, Yulong [State Key Laboratory of Tribology, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China); Huang, Yongling [Jinghang Biomedicine Engineering Division, Beijing Institute of Aeronautical Material, Beijing 100095 (China); Zhou, Ming [State Key Laboratory of Tribology, Department of Mechanical Engineering, Tsinghua University, Beijing 100084 (China)

    2015-11-01

    In the present study, stainless steel 316L samples with polishing, aluminum oxide blasting, and hydroxyapatite (HA) coating were prepared and characterized through a scanning electron microscope (SEM), optical interferometer (surface roughness, Sq), contact angle, surface composition and phase composition analyses. Osteoblast-like MC3T3-E1 cell adhesion on the samples was investigated by cell morphology using a SEM (4 h, 1 d, 3 d, 7 d), and cell proliferation was assessed by MTT method at 1 d, 3 d, and 7 d. In addition, adsorption of bovine serum albumin on the samples was evaluated at 1 h. The polished sample was smooth (Sq: 1.8 nm), and the blasted and HA coated samples were much rougher (Sq: 3.2 μm and 7.8 μm). Within 1 d of incubation, the HA coated samples showed the best cell morphology (e.g., flattened shape and complete spread), but there was no significant difference after 3 d and 7 d of incubation for all the samples. The absorbance value for the HA coated samples was the highest after 1 d and 3 d of incubation, indicating better cell viability. However, it reduced to the lowest value at 7 d. Protein adsorption on the HA coated samples was the highest at 1 h. The results indicate that rough stainless steel surface improves cell adhesion and morphology, and HA coating contributes to superior cell adhesion, but inhibits cell proliferation. - Highlights: • Rough stainless steel surface improves cell adhesion and proliferation. • HA coating results in superior cell morphology and cell attachment. • HA coating inhibits osteoblast cell proliferation after 7 d of incubation.

  4. The Proposal Concept of Development and Implementation in Strategy of Sustainable Corporate Social Responsibility in the Context of the HCS Model 3E

    Science.gov (United States)

    Sakál, Peter; Hrdinová, Gabriela

    2016-06-01

    This article is the result of a conceptual design methodology for the development of a sustainable strategy of sustainable corporate social responsibility (SCSR) in the context of the HCS model 3E formed, as a co-author within the stated grants and dissertation. On the basis of the use of propositional logic, the SCSR procedure is proposed for incorporation into the corporate strategy of sustainable development and the integrated management system (IMS) of the industrial enterprise. The aim of this article is the proposal of the concept of development and implementation strategy of SCSR in the context of the HCS model 3E.

  5. miR-195 inhibited abnormal activation of osteoblast differentiation in MC3T3-E1 cells via targeting RAF-1.

    Science.gov (United States)

    Chao, Chen; Li, Feng; Tan, Zhiping; Zhang, Weizhi; Yang, Yifeng; Luo, Cheng

    2018-01-15

    Recent reports have demonstrated that RAF-1 L613V (a mutant of RAF-1) mutant mice show bone deformities similar to Noonan syndrome. It has been suggested that RAF-1 L613V might abnormally activate osteoblast differentiation of MC3T3-E1 cells. To demonstrate that RAF-1 is associated with bone deformity and that RAF-1 L613V dependent bone deformity could be inhibited by microRNA-195 (miR-195), we first investigated the amplifying influence of wild-type RAF-1 (WT) or RAF-1 L613V (L613V) on the viability and differentiation of MC3T3-E1 cells induced by bone morphogenetic protein-2 (BMP-2) via 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, alkaline phosphatase (ALP) and Alizarin Red S (ARS) staining, quantitative real-time polymerase chain reaction (qRT-PCR) and western blot analysis. Subsequently, we investigated the blocking effect and its mechanism of miR-195 for abnormal activation of osteoblast differentiation of MC3T3-E1 cells via targeting RAF-1. RAF-1, especially RAF-1 L613V , abnormally activates osteoblast differentiation of MC3T3-E1 cells induced by BMP-2. Meanwhile, miR-195 could inhibit the cell viability and differentiation of MC3T3-E1 cells. Transfection of miR-195 largely suppressed the L613V-induced viability and osteoblast differentiation of MC3T3-E1 cells and attenuated the accelerative effect of L613V on runt-related transcription factor-2 (Runx2), Osterix (OSX), alkaline phosphatase (ALP), osteocalcin (OCN), and distal-less homeobox 5 (DLX5) osteogenic gene expressions. In addition, miR-195 decreased the expression of RAF-1 mRNA and protein by directly targeting the 3'-untranslated regions (3'-UTR) of RAF-1 mRNA in MC3T3-E1 cells. Our findings indicated that miR-195 inhibited WT and L613V RAF-1 induced hyperactive osteoblast differentiation in MC3T3-E1 cells by targeting RAF-1. miR-195 might be a novel therapeutic agent for the treatment of L613V-induced bone deformity in Noonan syndrome. Copyright © 2017. Published by

  6. Componentes C3 e C4 do sistema complemento como biomarcadores no diagnóstico de asma atópica intermitente

    Directory of Open Access Journals (Sweden)

    Tainá Mosca

    2011-12-01

    Full Text Available OBJETIVO: Analisar os componentes séricos C3 e C4 do sistema complemento como possíveis biomarcadores de asma atópica intermitente. MÉTODOS: Determinação dos níveis séricos dos componentes C3 e C4 do complemento em 70 crianças com história de "chiado no peito” entre 3 e 14 anos. Após 2 anos de acompanhamento ambulatorial, seguindo-se critérios de inclusão e exclusão, as crianças foram divididas em 2 grupos: 40 crianças com asma atópica intermitente e 30 crianças sem asma. Não houve uso de corticosteroides inalatórios ou sistêmicos ou de broncodilatadores de ação prolongada em nenhum dos grupos. Os dois grupos apresentaram faixas etárias semelhantes, comparadas pelo teste t de Student. Os resultados dos componentes C3 e C4 mostraram distribuição normal e foram então comparados utilizando-se o teste t de Student, considerando-se significante quando p < 0,05. RESULTADOS: Os valores observados no grupo de crianças portadoras de asma atópica intermitente mostraram aumentos significativos para: C3 em 85,0% das crianças; C4 em 87,5%; C3 e C4 em 72,5%; C3 ou C4 em 97,5%, quando comparados aos valores observados das crianças sem asma e da mesma faixa etária. CONCLUSÃO: Observamos um aumento dos valores séricos dos componentes C3 e/ou C4 do sistema complemento na maioria das crianças estudadas portadoras de asma atópica intermitente, em comparação aos valores de crianças sem asma, da mesma faixa etária. Concluímos que a presença de valores aumentados dos componentes C3 e/ou C4 do complemento possa representar um biomarcador no diagnóstico de asma atópica intermitente.

  7. Cuscuta chinensis seeds water extraction protecting murine osteoblastic MC3T3-E1 cells against tertiary butyl hydroperoxide induced injury.

    Science.gov (United States)

    Gao, Jian-mei; Li, Ran; Zhang, Lei; Jia, Li-long; Ying, Xi-xiang; Dou, De-qiang; Li, Jian-chun; Li, Hai-bo

    2013-07-09

    Cuscuta chinensis (C. chinensis) is a well-known traditional Chinese herb that has been used to treat heart disease, diabetes, liver injury, cancer, and aging. Murine osteoblastic MC3T3-E1 cells were treated with various concentrations of C. chinensis water extraction at different time intervals. The antioxidant effect of C. chinensis on MC3T3-E1 cells was evaluated using MTT and TUNEL assays. The effect of C. chinensis on cell cycle was analyzed by flow cytometry with propidium iodide. Lipid peroxidation was measured by the HPLC method. The cellular redox status was determined from the reduced glutathione to oxidized glutathione ratio (GSH/GSSG) and the enzymes involved in glutathione metabolism, including glutathione reductase (GR), Glutathione S-transferase (GST), and Glucose-6-phosphate dehydrogenase (G6PD). The changes in relative mitochondrial transmembrane potential (ΔΨm) in the MC3T3-E1 cells were analyzed with rhodamine 123 staining. Western blot analysis was used to evaluate the levels of cytochrome c (cyto c), Bax, Bcl-2, caspase 3, Sirt3, and IDH2 expressions. The C. chinensis water extraction protects tertiary butyl hydroperoxide (TBHP)-treated MC3T3-E1 cells from death in a dose-dependent manner. C. chinensis treatment significantly inhibited the reactive oxygen species (ROS) generation, malondialdehyde (MDA) production, and increased the activity of superoxide dismutase (SOD), GR, GST, and G6PD. The release of cyto c from mitochondria was reduced by C. chinensis, which increased the expression of antiapoptotic IDH2, Sirt3, and Bcl-2 and decreased the expression of Bax, cyto c, and caspase 3. C. chinensis modulated the oxidative stress-induced apoptosis in MC3T3-E1 cells, probably due to its antioxidant activity and functioning via mitochondria-dependent pathways. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  8. [Effects of sintered bone modified with surface mineralization/P24 peptide composite biomaterial on the adhesion, proliferation and osteodifferentiation of MC3T3-E1 cells].

    Science.gov (United States)

    Li, Jingfeng; Zheng, Qixin; Guo, Xiaodong; Chen, Liaobin

    2014-10-01

    In the present research, the effects of sintered bone modified with surface mineralization/P24 peptide composite biomaterials on the adhesion, proliferation and osteodifferentiation of MC3T3-E1 cells were investigated. The experiments were divided into three groups due to biomaterials used: Group A (composite materials of sintered bone modified with surface mineralization and P24, a peptide of bone morphogenetic protein-2); Group B (sintered bone modified with surface mineralization) and Group C (sintered bone only). The three groups were observed by scanning electron microscopy (SEM) before the experiments, respectively. Then MC3T3-E1 cells were cultured on the surfaces of the three kinds of material, respectively. The cell adhesion rate was assessed by precipitation method. The proliferative ability of MC3T3-E1 cells were measured with MTT assay. And the ALP staining and measurement of alkaline phosphatase (ALP) activity were performed to assess the differentiation of cells into osteoblasts. The SEM results showed that the materials in the three groups retained the natural pore structure and the pore sizes were in the range between 200-850 μm. The adhesive ratio measurements and MTT assay suggested that adhesion and proliferation of MC3T3-E1 cells in Group A were much higher than those in Group B and Group C (P bone modified with surface mineralization/P24 composite material was confirmed to improve the adhesion rate and proliferation and osteodifferentiation of MC3T3-E1 cells, and maintained their morphology.

  9. Protection by the flavonoids quercetin and luteolin against peroxide- or menadione-induced oxidative stress in MC3T3-E1 osteoblast cells.

    Science.gov (United States)

    Fatokun, Amos A; Tome, Mercedes; Smith, Robert A; Darlington, L Gail; Stone, Trevor W

    2015-01-01

    Potential protective effects of the flavonoids quercetin and luteolin have been examined against the oxidative stress of MC3T3-E1 osteoblast-like cells. Although hydrogen peroxide and menadione reduced cell viability, the toxicity was prevented by desferrioxamine or catalase but not superoxide dismutase, suggesting the involvement of hydrogen peroxide in both cases. Quercetin and luteolin reduced the oxidative damage, especially that caused by hydrogen peroxide. When cultures were pre-incubated with quercetin or luteolin, protection was reduced or lost. Protection was also reduced when a 24 h pre-incubation with the flavonoids was followed by exposure to menadione alone. Pretreating cultures with luteolin impaired protection by quercetin, whereas quercetin pretreatment did not affect protection by luteolin. It is concluded that quercetin and luteolin suppress oxidative damage to MC3T3-E1 cells, especially caused by peroxide. The reduction in protection by pretreatment implies a down-regulation of part of the toxic transduction pathway.

  10. μ→3e and μ→eγ decays in the model with neutrino and heavy neutral leptons mixing

    International Nuclear Information System (INIS)

    Ovchinnikova, A.A.

    1978-01-01

    Muon number nonconservation is discussed within the framework of the renormalizable model of Decker and Pestieau. To renormalize this model four heavy leptons are added. Then the gauge group SU(2)xU(1) is considered. Besides standard left doublets, the right ones in which mixing of neutrino and neutral heavy leptons takes place are introduced. In such a scheme the neutral current of charged leptons is a pure vector. Then the branching ratios of μ→3e and μ→eγ decays are evaluated. It has been shown that these quantities greatly depend upon neutrino masses. If neutrino has a mass about 0.65 MeV, the μ→eγ decay probability may well be close to its experimentally determined upper limit. It this model the μ→3e decay rate is a/π times less than the μ→eγ decay rate

  11. The Effect of Using 3E, 5E Learning Cycle in General Chemistry Laboratory to Prospective Science Teachers Attitude and Perceptions to the Science, Chemistry and Laboratory

    OpenAIRE

    Toprak, Fatih; Çelikler, Dilek

    2013-01-01

    The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pre-tes...

  12. The Effect of Using 3E, 5E Learning Cycle in General Chemistry Laboratory to Prospective Scinence Teachers’ Attitude and Perceptions to the Science, Chemistry and Laboratory

    OpenAIRE

    Toprak, Fatih; Çelikler, Dilek

    2013-01-01

    The study aimed to investigate the emerging changes in prospective science teachers" attitudes and perceptions towards science, chemistry and laboratory resulting from the implementation of 3E. 5E learning cycles and traditional instruction in laboratory environment in which learning is achieved by doing and experiencing. The study included 74 first grade prospective science teachers from Ondokuz Mayıs University at the Department of Science Education. In the study, quasi-experimental pr...

  13. The role of non-thermal atmospheric pressure biocompatible plasma in the differentiation of osteoblastic precursor cells, MC3T3-E1.

    Science.gov (United States)

    Han, Ihn; Choi, Eun Ha

    2017-05-30

    Non-thermal atmospheric pressure plasma is ionized matter, composed of highly reactive species that include positive ions, negative ions, free radicals, neutral atoms, and molecules. Recent reports have suggested that non-thermal biocompatible plasma (NBP) can selectively kill a variety of cancer cells, and promote stem cell differentiation. However as of yet, the regulation of proliferation and differentiation potential of NBP has been poorly understood.Here, we investigated the effects of NBP on the osteogenic differentiation of precursor cell lines of osteoblasts, MC3T3 E1 and SaOS-2. For in vitro osteogenic differentiation, precursor cell lines were treated with NBP, and cultured with osteogenic induction medium. After 10 days of treatment, the NBP was shown to be effective in osteogenic differentiation in MC3T3 E1 cells by von Kossa and Alizarin Red S staining assay. Real-time PCR was then performed to investigate the expression of osteogenic specific genes, Runx2, OCN, COL1, ALP and osterix in MC3T3 E1 cells after treatment with NBP for 4 days. Furthermore, analysis of the protein expression showed that NBP treatment significantly reduced PI3K/AKT signaling and MAPK family signaling. However, p38 controlled phosphorylation of transcription factor forkhead box O1 (FoxO1) that related to cell differentiation with increased phosphorylated p38. These results suggest that non-thermal atmospheric pressure plasma can induce osteogenic differentiation, and enhance bone formation.

  14. Energy, economic and environmental (3E) analysis of waste-to-energy (WTE) strategies for municipal solid waste (MSW) management in Malaysia

    International Nuclear Information System (INIS)

    Tan, Sie Ting; Ho, Wai Shin; Hashim, Haslenda; Lee, Chew Tin; Taib, Mohd Rozainee; Ho, Chin Siong

    2015-01-01

    Highlights: • 3E impact of WTE derived from MSW were performed. • MSW treatment technologies significantly effects the economic and environmental benefits of WTE. • Different scenarios are conducted based on the waste projections and production. • Comprehensive discussion on the trade-off of both incineration and anaerobic digestion for MSWM. - Abstract: The utilisation of municipal solid waste (MSW) for energy production has been implemented globally for many decades. Malaysia, however, is still highly dependent on landfills for MSW management. Because of the concern for greenhouse gases (GHG) emission and the scarcity of land, Malaysia has an urgent need for a better waste management strategy. This study aims to evaluate the energy, economic and environmental (3E) impact of waste-to-energy (WTE) for municipal solid waste management. An existing landfill in Malaysia is selected as the case study for consideration to adopt the advanced WTE technologies including the landfill gas recovery system (LFGRS), incineration, anaerobic digestion (AD), and gasification. The study presented an interactive comparison of different WTE scenarios and followed by further discussion on waste incineration and AD as the two potential WTE options in Malaysia. The 3E assessment reveals incineration as the superior technology choice when the production of electricity and heat were considered; however, AD is found to be more favourable under the consideration of electricity production only

  15. 7-ketocholesterol induces apoptosis of MC3T3-E1 cells associated with reactive oxygen species generation, endoplasmic reticulum stress and caspase-3/7 dependent pathway

    Directory of Open Access Journals (Sweden)

    Yuta Sato

    2017-03-01

    Full Text Available Type 2 diabetes mellitus (T2DM is associated with an increased risk of bone fractures without reduction of bone mineral density. The cholesterol oxide 7-ketocholesterol (7KCHO has been implicated in numerous diseases such as atherosclerosis, Alzheimer's disease, Parkinson's disease, cancer, age-related macular degeneration and T2DM. In the present study, 7KCHO decreased the viability of MC3T3-E1 cells, increased reactive oxygen species (ROS production and apoptotic rate, and upregulated the caspase-3/7 pathway. Furthermore, these effects of 7KCHO were abolished by pre-incubation of the cells with N-acetylcysteine (NAC, an ROS inhibitor. Also, 7KCHO enhanced the mRNA expression of two endoplasmic reticulum (ER stress markers; CHOP and GRP78, in MC3T3-E1 cells. Pre-incubation of the cells with NAC suppressed the 7KCHO-induced upregulation of CHOP, but not GRP78. In conclusion, we demonstrated that 7KCHO induced apoptosis of MC3T3-E1 cells associated with ROS generation, ER stress, and caspase-3/7 activity, and the effects of 7KCHO were abolished by the ROS inhibitor NAC. These findings may provide new insight into the relationship between oxysterol and pathophysiology of osteoporosis seen in T2DM.

  16. Osteoblast-like MC3T3-E1 Cells Prefer Glycolysis for ATP Production but Adipocyte-like 3T3-L1 Cells Prefer Oxidative Phosphorylation.

    Science.gov (United States)

    Guntur, Anyonya R; Gerencser, Akos A; Le, Phuong T; DeMambro, Victoria E; Bornstein, Sheila A; Mookerjee, Shona A; Maridas, David E; Clemmons, David E; Brand, Martin D; Rosen, Clifford J

    2018-06-01

    Mesenchymal stromal cells (MSCs) are early progenitors that can differentiate into osteoblasts, chondrocytes, and adipocytes. We hypothesized that osteoblasts and adipocytes utilize distinct bioenergetic pathways during MSC differentiation. To test this hypothesis, we compared the bioenergetic profiles of preosteoblast MC3T3-E1 cells and calvarial osteoblasts with preadipocyte 3T3L1 cells, before and after differentiation. Differentiated MC3T3-E1 osteoblasts met adenosine triphosphate (ATP) demand mainly by glycolysis with minimal reserve glycolytic capacity, whereas nondifferentiated cells generated ATP through oxidative phosphorylation. A marked Crabtree effect (acute suppression of respiration by addition of glucose, observed in both MC3T3-E1 and calvarial osteoblasts) and smaller mitochondrial membrane potential in the differentiated osteoblasts, particularly those incubated at high glucose concentrations, indicated a suppression of oxidative phosphorylation compared with nondifferentiated osteoblasts. In contrast, both nondifferentiated and differentiated 3T3-L1 adipocytes met ATP demand primarily by oxidative phosphorylation despite a large unused reserve glycolytic capacity. In sum, we show that nondifferentiated precursor cells prefer to use oxidative phosphorylation to generate ATP; when they differentiate to osteoblasts, they gain a strong preference for glycolytic ATP generation, but when they differentiate to adipocytes, they retain the strong preference for oxidative phosphorylation. Unique metabolic programming in mesenchymal progenitor cells may influence cell fate and ultimately determine the degree of bone formation and/or the development of marrow adiposity. © 2018 American Society for Bone and Mineral Research. © 2018 American Society for Bone and Mineral Research.

  17. Characterisation of 5-HT3C, 5-HT3D and 5-HT3E receptor subunits: evolution, distribution and function.

    Science.gov (United States)

    Holbrook, Joanna D; Gill, Catherine H; Zebda, Noureddine; Spencer, Jon P; Leyland, Rebecca; Rance, Kim H; Trinh, Han; Balmer, Gemma; Kelly, Fiona M; Yusaf, Shahnaz P; Courtenay, Nicola; Luck, Jane; Rhodes, Andrew; Modha, Sundip; Moore, Stephen E; Sanger, Gareth J; Gunthorpe, Martin J

    2009-01-01

    The 5-HT(3) receptor is a member of the 'Cys-loop' family of ligand-gated ion channels that mediate fast excitatory and inhibitory transmission in the nervous system. Current evidence points towards native 5-HT(3) receptors originating from homomeric assemblies of 5-HT(3A) or heteromeric assembly of 5-HT(3A) and 5-HT(3B). Novel genes encoding 5-HT(3C), 5-HT(3D), and 5-HT(3E) have recently been described but the functional importance of these proteins is unknown. In the present study, in silico analysis (confirmed by partial cloning) indicated that 5-HT(3C), 5-HT(3D), and 5-HT(3E) are not human-specific as previously reported: they are conserved in multiple mammalian species but are absent in rodents. Expression profiles of the novel human genes indicated high levels in the gastrointestinal tract but also in the brain, Dorsal Root Ganglion (DRG) and other tissues. Following the demonstration that these subunits are expressed at the cell membrane, the functional properties of the recombinant human subunits were investigated using patch clamp electrophysiology. 5-HT(3C), 5-HT(3D), and 5-HT(3E) were all non-functional when expressed alone. Co-transfection studies to determine potential novel heteromeric receptor interactions with 5-HT(3A) demonstrated that the expression or function of the receptor was modified by 5-HT(3C) and 5-HT(3E), but not 5-HT(3D). The lack of distinct effects on current rectification, kinetics or pharmacology of 5-HT(3A) receptors does not however provide unequivocal evidence to support a direct contribution of 5-HT(3C) or 5-HT(3E) to the lining of the ion channel pore of novel heteromeric receptors. The functional and pharmacological contributions of these novel subunits to human biology and diseases such as irritable bowel syndrome for which 5-HT(3) receptor antagonists have major clinical usage, therefore remains to be fully determined.

  18. Role of semaphorins in the adult nervous system

    NARCIS (Netherlands)

    de Wit, Joris; Verhaagen, J.

    2003-01-01

    In the developing nervous system, extending axons are directed towards their appropriate targets by a myriad of attractive and repulsive guidance cues. Work in the past decade has significantly advanced our understanding of these molecules and has made it increasingly clear that their function is

  19. Effect of surface topography and bioactive properties on early adhesion and growth behavior of mouse preosteoblast MC3T3-E1 cells.

    Science.gov (United States)

    Li, Na; Chen, Gang; Liu, Jue; Xia, Yang; Chen, Hanbang; Tang, Hui; Zhang, Feimin; Gu, Ning

    2014-10-08

    The effects of bioactive properties and surface topography of biomaterials on the adhesion and spreading properties of mouse preosteoblast MC3T3-E1 cells was investigated by preparation of different surfaces. Poly lactic-co-glycolic acid (PLGA) electrospun fibers (ES) were produced as a porous rough surface. In our study, coverslips were used as a substrate for the immobilization of 3,4-dihydroxyphenylalanine (DOPA) and collagen type I (COL I) in the preparation of bioactive surfaces. In addition, COL I was immobilized onto porous electrospun fibers surfaces (E-COL) to investigate the combined effects of bioactive molecules and topography. Untreated coverslips were used as controls. Early adhesion and growth behavior of MC3T3-E1 cells cultured on the different surfaces were studied at 6, 12, and 24 h. Evaluation of cell adhesion and morphological changes showed that the all the surfaces were favorable for promoting the adhesion and spreading of cells. CCK-8 assays and flow cytometry revealed that both topography and bioactive properties were favorable for cell growth. Analysis of β1, α1, α2, α5, α10 and α11 integrin expression levels by immunofluorescence, real-time RT-PCR, and Western blot and indicated that surface topography plays an important role in the early stage of cell adhesion. However, the influence of topography and bioactive properties of surfaces on integrins is variable. Compared with any of the topographic or bioactive properties in isolation, the combined effect of both types of properties provided an advantage for the growth and spreading of MC3T3-E1 cells. This study provides a new insight into the functions and effects of topographic and bioactive modifications of surfaces at the interface between cells and biomaterials for tissue engineering.

  20. Sizing a solar dish Stirling micro-CHP system for residential application in diverse climatic conditions based on 3E analysis

    International Nuclear Information System (INIS)

    Moghadam, Ramin Shabanpour; Sayyaadi, Hoseyn; Hosseinzade, Hadi

    2013-01-01

    Highlights: • 3E analysis was performed on solar CHP systems. • Significant primary energy saving and greenhouse gas reduction were obtained. • The engine was sized so that it had the best economic sound. • Various criteria at different weathers were used for sizing the engine. - Abstract: A solar dish Stirling cogeneration system is considered to provide energy demands of a residential building. As energy demands of the building and output power of the engine are functions of weather condition and solar irradiation flux, the benchmark building was considered to be located in five different cities in Iran with diverse climatic and solar irradiation conditions. The proposed solar dish Stirling micro-CHP system was analyzed based on 3E analysis. The 3E analysis evaluated primary energy saving analysis (energy analysis), carbon dioxide emission reduction (environmental analysis) and payback period for return of investment (economic analysis) and was compared to a reference building that utilized primary energy carriers for its demands. Three scenarios were considered for assessment and sizing the solar dish Stirling engine. In the first scenario, size of the solar dish Stirling engine was selected based on the lowest annual electric power demand while, in second, the highest annual electric power consumption was considered to specify size of the engine. In the third scenario, a solar dish Stirling engine with constant output capacity was considered for the five locations. It was shown that implementing the solar dish Stirling micro-CHP system had good potential in primary energy saving and carbon dioxide emission reduction in all scenarios and acceptable payback period for return of the investment in some scenarios. Finally, the best scenario for selecting size of the engine in each city was introduced using the TOPSIS decision making method. It was demonstrated that, for dry weather, the first scenario was the best while, for hot and humid cities and

  1. Enhancement of growth and osteogenic differentiation of MC3T3-E1 cells via facile surface functionalization of polylactide membrane with chitooligosaccharide based on polydopamine adhesive coating

    International Nuclear Information System (INIS)

    Li, Huihua; Luo, Chuang; Luo, Binghong; Wen, Wei; Wang, Xiaoying; Ding, Shan; Zhou, Changren

    2016-01-01

    Graphical abstract: - Highlights: • COS was conveniently immobilized on PDLLA membrane based on PDOPA adhesive layer. • The hydrophilicity of PDLLA membrane was improved by modified with PDOPA and COS. • COS-functionalized PDLLA membrane is favorable to cell adhesion and proliferation. • COS-coated PDLLA membrane notably promote osteogenic differentiation of MC3T3-E1. - Abstract: To develop a chitooligosaccharide(COS)-functionalized poly(D,L-lactide) (PDLLA) membrane to enhance growth and osteogenic differentiation of MC3T3-E1 cells, firstly a thin polydopamine (PDOPA) layer was adhered to the PDLLA membrane via the self-polymerization and strong adhesion behavior of dopamine. Subsequently, COS was immobilized covalently on the resultant PDLLA/PDOPA composite membrane by coupling with PDOPA active coating. The successful immobilization of the PDOPA and COS was confirmed by attenuated total reflectance Fourier transform infrared (ATR-FTIR) spectroscopy and X-ray photoelectron spectroscopy (XPS). Scanning electronic microscopy (SEM) and atomic force microscopy (AFM) results indicated that the surface topography and roughness of the membranes were changed, and the root mean square increased from 0.613 nm to 6.96 and 7.12 nm, respectively after coating PDOPA and COS. Water contact angle and surface energy measurements revealed that the membrane hydrophilicity was remarkably improved by surface modification. In vitro cells culture results revealed that the PDOPA- and COS-functionalized surfaces showed a significant increase in MC3T3-E1 cells adhesion, proliferation, osteogenic differentiation and alkaline phosphate activity compared to the pristine PDLLA substrate. Furthermore the COS-functionalized PDLLA membrane was more effectively at enhancing osteoblast activity than the PDOPA-functionalized PDLLA membrane.

  2. Sirtuin1 promotes osteogenic differentiation through downregulation of peroxisome proliferator-activated receptor γ in MC3T3-E1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Qu, Bo [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China); Ma, Yuan [Department of Neurosurgery, Chengdu Military General Hospital, Chengdu 610083 (China); Yan, Ming [Department of Orthopaedics, Xijing Hospital of The Fourth Military Medical University, Xi’an 710032 (China); Gong, Kai; Liang, Feng; Deng, Shaolin; Jiang, Kai; Ma, Zehui [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China); Pan, Xianming, E-mail: xianmingpanxj@163.com [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China)

    2016-09-09

    Osteoporosis is a skeletal disorder characterized by bone loss, resulting in architectural deterioration of the skeleton, decreased bone strength and an increased risk of fragility fractures. Strengthening osteogenesis is an effective way to relieve osteoporosis. Sirtuin1 (Sirt1) is a nicotinamide adenine dinucleotide (NAD{sup +})-dependent deacetylase, which is reported to be involved in improving osteogenesis. Sirt1 targets peroxisome proliferator-activated receptor γ (PPARγ) in the regulation of adipose tissues; however, the molecular mechanism of Sirt1 in osteogenic differentiation is still unknown. PPARγ tends to induce more adipogenic differentiation rather than osteogenic differentiation. Hence, we hypothesized that Sirt1 facilitates osteogenic differentiation through downregulation of PPARγ signaling. Mouse pre-osteoblastic MC3T3-E1 cells were cultured under osteogenic medium. Sirt1 was overexpressed through plasmid transfection. The results showed that high expression of Sirt1 was associated with increased osteogenic differentiation, as indicated by quantitative PCR and Western blot analysis of osteogenic markers, and Von Kossa staining. Sirt1 overexpression also directly and negatively regulated the expression of PPARγ and its downstream molecules. Use of the PPARγ agonist Rosiglitazone, reversed the effects of Sirt1 on osteogenic differentiation. Using constructed luciferase plasmids, we demonstrated a role of Sirt1 in inhibiting PPARγ–induced activity and expression of adipocyte–specific genes, including acetyl-coenzyme A carboxylase (Acc) and fatty acid binding protein 4 (Fabp4). The interaction between Sirt1 and PPARγ was further confirmed using co-immunoprecipitation analysis. Together, these results reveal a novel mechanism for Sirt1 in osteogenic differentiation through downregulation of PPARγ activity. These findings suggest that the Sirt1–PPARγ pathway may represent a potential target for enhancement of osteogenesis and treatment

  3. Sirtuin1 promotes osteogenic differentiation through downregulation of peroxisome proliferator-activated receptor γ in MC3T3-E1 cells

    International Nuclear Information System (INIS)

    Qu, Bo; Ma, Yuan; Yan, Ming; Gong, Kai; Liang, Feng; Deng, Shaolin; Jiang, Kai; Ma, Zehui; Pan, Xianming

    2016-01-01

    Osteoporosis is a skeletal disorder characterized by bone loss, resulting in architectural deterioration of the skeleton, decreased bone strength and an increased risk of fragility fractures. Strengthening osteogenesis is an effective way to relieve osteoporosis. Sirtuin1 (Sirt1) is a nicotinamide adenine dinucleotide (NAD"+)-dependent deacetylase, which is reported to be involved in improving osteogenesis. Sirt1 targets peroxisome proliferator-activated receptor γ (PPARγ) in the regulation of adipose tissues; however, the molecular mechanism of Sirt1 in osteogenic differentiation is still unknown. PPARγ tends to induce more adipogenic differentiation rather than osteogenic differentiation. Hence, we hypothesized that Sirt1 facilitates osteogenic differentiation through downregulation of PPARγ signaling. Mouse pre-osteoblastic MC3T3-E1 cells were cultured under osteogenic medium. Sirt1 was overexpressed through plasmid transfection. The results showed that high expression of Sirt1 was associated with increased osteogenic differentiation, as indicated by quantitative PCR and Western blot analysis of osteogenic markers, and Von Kossa staining. Sirt1 overexpression also directly and negatively regulated the expression of PPARγ and its downstream molecules. Use of the PPARγ agonist Rosiglitazone, reversed the effects of Sirt1 on osteogenic differentiation. Using constructed luciferase plasmids, we demonstrated a role of Sirt1 in inhibiting PPARγ–induced activity and expression of adipocyte–specific genes, including acetyl-coenzyme A carboxylase (Acc) and fatty acid binding protein 4 (Fabp4). The interaction between Sirt1 and PPARγ was further confirmed using co-immunoprecipitation analysis. Together, these results reveal a novel mechanism for Sirt1 in osteogenic differentiation through downregulation of PPARγ activity. These findings suggest that the Sirt1–PPARγ pathway may represent a potential target for enhancement of osteogenesis and treatment of

  4. Multifunctional chitosan/polyvinyl pyrrolidone/45S5 Bioglass® scaffolds for MC3T3-E1 cell stimulation and drug release

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Qingqing [Institute of Advanced Materials for Nano-Bio Applications, School of Ophthalmology & Optometry, Wenzhou Medical University, 270 Xueyuan Xi Road, Wenzhou, Zhejiang 325027 (China); Li, Wei [Institute of Biomaterials, Department of Materials Science and Engineering, University of Erlangen-Nuremberg, Cauerstrasse 6, Erlangen 91058 (Germany); Yu, Shanshan; Ma, Liwei [Institute of Advanced Materials for Nano-Bio Applications, School of Ophthalmology & Optometry, Wenzhou Medical University, 270 Xueyuan Xi Road, Wenzhou, Zhejiang 325027 (China); Jin, Dayong [Institute for Biomedical Materials and Devices, Faculty of Science, University of Technology Sydney, NSW 2007 (Australia); Advanced Cytometry Labs, ARC Center of Excellence for Nanoscale BioPhotonics, Macquarie University, Sydney, NSW 2109 (Australia); Boccaccini, Aldo R., E-mail: Aldo.Boccaccini@ww.uni-erlangen.de [Institute of Biomaterials, Department of Materials Science and Engineering, University of Erlangen-Nuremberg, Cauerstrasse 6, Erlangen 91058 (Germany); Liu, Yong, E-mail: yongliu1980@hotmail.com [Institute of Advanced Materials for Nano-Bio Applications, School of Ophthalmology & Optometry, Wenzhou Medical University, 270 Xueyuan Xi Road, Wenzhou, Zhejiang 325027 (China); Advanced Cytometry Labs, ARC Center of Excellence for Nanoscale BioPhotonics, Macquarie University, Sydney, NSW 2109 (Australia)

    2015-11-01

    Novel chitosan–polyvinyl pyrrolidone/45S5 Bioglass® (CS-PVP/BG) scaffolds were prepared via foam replication and chemical cross-linking techniques. The pristine BG, CS-PVP coated BG and genipin cross-linked CS-PVP/BG (G-CS-PVP/BG) scaffolds were synthesized and characterized in terms of chemical composition, physical structure and morphology respectively. Resistance to enzymatic degradation of the scaffold is improved significantly with the use of genipin cross-linked CS-PVP. The bio-effects of scaffolds on MC3T3-E1 osteoblast-like cells were evaluated by studying cell viability, adhesion and proliferation. The CCK-8 assay shows that cell viability on the resulting G-CS-PVP/BG scaffold is improved obviously after cross-linking of genipin. Cell skeleton images exhibit that well-stretched F-actin bundles are obtained on the G-CS-PVP/BG scaffold. SEM results present significant improvement on the cell adhesion and proliferation for cells cultured on the G-CS-PVP/BG scaffold. The drug release performance on the as-synthesized scaffold was studied in a phosphate buffered saline (PBS) solution. Vancomycin is found to be released in burst fashion within 24 h from the pristine BG scaffold, however, the release period from the G-CS-PVP/BG scaffold is enhanced to 7 days, indicating improved drug release properties of the G-CS-PVP/BG scaffold. Our results suggest that the G-CS-PVP/BG scaffolds possess promising physicochemical properties, sustained drug release capability and good biocompatibility for MC3T3-E1 cells' proliferation and adhesion, suggesting their potential applications in areas such as MC3T3-E1 cell stimulation and bone tissue engineering. - Highlights: • Novel genipi–chitosan–polyvinyl pyrrolidone/45S5 Bioglass® scaffolds are prepared. • Resistance to enzymatic degradation of the scaffold is improved significantly. • The resulting scaffold shows enhanced MC3T3-E1 cell adhesion and proliferation. • Release of antibiotic vancomycin from the

  5. Multifunctional chitosan/polyvinyl pyrrolidone/45S5 Bioglass® scaffolds for MC3T3-E1 cell stimulation and drug release

    International Nuclear Information System (INIS)

    Yao, Qingqing; Li, Wei; Yu, Shanshan; Ma, Liwei; Jin, Dayong; Boccaccini, Aldo R.; Liu, Yong

    2015-01-01

    Novel chitosan–polyvinyl pyrrolidone/45S5 Bioglass® (CS-PVP/BG) scaffolds were prepared via foam replication and chemical cross-linking techniques. The pristine BG, CS-PVP coated BG and genipin cross-linked CS-PVP/BG (G-CS-PVP/BG) scaffolds were synthesized and characterized in terms of chemical composition, physical structure and morphology respectively. Resistance to enzymatic degradation of the scaffold is improved significantly with the use of genipin cross-linked CS-PVP. The bio-effects of scaffolds on MC3T3-E1 osteoblast-like cells were evaluated by studying cell viability, adhesion and proliferation. The CCK-8 assay shows that cell viability on the resulting G-CS-PVP/BG scaffold is improved obviously after cross-linking of genipin. Cell skeleton images exhibit that well-stretched F-actin bundles are obtained on the G-CS-PVP/BG scaffold. SEM results present significant improvement on the cell adhesion and proliferation for cells cultured on the G-CS-PVP/BG scaffold. The drug release performance on the as-synthesized scaffold was studied in a phosphate buffered saline (PBS) solution. Vancomycin is found to be released in burst fashion within 24 h from the pristine BG scaffold, however, the release period from the G-CS-PVP/BG scaffold is enhanced to 7 days, indicating improved drug release properties of the G-CS-PVP/BG scaffold. Our results suggest that the G-CS-PVP/BG scaffolds possess promising physicochemical properties, sustained drug release capability and good biocompatibility for MC3T3-E1 cells' proliferation and adhesion, suggesting their potential applications in areas such as MC3T3-E1 cell stimulation and bone tissue engineering. - Highlights: • Novel genipi–chitosan–polyvinyl pyrrolidone/45S5 Bioglass® scaffolds are prepared. • Resistance to enzymatic degradation of the scaffold is improved significantly. • The resulting scaffold shows enhanced MC3T3-E1 cell adhesion and proliferation. • Release of antibiotic vancomycin from the

  6. Cathare2 V1.3E post-test computations of SPE-1 and SPE-2 experiments at PMK-NVH facility

    International Nuclear Information System (INIS)

    Belliard, M.; Laugier, E.

    1994-01-01

    This paper presents the first CATHARE2 V1.3E simulations of the SPE-2 transients at PMK-NVH loop. Concerning the SPE-1 and the SPE-2 experimentations at PMK-NVH, it contains a description of the facilities and the transient, as well as different conditions of use. The paper includes also a presentation of the CATHARE2 model and different type of computation, such as the steady state computation or SPE-1 and SPE-2 transient (TEC). 4 refs., 12 figs., 4 tabs

  7. Osteogenic differentiation of MC3T3-E1 cells on poly(L-lactide)/Fe{sub 3}O{sub 4} nanofibers with static magnetic field exposure

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Qing [State Key Laboratory of Organic–inorganic Composites, Beijing University of Chemical Technology, Beijing 100029 (China); Beijing Laboratory of Biomedical Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Shi, Yuzhou; Shan, Dingying; Jia, Wenkai; Duan, Shun [Beijing Laboratory of Biomedical Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Deng, Xuliang [Department of Geriatric Dentistry, Peking University School and Hospital of Stomatology, Beijing 100081 (China); Yang, Xiaoping, E-mail: yangxp@mail.buct.edu.cn [State Key Laboratory of Organic–inorganic Composites, Beijing University of Chemical Technology, Beijing 100029 (China); Beijing Laboratory of Biomedical Materials, Beijing University of Chemical Technology, Beijing 100029 (China)

    2015-10-01

    Proliferation and differentiation of bone-related cells are modulated by many factors such as scaffold design, growth factor, dynamic culture system, and physical simulation. Nanofibrous structure and moderate-intensity (1 mT–1 T) static magnetic field (SMF) have been identified as capable of stimulating proliferation and differentiation of osteoblasts. Herein, magnetic nanofibers were prepared by electrospinning mixture solutions of poly(L-lactide) (PLLA) and ferromagnetic Fe{sub 3}O{sub 4} nanoparticles (NPs). The PLLA/Fe{sub 3}O{sub 4} composite nanofibers demonstrated homogeneous dispersion of Fe{sub 3}O{sub 4} NPs, and their magnetism depended on the contents of Fe{sub 3}O{sub 4} NPs. SMF of 100 mT was applied in the culture of MC3T3-E1 osteoblasts on pure PLLA and PLLA/Fe{sub 3}O{sub 4} composite nanofibers for the purpose of studying the effect of SMF on osteogenic differentiation of osteoblastic cells on magnetic nanofibrous scaffolds. On non-magnetic PLLA nanofibers, the application of external SMF could enhance the proliferation and osteogenic differentiation of MC3T3-E1 cells. In comparison with pure PLLA nanofibers, the incorporation of Fe{sub 3}O{sub 4} NPs could also promote the proliferation and osteogenic differentiation of MC3T3-E1 cells in the absence or presence of external SMF. The marriage of magnetic nanofibers and external SMF was found most effective in accelerating every aspect of biological behaviors of MC3T3-E1 osteoblasts. The findings demonstrated that the magnetic feature of substrate and microenvironment were applicable ways in regulating osteogenesis in bone tissue engineering. - Highlights: • Magnetic nanofibers containing well-dispersed Fe{sub 3}O{sub 4} nanoparticles were produced. • Static magnetic field (SMF) was applied to perform the culture of osteoblasts. • Osteogenic differentiation was enhanced on magnetic substrate with exposure to SMF.

  8. MC3T3-E1 cell response of amorphous phase/TiO{sub 2} nanocrystal composite coating prepared by microarc oxidation on titanium

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Rui [Department of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Wei, Daqing, E-mail: daqingwei@hit.edu.cn [Department of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Yang, Haoyue; Feng, Wei [Department of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Cheng, Su [Department of Mechanical Engineering, School of Architecture and Civil Engineering, Harbin University of Science and Technology, Harbin 150001 (China); Li, Baoqiang; Wang, Yaming; Jia, Dechang; Zhou, Yu [Department of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)

    2014-06-01

    Bioactive amorphous phase/TiO{sub 2} nanocrystal (APTN) composite coatings were fabricated by microarc oxidation (MAO) on Ti. The APTN coatings are composed of much amorphous phase with Si, Na, Ca, Ti and O elements and a few TiO{sub 2} nanocrystals. With increasing applied voltage, the micropore density of the APTN coating decreases and the micropore size of the APTN coating increases. The results indicate that less MC3T3-E1 cells attach on the APTN coatings as compared to Ti. However, the APTN coatings greatly enhance the cell proliferation ability and the activity of alkaline phosphatase. The amorphous phase and the concentrations of the released Ca and Si from the APTN coatings during cell culture have significant effects on the cell response. - Highlights: • Amorphous phase/TiO2 nanocrystal (APTN) composite coatings were fabricated. • The MC3T3-E1 cell response of the APTN coatings was evaluated. • The APTN coatings greatly enhanced the cell proliferation ability.

  9. Psoroptes cuniculi induced oxidative imbalance in rabbits and its alleviation by using vitamins A, D3, E, and H as adjunctive remedial.

    Science.gov (United States)

    Singh, Shanker Kumar; Dimri, Umesh; Sharma, Mahesh Chandra; Swarup, Devendra; Kumar, Mritunjay; Tiwary, Ramesh

    2012-01-01

    The oxidant/antioxidant balance of rabbits naturally infected with Psoroptes cuniculi and treated with ivermectin +/- vitamins A, D(3), E, and H supplementation was investigated. Two groups of seven mixed ♂ and ♀, 6-to-8 month-old New Zealand White rabbits, diagnosed Psoroptes mites-positive by skin scraping examination and seven clinically healthy control rabbits were examined. Blood samples were obtained on day 0 and at 28 days post-therapy to determine oxidative stress indices. On day 0, the levels of lipid peroxides were significantly higher (P ≤ 0.01) in the Psoroptes-infected rabbits compared with the healthy controls while those of reduced glutathione and the activities of the antioxidant enzymes glutathione peroxidase, glutathione-S-transferase, catalase, and superoxide dismutase were significantly lower (P ≤ 0.01). Vitamin supplementation of the ivermectin-treated rabbits revealed both faster clinical (14 days) and parasitological (10 days) recovery. It was concluded that significant alteration of oxidant/antioxidant balance is a factor in the pathogenesis of P. cuniculi infestation of rabbits, and recovery can be enhanced by combining ivermectin treatment with vitamin A, D(3,) E, and H supplementation.

  10. The genetic impact of the lake chad basin population in North Africa as documented by mitochondrial diversity and internal variation of the L3e5 haplogroup.

    Science.gov (United States)

    Podgorná, Eliška; Soares, Pedro; Pereira, Luísa; Cerný, Viktor

    2013-11-01

    The presence of sub-Saharan L-type mtDNA sequences in North Africa has traditionally been explained by the recent slave trade. However, gene flow between sub-Saharan and northern African populations would also have been made possible earlier through the greening of the Sahara resulting from Early Holocene climatic improvement. In this article, we examine human dispersals across the Sahara through the analysis of the sub-Saharan mtDNA haplogroup L3e5, which is not only commonly found in the Lake Chad Basin (∼17%), but which also attains nonnegligible frequencies (∼10%) in some Northwestern African populations. Age estimates point to its origin ∼10 ka, probably directly in the Lake Chad Basin, where the clade occurs across linguistic boundaries. The virtual absence of this specific haplogroup in Daza from Northern Chad and all West African populations suggests that its migration took place elsewhere, perhaps through Northern Niger. Interestingly, independent confirmation of Early Holocene contacts between North Africa and the Lake Chad Basin have been provided by craniofacial data from Central Niger, supporting our suggestion that the Early Holocene offered a suitable climatic window for genetic exchanges between North and sub-Saharan Africa. In view of its younger founder age in North Africa, the discontinuous distribution of L3e5 was probably caused by the Middle Holocene re-expansion of the Sahara desert, disrupting the clade's original continuous spread. © 2013 John Wiley & Sons Ltd/University College London.

  11. Behaviors of MC3T3-E1 cells on carbonated apatite films, with a characteristic network structure, fabricated on a titanium plate by aqueous spray coating

    International Nuclear Information System (INIS)

    Mochizuki, Chihiro; Hara, Hiroki; Oya, Kei; Aoki, Shun; Hayakawa, Tohru; Fujie, Hiromichi; Sato, Mitsunobu

    2014-01-01

    Four carbonated apatite films having average thicknesses of 1.3–0.11 μm, proportions of network sizes above 10 μm of 41–68%, and average border heights of the characteristic network structure of 0.98–0.29 μm were fabricated on a titanium plate by aqueous spray coating. These carbonated apatite films after heat treatment showed good mineralization ability in Hanks' balanced salt solution. Assessment of initial cell attachment and calcination on these films and on the Ti plate using osteoblastic MC3T3-E1 indicated that the carbonated apatite film heat treated at 600 °C, whose film thickness, proportion of network sizes above 10 μm, and border height were 0.11 μm, 61%, and 0.31 μm, respectively, was most preferred by osteoblastic cells. Field emission scanning electron microscopic observation of the cells attached to the films showed that the wide network and low border height of the network structure on the carbonated apatite film play an important role in the development of the filopodia of the osteoblastic cells. - Highlights: • Osteoblastic MC3T3-E1 behaviors on aqueous spray coating-derived carbonated apatite (CA) films • The network size of CA films is important. • CA films having a low network border height are better for cell proliferation

  12. Behaviors of MC3T3-E1 cells on carbonated apatite films, with a characteristic network structure, fabricated on a titanium plate by aqueous spray coating

    Energy Technology Data Exchange (ETDEWEB)

    Mochizuki, Chihiro; Hara, Hiroki [Division of Liberal Arts, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan); Oya, Kei [Research Institute for Science and Technology, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan); School of Engineering, Tokai University, 4-1-1 Kitakanane, Hiratsuka, Kanagawa 259-1292 (Japan); Aoki, Shun [Faculty of System Design, Tokyo Metropolitan University, 6-6 Asahigaoka, Hino, Tokyo 191-0065 (Japan); Hayakawa, Tohru [Department of Dental Engineering, Tsurumi University School of Dental Medicine, 2-1-3 Tsurumi, Yokohama City, Kanagawa 230-8501 (Japan); Fujie, Hiromichi [Faculty of System Design, Tokyo Metropolitan University, 6-6 Asahigaoka, Hino, Tokyo 191-0065 (Japan); Sato, Mitsunobu, E-mail: lccsato@cc.kogakuin.ac.jp [Division of Liberal Arts, Kogakuin University, 2665-1 Nakano, Hachioji, Tokyo 192-0015 (Japan)

    2014-06-01

    Four carbonated apatite films having average thicknesses of 1.3–0.11 μm, proportions of network sizes above 10 μm of 41–68%, and average border heights of the characteristic network structure of 0.98–0.29 μm were fabricated on a titanium plate by aqueous spray coating. These carbonated apatite films after heat treatment showed good mineralization ability in Hanks' balanced salt solution. Assessment of initial cell attachment and calcination on these films and on the Ti plate using osteoblastic MC3T3-E1 indicated that the carbonated apatite film heat treated at 600 °C, whose film thickness, proportion of network sizes above 10 μm, and border height were 0.11 μm, 61%, and 0.31 μm, respectively, was most preferred by osteoblastic cells. Field emission scanning electron microscopic observation of the cells attached to the films showed that the wide network and low border height of the network structure on the carbonated apatite film play an important role in the development of the filopodia of the osteoblastic cells. - Highlights: • Osteoblastic MC3T3-E1 behaviors on aqueous spray coating-derived carbonated apatite (CA) films • The network size of CA films is important. • CA films having a low network border height are better for cell proliferation.

  13. Jefferson Lab E89-044 experiment: study of the quasi-elastic He3(e,e'p)d reaction in parallel kinematics

    International Nuclear Information System (INIS)

    Penel-Nottaris, E.

    2004-07-01

    The Jefferson Lab Hall A E89-044 experiment has measured the He 3 (e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up He 3 (e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the He 3 nucleus and the involved nuclear mechanisms beyond plane waves approximations, for missing momenta of 0 and +- 300 MeV/c and transferred momenta from 0.8 to 4.1 GeV 2 . Preliminary cross-sections have been obtained after calibration of the experimental setup by fitting theoretical models averaged over the experimental phase-space using a Monte-Carlo simulation. The 8% systematic error on cross-sections is linked mainly to the absolute normalization of the target density: the elastic scattering data analysis will allow to reduce this error. The preliminary results show some disagreement with theoretical predictions for the forward angles kinematics around 0 MeV/c missing momenta and sensitivity to final state interactions and He 3 waves functions for missing momenta of 300 MeV/c. The longitudinal and transverse separation should constraint theoretical models more strongly. (author)

  14. Poly(acrylic acid-regulated Synthesis of Rod-Like Calcium Carbonate Nanoparticles for Inducing the Osteogenic Differentiation of MC3T3-E1 Cells

    Directory of Open Access Journals (Sweden)

    Wei Yang

    2016-05-01

    Full Text Available Calcium carbonate, especially with nanostructure, has been considered as a good candidate material for bone regeneration due to its excellent biodegradability and osteoconductivity. In this study, rod-like calcium carbonate nanoparticles (Rod-CC NPs with desired water dispersibility were achieved with the regulation of poly (acrylic acid. Characterization results revealed that the Rod-CC NPs had an average length of 240 nm, a width of 90 nm with an average aspect ratio of 2.60 and a negative ζ-potential of −22.25 ± 0.35 mV. The degradation study illustrated the nanoparticles degraded 23% at pH 7.4 and 45% at pH 5.6 in phosphate-buffered saline (PBS solution within three months. When cultured with MC3T3-E1 cells, the Rod-CC NPs exhibited a positive effect on the proliferation of osteoblast cells. Alkaline phosphatase (ALP activity assays together with the osteocalcin (OCN and bone sialoprotein (BSP expression observations demonstrated the nanoparticles could induce the differentiation of MC3T3-E1 cells. Our study developed well-dispersed rod-like calcium carbonate nanoparticles which have great potential to be used in bone regeneration.

  15. Heat Capacity and Thermal Conductance Measurements of a Superconducting-Normal Mixed State by Detection of Single 3 eV Photons in a Magnetic Penetration Thermometer

    Science.gov (United States)

    Stevenson, T. R.; Balvin, M. A.; Bandler, S. R.; Denis, K. L.; Lee, S.-J.; Nagler, P. C.; Smith, S. J.

    2015-01-01

    We report on measurements of the detected signal pulses in a molybdenum-gold Magnetic Penetration Thermometer (MPT) in response to absorption of one or more 3 eV photons. We designed and used this MPT sensor for x-ray microcalorimetry. In this device, the diamagnetic response of a superconducting MoAu bilayer is used to sense temperature changes in response to absorbed photons, and responsivity is enhanced by a Meissner transition in which the magnetic flux penetrating the sensor changes rapidly to minimize free energy in a mixed superconducting normal state. We have previously reported on use of our MPT to study a thermal phonon energy loss to the substrate when absorbing x-rays. We now describe results of extracting heat capacity C and thermal conductance G values from pulse height and decay time of MPT pulses generated by 3 eV photons. The variation in C and G at temperatures near the Meissner transition temperature (set by an internal magnetic bias field) allow us to probe the behavior in superconducting normal mixed state of the condensation energy and the electron cooling power resulting from quasi-particle recombination and phonon emission. The information gained on electron cooling power is also relevant to the operation of other superconducting detectors, such as Microwave Kinetic Inductance Detectors.

  16. An Atmospheric General Circulation Model with Chemistry for the CRAY T3E: Design, Performance Optimization and Coupling to an Ocean Model

    Science.gov (United States)

    Farrara, John D.; Drummond, Leroy A.; Mechoso, Carlos R.; Spahr, Joseph A.

    1998-01-01

    The design, implementation and performance optimization on the CRAY T3E of an atmospheric general circulation model (AGCM) which includes the transport of, and chemical reactions among, an arbitrary number of constituents is reviewed. The parallel implementation is based on a two-dimensional (longitude and latitude) data domain decomposition. Initial optimization efforts centered on minimizing the impact of substantial static and weakly-dynamic load imbalances among processors through load redistribution schemes. Recent optimization efforts have centered on single-node optimization. Strategies employed include loop unrolling, both manually and through the compiler, the use of an optimized assembler-code library for special function calls, and restructuring of parts of the code to improve data locality. Data exchanges and synchronizations involved in coupling different data-distributed models can account for a significant fraction of the running time. Therefore, the required scattering and gathering of data must be optimized. In systems such as the T3E, there is much more aggregate bandwidth in the total system than in any particular processor. This suggests a distributed design. The design and implementation of a such distributed 'Data Broker' as a means to efficiently couple the components of our climate system model is described.

  17. Low-intensity pulsed ultrasound (LIPUS) stimulates mineralization of MC3T3-E1 cells through calcium and phosphate uptake.

    Science.gov (United States)

    Tassinary, João Alberto Fioravante; Lunardelli, Adroaldo; Basso, Bruno de Souza; Dias, Henrique Bregolin; Catarina, Anderson Velasque; Stülp, Simone; Haute, Gabriela Viegas; Martha, Bianca Andrade; Melo, Denizar Alberto da Silva; Nunes, Fernanda Bordignon; Donadio, Márcio Vinícius Fagundes; Oliveira, Jarbas Rodrigues de

    2018-03-01

    The present study aimed to evaluate the effect of low-intensity pulsed ultrasound (LIPUS) on pre-osteoblast mineralization using in vitro bioassays. Pre-osteoblastic MC3T3-E1 cells were exposed to LIPUS at 1 MHz frequency, 0.2 W/cm 2 intensity and 20% duty cycle for 30 min. The analyses were carried out up to 336 h (14 days) after exposure. The concentration of collagen, phosphate, alkaline phosphatase, calcium and transforming growth factor beta 1 (TGF-β1) in cell supernatant and the presence of calcium deposits in the cells were analyzed. Our results showed that LIPUS promotes mineralized nodules formation. Collagen, phosphate, and calcium levels were decreased in cell supernatant at 192 h after LIPUS exposure. However, alkaline phosphatase and TGF-β1 concentrations remained unchanged. Therapeutic pulsed ultrasound is capable of stimulating differentiation and mineralization of pre-osteoblastic MC3T3-E1 cells by calcium and phosphate uptake with consequent hydroxyapatite formation. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Effects of irradiation on TGF-β1 mRNA expression and calcific nodule formation in MC3T3-E1 osteoblastic cell line

    International Nuclear Information System (INIS)

    Song, Ju Seop; Kim, Kyoung A; Koh, Kwang Joon

    2008-01-01

    To investigate the effects of irradiation on transforming growth factor β1 (TGF-β 1 ) mRNA expression and calcific nodule formation in MC3T3-E1 osteoblastic cell line. Cells were cultured in alpha-minimum essential medium (α-MEM) supplemented with 10% fetal bovine serum and antibiotics. When the cells reached the level of 70-80% confluence, culture media were changed with α-MEM supplemented with 10% FBS, 5 mM β-glycerol phosphate, and 50 μg/mL ascorbic acid. Thereafter the cells were irradiated with a single dose of 2, 4, 6, 8 Gy at a dose rate of 1.5 Gy/min. The expression pattern of TGF-β 1 mRNA, calcium content and calcific nodule formation were examined on day 3, 7, 14, 21, 28, respectively, after the irradiation. The amount of TGF-β 1 mRNA expression decreased significantly on day 7 after irradiation of 4, 6, 8 Gy. It also decreased on day 14 after irradiation of 6, 8 Gy, and decreased on day 21 after irradiation of 8 Gy. The amount of calcium deposition decreased significantly on day 7 after irradiation of 4, 8 Gy (P 1 mRNA expression that was associated with proliferation and the production of extracellular matrix in MC3T3-E1 osteoblastic cell line

  19. Physical Validation of GPM Retrieval Algorithms Over Land: An Overview of the Mid-Latitude Continental Convective Clouds Experiment (MC3E)

    Science.gov (United States)

    Petersen, Walter A.; Jensen, Michael P.

    2011-01-01

    The joint NASA Global Precipitation Measurement (GPM) -- DOE Atmospheric Radiation Measurement (ARM) Midlatitude Continental Convective Clouds Experiment (MC3E) was conducted from April 22-June 6, 2011, centered on the DOE-ARM Southern Great Plains Central Facility site in northern Oklahoma. GPM field campaign objectives focused on the collection of airborne and ground-based measurements of warm-season continental precipitation processes to support refinement of GPM retrieval algorithm physics over land, and to improve the fidelity of coupled cloud resolving and land-surface satellite simulator models. DOE ARM objectives were synergistically focused on relating observations of cloud microphysics and the surrounding environment to feedbacks on convective system dynamics, an effort driven by the need to better represent those interactions in numerical modeling frameworks. More specific topics addressed by MC3E include ice processes and ice characteristics as coupled to precipitation at the surface and radiometer signals measured in space, the correlation properties of rainfall and drop size distributions and impacts on dual-frequency radar retrieval algorithms, the transition of cloud water to rain water (e.g., autoconversion processes) and the vertical distribution of cloud water in precipitating clouds, and vertical draft structure statistics in cumulus convection. The MC3E observational strategy relied on NASA ER-2 high-altitude airborne multi-frequency radar (HIWRAP Ka-Ku band) and radiometer (AMPR, CoSMIR; 10-183 GHz) sampling (a GPM "proxy") over an atmospheric column being simultaneously profiled in situ by the University of North Dakota Citation microphysics aircraft, an array of ground-based multi-frequency scanning polarimetric radars (DOE Ka-W, X and C-band; NASA D3R Ka-Ku and NPOL S-bands) and wind-profilers (S/UHF bands), supported by a dense network of over 20 disdrometers and rain gauges, all nested in the coverage of a six-station mesoscale rawinsonde

  20. A study of RUNX3, E-cadherin and β-catenin in CagA-positive Helicobacter pylori associated chronic gastritis in Saudi patients.

    Science.gov (United States)

    Wagih, H M; El-Ageery, S M; Alghaithy, A A

    2015-04-01

    H. pylori is the most important risk factor for gastric carcinoma. CagA-positive H. pylori is associated with an increased risk for gastric cancer compared with negative strains. RUNX3 is a tumor suppressor gene, which is related to the genesis of gastric cancer. β-catenin is integrated with E-cadherin in the cell membrane, and aberrant expression of the complex was reported in gastric carcinoma. Aim of this paper is to determine of the relation between RUNX3, E-cadherin and β-catenin in chronic gastritis associated with cagA-positive H. pylori infection. Retrospective study was done on formalin fixed paraffin embedded gastric biopsies blocks of 90 patients diagnosed as H. pylori associated chronic gastritis. H. pylori was detected using modified Giemsa stain. Nested PCR was used for detection of cagA, reverse transcription-PCR for detection of RUNX3 and immunohistochemistry for detection of E-cadherin and β-catenin. Fifty percent of cases were found to be cagA positive. CagA was significantly associated with the intensity of mononuclear inflammation, the intensity of neutrophilic inflammation, the degree of mucosal atrophy and loss of RUNX3 but not with the density of H. pylori, intestinal metaplasia, E-cadherin or β-catenin. There was significant relation between loss of RUNX3 and increasing density of H. pylori, intensity of neutrophilic inflammation, mucosal atrophy and intestinal metaplasia. RUNX3 was found to be significantly correlated with E-cadherin but not with β-catenin. E-cadherin showed decreased expression in 36.7% of biopsies while, β-catenin was decreased in 33% of biopsies. Loss of RUNX3, E-cadherin and β-catenin was considered early events in the cascade of gastric carcinoma development. Loss of RUNX3 but neither E-cadherin nor β-catenin was related to cagA positive H. pylori strains.

  1. The in vitro effects of macrophages on the osteogenic capabilities of MC3T3-E1 cells encapsulated in a biomimetic poly(ethylene glycol) hydrogel.

    Science.gov (United States)

    Saleh, Leila S; Carles-Carner, Maria; Bryant, Stephanie J

    2018-04-15

    Poly(ethylene glycol) PEG-based hydrogels are promising for cell encapsulation and tissue engineering, but are known to elicit a foreign body response (FBR) in vivo. The goal of this study was to investigate the impact of the FBR, and specifically the presence of inflammatory macrophages, on encapsulated cells and their ability to synthesize new extracellular matrix. This study employed an in vitro co-culture system with murine macrophages and MC3T3-E1 pre-osteoblasts encapsulated in a bone-mimetic hydrogel, which were cultured in transwell inserts, and exposed to an inflammatory stimulant, lipopolysaccharide (LPS). The co-culture was compared to mono-cultures of the cell-laden hydrogels alone and with LPS over 28 days. Two macrophage cell sources, RAW 264.7 and primary derived, were investigated. The presence of LPS-stimulated primary macrophages led to significant changes in the cell-laden hydrogel by a 5.3-fold increase in percent apoptotic osteoblasts at day 28, 4.2-fold decrease in alkaline phosphatase activity at day 10, and 7-fold decrease in collagen deposition. The presence of LPS-stimulated RAW macrophages led to significant changes in the cell-laden hydrogel by 5-fold decrease in alkaline phosphatase activity at day 10 and 4-fold decrease in collagen deposition. Mineralization, as measured by von Kossa stain or quantified by calcium content, was not sensitive to macrophages or LPS. Elevated interleukin-6 and tumor necrosis factor-α secretion were detected in mono-cultures with LPS and co-cultures. Overall, primary macrophages had a more severe inhibitory effect on osteoblast differentiation than the macrophage cell line, with greater apoptosis and collagen I reduction. In summary, this study highlights the detrimental effects of macrophages on encapsulated cells for bone tissue engineering. Poly(ethylene glycol) (PEG)-based hydrogels are promising for cell encapsulation and tissue engineering, but are known to elicit a foreign body response (FBR) in

  2. Synthesis and Biological Evaluation of (S)-Amino-2-methyl-4-[(76)Br]bromo-3-(E)-butenoic Acid (BrVAIB) for Brain Tumor Imaging.

    Science.gov (United States)

    Burkemper, Jennifer L; Huang, Chaofeng; Li, Aixiao; Yuan, Liya; Rich, Keith; McConathy, Jonathan; Lapi, Suzanne E

    2015-11-12

    The novel compound, (S)-amino-2-methyl-4-[(76)Br]bromo-3-(E)-butenoic acid (BrVAIB, [(76)Br]5), was characterized against the known system A tracer, IVAIB ([(123)I]8). [(76)Br]5 was prepared in a 51% ± 19% radiochemical yield with high radiochemical purity (≥98%). The biological properties of [(76)Br]5 were compared with those of [(123)I]8. Results showed that [(76)Br]5 undergoes mixed amino acid transport by system A and system L transport, while [(123)I]8 had less uptake by system L. [(76)Br]5 demonstrated higher uptake than [(123)I]8 in DBT tumors 1 h after injection (3.7 ± 0.4% ID/g vs 1.5 ± 0.3% ID/g) and also showed higher uptake vs [(123)I]8 in normal brain. Small animal PET studies with [(76)Br]5 demonstrated good tumor visualization of intracranial DBTs up to 24 h with clearance from normal tissues. These results indicate that [(76)Br]5 is a promising PET tracer for brain tumor imaging and lead compound for a mixed system A and system L transport substrate.

  3. Knockdown of Indian hedgehog protein induces an inhibition of cell growth and differentiation in osteoblast MC3T3-E1 cells

    Science.gov (United States)

    Deng, Ang; Zhang, Hongqi; Hu, Minyu; Liu, Shaohua; Gao, Qile; Wang, Yuxiang; Guo, Chaofeng

    2017-01-01

    Indian hedgehog protein (Ihh) is evolutionarily conserved and serves important roles in controlling the differentiation of progenitor cells into osteoblasts. Ihh null mutant mice exhibit a failure of osteoblast development in endochondral bone. Although studies have demonstrated that Ihh signaling is a potent local factor that regulates osteoblast differentiation, the specific transcription factors that determine osteoblast differentiation remain unclear. Further studies are required to determine the precise mechanism through which Ihh regulates osteoblast differentiation. In the present study, Ihh was knocked down in osteoblast MC3T3-E1 cells using short hairpin RNA, to investigate the function of Ihh in osteoblast proliferation and differentiation and to examine the potential mechanism through which Ihh induces osteoblast apoptosis and cell cycle arrest. It was observed that the knockdown of Ihh induced a marked inhibition of cell growth and increased the apoptosis rate compared with the negative control osteoblasts. Downregulation of Ihh resulted in a cell cycle arrest at the G1 to S phase boundary in osteoblasts. In addition, the knockdown of Ihh decreased the alkaline phosphatase activity and mineral deposition of osteoblasts. The inhibitory roles of Ihh downregulation in osteoblast growth and differentiation may be associated with the transforming growth factor-β/mothers against decapentaplegic homolog and tumor necrosis factor receptor superfamily member 11B/tumor necrosis factor ligand superfamily member 11 signaling pathways. Manipulating either Ihh expression or its signaling components may be of benefit for the treatment of skeletal diseases. PMID:28990069

  4. Layer-by-layer assembly of peptide based bioorganic–inorganic hybrid scaffolds and their interactions with osteoblastic MC3T3-E1 cells

    International Nuclear Information System (INIS)

    Romanelli, Steven M.; Fath, Karl R.; Phekoo, Aruna P.; Knoll, Grant A.; Banerjee, Ipsita A.

    2015-01-01

    In this work we have developed a new family of biocomposite scaffolds for bone tissue regeneration by utilizing self-assembled fluorenylmethyloxycarbonyl protected Valyl-cetylamide (FVC) nanoassemblies as templates. To tailor the assemblies for enhanced osteoblast attachment and proliferation, we incorporated (a) Type I collagen, (b) a hydroxyapatite binding peptide sequence (EDPHNEVDGDK) derived from dentin sialophosphoprotein and (c) the osteoinductive bone morphogenetic protein-4 (BMP-4) to the templates by layer-by-layer assembly. The assemblies were then incubated with hydroxyapatite nanocrystals blended with varying mass percentages of TiO 2 nanoparticles and coated with alginate to form three dimensional scaffolds for potential applications in bone tissue regeneration. The morphology was examined by TEM and SEM and the binding interactions were probed by FITR spectroscopy. The scaffolds were found to be non-cytotoxic, adhered to mouse preosteoblast MC3T3-E1 cells and promoted osteogenic differentiation as indicated by the results obtained by alkaline phosphatase assay. Furthermore, they were found to be biodegradable and possessed inherent antibacterial capability. Thus, we have developed a new family of tissue-engineered biocomposite scaffolds with potential applications in bone regeneration. - Highlights: • Fmoc-val-cetylamide assemblies were used as templates. • Collagen, a short dentin sialophosphoprotein derived sequence and BMP-4 were incorporated. • Hydroxyapatite–TiO 2 nanocomposite blends and alginate were incorporated. • The 3D scaffold biocomposites adhered to preosteoblasts and promoted osteoblast differentiation. • The biocomposites also displayed antimicrobial activity

  5. Effects of Apatite Cement Containing Atelocollagen on Attachment to and Proliferation and Differentiation of MC3T3-E1 Osteoblastic Cells

    Directory of Open Access Journals (Sweden)

    Masaaki Takechi

    2016-04-01

    Full Text Available To improve the osteoconductivity of apatite cement (AC for reconstruction of bone defects after oral maxillofacial surgery, we previously fabricated AC containing atelocollagen (AC(ate. In the present study, we examined the initial attachment, proliferation and differentiation of mouse osteoblastic cells (MC3T3-E1 cells on the surface of conventional AC (c-AC, AC(ate and a plastic cell dish. The number of osteoblastic cells showing initial attachment to AC(ate was greater than those attached to c-AC and similar to the number attached to the plastic cell wells. We also found that osteoblastic cells were well spread and increased their number on AC(ate in comparison with c-AC and the wells without specimens, while the amount of procollagen type I carboxy-terminal peptide (PIPC produced in osteoblastic cells after three days on AC(ate was greater as compared to the others. There was no significant difference in regard to alkaline phosphatase (ALP activity and osteocalcin production by osteoblastic cells among the three surface types after three and six days. However, after 12 days, ALP activity and the produced osteocalcin were greater with AC(ate. In conclusion, AC(ate may be a useful material with high osteoconductivity for reconstruction of bone defects after oral maxillofacial surgery.

  6. MC3T3-E1 proliferation and differentiation on biphasic mixtures of Mg substituted β-tricalcium phosphate and amorphous calcium phosphate

    International Nuclear Information System (INIS)

    Singh, Satish S.; Roy, Abhijit; Lee, Boeun E.; Banerjee, Ipsita; Kumta, Prashant N.

    2014-01-01

    A low temperature aqueous approach was used to synthesize nanocrystalline, high surface area Mg 2+ substituted β-tricalcium phosphate (β-TCMP) to assess its potential use as a synthetic bone graft substitute. X-ray diffraction indicated that β-TCMP was the predominant crystalline phase formed. However, thermal analysis revealed the presence of a secondary amorphous phase which increased with increasing Mg 2+ concentration. Further analysis by Rietveld refinement indicated that the level of ionic substitution of Ca 2+ by Mg 2+ was significantly lower than the amount of Mg 2+ measured using elemental analysis, confirming the formation of a Mg 2+ rich secondary amorphous phase. MC3T3-E1 proliferation on substrates prepared using β-TCMP was assessed using the MTT assay. In comparison to commercially available β-TCP, increased proliferation was observed on samples prepared with 50% Mg, despite elevated Mg 2+ and PO 4 3− concentrations in culture media. Alkaline phosphatase (ALP) activity and qRT-PCR were used to study the effect of varying Mg 2+ substitution on osteogenic differentiation. Cells cultured on β-TCMP substrates prepared with increased Mg 2+ concentrations expressed significantly increased levels of ALP activity and osteogenic genes such as, osteocalcin, collagen-1, and Runx2, in comparison to those cultured on commercially available β-TCP

  7. Layer-by-layer assembly of peptide based bioorganic–inorganic hybrid scaffolds and their interactions with osteoblastic MC3T3-E1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Romanelli, Steven M. [Fordham University Department of Chemistry, 441 East Fordham Road, Bronx, NY 10458 (United States); Fath, Karl R. [The City University of New York, Queens College, Department of Biology, 65-30 Kissena Blvd, Flushing, NY 11367 (United States); The Graduate Center, The City University of New York, 365 Fifth Avenue, NY 10016 (United States); Phekoo, Aruna P. [The City University of New York, Queens College, Department of Biology, 65-30 Kissena Blvd, Flushing, NY 11367 (United States); Knoll, Grant A. [Fordham University Department of Chemistry, 441 East Fordham Road, Bronx, NY 10458 (United States); Banerjee, Ipsita A., E-mail: banerjee@fordham.edu [Fordham University Department of Chemistry, 441 East Fordham Road, Bronx, NY 10458 (United States)

    2015-06-01

    In this work we have developed a new family of biocomposite scaffolds for bone tissue regeneration by utilizing self-assembled fluorenylmethyloxycarbonyl protected Valyl-cetylamide (FVC) nanoassemblies as templates. To tailor the assemblies for enhanced osteoblast attachment and proliferation, we incorporated (a) Type I collagen, (b) a hydroxyapatite binding peptide sequence (EDPHNEVDGDK) derived from dentin sialophosphoprotein and (c) the osteoinductive bone morphogenetic protein-4 (BMP-4) to the templates by layer-by-layer assembly. The assemblies were then incubated with hydroxyapatite nanocrystals blended with varying mass percentages of TiO{sub 2} nanoparticles and coated with alginate to form three dimensional scaffolds for potential applications in bone tissue regeneration. The morphology was examined by TEM and SEM and the binding interactions were probed by FITR spectroscopy. The scaffolds were found to be non-cytotoxic, adhered to mouse preosteoblast MC3T3-E1 cells and promoted osteogenic differentiation as indicated by the results obtained by alkaline phosphatase assay. Furthermore, they were found to be biodegradable and possessed inherent antibacterial capability. Thus, we have developed a new family of tissue-engineered biocomposite scaffolds with potential applications in bone regeneration. - Highlights: • Fmoc-val-cetylamide assemblies were used as templates. • Collagen, a short dentin sialophosphoprotein derived sequence and BMP-4 were incorporated. • Hydroxyapatite–TiO{sub 2} nanocomposite blends and alginate were incorporated. • The 3D scaffold biocomposites adhered to preosteoblasts and promoted osteoblast differentiation. • The biocomposites also displayed antimicrobial activity.

  8. Idealized Simulations of a Squall Line from the MC3E Field Campaign Applying Three Bin Microphysics Schemes: Dynamic and Thermodynamic Structure

    Energy Technology Data Exchange (ETDEWEB)

    Xue, Lulin [National Center for Atmospheric Research, Boulder, Colorado; Fan, Jiwen [Pacific Northwest National Laboratory, Richland, Washington; Lebo, Zachary J. [University of Wyoming, Laramie, Wyoming; Wu, Wei [National Center for Atmospheric Research, Boulder, Colorado; University of Illinois at Urbana–Champaign, Urbana, Illinois; Morrison, Hugh [National Center for Atmospheric Research, Boulder, Colorado; Grabowski, Wojciech W. [National Center for Atmospheric Research, Boulder, Colorado; Chu, Xia [University of Wyoming, Laramie, Wyoming; Geresdi, István [University of Pécs, Pécs, Hungary; North, Kirk [McGill University, Montréal, Québec, Canada; Stenz, Ronald [University of North Dakota, Grand Forks, North Dakota; Gao, Yang [Pacific Northwest National Laboratory, Richland, Washington; Lou, Xiaofeng [Chinese Academy of Meteorological Sciences, Beijing, China; Bansemer, Aaron [National Center for Atmospheric Research, Boulder, Colorado; Heymsfield, Andrew J. [National Center for Atmospheric Research, Boulder, Colorado; McFarquhar, Greg M. [National Center for Atmospheric Research, Boulder, Colorado; University of Illinois at Urbana–Champaign, Urbana, Illinois; Rasmussen, Roy M. [National Center for Atmospheric Research, Boulder, Colorado

    2017-12-01

    The squall line event on May 20, 2011, during the Midlatitude Continental Convective Clouds (MC3E) field campaign has been simulated by three bin (spectral) microphysics schemes coupled into the Weather Research and Forecasting (WRF) model. Semi-idealized three-dimensional simulations driven by temperature and moisture profiles acquired by a radiosonde released in the pre-convection environment at 1200 UTC in Morris, Oklahoma show that each scheme produced a squall line with features broadly consistent with the observed storm characteristics. However, substantial differences in the details of the simulated dynamic and thermodynamic structure are evident. These differences are attributed to different algorithms and numerical representations of microphysical processes, assumptions of the hydrometeor processes and properties, especially ice particle mass, density, and terminal velocity relationships with size, and the resulting interactions between the microphysics, cold pool, and dynamics. This study shows that different bin microphysics schemes, designed to be conceptually more realistic and thus arguably more accurate than bulk microphysics schemes, still simulate a wide spread of microphysical, thermodynamic, and dynamic characteristics of a squall line, qualitatively similar to the spread of squall line characteristics using various bulk schemes. Future work may focus on improving the representation of ice particle properties in bin schemes to reduce this uncertainty and using the similar assumptions for all schemes to isolate the impact of physics from numerics.

  9. Synthesis, characterization and computational studies of 3-{(E)-[(2-hydroxyphenyl)imino]methyl}benzene-1,2-diol and molecular structure of its zwitterionic form

    Science.gov (United States)

    Ezeorah, Julius Chigozie; Ossai, Valentine; Obasi, Lawrence Nnamdi; Elzagheid, Mohamed I.; Rhyman, Lydia; Lutter, Michael; Jurkschat, Klaus; Dege, Necmi; Ramasami, Ponnadurai

    2018-01-01

    The Schiff base 3-{(E)-[(2-hydroxyphenyl)imino]methyl}benzene-1,2-diol was synthesized by the condensation of 2,3-dihydroxybenzaldehyde and 2-aminophenol in water at room temperature. The crystal was grown using two solvents (dry methanol and 60% methanol). The compound was characterized using elemental microanalysis, IR, NMR, UV spectroscopies and single-crystal X-ray diffraction crystallography. The X-ray structure reveals that the Schiff base crystallizes as a methanol solvate in dry methanol with triclinic crystal system, space group P-1 and Z = 2 in the unit cell and as a non-methanol solvate in 60% methanol with triclinic crystal system, space group P-1 and Z = 4 in the unit cell. The compound showed absorption bands at 272, 389, 473 and 602 nm in DMSO. These bands were assigned as π → π ∗, n → π∗ and n-σ∗ transitions. The 473 and 602 nm bands in DMSO reveal that the compound exists in tautomeric forms. The presence of N-H, C-O and Cdbnd N stretching vibrations in the IR spectrum indicates that the compound is zwitterionic in the solid state. This study was supplemented using density functional theory method.

  10. The issue of the fourth nuclear power plant and its impact on 3-E problems in Taiwan - empirical evidence from the energy forecasting (EnFore) system

    International Nuclear Information System (INIS)

    Bor, Y.J.; Chou, F.-Y.

    2003-01-01

    Taiwan has placed considerable emphasis on economic, energy and environmental (3-E) problems in recent decades. Following President Chen's inauguration, one particular issue of concern has been the current dispute over the fourth nuclear power plant (FNPP) in northern Taiwan. This dispute has had a serious impact on Taiwan's economy, including its energy structure and general policy towards CO 2 emission controls. It is estimated, for example, that the loss to Taiwan's capital market as a result of the FNPP dispute, reached NT$7 trillion (about US$219 billion) by the end of 2000. If Taiwan Power Company (Taipower) were to replace the nuclear power plant capacity with liquified natural gas generators, average utility prices would go up by around 4.6% over the next 10 years. The alternative would be for low-cost coal-fired power plants to assume the major position in future power generation; however, this could cause significant damage to Taiwan's CO 2 emission control policy. This paper uses an integrated computerized system model of energy forecasting to simulate the complex interrelationship between the various issues. Empirical results reveal that there are no perfect solutions available; thus, this is an important learning process for the government in terms of administration, as well as for other academic studies

  11. Influence of MC3T3-E1 preosteoblast culture on the corrosion of a T6-treated AZ91 alloy

    Science.gov (United States)

    Brooks, Emily K.; Tobias, Menachem E.; Yang, Shuying; Bone, Lawrence B.; Ehrensberger, Mark T.

    2015-01-01

    This study investigated the corrosion of artificially aged T6 heat-treated Mg-9%Al-1%Zn (AZ91) for biomedical applications. Corrosion tests and surface analysis were completed both with and without a monolayer of mouse preosteoblast MC3T3-E1 cells cultured on the sample. Electrochemical impedance spectroscopy (EIS) and inductively coupled plasma mass spectroscopy (ICPMS) were used to explore the corrosion processes after either 3 or 21 days of AZ91 incubation in cell culture medium (CCM). The EIS showed both the inner layer resistance (Rin) and outer layer resistance (Rout) were lower for samples without cells cultured on the surface at 3 days (Rin = 2.64 e4 Ω/cm2, Rout = 140 Ω/cm2) compared to 21 days (Rin = 3.60 e4 Ω/cm2, Rout = 287 Ω/cm2) due to precipitation of magnesium and calcium phosphates over time. Samples with preosteoblasts cultured on the surface had a slower initial corrosion (3 day, Rin = 1.88 e5 Ω/cm2, Rout = 1060 Ω/cm2) which was observed to increase over time (21 day, Rin = 2.99 e4 Ω/cm2, Rout = 287 Ω/cm2). Changes in the corrosion processes were thought to be related to changes in the coverage provided by the cell layer. Our results reveal that the presence of cells and biological processes are able to significantly influence the corrosion rate of AZ91. PMID:25715925

  12. 1-Hydroxy-3-[(E)-4-(piperazine-diium)but-2-enyloxy]-9,10-anthraquinone ditrifluoroactate induced autophagic cell death in human PC3 cells.

    Science.gov (United States)

    Huang, A-Mei; Lin, Kai-Wei; Lin, Wei-Hong; Wu, Li-Hung; Chang, Hao-Chun; Ni, Chujun; Wang, Danny Ling; Hsu, Hsue-Yin; Su, Chun-Li; Shih, Chiaho

    2018-02-01

    The autophagy of human prostate cancer cells (PC3 cells) induced by a new anthraquinone derivative, 1-Hydroxy-3-[(E)-4-(piperazine-diium)but-2-enyloxy]-9,10-anthraquinone ditrifluoroactate (PA) was investigated, and the relationship between autophagy and reactive oxygen species (ROS) generation was studied. The results indicated that PA induced PC3 cell death in a time- and dose-dependent manner, could inhibit PC3 cell growth by G1 phase cell cycle arrest and corresponding decrease in the G2/M cell population and induced S-phase arrest accompanied by a significant decrease G2/M and G1 phase numbers after PC3 cells treated with PA for 48 h, and increased the accumulation of autophagolysosomes and microtubule-associated protein LC3-ll, a marker of autophagy. However, these phenomenon were not observed in the group pretreated with the autophagy inhibitor 3-MA or Bafilomycin A1 (BAF), suggesting that PA induced PC3 cell autophagy. In addition, we found that PA triggered ROS generation in cells, while the levels of ROS decreased in the N-acetylcysteine (NAC) co-treatment, indicating that PA-mediated autophagy was partly blocked by NAC. In summary, the autophagic cell death of human PC3 cells mediated by PA-triggered ROS generation. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Structure, MC3T3-E1 cell response, and osseointegration of macroporous titanium implants covered by a bioactive microarc oxidation coating with microporous structure.

    Science.gov (United States)

    Zhou, Rui; Wei, Daqing; Cheng, Su; Feng, Wei; Du, Qing; Yang, Haoyue; Li, Baoqiang; Wang, Yaming; Jia, Dechang; Zhou, Yu

    2014-04-09

    Macroporous Ti with macropores of 50-400 μm size is prepared by sintering Ti microbeads with different diameters of 100, 200, 400, and 600 μm. Bioactive microarc oxidation (MAO) coatings with micropores of 2-5 μm size are prepared on the macroporous Ti. The MAO coatings are composed of a few TiO2 nanocrystals and lots of amorphous phases with Si, Ca, Ti, Na, and O elements. Compared to compact Ti, the MC3T3-E1 cell attachment is prolonged on macroporous Ti without and with MAO coatings; however, the cell proliferation number increases. These results are contributed to the effects of the space structure of macroporous Ti and the surface chemical feature and element dissolution of the MAO coatings during the cell culture. Macroporous Ti both without and with MAO coatings does not cause any adverse effects in vivo. The new bone grows well into the macropores and micropores of macroporous Ti with MAO coatings, showing good mechanical properties in vivo compared to Ti, MAO-treated Ti, and macroporous Ti because of its excellent osseointegration. Moreover, the MAO coatings not only show a high interface bonding strength with new bones but also connect well with macroporous Ti. Furthermore, the pushing out force for macroporous Ti with MAO coatings increases significantly with increasing microbead diameter.

  14. From 2D to 3D: The morphology, proliferation and differentiation of MC3T3-E1 on silk fibroin/chitosan matrices.

    Science.gov (United States)

    Li, Da-Wei; He, Feng-Li; He, Jin; Deng, Xudong; Liu, Ya-Li; Liu, Yang-Yang; Ye, Ya-Jing; Yin, Da-Chuan

    2017-12-15

    It has been widely accepted that cell culture in two-dimensional (2D) conditions may not be able to represent growth in three-dimensional (3D) conditions. Systematic comparisons between 2D and 3D cell cultures are needed to appropriately use the existing 2D results. In this work, we conducted a comparative study between 2D and 3D cell cultures of MC3T3-E1 using the same type of material (a mixture of silk fibroin (SF) and chitosan (CS)). Our results showed 3D SF/CS scaffold exhibited different effects on cell culture compared with the 2D cases. 1) The cells grown in 3D scaffold showed multiple morphologies. 2) The proliferation of cells in 3D scaffold was long-term and sustainable. 3) Cell differentiation occurred throughout the entire 3D scaffold. The results showed that cell culture in 3D SF/CS scaffold exhibited different features than 2D cases and 3D SF/CS scaffold could be a promising material for 3D cell culture. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. [The effects of platelet-rich fibrin extract on MC3T3-E1 cells cultured on the titanium discs].

    Science.gov (United States)

    Zhang, X J; Xu, S; Meng, W Y; Xiao, H J; Dong, K; Liu, Z H

    2017-01-09

    Objective: To evaluate the effect of platelet-rich fibrin extract (PRFe) on the adhesion, proliferation and differentiation of MC3T3-E1 cells cultured on the titanium discs. Methods: Samples were divided into experimental group (P) and control group (D). Group P used the α-minimal essential medium (α-MEM) containing PRFe (0.5%), while group D used only the α-MEM. Cell adhesion and cytoskeleton were observed using scanning electron microscopy (SEM) and laser scanning confocal microscopy (LSCM). Methyl thiazolyl tetrazolium (MTT) assay to detect the number of the osteoblasts at 1, 3, 5, 7 d; the activity of alkaline phosphatase (ALP) to detect the differentiation of osteoblast at 1, 3, 5, 7 d; the level of osteogenetic biomarkers core-binding factorα1 (cbfα1) and osteocalcin (OCN) were quantified by quantitative real-time PCR (qRT-PCR) at 3 and 7 d. Results: SEM and LSCM showed that the adhesion and filaments of group P were higher than those of group D at each time point. MTT assay showed that the absorbance were significantly increased in group P (1 d: 0.299±0.002, 3 d: 0.517±0.004, 5 d: 0.810±0.002, 7 d: 1.203±0.011) compared with group D (1 d: 0.198±0.003, 3 d: 0.399±0.002, 5 d: 0.588±0.002, 7 d: 0.897±0.005) at each time points ( P< 0.05). Furthermore, the ALP activity of group P (1 d: 0.162±0.004, 3 d: 0.289±0.001, 5 d: 0.491±0.006, 7 d: 0.647±0.005) was significantly higher than that of group D (1 d: 0.121±0.003, 3 d: 0.191± 0.006, 5 d: 0.252±0.004, 7 d: 0.365±0.012), ( P< 0.05). Moreover, the qRT-PCR showed that the Cbfα1 and OCN gene expression in group P (Cfbα1, 3 d: 1.50±0.04, 7 d: 1.94±0.06; OCN, 3 d: 3.37±0.17, 7 d: 3.92± 0.04) were significantly higher than that in group D(Cfbα1, 3 d: 1, 7 d: 1.18±0.13; OCN, 3 d: 1, 7 d: 2.34± 0.09) ( P< 0.05). Conclusions: PRFe promoted the adhension, proliferation and differentiation of MC3T3-E1 cells on the titanium discs.

  16. Influence of MC3T3-E1 preosteoblast culture on the corrosion of a T6-treated AZ91 alloy.

    Science.gov (United States)

    Brooks, Emily K; Tobias, Menachem E; Yang, Shuying; Bone, Lawrence B; Ehrensberger, Mark T

    2016-02-01

    This study investigated the corrosion of artificially aged T6 heat-treated Mg-9%Al-1%Zn (AZ91) for biomedical applications. Corrosion tests and surface analysis were completed both with and without a monolayer of mouse preosteoblast MC3T3-E1 cells cultured on the sample. Electrochemical impedance spectroscopy (EIS) and inductively coupled plasma mass spectroscopy (ICPMS) were used to explore the corrosion processes after either 3 or 21 days of AZ91 incubation in cell culture medium (CCM). The EIS showed both the inner layer resistance (Rin ) and outer layer resistance (Rout ) were lower for samples without cells cultured on the surface at 3 days (Rin  = 2.64 e4 Ω/cm(2) , Rout  = 140 Ω/cm(2) ) compared to 21 days (Rin  = 3.60 e4 Ω/cm(2) , Rout  = 287 Ω/cm(2) ) due to precipitation of magnesium and calcium phosphates over time. Samples with preosteoblasts cultured on the surface had a slower initial corrosion (3 day, Rin  = 1.88 e5 Ω/cm(2) , Rout  = 1060 Ω/cm(2) ) which was observed to increase over time (21 day, Rin  = 2.99 e4 Ω/cm(2) , Rout  = 287 Ω/cm(2) ). Changes in the corrosion processes were thought to be related to changes in the coverage provided by the cell layer. Our results reveal that the presence of cells and biological processes are able to significantly influence the corrosion rate of AZ91. © 2015 Wiley Periodicals, Inc.

  17. Short-term administration of small molecule phenamil induced a protracted osteogenic effect on osteoblast-like MC3T3-E1 cells.

    Science.gov (United States)

    Lo, Kevin W-H; Kan, Ho Man; Laurencin, Cato T

    2016-06-01

    Sustained administration (21-day treatment) of the small molecule phenamil has been proposed as an alternative osteogenic factor when used in conjunction with a biodegradable scaffold for in vitro osteogenesis. While promising, the major issue associated with small molecules is non-specific cytotoxicity. The aim of this study was to minimize the side-effects from small-molecule drugs by reducing the frequency of administration. Toward this goal, we investigated whether a shorter phenamil treatment is sufficient to induce in vitro osteogenesis. We compared the effects of short-term (12 h) and continuous treatments of phenamil on osteoblastic differentiation and mineralization. Alkaline phosphatase (ALP) and osteopontin (OPN) activity were used as markers for osteoblastic differentiation. Measurement of the calcium content of the extracellular matrix was used as the hallmark for in vitro bone formation after 21 days of culture. Our findings revealed that both short and continuous phenamil treatment triggers osteoblastic differentiation and mineralization of MC3T3-E1 cells on a biodegradable polymeric scaffold composed of polylactic-co-glycolic acid (PLAGA) at the same time points. In addition, in order to fabricate a phenamil-loaded PLAGA scaffold, the small molecule phenamil was physically absorbed onto the surface of scaffolds and the bioactivity of the loaded scaffolds was evaluated. Furthermore, biochemical analysis indicated that short phenamil treatment of cells was accompanied by upregulation in protein expression of integrin α5, p125(FAK) and phosphorylation of CREB. These effects may contribute to the downstream signalling cascade necessary for osteogenesis, and such responses may account for our observed protracted osteogenic differentiation in vitro. Copyright © 2013 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  18. Direct effects of casein phosphopeptides on growth and differentiation of in vitro cultured osteoblastic cells (MC3T3-E1).

    Science.gov (United States)

    Tulipano, Giovanni; Bulgari, Omar; Chessa, Stefania; Nardone, Alessandro; Cocchi, Daniela; Caroli, Anna

    2010-02-25

    Casein phosphopeptides (CPPs) obtained by enzymatic hydrolysis in vitro of caseins, have been shown to enhance calcium solubility and to increase the calcification of embryonic rat bones in their diaphyseal area. Little is known about the direct effects of CPPs on cultured osteoblastic cells. Calcium in the microenvironment surrounding bone cells is not only important for the mineralization of the extracellular matrix, but it is believed to provide preosteblasts with a signal that modulates their proliferation and differentiation. The aim of the present study was to investigate the direct effects of four selected casein phosphopeptides on osteoblastic cell (MC3T3-E1 cells) viability and differentiation. The selected peptides have been obtained by chemical synthesis and differed in the number of phosphorylated sites and in the amino acid spacing out two phosphorylated sites, in order to further characterize the relationship between structure and function. The results obtained in this work demonstrated that CPPs may directly affect osteoblast-like cell growth, calcium uptake and ultimately calcium deposition in the extracellular matrix. The effects exerted by distinct CPPs on osteogenesis in vitro can be either stimulatory or inhibitory. Differential short amino acid sequences in their molecules, like the -SpEE- and the -SpTSpEE-motifs, are likely the molecular determinants for their biological activities on osteoblastic cells. Moreover, two genetic variants of CPPs showing one amino acid change in their sequence may profoundly differ in their biological activities. Finally, our data may also suggest important clues about the role of intrinsic phosphorylated peptides derived from endogenous phosphorylated proteins in bone metabolism, apart from extrinsic CPPs. Copyright 2009 Elsevier B.V. All rights reserved.

  19. Energy, exergy, economic (3E) analyses and multi-objective optimization of vapor absorption heat transformer using NSGA-II technique

    International Nuclear Information System (INIS)

    Jain, Vaibhav; Sachdeva, Gulshan

    2017-01-01

    Highlights: • Study includes energy, exergy and economic analyses of absorption heat transformer. • It addresses multi-objective optimization study using NSGA-II technique. • Total annual cost and total exergy destruction are simultaneously optimized. • Results with multi-objective optimized design are more acceptable than other. - Abstract: Present paper addresses the energy, exergy and economic (3E) analyses of absorption heat transformer (AHT) working with LiBr-H 2 O fluid pair. The heat exchangers namely absorber, condenser, evaporator, generator and solution heat exchanger are designed for the size and cost estimation of AHT. Later, the effect of operating variables is examined on the system performance, size and cost. Simulation studies showed a conflict between thermodynamic and economic performance of the system. The heat exchangers with lower investment cost showed high irreversible losses and vice versa. Thus, the operating variables of systems are determined economically as well as thermodynamically by implementing non-dominated sort genetic algorithm-II (NSGA-II) technique of multi-objective optimization. In present work, if the cost based optimized design is chosen, total exergy destruction is 2.4% higher than its minimum possible value; whereas, if total exergy based optimized design is chosen, total annual cost is 6.1% higher than its minimum possible value. On the other hands, total annual cost and total exergy destruction are only 1.0% and 0.8%, respectively more from their minimum possible values with multi-objective optimized design. Thus, the multi-objective optimized design of the AHT is best outcome than any other single-objective optimized designs.

  20. Effect of phytotoxic secondary metabolites and semisynthetic compounds from endophytic fungus Xylaria feejeensis strain SM3e-1b on spinach chloroplast photosynthesis.

    Science.gov (United States)

    Macías-Rubalcava, Martha Lydia; García-Méndez, Marbella Claudia; King-Díaz, Beatriz; Macías-Ruvalcaba, Norma Angélica

    2017-01-01

    We investigated the mechanism of action on the photosynthesis light reactions of three major secondary metabolites produced by the endophytic fungus Xylaria feejeensis strain SM3e-1b, isolated from Sapium macrocarpum; and four novel derivatives of coriloxine, a major compound produced by X. feejeensis. The natural phytotoxins include one epoxycyclohexenone derivative, coriloxine (1), and two quinone derivatives (2-3). The semisynthetic derivatives of coriloxine are two cyclohexenone (4-6) and two quinone compounds (5-7). Cyclohexenone (4), (4R,5S,6R)-6-chloro-4,5-dihydroxy-3-methoxy-5-methylcyclohex-2-enone, inhibited ATP synthesis in freshly lysed spinach chloroplasts from water to MV; it also partly inhibited the basal and uncoupled photosynthetic electron transport, and significantly enhanced the phosphorylating electron transport and Mg 2+ -ATPase activity, thus demonstrating its action as an uncoupler agent. On the other hand, quinone (7), 2-((4-butylphenyl)amino)-5-methoxy-3-methylcyclohexa-2,5-diene-1,4-dione, inhibited ATP synthesis, and non-cyclic electron transport from water to MV in basal, phosphorylating and uncoupled conditions in a concentration-dependent manner. Hence, (7) behaves as a Hill reaction inhibitor at the PSII electron transport on the water splitting enzyme (OEC), and on the acceptor side between P 680 and Q A . This mechanism of action was confirmed by chlorophyll a fluorescence measurements. These results indicate that coriloxine derivatives 4 and 7 could work as prototype structures for the development of new herbicides. Contrastingly, natural products 1-3, and derivatives 5 and 6 did not show a significant inhibitory effect on ATP synthesis. Copyright © 2016 Elsevier B.V. All rights reserved.

  1. [Effect of NF-κB on the expression of interleukin-6 induced by lipopolysaccharides of Porphyromonas endodontalis in MC3T3-E1 cells].

    Science.gov (United States)

    Yu, Ya-qiong; Guo, Jia-jie; Qiu, Li-hong; Lv, You; Jia, Ge; Guo, Yan

    2013-08-01

    To investigate the effect of NF-κB signaling on the expression of interleukin-6(IL-6) induced by lipopolysaccharides(LPS) extracted from Porphyromonas endodontalis(P.e) in MC3T3-El cells. MC3T3-E1 cells were pretreated with BAY-117082 for 1 h, and then were treated with 10 mg/L P.e-LPS for different times. The translocation of NF-κB was observed by immunofluorescence. The expression of IL-6 was detected by reverse transcription polymerse chain reaction (RT-PCR) and enzyme-linked immuno sorbent assay (ELISA). Statistical analysis was performed using multi-way ANOVA and Dunnett's t test with SPSS 13.0 software package. The staining of NF-κB was mostly in cytoplasm in untreated cells. Rapid translocation of NF-κB into nucleus was observed in the cells stimulated for 30 min and mostly relocalization of NF-κB from nucleus to cytoplasm was observed after 60 min. Pretreatment with 10 μmol/L BAY-117082 for 1h significantly inhibited P.e-LPS-induced translocation of NF-κB .The mRNA and proteins of IL-6 decreased significantly after pretreatment with 10 μmol/L BAY-117082 and the expression of IL-6 proteins was reduced from (774.983±6.585) ng/L to (377.384±14.620) ng/L (P<0.01). The group of treatment with BAY-117082 alone had no significant difference from the blank control group. P.e-LPS can induce translocation of NF-κB in mouse osteoblast MC3T3-El, and P.e-LPS may induce the expression of IL-6 in mouse osteoblast through the signaling of NF-κB.

  2. Icaritin induces MC3T3-E1 subclone14 cell differentiation through estrogen receptor-mediated ERK1/2 and p38 signaling activation.

    Science.gov (United States)

    Wu, Zhidi; Ou, Ling; Wang, Chaopeng; Yang, Li; Wang, Panpan; Liu, Hengrui; Xiong, Yingquan; Sun, Kehuan; Zhang, Ronghua; Zhu, Xiaofeng

    2017-10-01

    Icaritin (ICT), a hydrolytic product of icariin from the genus Epimedium, has many indicated pharmacological and biological activities. Several studies have shown that ICT has potential osteoprotective effects, including stimulation of osteoblast differentiation and inhibition of osteoclast differentiation. However, the molecular mechanism for this anabolic action of ICT remains largely unknown. Here, we found that ICT could enhance MC3T3-E1 subclone 14 preosteoblastic cell differentiation associated with increased mRNA levels and protein expression of the differentiation markers alkaline phosphatase (ALP), type 1 collagen (COL1), osteocalcin (OC), osteoponin (OPN) and runt-related transcription factor 2 (RUNX2), and improved mineralization, confirmed by bone nodule formation and collagen synthesis. To characterize the underlying mechanisms, we examined the effect of ICT on estrogen receptor (ER) and mitogen-activated protein kinase (MAPK) signaling. ICT treatment induced p38 kinase and extracellular signal-regulated kinase 1/2 (ERK1/2) activation, but it demonstrated at the same time point no effect on activation of c-Jun N-terminal kinase (JNK). ER antagonist ICI182780, p38 antagonist SB203580 and ERK1/2 antagonist PD98059 markedly inhibited the ICT-induced the mRNA expression of ALP, COL1, OC and OPN. ICI182780 attenuated the ICT-induced phosphorylation of p38 and ERK1/2. These observations indicate a potential mechanism of osteogenic effects of ICT involving the ERK1/2 and p38 pathway activation through the ER. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  3. BPM-CUL3 E3 ligase modulates thermotolerance by facilitating negative regulatory domain-mediated degradation of DREB2A in Arabidopsis.

    Science.gov (United States)

    Morimoto, Kyoko; Ohama, Naohiko; Kidokoro, Satoshi; Mizoi, Junya; Takahashi, Fuminori; Todaka, Daisuke; Mogami, Junro; Sato, Hikaru; Qin, Feng; Kim, June-Sik; Fukao, Yoichiro; Fujiwara, Masayuki; Shinozaki, Kazuo; Yamaguchi-Shinozaki, Kazuko

    2017-10-03

    DEHYDRATION-RESPONSIVE ELEMENT BINDING PROTEIN 2A (DREB2A) acts as a key transcription factor in both drought and heat stress tolerance in Arabidopsis and induces the expression of many drought- and heat stress-inducible genes. Although DREB2A expression itself is induced by stress, the posttranslational regulation of DREB2A, including protein stabilization, is required for its transcriptional activity. The deletion of a 30-aa central region of DREB2A known as the negative regulatory domain (NRD) transforms DREB2A into a stable and constitutively active form referred to as DREB2A CA. However, the molecular basis of this stabilization and activation has remained unknown for a decade. Here we identified BTB/POZ AND MATH DOMAIN proteins (BPMs), substrate adaptors of the Cullin3 (CUL3)-based E3 ligase, as DREB2A-interacting proteins. We observed that DREB2A and BPMs interact in the nuclei, and that the NRD of DREB2A is sufficient for its interaction with BPMs. BPM -knockdown plants exhibited increased DREB2A accumulation and induction of DREB2A target genes under heat and drought stress conditions. Genetic analysis indicated that the depletion of BPM expression conferred enhanced thermotolerance via DREB2A stabilization. Thus, the BPM-CUL3 E3 ligase is likely the long-sought factor responsible for NRD-dependent DREB2A degradation. Through the negative regulation of DREB2A stability, BPMs modulate the heat stress response and prevent an adverse effect of excess DREB2A on plant growth. Furthermore, we found the BPM recognition motif in various transcription factors, implying a general contribution of BPM-mediated proteolysis to divergent cellular responses via an accelerated turnover of transcription factors.

  4. Magnetically actuated mechanical stimuli on Fe3O4/mineralized collagen coatings to enhance osteogenic differentiation of the MC3T3-E1 cells.

    Science.gov (United States)

    Zhuang, Junjun; Lin, Suya; Dong, Lingqing; Cheng, Kui; Weng, Wenjian

    2018-04-15

    Mechanical stimuli at the bone-implant interface are considered to activate the mechanotransduction pathway of the cell to improve the initial osseointegration establishment and to guarantee clinical success of the implant. However, control of the mechanical stimuli at the bone-implant interface still remains a challenge. In this study, we have designed a strategy of a magnetically responsive coating on which the mechanical stimuli is controlled because of coating deformation under static magnetic field (SMF). The iron oxide nanoparticle/mineralized collagen (IOP-MC) coatings were electrochemically codeposited on titanium substrates in different quantities of IOPs and distributions; the resulting coatings were verified to possess swelling behavior with flexibility same as that of hydrogel. The relative quantity of IOP to collagen and the IOP distribution in the coatings were demonstrated to play a critical role in mediating cell behavior. The cells present on the outer layer of the distributed IOP-MC (O-IOP-MC) coating with a mass ratio of 0.67 revealed the most distinct osteogenic differentiation activity being promoted, which could be attributed to the maximized mechanical stimuli with exposure to SMF. Furthermore, the enhanced osteogenic differentiation of the stimulated MC3T3-E1 cells originated from magnetically actuated mechanotransduction signaling pathway, embodying the upregulated expression of osteogenic-related and mechanotransduction-related genes. This work therefore provides a promising strategy for implementing mechanical stimuli to activate mechanotransduction on the bone-implant interface and thus to promote osseointegration. The magnetically actuated coating is designed to produce mechanical stimuli to cells for promoting osteogenic differentiation based on the coating deformation. Iron oxide nanoparticles (IOPs) were incorporated into the mineralized collagen coatings (MC) forming the composite coatings (IOP-MC) with spatially distributed IOPs

  5. The corrosion and biological behaviour of titanium alloys in the presence of human lymphoid cells and MC3T3-E1 osteoblasts

    International Nuclear Information System (INIS)

    Zhang Yumei; Zhao Yimin; Chai Feng; Hildebrand, Hartmut F; Hornez, Jean-Christophe; Li, Chang Liang; Traisnel, Michel

    2009-01-01

    Corrosion behaviour of biomedical alloys is generally determined in mineral electrolytes: unbuffered NaCl 0.9% (pH 7.4) or artificial saliva (pH 6.8). The assays with exclusive utilization of these electrolytes are of low relevance for the biological condition, to which the alloys will be exposed once implanted in the human organism. As an approach to the biological situation regarding the interaction of proteins, electrolytes and metals, we added the RPMI cell culture medium containing foetal calf serum as a biological electrolyte (pH 7.0). The analysis of corrosion behaviour was also performed in the presence of human lymphoid cells (CEM). The rest potential (E r ) and the global polarization were determined on cp-Ti, micro-arc oxidized cp-Ti (MAO-Ti), four different Ti-alloys (Ti6Al4V, Ti12Zr, Ti(AlMoZr), Ti(NbTaZr)) and 316L stainless steel. The 316L exhibited an appropriate E r and a good passive current density (I p ), but a high corrosion potential (E c ) and a very low breakdown potential (E b ) in all electrolytes. All Ti-alloys exhibited a much better electrochemical behaviour: better E r and E c and very high E b . No significant differences of the above parameters existed between the Ti-alloys, except for Zr-containing alloys that showed better corrosion behaviour. A remarkable difference, however, was stated with respect to the electrolytes. NaCl 0.9% induced strong variations between the Ti-alloys. More homogeneous results were obtained with artificial saliva and RPMI medium, which induced a favourable E c and an increased I p . The presence of cells further decreased these values. The unbuffered NaCl solution seems to be less appropriate for the analysis of corrosion of metals. Additional in vitro biological assessments with CEM cell suspensions and MC3T3-E1 osteoblasts confirmed the advantages of the Ti(AlMoZr) and Ti(NbTaZr) alloys with an improved cell proliferation and vitality rate.

  6. The corrosion and biological behaviour of titanium alloys in the presence of human lymphoid cells and MC3T3-E1 osteoblasts.

    Science.gov (United States)

    Zhang, Yu Mei; Chai, Feng; Hornez, Jean-Christophe; Li, Chang Liang; Zhao, Yi Min; Traisnel, Michel; Hildebrand, Hartmut F

    2009-02-01

    Corrosion behaviour of biomedical alloys is generally determined in mineral electrolytes: unbuffered NaCl 0.9% (pH 7.4) or artificial saliva (pH 6.8). The assays with exclusive utilization of these electrolytes are of low relevance for the biological condition, to which the alloys will be exposed once implanted in the human organism. As an approach to the biological situation regarding the interaction of proteins, electrolytes and metals, we added the RPMI cell culture medium containing foetal calf serum as a biological electrolyte (pH 7.0). The analysis of corrosion behaviour was also performed in the presence of human lymphoid cells (CEM). The rest potential (Er) and the global polarization were determined on cp-Ti, micro-arc oxidized cp-Ti (MAO-Ti), four different Ti-alloys (Ti6Al4V, Ti12Zr, Ti(AlMoZr), Ti(NbTaZr)) and 316L stainless steel. The 316L exhibited an appropriate Er and a good passive current density (Ip), but a high corrosion potential (Ec) and a very low breakdown potential (Eb) in all electrolytes. All Ti-alloys exhibited a much better electrochemical behaviour: better Er and Ec and very high Eb. No significant differences of the above parameters existed between the Ti-alloys, except for Zr-containing alloys that showed better corrosion behaviour. A remarkable difference, however, was stated with respect to the electrolytes. NaCl 0.9% induced strong variations between the Ti-alloys. More homogeneous results were obtained with artificial saliva and RPMI medium, which induced a favourable Ec and an increased Ip. The presence of cells further decreased these values. The unbuffered NaCl solution seems to be less appropriate for the analysis of corrosion of metals. Additional in vitro biological assessments with CEM cell suspensions and MC3T3-E1 osteoblasts confirmed the advantages of the Ti(AlMoZr) and Ti(NbTaZr) alloys with an improved cell proliferation and vitality rate.

  7. Research on the Sustainable Development of an Economic-Energy-Environment (3E System Based on System Dynamics (SD: A Case Study of the Beijing-Tianjin-Hebei Region in China

    Directory of Open Access Journals (Sweden)

    Yi Zuo

    2017-09-01

    Full Text Available The sustainable development of an economic-energy-environment (3E system has received increasing attention by the government because it both determines national development and individuals’ health at the macro and micro level. In this paper, we synthetically consider various important factors based on analysis of the existing literature and use system dynamics (SD to establish models of sustainable development of a 3E system. The model not only clearly shows the complex logical relationship between the factors but also reveals the process of the 3E system. In addition, the paper provides a case study of the Beijing-Tianjin-Hebei region in China by using a scenario analysis method. The models proposed in this paper can facilitate an understanding of the sustainable development pattern of a 3E coordination system and help to provide references for policy-making institutions. The results show that the long-term development of the Beijing-Tianjin-Hebei region’s 3E system is not sustainable, but it can be changed through the adjustment of the energy structure and an increase in investment in environmental protection, which can improve the environmental quality and ensure continuous growth rather than excessive growth of energy consumption and the gross domestic product (GDP.

  8. Expressão citofotométrica quantitativa da CASPASE-3 e do CD-34 no carcinoma ductal infiltrante de mama

    Directory of Open Access Journals (Sweden)

    Fábio Santana dos Passos

    Full Text Available OBJETIVO: Descrever, correlacionar e comparar a expressão dos marcadores tumorais CD-34 (angiogênese e caspase-3 (apoptose em carcinoma ductal invasor de mama. MÉTODOS: Foram utilizados 22 casos de adenocarcinoma infiltrante de mama provenientes de blocos de parafina e, após preparo específico para imunoistoquímica, 15 apresentaram leitura satisfatória e foram avaliados pelo sistema de fotocitometria de imagem SAMBA 4000® e software IMMUNO®. Os parâmetros analisados foram o índice de marcagem e densidade óptica. RESULTADOS: Para o CD-34 não houve normalidade dos dados na análise do índice de marcagem, com obtenção de P=0,019, havendo normalidade para a análise da densidade óptica, com P=0,199. Para a caspase-3 houve normalidade de dados para o índice marcagem com P=0,306 e para a densidade óptica com P=0,114; não houve diferença estatística significativa entre eles em relação à média do índice de marcagem (P=0,872 e da densidade óptica (P=0,816, quando analisados os parâmetros que definem a expressão dos marcadores; existiu tendência à associação entre a densidade óptica e o índice de marcagem do marcador tumoral caspase-3, com P=0,025. Não foi observada tendência à associação quando comparados densidade óptica e índice de marcagem do marcador tumoral CD-34; índice de marcagem do marcador tumoral caspase-3 e índice de marcagem do marcador tumoral CD-34; e densidade óptica da caspase-3 com a do CD-34. CONCLUSÃO: Dos 22 casos incluídos foi possível verificar a expressão do marcador CD-34 em 18 lâminas e da caspase-3 em 22 lâminas; Para o CD-34 não houve normalidade dos dados na análise do índice de marcagem, havendo sim normalidade para a análise da densidade óptica. Para a caspase-3 houve normalidade de dados tanto para o índice de marcagem como para a densidade óptica. Existe tendência à associação entre a densidade óptica e o índice de marcagem da caspase-3. Não foi observada

  9. Multinational evidence-based recommendations for pain management by pharmacotherapy in inflammatory arthritis: integrating systematic literature research and expert opinion of a broad panel of rheumatologists in the 3e Initiative

    NARCIS (Netherlands)

    Whittle, Samuel L.; Colebatch, Alexandra N.; Buchbinder, Rachelle; Edwards, Christopher J.; Adams, Karen; Englbrecht, Matthias; Hazlewood, Glen; Marks, Jonathan L.; Radner, Helga; Ramiro, Sofia; Richards, Bethan L.; Tarner, Ingo H.; Aletaha, Daniel; Bombardier, Claire; Landewé, Robert B.; Müller-Ladner, Ulf; Bijlsma, Johannes W. J.; Branco, Jaime C.; Bykerk, Vivian P.; da Rocha Castelar Pinheiro, Geraldo; Catrina, Anca I.; Hannonen, Pekka; Kiely, Patrick; Leeb, Burkhard; Lie, Elisabeth; Martinez-Osuna, Píndaro; Montecucco, Carlomaurizio; Ostergaard, Mikkel; Westhovens, Rene; Zochling, Jane; van der Heijde, Désirée

    2012-01-01

    To develop evidence-based recommendations for pain management by pharmacotherapy in patients with inflammatory arthritis (IA). A total of 453 rheumatologists from 17 countries participated in the 2010 3e (Evidence, Expertise, Exchange) Initiative. Using a formal voting process, 89 rheumatologists

  10. Evidence-based recommendations for the management of ankylosing spondylitis: systematic literature search of the 3E Initiative in Rheumatology involving a broad panel of experts and practising rheumatologists

    DEFF Research Database (Denmark)

    Sidiropoulos, P.I.; Hatemi, G.; Song, I.H.

    2008-01-01

    OBJECTIVE: Recommendations and/or guidelines represent a popular way of integrating evidence-based medicine into clinical practice. The 3E Initiatives is a multi-national effort to develop recommendations for the management of rheumatic diseases, which involves a large number of experts combined ...... of rheumatologists may improve their dissemination and implementation in daily clinical practice....

  11. Detection of Genetic Relationship in the Tree of Life of Some Quail Through Molecular Markers Analyses

    Directory of Open Access Journals (Sweden)

    Lamiaa Elsayed Mokhtar Deef

    2017-08-01

    Full Text Available ABSTRACT Quail is an important and interesting group of galliform birds. The Common quail (Coturnix coturnix; the Japanese quail (Coturnix japonica; the Panda quail (Coturnix japonica; the Dotted white quail (Coturnix japonica and the Bobwhite quail (Colinus virginianus were used in this study. PCR-RFLP and SDS-proteins were performed to reveal the genetic characterization and genetic relationship of the studied quails. Analysis of fragments generated by digestion of PCR product with restriction enzyme NlaIII recorded highly polymorphic restriction profiles. There is a wide intraspecific COI, SEMA3E and TLX genes variability among the studied quails. Protein bands varied from10 to 18 between quails with minimum number of bands were in the Dotted white quail (10 bands and the maximum were in the Japanese quail (18 bands as measured by SDS-polyacrylamide gel electrophoresis. The Dotted white quail revealed the lowest similarity to the Bobwhite with a coefficient of 0.18 while The similarity coefficients between the Common quail and each one of the other quails were 0.67, 0.62, 0.45 and 0.42 for the Japanese, Panda, Dotted white and the Bobwhite quails, respectively. The results indicate that, PCR-RFLP and protein analyses are good techniques to evaluate genetic characterization and genetic relationship of these quails.

  12. The Natural Flavonoid Fisetin Inhibits Cellular Proliferation of Hepatic, Colorectal, and Pancreatic Cancer Cells through Modulation of Multiple Signaling Pathways.

    Science.gov (United States)

    Youns, Mаhmoud; Abdel Halim Hegazy, Wael

    2017-01-01

    Digestive cancers are major causes of mortality and morbidity worldwide. Fisetin, a naturally occurring flavonoid, has been previously shown anti-proliferative, anti-cancer, neuroprotective, and antioxidant activities. In our study, the anti-tumor activities in addition to regulatory effects of fisetin on some cancer cell lines were investigated. Data presented here showed that fisetin induces growth inhibition, and apoptosis in hepatic (HepG-2), colorectal (Caco-2) and pancreatic (Suit-2) cancer cell lines. Gene expression results showed that 1307 genes were significantly regulated in their expression in hepatic and pancreatic cell lines. 350 genes were commonly up-regulated and 353 genes were commonly down-regulated. Additionally, 604 genes were oppositely expressed in both tumor cells. CDK5 signaling, NRF2-mediated oxidative stress response, glucocorticoid signaling, and ERK/MAPK signaling were among most prominent signaling pathways modulating the growth inhibitory effects of fisetin on hepatic and pancreatic cancer cells. The present analysis showed, for the first time, that the anti-tumor effect of fisetin was mediated mainly through modulation of multiple signaling pathways and via activation of CDKN1A, SEMA3E, GADD45B and GADD45A and down-regulation of TOP2A, KIF20A, CCNB2 and CCNB1 genes.

  13. The Natural Flavonoid Fisetin Inhibits Cellular Proliferation of Hepatic, Colorectal, and Pancreatic Cancer Cells through Modulation of Multiple Signaling Pathways.

    Directory of Open Access Journals (Sweden)

    Mаhmoud Youns

    Full Text Available Digestive cancers are major causes of mortality and morbidity worldwide. Fisetin, a naturally occurring flavonoid, has been previously shown anti-proliferative, anti-cancer, neuroprotective, and antioxidant activities. In our study, the anti-tumor activities in addition to regulatory effects of fisetin on some cancer cell lines were investigated. Data presented here showed that fisetin induces growth inhibition, and apoptosis in hepatic (HepG-2, colorectal (Caco-2 and pancreatic (Suit-2 cancer cell lines. Gene expression results showed that 1307 genes were significantly regulated in their expression in hepatic and pancreatic cell lines. 350 genes were commonly up-regulated and 353 genes were commonly down-regulated. Additionally, 604 genes were oppositely expressed in both tumor cells. CDK5 signaling, NRF2-mediated oxidative stress response, glucocorticoid signaling, and ERK/MAPK signaling were among most prominent signaling pathways modulating the growth inhibitory effects of fisetin on hepatic and pancreatic cancer cells. The present analysis showed, for the first time, that the anti-tumor effect of fisetin was mediated mainly through modulation of multiple signaling pathways and via activation of CDKN1A, SEMA3E, GADD45B and GADD45A and down-regulation of TOP2A, KIF20A, CCNB2 and CCNB1 genes.

  14. The Natural Flavonoid Fisetin Inhibits Cellular Proliferation of Hepatic, Colorectal, and Pancreatic Cancer Cells through Modulation of Multiple Signaling Pathways

    Science.gov (United States)

    Youns, Mаhmoud; Abdel Halim Hegazy, Wael

    2017-01-01

    Digestive cancers are major causes of mortality and morbidity worldwide. Fisetin, a naturally occurring flavonoid, has been previously shown anti-proliferative, anti-cancer, neuroprotective, and antioxidant activities. In our study, the anti-tumor activities in addition to regulatory effects of fisetin on some cancer cell lines were investigated. Data presented here showed that fisetin induces growth inhibition, and apoptosis in hepatic (HepG-2), colorectal (Caco-2) and pancreatic (Suit-2) cancer cell lines. Gene expression results showed that 1307 genes were significantly regulated in their expression in hepatic and pancreatic cell lines. 350 genes were commonly up-regulated and 353 genes were commonly down-regulated. Additionally, 604 genes were oppositely expressed in both tumor cells. CDK5 signaling, NRF2-mediated oxidative stress response, glucocorticoid signaling, and ERK/MAPK signaling were among most prominent signaling pathways modulating the growth inhibitory effects of fisetin on hepatic and pancreatic cancer cells. The present analysis showed, for the first time, that the anti-tumor effect of fisetin was mediated mainly through modulation of multiple signaling pathways and via activation of CDKN1A, SEMA3E, GADD45B and GADD45A and down-regulation of TOP2A, KIF20A, CCNB2 and CCNB1 genes. PMID:28052097

  15. Molecular docking studies of (1E,3E,5E)-1,6-Bis(substituted phenyl)hexa-1,3,5-triene and 1,4-Bis(substituted trans-styryl)benzene analogs as novel tyrosinase inhibitors.

    Science.gov (United States)

    Ha, Young Mi; Lee, Hye Jin; Park, Daeui; Jeong, Hyoung Oh; Park, Ji Young; Park, Yun Jung; Lee, Kyung Jin; Lee, Ji Yeon; Moon, Hyung Ryong; Chung, Hae Young

    2013-01-01

    We simulated the docking of the tertiary structure of mushroom tyrosinase with our compounds. From the structure-tyrosinase inhibitory activity relationship, it is notable that compounds 4, 8 and 11 showed similar or better activity rates than kojic acid which was used as a positive control. Compounds 17, 21, and 23 among benzene analogs that possess the same substituent showed significantly lower tyrosinase inhibitory effects. Therefore, we have confirmed that among the compounds showing better tyrosinase inhibitory effects than kojic acid, the compounds with triene analogs have better tyrosinase inhibitory effect than the compounds with benzene analogs. Docking simulation suggested the mechanism of compounds by several key residues which had possible hydrogen bonding interactions. The pharmacophore model underlined the features of active compounds, 4,4'-((1E,3E,5E)-hexa-1,3,5-triene-1,6-diyl)diphenol, 5,5'-((1E,3E,5E)-hexa-1,3,5-triene-1,6-diyl)bis(2-methoxy-phenol), and 5,5'-((1E,3E,5E)-hexa-1,3,5-triene-1,6-diyl)dibenzene-1,3-diol among triene derivatives which had several hydrogen bond groups on both terminal rings. The soundness of the docking results and the agreement with the pharmacophores suggest that it can be conveniently exploited to design inhibitors with an improved affinity for tyrosinase.

  16. Mechanotransductive Regulation of Gap-Junction Activity Between MLO-Y4 Osteocyte-Like and MC3T3-E1 Osteoblast-Like Cells in Three-Dimensional Co-Culture.

    Science.gov (United States)

    Juran, C. M.; Blaber, E. A.; Almeida, E. A. C.

    2016-01-01

    Cell and animal studies conducted onboard the International Space Station and formerly on Shuttle flights have provided groundbreaking data illuminating the deleterious biological response of bone to mechanical unloading. However the intercellular communicative mechanisms associated with the regulation of bone synthesis and bone resorption cells are still largely unknown. Connexin-43 (CX43), a gap junction protein, is hypothesized to play a significant role in osteoblast and osteocyte signaling. The purpose of this investigation was to evaluate within a novel three-dimensional microenvironment how the osteocyte-osteoblast gap-junction expression changes when cultures are exposed to exaggerated mechanical load. MLO-Y4 osteocyte-like cells were cultured on a 3D-Biotek polystyrene insert and placed in direct contact with an MC3T3-E1 pre-osteoblast co-cultured monolayer and exposed to 48 h of mechanical stimulation (pulsatile fluid flow (PFF) or monolayer cyclic stretch (MCS)) then evaluated for viability, proliferation, metabolism, and CX43 expression. Mono-cultured MLO-Y4 and MC3T3-E1 control experiments were conducted under PFF and MCS stimulation to observe how strain application stimuli (PFF cell membrane shear or MCS cell focal adhesion/attachment loading) initiates different signaling pathways or downstream regulatory controls. TotalLive cell count, viability and metabolic reduction (Trypan Blue, LIVEDead and Alamar Blue analysis respectively) indicate that mechanical activation of MC3T3-E1 cells inhibits proliferation while maintaining an average 1.04E4 reductioncell metabolic rate, *p0.05 n4. MLO-Y4s in monolayer culture increase in number when exposed to MCS loading but the percent of live cells within the population is low (46.3 total count, *p0.05 n4), these results may indicate an apoptotic signaling cascade. PFF stimulation of the three-dimensional co-cultures elicits a universal increase in CX43 in MLO-Y4 and MC3T3-E1 cells, illustrated by

  17. CSN1S2 protein of goat milk inhibits the decrease of viability and increases the proliferation of MC3T3E1 pre-osteoblast cell in methyl glyoxal exposure

    Directory of Open Access Journals (Sweden)

    Choirunil Chotimah

    2015-03-01

    Full Text Available Objective: To investigate whether the CNS1S2 protein of goat milk is able to inhibit the toxicity of methyl glyoxal (MG towards MC3T3E1 pre-osteoblast cells. Methods: At confluency, pre-osteoblast cells were divided into five groups which included control (untreated, pre-osteoblast cells exposed to 5 µmol/L MG, pre-osteoblast cells exposed to MG in the presence of CSN1S2 protein at doses of 0.025, 0.050, and 0.100 mg/L, respectively. Analysis of reactive oxygen species was done with 2,7-dichlorodihydrofluorescein diacetate fluorochrome. The proliferation and viability of MC3T3E1 cells were measured by trypan blue staining. Malondialdehyde analysis was done colorimetrically. Results: Cell's viabilities were significantly lower in MG+0.050 mg/L CSN1S2 protein of goat milk compared to MG group (P<0.05. MG+0.100 mg/L CSN1S2 protein of goat milk significantly increased the cells viability compared to MG group (P<0.05. The levels of proliferation were significantly higher in MG+0.100 mg/L CSN1S2 protein of goat milk compared to control group and all treatment groups, respectively (P<0.05. Conclusions: High dose of CSN1S2 protein of goat milk (0.100 mg/L in high MG environment inhibits the decrease of viability due to the increases of the proliferation of MC3T3E1 preosteoblast cell.

  18. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Li, Q S; Meng, F Y; Zhao, Y H; Jin, C L; Tian, J; Yi, X J

    2017-08-01

    This study aimed to investigate the functional effects of microRNA (miR)-214-5p on osteoblastic cells, which might provide a potential role of miR-214-5p in bone fracture healing. Blood samples were obtained from patients with hand fracture or intra-articular calcaneal fracture and from healthy controls (HCs). Expression of miR-214-5p was monitored by qRT-PCR at day 7, 14 and 21 post-surgery. Mouse osteoblastic MC3T3-E1 cells were transfected with antisense oligonucleotides (ASO)-miR-214-5p, collagen type IV alpha 1 (COL4A1) vector or their controls; thereafter, cell viability, apoptotic rate, and the expression of collagen type I alpha 1 (COL1A1), type II collagen (COL-II), and type X collagen (COL-X) were determined. Luciferase reporter assay, qRT-PCR, and Western blot were performed to ascertain whether COL4A1 was a target of miR-214-5p. Plasma miR-214-5p was highly expressed in patients with bone fracture compared with HCs after fracture (p extracellular matrix (ECM) formation of osteoblastic MC3T3-E1 cells by targeting COL4A1. Cite this article: Q. S. Li, F. Y. Meng, Y. H. Zhao, C. L. Jin, J. Tian, X. J. Yi. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells. Bone Joint Res 2017;6:464-471. DOI: 10.1302/2046-3758.68.BJR-2016-0208.R2. © 2017 Yi et al.

  19. Effects of 2-deoxy-D-glucose and quercetin on the expression of osteonectin and osteopontin during the differentiation of irradiated MC3T3-E1 osteoblastic cells

    International Nuclear Information System (INIS)

    Yu, Su Kyung; Koh, Kwang Joon; Kim, Kyoung A

    2008-01-01

    To characterize the effects of 2-deoxy-D-glucose (2-DG) and quercetin (QCT) on gene expression of osteonectin (ON) and osteopontin (OP) in irradiated MC3T3-E1 cells. When MC3T3-E1 osteoblastic cells had reached 70-80% confluence, cultures were transferred to a differentiating medium supplemented with 5 mM 2-DG or 10 μM QCT and then irradiated with 2, 4, 6, and 8 Gy. At various times after irradiation, the cells were analyzed for the expression of bone mineralization genes such as ON and OP. The mRNA expression of both ON and OP was increased according to the culture time in the differentiation medium, and the increase of the genes peaked at 14 days after the differentiation induction. In the case of OP, the increase of mRNA expression was maintained to 28 days after the differentiation, while the mRNA level of ON was reduced to the basal level at the same time. Irradiation adding 2-DG showed a significant peak value in the expression pattern of ON at 4 Gy 7 days after irradiation. Irradiation adding QCT increased the mRNA expression of ON and OP in a dose-dependant manner, but irradiation adding 2-DG did not show any differences between the control and experiments 14 days after irradiation. Irradiation adding QCT increased significantly the expression patterns of ON 21 days after irradiation. The results showed that QCT acted as a radiosensitizer in the gene expression of ON and OP during differentiation of the late stage of irradiated MC3T3-E1 osteoblastic cells in vitro.

  20. 3-[(E-(4-Chlorobenzylideneamino]-1-phenylthiourea

    Directory of Open Access Journals (Sweden)

    Nur Nadia Dzulkifli

    2011-04-01

    Full Text Available In the title compound, C14H12ClN3S, the dihedral angle between the terminal benzene rings is 56.6 (2°; the benzene rings lie to the same side of the molecule. The major twist in the molecule occurs around the Car—N bond (ar is aromatic [C—N—C—C = 49.9 (5°]. The configuration about the N=C bond [1.271 (4 Å] is E. The amine H atoms lie on opposite sides of the molecule with one forming an intramolecular N—H...N(imine hydrogen bond and an S(5 ring. In the crystal, centrosymmetric dimers are formed via {...HNC=S}2 synthons.

  1. Oscillatory fluid flow elicits changes in morphology, cytoskeleton and integrin-associated molecules in MLO-Y4 cells, but not in MC3T3-E1 cells

    Directory of Open Access Journals (Sweden)

    Huiyun Xu

    2012-01-01

    Full Text Available Interstitial fluid flow stress is one of the most important mechanical stimulations of bone cells under physiological conditions. Osteocytes and osteoblasts act as primary mechanosensors within bones, and in vitro are able to respond to fluid shear stress, both morphologically and functionally. However, there is little information about the response of integrin-associated molecules using both osteoblasts and osteocytes. In this study, we investigated the changes in response to 2 hours of oscillatory fluid flow stress in the MLO-Y4 osteocyte-like cell line and the MC3T3-E1 osteoblast-like cell line. MLO-Y4 cells exhibited a significant increase in the expression of integrin-associated molecules, including OPN, CD44, vinculin and integrin avp3. However, there was no or limited increase observed in MC3T3-E1 osteoblast-like cells. Cell area and fiber stress formation were also markedly promoted by fluid flow only in MLO-Y4 cells. But the numbers of processes per cell remain unaffected in both cell lines.

  2. Italian consensus on the recommendations about the use of methotrexate for the treatment of rheumatic diseases with a focus on rheumatoid arthritis: results from the “3E initiative”

    Directory of Open Access Journals (Sweden)

    C. Montecucco

    2011-06-01

    Full Text Available Objective: To develop a set of national evidence-based recommendations for the use of Methotrexate (MTX in daily clinical practice. Methods: A panel of 37 Italian Rheumatologists reviewed 10 international recommendations formulated during the “3E (Evidence, Expertise, Exchange initiative” for the year 2007-8, following a systematic literature search in Medline, Embase, Cochrane Library, and 2005-7 American College of Rheumatology/European League Against Rheumatism meeting abstracts and the revision of selected papers and the appraisal of Oxford levels of evidence. Moreover, the same panel by the same methodology formulated further 5 recommendations on topics previously selected by Italian representatives to 3E initiative. The agreement about the set of proposed recommendations was stated by a consensus process and the potential impact on clinical practice was assessed. Results: International Recommendations were analysed and changed when appropriate. In addition, 5 national recommendations were developed by identifying 6371 references, selecting and evaluating the 29 ones satisfying Evidence Based Medicine principles. Conclusions: A set of 15 national recommendations for the use of MTX in daily clinical practice was developed. These recommendations are evidence-based and integrate the expertise of a large panel of Italian rheumatologists.

  3. Bone morphogenetic protein-2 (BMP-2 and transforming growth factor-β1 (TGF-β1 alter connexin 43 phosphorylation in MC3T3-E1 Cells

    Directory of Open Access Journals (Sweden)

    Rudkin George H

    2001-07-01

    Full Text Available Abstract Background Bone morphogenetic proteins (BMPs and transforming growth factor-βs (TGF-βs are important regulators of bone repair and regeneration. BMP-2 and TGF-β1 have been shown to inhibit gap junctional intercellular communication (GJIC in MC3T3-E1 cells. Connexin 43 (Cx43 has been shown to mediate GJIC in osteoblasts and it is the predominant gap junctional protein expressed in these murine osteoblast-like cells. We examined the expression, phosphorylation, and subcellular localization of Cx43 after treatment with BMP-2 or TGF-β1 to investigate a possible mechanism for the inhibition of GJIC. Results Northern blot analysis revealed no detectable change in the expression of Cx43 mRNA. Western blot analysis demonstrated no significant change in the expression of total Cx43 protein. However, significantly higher ratios of unphosphorylated vs. phosphorylated forms of Cx43 were detected after BMP-2 or TGF-β1 treatment. Immunofluorescence and cell protein fractionation revealed no detectable change in the localization of Cx43 between the cytosol and plasma membrane. Conclusions BMP-2 and TGF-β1 do not alter expression of Cx43 at the mRNA or protein level. BMP-2 and TGF-β1 may inhibit GJIC by decreasing the phosphorylated form of Cx43 in MC3T3-E1 cells.

  4. PRELP (proline/arginine-rich end leucine-rich repeat protein) promotes osteoblastic differentiation of preosteoblastic MC3T3-E1 cells by regulating the β-catenin pathway

    Energy Technology Data Exchange (ETDEWEB)

    Li, Haiying; Cui, Yazhou; Luan, Jing [School of Medicine and Life Sciences, University of Jinan-Shandong Academy of Medical Science, Ji' nan, Shandong (China); Key Laboratory for Rare Disease Research of Shandong Province, Key Laboratory for Biotech Drugs of the Ministry of Health, Shandong Medical Biotechnological Center, Shandong Academy of Medical Sciences, Ji' nan, Shandong (China); Zhang, Xiumei [School of Medicine and Life Sciences, University of Jinan-Shandong Academy of Medical Science, Ji' nan, Shandong (China); Li, Chengzhi; Zhou, Xiaoyan; Shi, Liang [School of Medicine and Life Sciences, University of Jinan-Shandong Academy of Medical Science, Ji' nan, Shandong (China); Key Laboratory for Rare Disease Research of Shandong Province, Key Laboratory for Biotech Drugs of the Ministry of Health, Shandong Medical Biotechnological Center, Shandong Academy of Medical Sciences, Ji' nan, Shandong (China); Wang, Huaxin [Shandong University of Traditional Chinese Medicine, Ji' an, Shandong (China); Han, Jinxiang, E-mail: jxhan9888@aliyun.com [School of Medicine and Life Sciences, University of Jinan-Shandong Academy of Medical Science, Ji' nan, Shandong (China); Key Laboratory for Rare Disease Research of Shandong Province, Key Laboratory for Biotech Drugs of the Ministry of Health, Shandong Medical Biotechnological Center, Shandong Academy of Medical Sciences, Ji' nan, Shandong (China)

    2016-02-12

    Proline/arginine-rich end leucine-rich repeat protein (PRELP) is a collagen-binding proteoglycan highly expressed in the developing bones. Recent studies indicated that PRELP could inhibit osteoclastogenesis as a NF-κB inhibitor. However, its role during osteoblast differentiation is still unclear. In this study, we confirmed that the expression of PRELP increased with the osteogenesis induction of preosteoblastic MC3T3-E1 cells. Down-regulation of PRELP expression by shRNA reduced ALP activity, mineralization and expression of osteogenic marker gene Runx2. Our microarray analysis data suggested that β-catenin may act as a hub gene in the PRELP-mediated gene network. We validated furtherly that PRELP knockdown could inhibit the level of connexin43, a key regulator of osteoblast differentiation by affecting β-catenin protein expression, and its nuclear translocation in MC3T3-E1 preosteoblasts. Therefore, this study established a new role of PRELP in modulating β-catenin/connexin43 pathway and osteoblast differentiation.

  5. Ghrelin protects against depleted uranium-induced apoptosis of MC3T3-E1 cells through oxidative stress-mediated p38-mitogen-activated protein kinase pathway

    Energy Technology Data Exchange (ETDEWEB)

    Hao, Yuhui; Liu, Cong; Huang, Jiawei; Gu, Ying; Li, Hong; Yang, Zhangyou; Liu, Jing [State Key Laboratory of Trauma, Burns and Combined Injury, Institute of Combined Injury, Chongqing Engineering Research Center for Nanomedicine, College of Preventive Medicine, Third Military Medical University, No. 30 Gaotanyan Street, Shapingba District, Chongqing 400038 (China); Wang, Weidong, E-mail: wwdwyl@sina.com [Department of Radiation Oncology, Shanghai Jiao Tong University Affiliated Sixth People Hospital, Shanghai 200233 (China); Li, Rong, E-mail: yuhui_hao@126.com [State Key Laboratory of Trauma, Burns and Combined Injury, Institute of Combined Injury, Chongqing Engineering Research Center for Nanomedicine, College of Preventive Medicine, Third Military Medical University, No. 30 Gaotanyan Street, Shapingba District, Chongqing 400038 (China)

    2016-01-01

    Depleted uranium (DU) mainly accumulates in the bone over the long term. Osteoblast cells are responsible for the formation of bone, and they are sensitive to DU damage. However, studies investigating methods of reducing DU damage in osteoblasts are rarely reported. Ghrelin is a stomach hormone that stimulates growth hormones released from the hypothalamic–pituitary axis, and it is believed to play an important physiological role in bone metabolism. This study evaluates the impact of ghrelin on DU-induced apoptosis of the osteoblast MC3T3-E1 and investigates its underlying mechanisms. The results show that ghrelin relieved the intracellular oxidative stress induced by DU, eliminated reactive oxygen species (ROS) and reduced lipid peroxidation by increasing intracellular GSH levels; in addition, ghrelin effectively suppressed apoptosis, enhanced mitochondrial membrane potential, and inhibited cytochrome c release and caspase-3 activation after DU exposure. Moreover, ghrelin significantly reduced the expression of DU-induced phosphorylated p38-mitogen-activated protein kinase (MAPK). A specific inhibitor (SB203580) or specific siRNA of p38-MAPK could significantly suppress DU-induced apoptosis and related signals, whereas ROS production was not affected. In addition, ghrelin receptor inhibition could reduce the anti-apoptosis effect of ghrelin on DU and reverse the effect of ghrelin on intracellular ROS and p38-MAPK after DU exposure. These results suggest that ghrelin can suppress DU-induced apoptosis of MC3T3-E1 cells, reduce DU-induced oxidative stress by interacting with its receptor, and inhibit downstream p38-MAPK activation, thereby suppressing the mitochondrial-dependent apoptosis pathway. - Highlights: • Ghrelin suppressed DU-induced apoptosis of MC3T3-E1 cells. • Ghrelin inhibited DU-induced oxidative stress and further p38-MAPK activation. • Ghrelin further suppressed mitochondrial-dependent apoptosis pathway. • The anti-oxidation effect of

  6. Síntese de BaTIO3 e SrTIO3 pelo método hidrotermal assistido por micro-ondas utilizando anatase como precursor de titânio

    Directory of Open Access Journals (Sweden)

    Renata S. Magalhães

    Full Text Available In this work barium titanate (BT and strontium titanate (ST were prepared by Microwave-Assisted Hydrothermal (MAH method, using a Ti precursor different from those shown in the literature and various concentrations (1, 3 e 6 mol L-1 of KOH mineralizer. As a titanium precursor, an anatase complex with hydrogen peroxide were used. For the precursors of barium and strontium, chlorides were used. The materials resulting from the synthesis processes were characterized in room temperature by different techniques as like: X-Ray Diffraction (XRD, micro-Raman Spectroscopy, UV-Vis, Scanning Electron Microscopy (SEM and Photoluminescence (PL. The results show that there were differences in crystallinity, morphology, number of phases and photoluminescence depending on the concentration of the mineralizer.

  7. In vitro growth of Brassocattleya orchid hybrid in different concentrations of KNO3, NH4NO3 and benzylaminopurine Cultivo in vitro de Brassocattleya (Orchidaceae em diferentes concentrações de KNO3, NH4NO3 e benzilaminopurina

    Directory of Open Access Journals (Sweden)

    Jean C Cardoso

    2011-09-01

    Full Text Available One of the most important applications of plant tissue culture is mass propagation of ornamental plants. This experiment evaluated the effect of different concentrations of NH4NO3 and KNO3 and BAP on the in vitro growth of orchid hybrid Brassocattleya 'Pastoral'. Seedlings of this orchid hybrid were used as explants and cultivated in medium with mineral salts and vitamins from the MS medium (Murashige & Skoog, 1962, with the macronutrients P, Ca and Mg reduced by half, and with an addition of 25 g L-1 of sucrose, 0.1 g L-1 of myo-inositol and 1.5 g L-1 of activated charcoal. Agar-agar was added (6.5 g L-1 and the pH was adjusted to 5.8. As treatments, four concentrations of the NH4NO3 and KNO3 (2x; 1x; ½ and ¼ MS medium and three concentrations of BAP (0.0; 0.5 and 1.0 mg L-1 were assayed. The multiplication, growth in height, fresh and dry weight and sugar level in dry weight of sprouts were evaluated. There occurred a higher growth in height with 0.25x NH4NO3 and KNO3 salts concentrations of MS medium and higher rate of multiplication with combination of NH4NO3 and KNO3 reduced by half of the MS medium concentration and 1.0 mg L-1 BAP.Entre as maiores aplicações da cultura de tecidos de plantas está a propagação massal de mudas de plantas ornamentais. O objetivo deste trabalho foi avaliar o cultivo in vitro de um híbrido de orquídea Brassocattleya em diferentes concentrações de NH4NO3, KNO3 e BAP. Foram utilizadas sementes do híbrido de orquídea Brassocattleya 'Pastoral' e as plantas foram cultivadas em meio MS com redução pela metade das fontes de P, Mg e Ca e adição de 25 g L-1 de sacarose, 100 mg L-1 de mio-inositol, 1,5 g L-1 de carvão ativo e 6,5 g L-1 de ágar-ágar, sendo o pH ajustado para 5,8. Como tratamentos foram usados quatro concentrações dos sais NH4NO3 e KNO3 (2x; 1x; ½ e ¼ do meio MS e três concentrações de BAP (0,0; 0,5 e 1,0 mg L-1. Avaliou-se a multiplicação, o crescimento em altura, massa fresca

  8. Attosecond sublevel beating and nonlinear dressing on the 3d-to-5p and 3p-to-5s core-transitions at 91.3 eV and 210.4 eV in krypton.

    Science.gov (United States)

    Seres, Enikoe; Seres, Jozsef; Namba, Shinichi; Afa, John; Serrat, Carles

    2017-12-11

    Applying extreme ultraviolet (XUV) transient absorption spectroscopy, the dynamics of the two laser dressed transitions 3d 5/2 -to-5p 3/2 and 3p 3/2 -to-5s 1/2 at photon energies of 91.3 eV and 210.4 eV were examined with attosecond temporal resolution. The dressing process was modeled with density matrix equations which are found to describe very accurately both the experimentally observed transmission dynamics and the linear and nonlinear dressing oscillations at 0.75 PHz and 1.5 PHz frequencies. Furthermore, using Fourier transform XUV spectroscopy, quantum beats from the 3d 5/2 -3d 3/2 and 3p 3/2 -3p 1/2 sublevels at 0.3 PHz and 2.0 PHz were experimentally identified and resolved.

  9. Complete-active-space second-order perturbation theory (CASPT2//CASSCF) study of the dissociative electron attachment in canonical DNA nucleobases caused by low-energy electrons (0-3 eV)

    Energy Technology Data Exchange (ETDEWEB)

    Francés-Monerris, Antonio; Segarra-Martí, Javier; Merchán, Manuela; Roca-Sanjuán, Daniel, E-mail: Daniel.Roca@uv.es [Instituto de Ciencia Molecular, Universitat de València, P.O. Box 22085, 46071 València (Spain)

    2015-12-07

    Low-energy (0-3 eV) ballistic electrons originated during the irradiation of biological material can interact with DNA/RNA nucleobases yielding transient-anion species which undergo decompositions. Since the discovery that these reactions can eventually lead to strand breaking of the DNA chains, great efforts have been dedicated to their study. The main fragmentation at the 0-3 eV energy range is the ejection of a hydrogen atom from the specific nitrogen positions. In the present study, the methodological approach introduced in a previous work on uracil [I. González-Ramírez et al., J. Chem. Theory Comput. 8, 2769-2776 (2012)] is employed to study the DNA canonical nucleobases fragmentations of N–H bonds induced by low-energy electrons. The approach is based on minimum energy path and linear interpolation of internal coordinates computations along the N–H dissociation channels carried out at the complete-active-space self-consistent field//complete-active-space second-order perturbation theory level. On the basis of the calculated theoretical quantities, new assignations for the adenine and cytosine anion yield curves are provided. In addition, the π{sub 1}{sup −} and π{sub 2}{sup −} states of the pyrimidine nucleobases are expected to produce the temporary anions at electron energies close to 1 and 2 eV, respectively. Finally, the present theoretical results do not allow to discard neither the dipole-bound nor the valence-bound mechanisms in the range of energies explored, suggesting that both possibilities may coexist in the experiments carried out with the isolated nucleobases.

  10. Improved synthesis of (3E,6Z,9Z)-1,3,6,9-nonadecatetraene, attraction inhibitor of bruce spanworm, Operophtera bruceata, to pheromone traps for monitoring winter moth, Operophtera brumata.

    Science.gov (United States)

    Khrimian, Ashot; Lance, David R; Mastro, Victor C; Elkinton, Joseph S

    2010-02-10

    The winter moth, Operophtera brumata (Lepidoptera: Geometridae), is an early-season defoliator that attacks a wide variety of hardwoods and, in some cases, conifers. The insect is native to Europe but has become established in at least three areas of North America including southeastern New England. The female-produced sex attractant pheromone of the winter moth was identified as (3Z,6Z,9Z)-1,3,6,9-nonadecatetraene (1), which also attracts a native congener, the Bruce spanworm, Operophtera bruceata . Dissection, or (for certainty) DNA molecular testing, is required to differentiate between males of the two species. Thus, a trapping method that is selective for winter moth would be desirable. A geometric isomer of the pheromone, (3E,6Z,9Z)-1,3,6,9-nonadecatetraene (2), can reportedly inhibit attraction of Bruce spanworm to traps without affecting winter moth catch, but use of the pheromone and inhibitor together has not been optimized, nor has the synthesis of the inhibitor. This paper presents two new syntheses of the inhibitor (3E,6Z,9Z)-1,3,6,9-nonadecatetraene based on the intermediate (3Z,6Z)-3,6-hexadecadien-1-ol (4), which has also been utilized in the synthesis of the pheromone. The syntheses combine traditional acetylenic chemistry and Wittig olefination reactions. In one approach, 2 was synthesized in 80% purity (20% being pheromone 1), and in the second, tetraene 2 of 96% purity (and free of 1) was produced in 25% overall yield from dienol 4. The last method benefitted from a refined TEMPO-mediated PhI(OAc)(2) oxidation of 4 and a two-carbon homologation of the corresponding aldehyde 7.

  11. Utilização da vitamina D3 e seus metabólitos na alimentação de frangos de corte sobre parâmetros imunológicos e morfometria intestinal

    Directory of Open Access Journals (Sweden)

    Ana Flávia Q. Garcia Guerra

    2014-05-01

    Full Text Available Os efeitos da suplementação da vitamina D3 e de seus diferentes metabólitos foram avaliados na resposta imune e na morfometria intestinal de frangos de corte. Foram utilizados 952 frangos de corte de um dia de idade, distribuídos em um delineamento inteiramente casualizado, com quatro tratamentos, sete repetições e 34 aves por unidade experimental. Os tratamentos foram constituídos por quatros diferentes fontes de vitamina D3: colecalciferol (D3, 25-hidroxicolecalciferol (25(OHD3, 1,25-dihidroxicolecalciferol (1,25(OH2D3 e 1α-hidroxicolecalciferol (1α(OHD3. As diferentes fontes foram incluídas na dieta, fornecendo 2000 e 1600 UI de vitamina D, nas fases pré-inicial, inicial e de crescimento, respectivamente. O peso relativo do intestino delgado diferiu entre os tratamentos aos 7, 21 e 42 dias e o peso relativo do fígado somente aos 42 dias de idade. Os demais órgãos e parâmetros imunológicos avaliados (peso dos órgãos linfóides, reação de hipersensibilidade cutânea basofílica, avaliação da atividade de macrófagos, dosagem de nitrito e perfil heterofilo: linfócito foram similares entre os animais alimentados com os diferentes metabólitos. Houve efeito (P0,05 dos tratamentos. Os parâmetros imunológicos não foram afetados pelos diferentes metabólitos de vitamina D. Os diferentes metabólitos de vitamina D afetaram positivamente a morfometria intestinal na altura de vilo na fase inicial, sendo os melhores resultados obtido pelos animais alimentados com 1,25(OH2D3, contudo os parâmetros imunológicos foram similares entre os metabólitos estudados.

  12. GA3 e Paclobutrazol no florescimento e na produção de frutos em duas cultivares de morangueiro GA3 and Paclobutrazol on the flowering and yield of strawberry

    Directory of Open Access Journals (Sweden)

    Jaime Duarte Filho

    2004-06-01

    Full Text Available Neste trabalho estudou-se o efeito dos fitorreguladores Ga3 e Paclobutrazol no florescimento e produção de frutos de morangueiro (Fragaria x ananassa Duch.. O experimento foi conduzido em Caldas (MG, na EPAMIG. O delineamento experimental adotado foi o de blocos casualizados, com quatro repetições, num esquema fatorial 2x4, onde as variáveis dependentes foram duas cultivares ('Oso Grande' e 'Seascape' e os tratamentos controle (água; GA3 a 40 mg L-1 em duas aplicações (aos 45 e 65 dias após o transplante; paclobutrazol (produto comercial Cultar 10% a 100 mg L-1 aos 75 dias após o transplante das mudas; combinação de GA3 + paclobutrazol aplicados aos 45; 65 e aos 75 dias, respectivamente, após o transplante. Os tratamentos foram aplicados via foliar em ambas as cultivares. A resposta à aplicação dos fitorreguladores GA3 e paclobutrazol em morangueiro depende da cultivar. A cv. Seascape, de dia neutro, respondeu melhor à aplicação de GA3 que a 'Oso Grande', de dia curto; Por outro lado, o paclobutrazol, quando aplicado via foliar, aos 75 dias após o transplante, reduziu o florescimento do morangueiro o que mostra a necessidade de mais pesquisas sobre dosagens e épocas de aplicação do paclobutrazol nesta cultura.The effect of bioregulators GA3 and paclobutrazol was evaluated on flowering and yield of strawberry cultivars Oso Grande and Seascape. The experiment was carried out in Caldas, Minas Gerais State, Brazil. The treatments consisted of control (no application of bioregulators; GA3 at 40 mg L-1, in two applications (45 and 65 days after transplanting date; paclobutrazol (commercial product Cultar, 10% at 100 mg L-1, 75 days after transplanting date; combination of GA3 + paclobutrazol, applied 45; 65 and 75 days, respectively, after transplanting date. The experimental design was a randomized complete block, with four replications, in a factorial 2x4. The response to the bioregulators GA3 and Paclobutrazol was cultivar

  13. Synthesis, structural studies and antimicrobial activity of N'-((2Z, 3E)-3-(hydroxyimino)butan-2-ylidene)-2-phenylacetohydrazide and its Co(II), Ni(II) complexes

    Science.gov (United States)

    Karadeniz, Şeyma; Ataol, Cigdem Yuksektepe; Şahin, Onur; İdil, Önder; Bati, Hümeyra

    2018-06-01

    A new aroylhydrazoneoxime, N'-((2Z, 3E)-3-(hydroxyimino)butan-2-ylidene)-2-phenylacetohydrazide ligand (LH2) and its Ni(II) and Co(II) complexes, have been synthesized and characterized by elemental and thermal analyses, IR and UV-vis spectroscopy, magnetic moment and X-ray diffraction. The antimicrobial activities of these compounds were tested by using minimal inhibitory concentration method (MIC). The ligand-containing aroylhydrazone and oxime groups and its Ni complex crystallize in the triclinic system and P 1 - space group, while its Co complex crystallizes in the monoclinic system and the C 2/c space group. X-ray results show that the ligand in the keto form is transformed into enolic form when it forms coordination. From elemental analysis data, the stoichiometry of Co(II) complex was found to be 1:2 (metal/ligand), but 1:1 for Ni(II). IR spectra indicate that the ligand acts as monoanionic NNO- tridentate and coordination takes place form through the oxime nitrogen, imine nitrogen, and enolate oxygen atoms.

  14. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  15. Synthesis and Antibacterial Activities of Novel 2,5-Diphenylindolo[2,3-e] Pyrazolo[1',5':3",4"]pyrimido[2",1"-c] [1,2,4]triazines

    Directory of Open Access Journals (Sweden)

    Mohamed G. Marei

    2011-12-01

    Full Text Available The formation of (E-3-{2-(2,5-diphenylpyrazolo[1,5-c]pyrimidin-7-ylhydrazono}indolin-2-ones 3 has been achieved by condensation of equimolar amounts of 7-hydrazino-2,5-diphenylpyrazolo[1,5-c]pyrimidine (1 and isatin (or isatin derivatives 2 at room temperature. The (E-products could be isomerized into corresponding the (Z-3 isomers. Reactions of the latter fused heterocyclic hydrazones towards different electro-philic reagents yielded the corresponding 3-substituted derivatives 4–7. Dehydrative cyclisation of the hydrazones 3 using phosphorus oxychloride afforded the 2,5-diphenyl- indolo[2,3-e]pyrazolo[1',5':3",4"]pyrimido[2",1"-c][1,2,4] triazines 13. The polyfused heterocyclic ring system 13 underwent electrophilic substitution reactions at position 4 rather than at position 3. The 3-bromo isomer of 17 was prepared by a sequence of reactions starting from 2,5-diphenylpyrazolo[1,5-c]pyrimidine-7(6H-thione (11. The orientation of the electrophilic attack was supported by spectroscopic and chemical evidence. Some of the synthesized compounds were found to possess slight to moderate activity against the microorganisms Bacillus subtilis, Micrococcus luteus, Staphylococcus aureus, Escherichia coli and Pseudomonas aeruginosa.

  16. Novel (1E,3E,5E-1,6-bis(Substituted phenylhexa-1,3,5-triene Analogs Inhibit Melanogenesis in B16F10 Cells and Zebrafish

    Directory of Open Access Journals (Sweden)

    Jisun Oh

    2018-04-01

    Full Text Available The present study aimed to evaluate the anti-melanogenic activity of 1,6-diphenyl-1,3,5-hexatriene and its derivatives in B16F10 murine melanoma cells and zebrafish embryos. Twenty five (1E,3E,5E-1,6-bis(substituted phenylhexa-1,3,5-triene analogs were synthesized and their non-cytotoxic effects were predictively analyzed using three-dimensional quantitative structure-activity relationship approach. Inhibitory activities of these synthetic compounds against melanin synthesis were determined by evaluating melanin content and melanogenic regulatory enzyme expression in B16F10 cells. The anti-melanogenic activity was verified by observing body pigmentation in zebrafishes treated with these compounds. Compound #2, #4, and #6 effectively decreased melanogenesis induced by α-melanocyte-stimulating hormone. In particular, compound #2 remarkably lowered the mRNA and protein expression levels of microphthalmia-associated transcription factor (MITF, tyrosinase (TYR, tyrosinase-related protein 1 (TYRP1, and TYRP2 in B16F10 cells and substantially reduced skin pigmentation in the developed larvae of zebrafish. These findings suggest that compound #2 may be used as an anti-melanogenic agent for cosmetic purpose.

  17. Semaphorin 4A enhances lung fibrosis through activation of Akt via ...

    Indian Academy of Sciences (India)

    2015-11-28

    Nov 28, 2015 ... In the present study, we show that treatment of Sema4A on normal lung fibroblasts ... of patients with the fibrotic disease Systemic Sclerosis (SSc) showed ... modulated at multiple levels: transcription, translation, and post-.

  18. The Role of Semaphorin 3B (SEMA3B) in the Pathogenesis of Breast Cancer

    Science.gov (United States)

    2006-04-01

    apoptotic and anti-proliferative effect on cancer lines it is in part by the inhibition of Akt pathway. In conclusion, we hypothesize that VEGF165...autocrine activity and by inhibiting the Akt pathway. 15. SUBJECT TERMS tumor suppressor gene, breast cancer and apoptosis 16. SECURITY...TGFβ TGFR2 Smad4 M D A M B A 54 9 H 12 99 H el a H 46 0 M C F7 ZR -7 5 H 15 7 2 31 GAPDH TGFR1 B. C 2H 24H 48H 72H SEMA3B SEMA3B

  19. Brain endothelial cells control fertility through ovarian-steroid-dependent release of semaphorin 3A

    NARCIS (Netherlands)

    Giacobini, Paolo; Parkash, Jyoti; Campagne, Céline; Messina, Andrea; Casoni, Filippo; Vanacker, Charlotte; Langlet, Fanny; Hobo, Barbara; Cagnoni, Gabriella; Gallet, Sarah; Hanchate, Naresh Kumar; Mazur, Danièle; Taniguchi, Masahiko; Mazzone, Massimiliano; Verhaagen, J.; Ciofi, Philippe; Bouret, Sébastien G; Tamagnone, Luca; Prevot, Vincent

    Neuropilin-1 (Nrp1) guides the development of the nervous and vascular systems, but its role in the mature brain remains to be explored. Here we report that the expression of the 65 kDa isoform of Sema3A, the ligand of Nrp1, by adult vascular endothelial cells, is regulated during the ovarian cycle

  20. Brain Endothelial Cells Control Fertility through Ovarian-Steroid–Dependent Release of Semaphorin 3A

    Science.gov (United States)

    Messina, Andrea; Casoni, Filippo; Vanacker, Charlotte; Langlet, Fanny; Hobo, Barbara; Cagnoni, Gabriella; Gallet, Sarah; Hanchate, Naresh Kumar; Mazur, Danièle; Taniguchi, Masahiko; Mazzone, Massimiliano; Verhaagen, Joost; Ciofi, Philippe; Bouret, Sébastien G.; Tamagnone, Luca; Prevot, Vincent

    2014-01-01

    Neuropilin-1 (Nrp1) guides the development of the nervous and vascular systems, but its role in the mature brain remains to be explored. Here we report that the expression of the 65 kDa isoform of Sema3A, the ligand of Nrp1, by adult vascular endothelial cells, is regulated during the ovarian cycle and promotes axonal sprouting in hypothalamic neurons secreting gonadotropin-releasing hormone (GnRH), the neuropeptide controlling reproduction. Both the inhibition of Sema3A/Nrp1 signaling and the conditional deletion of Nrp1 in GnRH neurons counteract Sema3A-induced axonal sprouting. Furthermore, the localized intracerebral infusion of Nrp1- or Sema3A-neutralizing antibodies in vivo disrupts the ovarian cycle. Finally, the selective neutralization of endothelial-cell Sema3A signaling in adult Sema3a loxP/loxP mice by the intravenous injection of the recombinant TAT-Cre protein alters the amplitude of the preovulatory luteinizing hormone surge, likely by perturbing GnRH release into the hypothalamo-hypophyseal portal system. Our results identify a previously unknown function for 65 kDa Sema3A-Nrp1 signaling in the induction of axonal growth, and raise the possibility that endothelial cells actively participate in synaptic plasticity in specific functional domains of the adult central nervous system, thus controlling key physiological functions such as reproduction. PMID:24618750

  1. Brain endothelial cells control fertility through ovarian-steroid-dependent release of semaphorin 3A.

    Science.gov (United States)

    Giacobini, Paolo; Parkash, Jyoti; Campagne, Céline; Messina, Andrea; Casoni, Filippo; Vanacker, Charlotte; Langlet, Fanny; Hobo, Barbara; Cagnoni, Gabriella; Gallet, Sarah; Hanchate, Naresh Kumar; Mazur, Danièle; Taniguchi, Masahiko; Mazzone, Massimiliano; Verhaagen, Joost; Ciofi, Philippe; Bouret, Sébastien G; Tamagnone, Luca; Prevot, Vincent

    2014-03-01

    Neuropilin-1 (Nrp1) guides the development of the nervous and vascular systems, but its role in the mature brain remains to be explored. Here we report that the expression of the 65 kDa isoform of Sema3A, the ligand of Nrp1, by adult vascular endothelial cells, is regulated during the ovarian cycle and promotes axonal sprouting in hypothalamic neurons secreting gonadotropin-releasing hormone (GnRH), the neuropeptide controlling reproduction. Both the inhibition of Sema3A/Nrp1 signaling and the conditional deletion of Nrp1 in GnRH neurons counteract Sema3A-induced axonal sprouting. Furthermore, the localized intracerebral infusion of Nrp1- or Sema3A-neutralizing antibodies in vivo disrupts the ovarian cycle. Finally, the selective neutralization of endothelial-cell Sema3A signaling in adult Sema3aloxP/loxP mice by the intravenous injection of the recombinant TAT-Cre protein alters the amplitude of the preovulatory luteinizing hormone surge, likely by perturbing GnRH release into the hypothalamo-hypophyseal portal system. Our results identify a previously unknown function for 65 kDa Sema3A-Nrp1 signaling in the induction of axonal growth, and raise the possibility that endothelial cells actively participate in synaptic plasticity in specific functional domains of the adult central nervous system, thus controlling key physiological functions such as reproduction.

  2. Brain endothelial cells control fertility through ovarian-steroid-dependent release of semaphorin 3A.

    Directory of Open Access Journals (Sweden)

    Paolo Giacobini

    2014-03-01

    Full Text Available Neuropilin-1 (Nrp1 guides the development of the nervous and vascular systems, but its role in the mature brain remains to be explored. Here we report that the expression of the 65 kDa isoform of Sema3A, the ligand of Nrp1, by adult vascular endothelial cells, is regulated during the ovarian cycle and promotes axonal sprouting in hypothalamic neurons secreting gonadotropin-releasing hormone (GnRH, the neuropeptide controlling reproduction. Both the inhibition of Sema3A/Nrp1 signaling and the conditional deletion of Nrp1 in GnRH neurons counteract Sema3A-induced axonal sprouting. Furthermore, the localized intracerebral infusion of Nrp1- or Sema3A-neutralizing antibodies in vivo disrupts the ovarian cycle. Finally, the selective neutralization of endothelial-cell Sema3A signaling in adult Sema3aloxP/loxP mice by the intravenous injection of the recombinant TAT-Cre protein alters the amplitude of the preovulatory luteinizing hormone surge, likely by perturbing GnRH release into the hypothalamo-hypophyseal portal system. Our results identify a previously unknown function for 65 kDa Sema3A-Nrp1 signaling in the induction of axonal growth, and raise the possibility that endothelial cells actively participate in synaptic plasticity in specific functional domains of the adult central nervous system, thus controlling key physiological functions such as reproduction.

  3. Semaphorin 5A inhibits synaptogenesis in early postnatal- and adult-born hippocampal dentate granule cells

    OpenAIRE

    Duan, Yuntao; Wang, Shih-Hsiu; Song, Juan; Mironova, Yevgeniya; Ming, Guo-li; Kolodkin, Alex L; Giger, Roman J

    2014-01-01

    eLife digest Neurons communicate with one another at specialized junctions called synapses. There are two types of synapses, called excitatory synapses and inhibitory synapses, and the density and strength of both are tightly regulated because small deviations from the normal density and/or strength may lead to illness. For example, an excess of excitatory synapses has been observed in patients who have autism spectrum disorders and exhibit difficulties in social interaction. The gene that co...

  4. Semaphorin SEMA3F and VEGF Have Opposing Effects on Cell Attachment and Spreading

    Directory of Open Access Journals (Sweden)

    Patrick Nasarre

    2003-01-01

    Full Text Available SEMA3F, isolated from a 3p21.3 deletion, has antitumor activity in transfected cells, and protein expression correlates with tumor stage and histology. In primary tumors, SEMA3F and VEGF surface staining is inversely correlated. Coupled with SEMA3F at the leading edge of motile cells, we previously suggested that both proteins competitively regulate cell motility and adhesion. We have investigated this using the breast cancer cell line, MCF7. SEMA3F inhibited cell attachment and spreading as evidenced by loss of lamellipodia extensions, membrane ruffling, and cell-cell contacts, with cells eventually rounding-up and detaching. In contrast, VEGF had opposite effects. Although SEMA3F binds NRP2 with 10-fold greater affinity than NRP1, the effects in MCF7 were mediated by NRP1. This was determined by receptor expression and blocking of anti-NRP1 antibodies. Similar effects, but through NRP2, were observed in the C100 breast cancer cell line. Although we were unable to demonstrate changes in total GTPbound Rac1 or RhoA, we did observe changes in the localization of Rac1-GFP using time lapse microscopy. Following SEMA3F, Rac1 moved to the base of lamellipodia and — with their collapse — to the membrane. These results support the concept that SEMA3F and VEGF have antagonistic actions affecting motility in primary tumor cell.

  5. Regulation of semaphorin III/collapsin-1 gene expression during peripheral nerve regeneration

    NARCIS (Netherlands)

    Pasterkamp, R Jeroen; Giger, Roman J; Verhaagen, J

    1998-01-01

    The competence of neurons to regenerate depends on their ability to initiate a program of gene expression supporting growth and on the growth-permissive properties of glial cells in the distal stump of the injured nerve. Most studies on intrinsic molecular mechanisms governing peripheral nerve

  6. INFLUÊNCIA DA QUALIDADE DA ÁGUA DESTINADA AO CONSUMO HUMANO NO ESTADO NUTRICIONAL DE CRIANÇAS COM IDADES ENTRE 3 E 6 ANOS, NO MUNICÍPIO DE OURO PRETO-MG

    Directory of Open Access Journals (Sweden)

    A. C. ANTUNES

    2008-09-01

    Full Text Available

    A água corresponde a 70% do peso corporal. Excelente solvente, ela pode veicular produtos químicos, germes e parasitas, representando risco potencial à saúde da população, se não apresentar características de potabilidade dentro dos padrões legais. Como o distrito de Santa Rita de Ouro Preto não possui sistema de abastecimento convencional, neste trabalho buscou-se avaliar a qualidade da água desse sistema e verificar sua influência no estado nutricional de crianças de 03 a 06 anos. Foram coletadas 381 amostras de água, no período de julho de 2003 a abril de 2004, em residências, nascentes e reservatórios. Essas amostras foram submetidas às análises físico-químicas e bacteriológicas. Nas crianças moradoras das casas amostradas, foram realizados exame parasitológico de fezes e avaliação do estado nutricional. A água não se apresentou potável. Em 43% das amostras foram encontradas bactérias coliformes termotolerantes, em 100% cloro residual negativo, além de turbidez fora dos padrões em 55 amostras. Parasitas de veiculação hídrica foram encontrados nas amostras de fezes: Giardia lamblia (7,1%, Ascaris lumbricoides (33,3% e Entamoeba coli (46,4%. O estado nutricional das crianças foi considerado satisfatório, mas a qualidade da água pode reverter o quadro, se mecanismos que proporcionem melhorias da potabilidade não forem previstos.

  7. Association between the SLC6A3 A1343G polymorphism and schizophrenia Associação entre o polimorfismo A1343G do SLC6A3 e esquizofrenia

    Directory of Open Access Journals (Sweden)

    Quirino Cordeiro

    2010-10-01

    Full Text Available Epidemiological studies have demonstrated that the genetic component is an important risk factor for the development of schizophrenia. The genes that codify the different compounds of the dopaminergic system have created interest for molecular investigations in patients with schizophrenia because the antipsychotic drugs, especially those of first generation, act on this cerebral system. Thus the aim of the present study was to investigate the possible association between a new single nucleotide polymorphism (rs6347 located in exon 9 of the protein transporter (SLC6A3 and schizophrenia. The distribution of the alleles and genotypes of the studied polymorphism was investigated in a sample of 235 patients and 834 controls matched by gender and age. There were statistical differences in the allelic (χ2=5.97, 1d.f. , p=0.01, OR=1.33-1.05Estudos epidemiológicos têm demonstrado que o componente genético é um importante fator de risco para a esquizofrenia. Os genes que codificam os diferentes componentes do sistema dopaminérgico passaram a despertar interesse para estudos moleculares em pacientes com esquizofrenia, pois os antipsicóticos, em especial os de primeira geração, exercem sua ação nesse sistema. Assim, o objetivo do presente estudo foi investigar a associação entre um novo polimorfismo de nucleotídeo único (rs6347 localizado no exon 9 do gene do transportador de dopamina (SLC6A3 e esquizofrenia. Um total de 235 pacientes e 834 controles pareados para sexo e idade foi selecionado para a investigação da distribuição dos alelos e genótipos do polimorfismo investigado entre os grupos de pacientes e controles. Houve diferenças estatisticamente significantes nas distribuições alélicas (χ2=5,97, 1d.f. , p=0,01, OR=1,33-1,05

  8. Fluid shear stress suppresses TNF-α-induced apoptosis in MC3T3-E1 cells: Involvement of ERK5-AKT-FoxO3a-Bim/FasL signaling pathways

    Energy Technology Data Exchange (ETDEWEB)

    Bin, Geng; Bo, Zhang; Jing, Wang; Jin, Jiang; Xiaoyi, Tan; Cong, Chen; Liping, An; Jinglin, Ma; Cuifang, Wang; Yonggang, Chen [The Second Hospital of Lanzhou University, #82 Cuiyingmen, Lanzhou, 730000 Gansu (China); Orthopaedics Key Laboratory of Gansu Province, Lanzhou, 730000 Gansu (China); Yayi, Xia, E-mail: xiayayildey@163.com [The Second Hospital of Lanzhou University, #82 Cuiyingmen, Lanzhou, 730000 Gansu (China); Orthopaedics Key Laboratory of Gansu Province, Lanzhou, 730000 Gansu (China)

    2016-05-01

    TNF-α is known to induce osteoblasts apoptosis, whereas mechanical stimulation has been shown to enhance osteoblast survival. In the present study, we found that mechanical stimulation in the form of fluid shear stress (FSS) suppresses TNF-α induced apoptosis in MC3T3-E1 cells. Extracellular signal-regulated kinase 5 (ERK5) is a member of the mitogen-activated protein kinase (MAPK) family that has been implicated in cell survival. We also demonstrated that FSS imposed by flow chamber in vitro leads to a markedly activation of ERK5, which was shown to be protective against TNF-α-induced apoptosis, whereas the transfection of siRNA against ERK5 (ERK5-siRNA) reversed the FSS-medicated anti-apoptotic effects. An initial FSS-mediated activation of ERK5 that phosphorylates AKT to increase its activity, and a following forkhead box O 3a (FoxO3a) was phosphorylated by activated AKT. Phosphorylated FoxO3a is sequestered in the cytoplasm, and prevents it from translocating to nucleus where it can increase the expression of FasL and Bim. The inhibition of AKT-FoxO3a signalings by a PI3K (PI3-kinase)/AKT inhibitor (LY294002) or the transfection of ERK5-siRNA led to the nuclear translocation of non-phosphorylated FoxO3a, and increased the protein expression of FasL and Bim. In addition, the activation of caspase-3 by TNF-α was significantly inhibited by aforementioned FSS-medicated mechanisms. In brief, the activation of ERK5-AKT-FoxO3a signaling pathways by FSS resulted in a decreased expression of FasL and Bim and an inhibition of caspase-3 activation, which exerts a protective effect that prevents osteoblasts from apoptosis. - Highlights: • Fluid shear stress inhibits osteoblast apoptosis induced by TNF-α. • Inhibition of ERK5 activity by transfection of ERK5 siRNA blocks FSS-mediated anti-apoptotic effect in osteoblast. • Activated ERK5-AKT-FoxO3a-Bim/FasL signaling pathways by FSS is required to protect osteoblast from apoptosis.

  9. Effect of copper-doped silicate 13–93 bioactive glass scaffolds on the response of MC3T3-E1 cells in vitro and on bone regeneration and angiogenesis in rat calvarial defects in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Yinan; Xiao, Wei [Department of Materials Science and Engineering, Missouri University of Science and Technology, Rolla, MO 65409 (United States); Bal, B. Sonny [Department of Orthopaedic Surgery, University of Missouri, Columbia, MO 65212 (United States); Rahaman, Mohamed N., E-mail: rahaman@mst.edu [Department of Materials Science and Engineering, Missouri University of Science and Technology, Rolla, MO 65409 (United States)

    2016-10-01

    The release of inorganic ions from biomaterials could provide an alternative approach to the use of growth factors for improving tissue healing. In the present study, the release of copper (Cu) ions from bioactive silicate (13–93) glass scaffolds on the response of cells in vitro and on bone regeneration and angiogenesis in vivo was studied. Scaffolds doped with varying concentrations of Cu (0–2.0 wt.% CuO) were created with a grid-like microstructure by robotic deposition. When immersed in simulated body fluid in vitro, the Cu-doped scaffolds released Cu ions into the medium in a dose-dependent manner and converted partially to hydroxyapatite. The proliferation and alkaline phosphatase activity of pre-osteoblastic MC3T3-E1 cells cultured on the scaffolds were not affected by 0.4 and 0.8 wt.% CuO in the glass but they were significantly reduced by 2.0 wt.% CuO. The percent new bone that infiltrated the scaffolds implanted for 6 weeks in rat calvarial defects (46 ± 8%) was not significantly affected by 0.4 or 0.8 wt.% CuO in the glass whereas it was significantly inhibited (0.8 ± 0.7%) in the scaffolds doped with 2.0 wt.% CuO. The area of new blood vessels in the fibrous tissue that infiltrated the scaffolds increased with CuO content of the glass and was significantly higher for the scaffolds doped with 2.0 wt.% CuO. Loading the scaffolds with bone morphogenetic protein-2 (1 μg/defect) significantly enhanced bone infiltration and reduced fibrous tissue in the scaffolds. These results showed that doping the 13–93 glass scaffolds with up to 0.8 wt.% CuO did not affect their biocompatibility whereas 2.0 wt.% CuO was toxic to cells and detrimental to bone regeneration. - Highlights: • First study to evaluate Cu ion release from silicate (13-93) bioactive glass scaffolds on osteogenesis in vivo • Released Cu ions influenced bone regeneration in a dose dependent manner • Lower concentrations of Cu ions had little effect on bone regeneration • Cu ion

  10. Ácidos graxos poliinsaturados ômega-3 e ômega-6: importância e ocorrência em alimentos Omega-3 and omega-6 polyunsaturated fatty acids: importance and occurrence in foods

    Directory of Open Access Journals (Sweden)

    Clayton Antunes Martin

    2006-12-01

    Full Text Available Os ácidos graxos poliinsaturados abrangem as famílias de ácidos graxos ômega-3 e ômega-6. Os ácidos graxos de cadeia muito longa, como os ácidos araquidônico e docosaexaenóico, desempenham importantes funções no desenvolvimento e funcionamento do cérebro e da retina. Esse grupo de ácidos graxos não pode ser obtido pela síntese de novo, mas pode ser sintetizado a partir dos ácidos linoléico e alfa-linolênico presentes na dieta. Neste artigo são considerados os principais fatores que podem inibir a atividade das enzimas dessaturases envolvidas na síntese dos ácidos graxos de cadeia muito longa. São apresentadas as recomendações da razão ômega-6/ômega-3 na dieta, propostas em diversos países, sendo verificada a convergência para o intervalo de 4 a 5:1. São relacionados alimentos que podem contribuir para aumentar a ingestão do ácido alfa-linolênico e dos ácidos graxos de cadeia muito longa. A essencialidade dos ácidos graxos de cadeia muito longa é muito dependente do metabolismo do indivíduo, sendo que a razão n-6/n-3 da dieta exerce grande influência nesse sentido.Polyunsaturated fatty acids include the classes of fatty acids designated as omega-3 and omega-6. Very-long-chain polyunsaturated fatty acids as arachidonic and docosahexaenoic have important roles in the development and functioning of the brain and retina. This group of fatty acids cannot be synthesized by de novo pathway, but can be formed from linoleic and alpha-linolenic acid present in diet. In this article, the main factors that can inhibit desaturase enzymes activity involved in the synthesis of MLC-PUFAs are considered. Recommendations of omega-6/omega-3 ratio in diet proposed in several countries are presented, showing a coverage range from 4 to 5:1. Foods that are sources of alpha-linolenic acid and Very-long-chain are listed. The essentiality of Very-long-chain is very dependent of individual metabolism, and omega-6/omega-3 dietary ratio

  11. Effect of copper-doped silicate 13–93 bioactive glass scaffolds on the response of MC3T3-E1 cells in vitro and on bone regeneration and angiogenesis in rat calvarial defects in vivo

    International Nuclear Information System (INIS)

    Lin, Yinan; Xiao, Wei; Bal, B. Sonny; Rahaman, Mohamed N.

    2016-01-01

    The release of inorganic ions from biomaterials could provide an alternative approach to the use of growth factors for improving tissue healing. In the present study, the release of copper (Cu) ions from bioactive silicate (13–93) glass scaffolds on the response of cells in vitro and on bone regeneration and angiogenesis in vivo was studied. Scaffolds doped with varying concentrations of Cu (0–2.0 wt.% CuO) were created with a grid-like microstructure by robotic deposition. When immersed in simulated body fluid in vitro, the Cu-doped scaffolds released Cu ions into the medium in a dose-dependent manner and converted partially to hydroxyapatite. The proliferation and alkaline phosphatase activity of pre-osteoblastic MC3T3-E1 cells cultured on the scaffolds were not affected by 0.4 and 0.8 wt.% CuO in the glass but they were significantly reduced by 2.0 wt.% CuO. The percent new bone that infiltrated the scaffolds implanted for 6 weeks in rat calvarial defects (46 ± 8%) was not significantly affected by 0.4 or 0.8 wt.% CuO in the glass whereas it was significantly inhibited (0.8 ± 0.7%) in the scaffolds doped with 2.0 wt.% CuO. The area of new blood vessels in the fibrous tissue that infiltrated the scaffolds increased with CuO content of the glass and was significantly higher for the scaffolds doped with 2.0 wt.% CuO. Loading the scaffolds with bone morphogenetic protein-2 (1 μg/defect) significantly enhanced bone infiltration and reduced fibrous tissue in the scaffolds. These results showed that doping the 13–93 glass scaffolds with up to 0.8 wt.% CuO did not affect their biocompatibility whereas 2.0 wt.% CuO was toxic to cells and detrimental to bone regeneration. - Highlights: • First study to evaluate Cu ion release from silicate (13-93) bioactive glass scaffolds on osteogenesis in vivo • Released Cu ions influenced bone regeneration in a dose dependent manner • Lower concentrations of Cu ions had little effect on bone regeneration • Cu ion

  12. Laser-capture micro dissection combined with next-generation sequencing analysis of cell type-specific deafness gene expression in the mouse cochlea.

    Science.gov (United States)

    Nishio, Shin-Ya; Takumi, Yutaka; Usami, Shin-Ichi

    2017-05-01

    Cochlear implantation (CI), which directly stimulates the cochlear nerves, is the most effective and widely used medical intervention for patients with severe to profound sensorineural hearing loss. The etiology of the hearing loss is speculated to have a major influence of CI outcomes, particularly in cases resulting from mutations in genes preferentially expressed in the spiral ganglion region. To elucidate precise gene expression levels in each part of the cochlea, we performed laser-capture micro dissection in combination with next-generation sequencing analysis and determined the expression levels of all known deafness-associated genes in the organ of Corti, spiral ganglion, lateral wall, and spiral limbs. The results were generally consistent with previous reports based on immunocytochemistry or in situ hybridization. As a notable result, the genes associated with many kinds of syndromic hearing loss (such as Clpp, Hars2, Hsd17b4, Lars2 for Perrault syndrome, Polr1c and Polr1d for Treacher Collins syndrome, Ndp for Norrie Disease, Kal for Kallmann syndrome, Edn3 and Snai2 for Waardenburg Syndrome, Col4a3 for Alport syndrome, Sema3e for CHARGE syndrome, Col9a1 for Sticker syndrome, Cdh23, Cib2, Clrn1, Pcdh15, Ush1c, Ush2a, Whrn for Usher syndrome and Wfs1 for Wolfram syndrome) showed higher levels of expression in the spiral ganglion than in other parts of the cochlea. This dataset will provide a base for more detailed analysis in order to clarify gene functions in the cochlea as well as predict CI outcomes based on gene expression data. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  13. Low temperature storage of NAA, GA3 and 2,4-D treated citrus budsticks Armazenamento em baixa temperatura de hastes porta-borbulhas de citros tratadas com ANA, GA3 e 2,4-D

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Chamhum Salomão

    2008-01-01

    2,4-D nas concentrações 1, 10, 50 e 100 µmol L-1 e armazenadas em sacos de polietileno a 5 ± 1ºC, por 74 dias. Foram avaliados a percentagem de abscisão dos pecíolos foliares, a perda de massa da matéria fresca e seca das hastes, a viabilidade das borbulhas e o crescimento das brotações. ANA e 2,4-D controlaram até 99% da abscisão dos pecíolos. O sistema de acondicionamento e o armazenamento em baixa temperatura mostraram-se eficientes na redução das perdas de massa de matéria fresca e seca. O armazenamento não reduziu a viabilidade das borbulhas das laranjeiras 'Baianinha' e 'Valência', e nem da tangoreira 'Murcote', cujo pegamento de enxertia foi superior a 95%. Os tratamentos com ANA, GA3 e 2,4-D não influenciaram o crescimento das brotações.

  14. Avaliação de indicadores socioeconômicos dos grupos 1, 2, 3 e 4 de municípios paulistas com o uso da análise multivariada de variância

    Directory of Open Access Journals (Sweden)

    Patrícia Siqueira Varela

    2011-01-01

    Full Text Available Nos municípios, o movimento de descentralização é uma estratégia utilizada pelo processo de reforma do estado e pelo processo de redemocratização do país, que favorece a transferência de poder, recursos e atribuições para os governos locais. Este trabalho objetivou indicar se as variáveis valores per capita de transferência do Fundo de Participação dos Municípios (FPM, quota-parte do Imposto sobre Circulação de Mercadorias e Serviços (ICMS e Receita Tributária arrecadada têm médias estatisticamente diferentes entre os municípios paulistas caracterizados pelo Índice de Responsabilidade Social Paulista (IPRS como municípios favorecidos econômica e socialmente (grupo 1, municípios com alto índice de riqueza e médios/baixos índices sociais (grupo 2, municípios com baixo índice de riqueza e altos/médios índices sociais (grupo 3 e municípios desfavorecidos em riqueza com níveis sociais intermediários (grupo 4, com base na análise multivariada de variância. Esta técnica estatística sinalizou que a variável Receita Tributária possui a maior diferença de média entre os quatro grupos de municípios. É possível dizer que, para estes grupos analisados, a distribuição do FPM também é aplicada de forma diferenciada, contribuindo efetivamente para tornar as condições dos municípios mais eqüitativas. Este trabalho faz parte de um estudo que combina grupos de municípios e diversas técnicas estatísticas.Abstract In the municipalities, the decentralization movement is a strategy used by the process of state reform and by the process of democratization of the country, which favors the transfer of power, resources and assignments to local governments. This study aimed to indicate whether the variables transference per capita values from the Municipal Participation Fund (MPF, Product and Service Circulation Tax Quota (PSCT and collected tax revenue present averages statistically different between the

  15. Estudo citofotométrico da expressão dos marcadores tumorais Caspase-3 e Ki-67 no adenocarcinoma gástrico Cytophotometric study of the expression of tumoral markers Caspase-3 and Ki-67 in gastric adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Pedro Manuel Gonzales Cuellar

    2007-06-01

    Full Text Available RACIONAL: A carcinogênese gástrica é processo complexo e depende de fatores genéticos, ambientais e infecciosos. Nos últimos anos, houve grandes avanços nos campos da genética e da biologia molecular, sobre o desenvolvimento dos tumores. Os marcadores tumorais são substâncias ausentes nos tecidos normais e que podem ser identificadas em tecidos com câncer. Através de procedimentos imunoistoquímicos eles podem ser estudados. OBJETIVOS: Descrever a expressão citofotométrica do marcador tumoral Ki-67 analisando a densidade óptica e o índice de marcagem no adenocarcinoma de estômago. Descrever a expressão citofotométrica do marcador tumoral Caspase-3 analisando a densidade óptica e o índice de marcagem no adenocarcinoma de estômago. Comparar o índice de marcagem e densidade óptica dos marcadores tumorais Ki-67 e Caspase-3 no adenocarcinoma de estômago. MÉTODO: Foram selecionados, inicialmente, 58 blocos com espécime de adenocarcinoma gástrico coletados nos Serviços de Anátomo-Patologia do Hospital do Gama - Brasília (DF e Hospital Dom Orione - Araguaina (TO, e analizados no Laboratório de Citologia e Histopalogia Ltda - CITOLAB, Curitiba (PR. Foram aproveitados 31 blocos para o estudo histológico e imunoistoquímico realizado pelo sistema de análise computarizado SAMBA 4000. RESULTADOS: Das 31 lâminas estudas, 15 (48% foram marcadas pelo marcador Ki-67, 22 (71% foram marcadas pelo marcador Caspase-3 e 14 (45% marcaram com os dois marcadores. CONCLUSÕES: A expressão citofométrica do marcador Ki-67 foi observada em 15 lâminas da amostra estudada e apresentaram média do índice de marcagem de 36,85%, enquanto a densidade óptica apresentou média de 29,33 pixels. A expressão citofotométrica do marcador Caspase-3 foi observada em 22 lâminas da amostra estudada e apresentaram média do índice de marcagem de 87,71% e 60,74 pixels de média para a densidade óptica. Na comparação do índice de marcagem dos

  16. Nuclear power development. South-Eastern Europe 3E Analysis

    International Nuclear Information System (INIS)

    Yanev, Y

    2010-01-01

    Objectives: 1.Assessments of the incremental costs to the energy system of different “development”and “closure”scenarios. 2.Evaluation of scenarios of the national electricity and centralized heat systems focusing on the economic feasibility of new nuclear power plant(s). General findings: The energy future of Bulgaria depends strongly on the development of the nuclear power sectorThe environmental commitments of Bulgaria drive the energy system towards a roadmap of increased use of renewable energy and maintaining or even strengthening virtually non-emitting hydro and nuclear power. Specific findings: The early closure of KNPP Units 3&4 (SHUTDOWN scenario) increased the system costs. The undiscounted difference in system costs estimated between €734 to €1,095 Million for the essential period 2007 to 2014 -a direct loss to the Bulgarian energy sector; Electricity exports and associated revenues are the key to the Bulgarian system even at revenues of €27.50 per MWh because exports drive rehabilitation schedules; exports affect the ability to finance new construction; exports allow for efficient capacity management and more optimaltiming of properly sized capacity investments; lower exports increase system costs; No net exports after 2007 results in substantial system loss

  17. 3-[(E-(2,4-Dichloropbenzylideneamino]benzoic acid

    Directory of Open Access Journals (Sweden)

    Adnan Ashraf

    2011-01-01

    Full Text Available In the crystal of the title compound, C14H9Cl2NO2, inversion-related dimers with R22(8 ring motifs are formed by intermolecular O—H...O hydrogen bonding. The 3-aminobenzoic acid group and the 2,4-dichlobenzaldehyde moiety subtend a dihedral angle of 55.10 (2°. The H atom of the carboxyl group is disordered over two sites with equal occupancies.

  18. IFRS leerboek: international financial reporting standards. - 3e dr.

    NARCIS (Netherlands)

    Backhuijs, J.; Braam, G.; Brouwer, A.; van den Ende, H.; de Feijter, J.; Hartman, M.; Langendijk, H.; Schoonderbeek, W.; Veuger, P.

    2010-01-01

    Dit IFRS Leerboek is bedoeld voor iedereen die kennis van de regelgeving van de IASB wil krijgen. De regelgeving van de IASB omvat niet alleen de standaarden die onder de naam IFRS worden gepubliceerd, maar ook de standaarden die eerder zijn uitgegeven onder de naam IAS en nog steeds van kracht

  19. Potential Role of Semaphorin 3A and Its Receptors in Regulating Aberrant Sympathetic Innervation in Peritoneal and Deep Infiltrating Endometriosis.

    Science.gov (United States)

    Liang, Yanchun; Wang, Wei; Huang, Jiaming; Tan, Hao; Liu, Tianyu; Shang, Chunliang; Liu, Duo; Guo, Luyan; Yao, Shuzhong

    2015-01-01

    Previous studies have demonstrated the involvement of nerve repellent factors in regulation of the imbalanced innervation of endometriosis. This prospective study aims to explore the role of Sema 3A in regulating aberrant sympathetic innervation in peritoneal and deep infiltrating endometriosis. Ectopic endometriotic lesion were collected from patients with peritoneal endometriosis (n = 24) and deep infiltrating endometriosis of uterosacral ligament (n = 20) undergoing surgery for endometriosis. Eutopic endometrial samples were collected from patients with endometriosis (n = 22) or without endometriosis (n = 26). Healthy peritoneum (n = 13) from the lateral pelvic wall and healthy uterosacral ligament (n = 13) were obtained from patients who had no surgical and histological proof of endometriosis during hysterectomy for uterine fibroids. Firstly, we studied the immunostaining of Sema 3A, Plexin A1 and NRP-1 in all the tissues described above. Then we studied the nerve fiber density (NFD) of endometriosis-associated (sympathetic) nerve and para-endometriotic (sympathetic) nerve by double immunofluorescence staining. Finally we analyzed the relationship between expression of Sema 3A in stromal cells of endometriotic lesion and the aberrant innervation of endometriosis. Semi-quantitative immunostaining demonstrated that (1) Higher immunostaining of Sema 3A were found in the eutopic endometrial glandular epithelial cells from patients with endometriosis (p = 0.041) than those without endometriosis; (2) Sema 3A immunostaining was higher in glandular epithelial cells of peritoneal endometriosis (Pendometriosis, while its expression in ectopic stormal cells in both groups were significantly lower than that from eutopic endometrium of women without endometirosis (Pendometriosis-associated sympathetic nerve of peritoneal endometriosis (pendometriosis of uterosacral ligament (pperitoneal and deep infiltrating endometriosis.

  20. Potential Role of Semaphorin 3A and Its Receptors in Regulating Aberrant Sympathetic Innervation in Peritoneal and Deep Infiltrating Endometriosis

    Science.gov (United States)

    Liang, Yanchun; Wang, Wei; Huang, Jiaming; Tan, Hao; Liu, Tianyu; Shang, Chunliang; Liu, Duo; Guo, Luyan; Yao, Shuzhong

    2015-01-01

    Previous studies have demonstrated the involvement of nerve repellent factors in regulation of the imbalanced innervation of endometriosis. This prospective study aims to explore the role of Sema 3A in regulating aberrant sympathetic innervation in peritoneal and deep infiltrating endometriosis. Ectopic endometriotic lesion were collected from patients with peritoneal endometriosis (n = 24) and deep infiltrating endometriosis of uterosacral ligament (n = 20) undergoing surgery for endometriosis. Eutopic endometrial samples were collected from patients with endometriosis (n = 22) or without endometriosis (n = 26). Healthy peritoneum (n = 13) from the lateral pelvic wall and healthy uterosacral ligament (n = 13) were obtained from patients who had no surgical and histological proof of endometriosis during hysterectomy for uterine fibroids. Firstly, we studied the immunostaining of Sema 3A, Plexin A1 and NRP-1 in all the tissues described above. Then we studied the nerve fiber density (NFD) of endometriosis-associated (sympathetic) nerve and para-endometriotic (sympathetic) nerve by double immunofluorescence staining. Finally we analyzed the relationship between expression of Sema 3A in stromal cells of endometriotic lesion and the aberrant innervation of endometriosis. Semi-quantitative immunostaining demonstrated that (1) Higher immunostaining of Sema 3A were found in the eutopic endometrial glandular epithelial cells from patients with endometriosis (p = 0.041) than those without endometriosis; (2) Sema 3A immunostaining was higher in glandular epithelial cells of peritoneal endometriosis (Pendometriosis, while its expression in ectopic stormal cells in both groups were significantly lower than that from eutopic endometrium of women without endometirosis (Pendometriosis-associated sympathetic nerve of peritoneal endometriosis (pendometriosis of uterosacral ligament (pendometriosis. PMID:26720585

  1. An axial distribution of seeding, proliferation, and osteogenic differentiation of MC3T3-E1 cells and rat bone marrow-derived mesenchymal stem cells across a 3D Thai silk fibroin/gelatin/hydroxyapatite scaffold in a perfusion bioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Sinlapabodin, Salita; Amornsudthiwat, Phakdee; Damrongsakkul, Siriporn; Kanokpanont, Sorada, E-mail: sorada.k@chula.ac.th

    2016-01-01

    In cell culture, a perfusion bioreactor provides effective transportation of nutrients, oxygen, and waste removal to and from the core of the scaffold. In addition, it provides mechanical stimuli for enhancing osteogenic differentiation. In this study, we used an axial distribution of cell numbers, alkaline phosphatase (ALP) enzyme activity, and calcium content across 4 cross-sections of 10 mm thick scaffold, made of Thai silk fibroin (SF)/gelatin (G)/hydroxyapatite (HA), as a tool to evaluate the suitable perfusion flow rate. These evaluations cover all cellular developmental phases starting from seeding, to proliferation, and later osteogenic differentiation. Mouse pre-osteoblastic MC3T3-E1 cell lines were used as a cell model during seeding and proliferation. The bioreactor seeded scaffold provided more uniform cell distribution across the scaffold compared to centrifugal and agitation seeding, while the overall number of adhered cells from bioreactor seeding was slightly lower than agitation seeding. The dynamic culture using 1 ml/min perfusion flow rate (initial shear stress of 0.1 dyn/cm{sup 2}) enabled statistically higher MC3T3-E1 proliferation, ALP activity, and calcium deposition than those observed in the static-culturing condition. However, the perfusion flow rate of 1 ml/min seemed not to be enough for enhancing ALP expression across all sections of the scaffold. Rat bone marrow derived stromal cells (rMSC) were used in the detachment test and osteogenic differentiation. It was found that perfusion flow rate of 5 ml/min caused statistically higher cell detachment than that of 1 and 3 ml/min. The perfusion flow rate of 3 ml/min gave the highest rMSC osteogenic differentiation on a SF/G/HA scaffold than other flow rates, as observed from the significantly highest number of ALP enzyme activity and the calcium content without any significant cell growth. In addition, all of these parameters were evenly distributed across all scaffold sections. - Highlights

  2. Caracterização microestrutural e comportamento mecânico das ligas de alumínio AA2139 T3 e T8 soldadas por fricção rotativa com mistura Microstructural characterization and mechanical behavior of an AA2139 T3 and T8 aluminum alloy joined by friction stir welding (FSW

    Directory of Open Access Journals (Sweden)

    Vinícius Toledo Saccon

    2010-12-01

    Full Text Available Este trabalho visou analisar a caracterização microestrutural e o comportamento mecânico das ligas de alumínio AA2139 T3 e T8 quando são soldadas pelo processo Soldagem por Fricção Rotativa com Mistura, o qual é realizado na fase sólida. A análise microestrutural foi realizada utilizando microscopia óptica e eletrônica de varredura, e o comportamento mecânico foi avaliado através de medidas de microdureza e ensaio de tração convencional complementado pelo sistema ARAMIS. As ligas foram soldadas nos mesmos parâmetros de soldagem e com a mesma ferramenta, a fim de avaliar a qualidade da junta soldada para as duas condições de tratamento térmico, T3 e T8. Os resultados obtidos mostraram soldas resistentes para ambos os tratamentos térmicos, porém com melhores propriedades mecânicas para a liga AA2139 T3.This work aimed to study the microstructural characterization and mechanical behavior of AA2139 T3 and T8 aluminum alloys joined by FSW - Friction Stir Welding. The microstructural analysis has been done using optical microscope and scanning electron microscopy, and the mechanical analysis were evaluate through microhardness testing and conventional tensile test using the ARAMIS system . Each alloy were welded using the same welding parameters and the same tool in order to evaluate the joint quality for both heat treatment used for this work, T3 and T8. The result showed sounds joints for both heat treatments, although with better mechanical properties for the alloy AA2139 T3.

  3. Synthesis, characterization, in-vitro antimicrobial properties, molecular docking and DFT studies of 3-{(E-[(4,6-dimethylpyrimidin-2-ylimino]methyl} naphthalen-2-ol and Heteroleptic Mn(II, Co(II, Ni(II and Zn(II complexes

    Directory of Open Access Journals (Sweden)

    Chioma Festus

    2018-03-01

    Full Text Available Heteroleptic divalent metal complexes [M(L (bipy(Y]•nH2O (where M = Mn, Co, Ni, and Zn; L = Schiff base; bipy = 2,2’-bipyridine; Y = OAc and n = 0, 1 have been synthesized from pyrimidine Schiff base ligand 3-{(E-[(4,6-dimethylpyrimidin-2-ylimino]methyl} naphthalen-2-ol, 2,2’-bipyridine and metal(II acetate salts. The Schiff base and its complexes were characterized by analytical (CHN elemental analyses, solubility, melting point, conductivity measurements, spectral (IR, UV-vis, 1H and 13C-NMR and MS and magnetometry. The elemental analyses, Uv-vis spectra and room temperature magnetic moment data provide evidence of six coordinated octahedral geometry for the complexes. The metal complexes’ low molar conductivity values in dimethylsulphoxide suggested that they were non-ionic in nature. The compounds displayed moderate to good antimicrobial and antifungal activities against S. aureus, P. aeruginosa, E. coli, B. cereus, P. mirabilis, K. oxytoca, A. niger, A. flevus and R. Stolonifer. The compounds also exhibited good antioxidant potentials with ferrous ion chelation and, 1-diphenyl-2-picryl-hydrazyl (DPPH radical scavenging assays. Molecular docking studies showed a good interaction with drug targets used. The structural and electronic properties of complexes were further confirmed by density functional theory calculations.

  4. 3,3'-[(E-eten-1,2-diil]di(9-heksil-9H-karbazol bileşiğinin sentezi, X-ışını yapı tayini ve teorik yapı tahmini

    Directory of Open Access Journals (Sweden)

    Erol Asker

    2016-08-01

    Full Text Available 3,3'-[(E-eten-1,2-diil]di(9-heksil-9H-karbazol bileşiği 9H-karbazoldan çıkarak üç basamakta sentezlenmiş ve yapısı spektroskopik yöntemlerle aydınlatılmıştır. Kristal yapısı monoklinik uzay grubu P21/c'de çözülmüş ve geometrik özellikleri yarı-deneysel PM7 ve teorik DFT/B3LYP hesaplamalarla elde edilen verilerle karşılaştırılmıştır. DFT hesapsal sonuçlar ile X-ışını kırınımı deneysel sonuçlar arasında yüksek korelasyon belirlenmiştir. Kristal yapıdaki moleküller arası etkileşimler hesaplanan öncü orbitallerle açıklanmaya çalışılmıştır.

  5. Migração de β-caprolactama de embalagens contendo poliamida 6 para simulante ácido acético 3% e validação do método analítico β-Caprolactam migration from polyamide 6 packaging into 3% acetic acid food simulant and validation of the analytical method

    Directory of Open Access Journals (Sweden)

    Juliana Silva Félix

    2007-08-01

    Full Text Available Este trabalho teve como objetivo desenvolver e validar método analítico para determinar ε-caprolactama no simulante de alimentos solução de ácido acético 3% e estudar sua migração de embalagens contendo poliamida 6 para o simulante em contato. Foi empregada a cromatografia gasosa usando ε-caprolactama como padrão analítico e 2-azociclononanona como padrão interno. A linearidade esteve entre 1,60 e 640,00 µg de ε-caprolactama.mL-1 de simulante, com coeficiente de correlação 0,9999. Os limites de detecção e de quantificação do método foram 0,24 e 1,60 ng, respectivamente. A precisão do método revelou valores de coeficiente de variação menores que 4,3% e a avaliação da exatidão mostrou recuperação de 100 a 106%. O método demonstrou ser eficaz para quantificar ε-caprolactama no simulante, apresentando ampla linearidade, boa precisão e exatidão. No ensaio de migração, embalagens contendo poliamida 6 foram colocadas em tubos de vidro com 10 mL do simulante, que foram hermeticamente fechados e acondicionados a 40 ± 1 °C durante 10 dias. O ensaio de migração foi realizado por imersão total. A quantidade de ε-caprolactama migrada variou de 7,8 a 10,5 e de 6,9 a 7,6 mg.kg-1 de simulante para as embalagens destinadas aos produtos cárneos e queijos, respectivamente. Todas as embalagens atenderam às exigências da Legislação Brasileira para migração de ε-caprolactama.The aim of this work was to develop and validate an analytical method to determine ε-caprolactam in 3% acetic acid solution and to study its migration from polyamide 6 into food simulant. Gas chromatography was used with ε-caprolactam as an analytical standard and 2-azacyclononanone as an internal standard. The linearity was obtained by the concentration range of 1.60 to 640.00 µg.mL-1, with a correlation coefficient of 0.9999. Detection and quantification limits of the method were 0.24 ng and 1.60 ng, respectively. Relative standard

  6. A pulverização pré-colheita com ácido giberélico (GA3 e aminoetoxivinilglicina (AVG retarda a maturação e reduz as perdas de frutos na cultura do pessegueiro Preharvest spraying with gibberellic acid (GA3 and aminoethoxyvinilglycine (AVG delays fruit maturity and reduces fruit losses on peaches

    Directory of Open Access Journals (Sweden)

    Cassandro Vidal Talamini do Amarante

    2005-04-01

    Full Text Available Este trabalho objetivou avaliar os efeitos da pulverização pré-colheita com ácido giberélico (GA3 e aminoetoxivinilglicina (AVG na queda pré-colheita, maturação e qualidade de pêssegos, da cultivar Rubidoux. O delineamento experimental foi em blocos inteiramente casualizados, com quatro repetições, consistindo de seis tratamentos, resultantes da combinação de duas doses de GA3 (0 e 100 mg L-1 e três doses de AVG (0; 75 e 150 mg L-1. O GA3 e o AVG foram pulverizados cerca de seis e três semanas antes do início da colheita comercial dos frutos, respectivamente. Tratamentos envolvendo a combinação de GA3 (100 mg L-1 e AVG (75 e 150 mg L-1 retardaram a maturação dos frutos na colheita e durante o armazenamento refrigerado (4 semanas a 0-2ºC/90-95% UR, ocasionando maior retenção de cor verde da casca, menor redução da firmeza de polpa, menor aumento no teor de sólidos solúveis totais e menor redução na acidez titulável. De forma geral, os efeitos mais expressivos foram observados para tratamentos com GA3 100 mg L-1 do que para tratamentos com AVG 75 e 150 mg L-1. O tratamento com GA3 100 mg L-1 também reduziu o número de frutos com rachaduras e podridões, aumentou o peso médio de frutos na colheita e reduziu a incidência de escurecimento da polpa após armazenamento refrigerado. O AVG aumentou a incidência de frutos rachados.This research had the objective of studying the effects of preharvest spraying with gibberellic acid (GA3 and aminoethoxyvinilglycine (AVG on preharvest fruit drop, fruit maturity and fruit quality of peach, cultivar Rubidoux. The experiment consisted of a randomized complete block design, with four replicates, comprising six treatments derived from combinations of two doses of GA3 (0 and 100 mg L-1 and three doses of AVG (0, 75, and 150 mg L-1. GA3 and AVG were sprayed about six and three weeks before commercial fruit harvest, respectively. Treatments with GA3 (100 mg L-1 and AVG (75 and 150

  7. Germinação de sementes de atemoia (Annona Cherimola Mill. x A. squamosa L. cv 'Gefner' submetidas a tratamentos com ácido Giberélico (GA3 e ethephon Germination of atemoya seeds (Annona Cherimola Mill. x A. squamosa L. cv 'Gefner' subjected to treatments with Gibberellic acid (GA3 and ethephon

    Directory of Open Access Journals (Sweden)

    Marcos Campos de Oliveira

    2010-06-01

    Full Text Available O objetivo deste trabalho foi estudar os efeitos do ácido giberélico (GA3, do ethephon e da interação de ambos os reguladores vegetais no processo germinativo de sementes de atemoia (Annona cherimola Mill. x A. squamosa L. , cultivar 'Gefner'. Empregou-se delineamento experimental inteiramente casualizado, em esquema fatorial 5², com os tratamentos constituídos pela combinação de cinco concentrações de GA3 (ácido giberélico e cinco concentrações de ethephon, resultando em 25 tratamentos, com quatro repetições de 25 sementes por parcela. As concentrações de GA3 empregadas foram: 0; 250; 500; 750 e 1.000 mg L-1 i.a.e de ethephon: 0; 25; 50; 75 e 100 mg L-1 i.a.. Os tratamentos com os reguladores vegetais foram aplicados na semente por imersão das mesmas nas soluções de GA3 e ethephon por período de 36 horas. As sementes foram semeadas em rolo de papel germitest e levadas à câmara de germinação onde permaneceram no escuro, com temperatura alternada entre 20ºC por 8 horas e 30ºC por 16 horas. As variáveis avaliadas foram: percentagem, tempo e índice de velocidade de germinação, percentagem de plântulas normais e percentagem de sementes dormentes. Existe interação da ação dos reguladores vegetais estudados no processo germinativo de sementes de atemoia, o que permite concluir que a percentagem de germinação de sementes de atemoia (Annona cherimola Mill. x A. squamosa L. cv 'Gefner' é aumentada com o emprego de 778 mg L-1 de GA3, enquanto a associação entre elevadas concentrações de GA3 e 75 a 100 mg L-1 de ethephon incrementam o índice de velocidade de germinação e a percentagem de plântulas normais.The aim of this work was to evaluate the effect of gibberellic acid (GA3 and ethephon, besides the interaction of both plant growth regulators, on the germinative process of atemoya seeds (Annona cherimola Mill. X A. squamosa L., cultivar 'Gefner'. Experimental design was completely randomized, in a 5

  8. Importância da detecção das mutações no gene FLT3 e no gene NPM1 na leucemia mieloide aguda - Classificação da Organização Mundial de Saúde 2008 Importance of detecting FLT3 and NPM1 gene mutations in acute myeloid leukemia -World Health Organization Classification 2008

    Directory of Open Access Journals (Sweden)

    Marley Aparecida Licínio

    2010-01-01

    Full Text Available As leucemias mieloides agudas (LMA constituem um grupo de neoplasias malignas caracterizadas pela proliferação descontrolada de células hematopoéticas, decorrente de mutações que podem ocorrer em diferentes fases da diferenciação de células precursoras mieloides. Em 2008, a Organização Mundial da Saúde (OMS-2008 publicou uma nova classificação para neoplasias do sistema hematopoético e linfoide. De acordo com essa classificação, para um diagnóstico mais preciso e estratificação de prognóstico de pacientes com leucemias mieloides agudas, devem-se pesquisar mutações nos genes FLT3 e NPM1. Sabe-se que a presença de mutações no gene FLT3 é de prognóstico desfavorável e que as mutações no gene NPM1 do tipo A são de prognóstico favorável. Assim, nos países desenvolvidos, a análise das mutações no gene FLT3 e NPM1 tem sido considerada como um fator de prognóstico importante na decisão terapêutica em pacientes com diagnóstico de leucemias mieloides agudas. Considerando essas informações, é de extrema importância a análise das mutações no gene FLT3 (duplicação interna em tandem - DIT - e mutação pontual D835 e no gene NPM1 como marcadores moleculares para o diagnóstico, o prognóstico e a monitoração de doença residual mínima em pacientes com leucemias mieloides agudas.Acute myeloid leukemia (AML is a group of malignancies characterized by uncontrolled proliferation of hematopoietic cells resulting from mutations that occur at different stages in the differentiation of myeloid precursor cells. In 2008, the World Health Organization (WHO-2008 published a new classification for cancers of the hematopoietic and lymphoid system. According to this classification, FLT3 and NPM1 gene mutations should be investigated for a more precise diagnosis and prognostic stratification of AML patients. It is well known that the presence of FLT3 gene mutations is considered an unfavorable prognostic factor and type

  9. Evaluación de los cebadores TS3 e ITS4 para la detección de infecciones por Candida spp. en muestras de flujo vaginal y humor acuoso Evaluation of ITS3 and ITS4 primers for detection of Candida spp. Candida spp. infections from vaginal samples and aqueous humor

    Directory of Open Access Journals (Sweden)

    Juan Felipe Ramirez

    2008-06-01

    Full Text Available Antecedentes. Los métodos convencionales para a identificación de levaduras del género Candida requieren mucho tiempo, necesitan cantidad importante de la muestra y, en muchos casos, es necesario realizar cultivo. Objetivos. Evaluar un par de cebadores para la identificación de levaduras del género Candida y demostrar su potencial aplicación para el diagnóstico de infecciones intraoculares. Materiales y métodos. Se utilizaron 17 cepas de referencia, 29 aislamientos clínicos de flujo vaginal, 7 muestras de humor acuoso y una de humor vítreo. Evaluamos tres métodos para el rompimiento de la pared celular: congelación descongelación, sonicación, y la enzima liticasa. Para la purificación del ácido nucleico, se utilizó en los tres casos el estuche comercial Wizard Genomics; en la reacción de PCR, el estuche comercial Go Taq Green Master Mix y los iniciadores ITS3 e ITS4 a una concentración de 0,5 µM. Resultados. De los tres métodos el que mejor resultados ofreció fue el uso de enzima liticasa más el estuche comercial. Con los iniciadores ITS3 e ITS4 fue posible identificar las levaduras únicamente a nivel de género y no se presentó reacción cruzada con otros microorganismos comúnmente encontrados en diferentes muestras de tejido humano. La sensibilidad fue de 100 fg. Se lograron identificar por PCR todos los aislamientos a partir de flujo vaginal y de una muestra de humor acuso. Para las demás muestras de humor acuoso el diagnóstico fue para otros agentes causales, entre ellos, Toxoplasma sp. Conclusión. Consideramos que ésta es una metodología adecuada, la cual permite identificar levaduras del género Candida con gran sensibilidad y reproducibilidad.Background. Conventional methods for Candida identification are time consuming, require high amounts of the sample and in several cases the culture is mandatory. Aims. To evaluate two primers for the identification of Candida and to demonstrate their application for

  10. Validation of microsatellite markers for assisted selection of soybean resistance to cyst nematode races 3 and 14 Validação de marcadores microssatélites para a seleção assistida de resistência de soja ao nematóide-de-cisto raças 3 e 14

    Directory of Open Access Journals (Sweden)

    Marcia Flores da Silva

    2007-08-01

    Full Text Available The objective of this work was to validate microsatellite markers associated with resistance to soybean cyst nematode (Heterodera glycines Ichinohe races 3 and 14, in soybean (Glycine max L. genotypes, for use in marker-assisted selection (MAS programs. Microsatellites of soybean linkage groups A2, D2 and G were tested in two populations, and their selection efficiencies were determined. The populations were 65 F2:3 families from Msoy8001 (resistant x Conquista (susceptible cross, and 66 F2:3 families of S5995 (resistant x Renascença (susceptible cross, evaluated for resistance to races 3 and 14, respectively. Families with female index up to 30% were considered moderately resistant. Markers of A2 and G linkage groups were associated with resistance to race 3. Markers Satt309 and GMENOD2B explained the greatest proportion of phenotypic variance in the different groups. The combinations Satt309+GMENOD2B and Satt309+Satt187 presented 100% selection efficiency. Resistance to race 14 was associated with markers of G linkage group, and selection efficiency in the Satt309+Satt356 combination was 100%. The selection differential obtained by phenotypic and marker assisted selection showed that both can result in similar gains.O objetivo deste trabalho foi validar marcadores microssatélites associados à resistência às raças 3 e 14 do nematóide-de-cisto (Heterodera glycines Ichinohe da soja (Glycine max L., para serem utilizados em programas de seleção assistida por marcadores moleculares (SAM. Microssatélites dos grupos de ligação A2, D2 e G da soja foram testados em duas populações, e suas eficiências de seleção foram determinadas. As populações foram 65 famílias F2:3, do cruzamento Msoy8001 (resistente x Conquista (suscetível, e 66 famílias F2:3, do cruzamento S5995 (resistente x Renascença (suscetível, avaliadas para a resistência às raças 3 e 14, respectivamente. Famílias com índice de fêmeas de até 30% foram

  11. Influência da Espessura do Filme Polimérico Intermediário na Resistência Mecânica de Juntas Híbridas de Alumínio 2024-T3 e CF-PPS Produzidas por União Pontual por Fricção

    Directory of Open Access Journals (Sweden)

    Natália M. André

    2016-03-01

    Full Text Available Resumo A União Pontual por Fricção (FSpJ é uma técnica inovadora para união de estruturas híbridas metal-polímero e baseia-se na geração de calor por fricção. Juntas de alumínio 2024-T3 e compósito laminado de poli(sulfeto de fenileno com fibra de carbono (CF-PPS foram produzidas com filme intermediário de PPS. Duas espessuras de filme foram investigadas: 100 e 500 µm. Ensaios de cisalhamento sob tração demonstraram que as juntas com filmes de 100 µm são mais resistentes (2093 ± 180 N em relação às juntas com filme de 500 µm (708 ± 69 N. Adicionalmente, as superfícies de fratura das juntas revelaram áreas de união maiores para as juntas com filmes de 100 µm (53 ± 2 contra 40 ± 1 mm2. Para o filme mais fino, a extensão do amolecimento devido ao calor friccional é maior. Consequentemente, a baixa viscosidade atingida com a fusão do polímero favorece a molhabilidade das superfícies dos componentes da junta pelo PPS amolecido, resultando em melhor adesão entre as partes. Ademais, análises microestruturais demonstraram que a formação do cerne metálico e a interdifusão das moléculas de PPS entre compósito e filme também são favorecidas. Portanto, concluiu-se que a adição do filme mais fino produziu juntas mais resistentes.

  12. Expressão de galectina-3 e beta-catenina em lesões pré-malignas e carcinomatosas de língua de camundongos Galectin-3 and beta-catenin expression in premalignant and carcinomatous lesions in tongue of mice

    Directory of Open Access Journals (Sweden)

    Juliana Moreira de Almeida Sant'ana

    2011-02-01

    Full Text Available INTRODUÇÃO: A galectina-3 (GAL3 apresenta importantes papéis na biologia tumoral e recentemente foi mostrada a sua participação na via de sinalização Wnt, translocando a beta-catenina para o núcleo. Expressão alterada de GAL3 e beta-catenina tem sido descrita em cânceres, mas não há estudos avaliando a expressão de ambas em displasias e carcinomas desenvolvidos em modelos de carcinogênese de língua. OBJETIVOS: Estudar a expressão de GAL3 e beta-catenina em lesões displásicas e carcinomas induzidos experimentalmente em língua de camundongos. MATERIAL E MÉTODOS: Vinte camundongos C57BL/6 machos foram desafiados com 4NQO na água de beber por 16 semanas e sacrificados na semana 16 e 32. Após o sacrifício, as línguas foram removidas, processadas, coradas por hematoxilina e eosina (HE para detecção de displasias e carcinomas. Ensaio imuno-histoquímico foi realizado para determinar o índice de positividade para GAL3 e beta-catenina nessas lesões, bem como uma correlação entre elas em carcinomas. RESULTADOS: O número de camundongos afetados por carcinoma aumentou entre as semanas 16 e 32 (22,2% vs. 88,9% e o de displasia diminuiu (66,7% vs. 11,1%. Um aumento de células positivas para beta-catenina não membranosa e GAL3 citoplasmática foi observado nas displasias e nos carcinomas, mas essa diferença não foi estatisticamente significativa. No entanto, um aumento estatisticamente significativo de GAL3 nuclear foi observado na evolução de displasia para carcinoma (p = 0,04. Nenhuma correlação foi encontrada entre beta-catenina e GAL3. CONCLUSÃO: Tanto nas displasias quanto nos carcinomas a via de sinalização Wnt está ativa, e o aumento de GAL3 nuclear nos carcinomas sugere um papel na transformação maligna do epitélio lingual.INTRODUCTION: Galectin-3 plays pivotal role in tumor biology and its participation in Wnt signaling pathway translocating beta-catenin into the nucleus has been recently demonstrated

  13. Association analysis between a VNTR intron 8 polymorphism of the dopamine transporter gene (SLC6A3 and obsessive- compulsive disorder in a Brazilian sample Análise de associação entre um polimorfismo VNTR no intron 8 do gene do transportador de dopamina (SLC6A3 e transtorno obsessivo-compulsivo em uma amostra brasileira

    Directory of Open Access Journals (Sweden)

    Karen Miguita

    2007-12-01

    Full Text Available Family, twin and segregation analysis have provided evidences that genetic factors are implicated in the susceptibility for obsessive-compulsive disorder (OCD. Several lines of research suggest that the dopaminergic system may be involved in the pathophysiology of OCD. Thus, the aim of the present study was to investigate a possible association between a polymorphism located in intron 8 of the dopamine transporter gene (SLC6A3 and OCD in a Brazilian sample composed by 208 patients and 865 healthy controls. No statistically differences were observed in allelic and genotype distributions between cases and controls. No association was also observed when the sample was divided according to specific phenotypic features such as gender, presence of tic disorders co-morbidity and age at onset of obsessive-compulsive symptoms (OCS. Our results suggest that the intron 8 VNTR of the SLC6A3 investigated in this study is not related to the susceptibility for OCD in our Brazilian sample.Estudos de família, gêmeos e de segregação têm demonstrado que fatores genéticos estão envolvidos na susceptibilidade para o desenvolvimento do transtorno obsessivo-compulsivo (TOC. Várias linhas de pesquisa sugerem que o sistema dopaminérgico possa estar envolvido na fisiopatologia do TOC. Assim, o objetivo do presente estudo foi investigar uma possível associação entre o polimorfismo localizado no intron 8 do gene do transportador da dopamina (SLC6A3 e o TOC em uma amostra brasileira composta por 208 pacientes e 865 controles sadios. Nenhuma diferença estatisticamente significante foi observada nas distribuições alélicas e genotípicas entre os grupos de pacientes e controles. Nenhuma associação também foi observada quando as amostras foram divididas de acordo com características fenotípicas específicas, tais como gênero, presença de co-morbidade com tiques e idade de início dos sintomas obsessivo-compulsivo (SOC. Nossos resultados sugerem que o VNTR

  14. Padronização de três ELISAs polivalentes com lipopolissacarídeos de cadeia longa dos sorotipos 1 e 5, 2, 3 e 7 ou 10 e 12 de Actinobacillus pleuropneumoniae Standardization of three polyvalent ELISA based on long chain lipopolysaccharides of serotypes 1 and 5, 2, 3 and 7, or 10 and 12 of Actinobacillus pleuropneumoniae

    Directory of Open Access Journals (Sweden)

    S.S. Kuchiishi

    2008-04-01

    Full Text Available Três ELISAs polivalentes baseados em lipopolissacarídeos de cadeia longa (LPS-CL foram estabelecidos para detectar anticorpos para todos os sorotipos prevalentes de Actinobacillus pleuropneumoniae. Foram testadas amostras provenientes do banco de soros de suínos experimentalmente inoculados com todos os sorotipos de A. pleuropneumoniae. Os ELISAs foram sensíveis à detecção de anticorpos contra todos os LPS-CL. Foram observadas reações cruzadas no ELISA polivalente produzido com os sorotipos 1 e 5, com anti-soros específicos para os sorotipos 9 e 11, pois os sorotipos 1, 9 e 11 apresentaram antígenos somáticos comuns. No polivalente com os sorotipos 2, 3 e 7, observaram-se reações com anti-soros dos sorotipos 4, 6 e 8, devido à presença de antígenos somáticos entre os sorotipos 3, 6 e 8 e entre os sorotipos 4 e 7. Amostras de soros de animais infectados com Mycoplasma hyopneumoniae, Mycoplasma flocculare e Haemophilus parasuis, agentes que acometem o sistema respiratório dos suínos, não apresentaram reações cruzadas com os antígenos baseados em LPS-CL.Three polyvalent ELISA based on long chain lipopolysaccharides (LC-LPS were established to detect all prevalent serotypes of Actinobacillus pleuropneumoniae. Samples from a serum bank of experimentally inoculated animals with all serotypes of A. pleuropneumoniae were tested. Antibodies specific to LC-LPS of each serotype were detected. Cross-reactions were observed in the polyvalent ELISA produced with serotypes 1 and 5, with specific antisera to serotypes 9 and 11 due to common somatic antigens presence in serotypes 1, 9, and 11. In the polyvalent with serotypes 2, 3 and 7 reactions were observed with antisera of serotypes 4, 6, and 8, due to the presence of somatic antigens in serotypes 3, 6, and 8 and serotypes 4 and 7. Experimentally infected animals with respiratory agents of swine Mycoplasma hyopneumoniae, Mycoplasma flocculare, and Haemophilus parasuis did not present

  15. Apoptose e expressão de Bcl-2 e das caspases 3 e 8 em placenta bovina, em diferentes estádios de gestação Apoptosis and expression of Bcl-2 and caspases 3 and 8 in placenta of cows at different pregnancy stages

    Directory of Open Access Journals (Sweden)

    K.K.O.L. Meça

    2010-04-01

    Full Text Available Apoptose e seus mecanismos reguladores são eventos fisiológicos cruciais para a manutenção da homeostase placentária, e o desequilíbrio desses processos pode comprometer a função placentária e, consequentemente, o sucesso da gravidez. Neste estudo, investigou-se a apoptose utilizando-se histomorfometria em lâminas coradas em HE e submetidas à reação de TUNEL. Além disso, avaliou-se a expressão de Bcl-2 e das caspases 8 e 3, pela reação de polimerase em cadeia em tempo real, em placentas saudáveis em diferentes estádios de gestação. Amostras de placentônios de vacas com quatro, seis e nove meses de gestação foram colhidas e processadas. O índice apoptótico aumentou progressivamente com o avanço da gestação. Tanto o Bcl-2 quanto as caspases 3 e 8 foram expressas nos três períodos estudados, sendo a expressão de Bcl-2 menor que a de caspase 8, que é menor que a de caspase 3. Estes resultados indicam que essas moléculas estão envolvidas na via apoptótica ativada na maturação placentária, exibindo um padrão de expressão ao longo da gestação e contribuindo para o equilíbrio fisiológico da celularidade e renovação celular na placenta bovina.Apoptosis and its regulating mechanisms are crucial physiological events for the maintenance of the placental homostasis; and disequilibrium of these processes may compromise placental function and the success of the pregnancy. In this study, apoptosis was investigated by histomorphometry using slides stained with HE and TUNEL reaction. Besides that, Bcl-2 and caspases 8 and 3 expression were evaluated by real time polymerase chain reaction in healthy placentas under different gestacional ages. Samples of placentones of cows at 4th, 6th, and 9th months of gestation were harvested and processed. The apoptotic index gradually increased with the advance of the gestation. Bcl-2 and caspases 3 and 8 were expressed in all the studied periods, being the expression of Bcl-2

  16. Efeito dos ácidos graxos n-3 e n-6 na expressão de genes do metabolismo de lipídeos e risco de aterosclerose Effects of n-3 and n-6 fatty acids on the expression of genes involved in the lipid metabolism and risk of atherosclerosis

    Directory of Open Access Journals (Sweden)

    Helena Fonseca Raposo

    2010-10-01

    Full Text Available A aterosclerose, principal responsável pela patogênese do infarto miocárdico e cerebral, bem como pela gangrena e por outras doenças vasculares periféricas, permanece como principal causa de morbidade e mortalidade nas populações "ocidentalizadas". Estima-se que 17,5 milhões de pessoas morreram por doenças cardiovasculares em 2005, o que representou 30% das causas de morte nesse ano, e que, em 2015, 20 milhões de pessoas morrerão por doenças cardiovasculares no mundo. Os ácidos graxos n-3, principalmente os de cadeia longa, encontrados nos peixes, têm-se mostrado particularmente úteis na prevenção e tratamento de doenças como dislipidemias, diabetes mellitus e obesidade, apresentando importante efeito cardioprotetor. Nesse contexto, pesquisas têm evidenciado que ao menos parte dos benefícios dos ácidos graxos eicosapentaenóico e docosahexaenóico sobre o risco de doenças cardiovasculares é decorrente da modulação de genes responsivos aos receptores ativados por proliferadores de peroxissomos e envolvidos no metabolismo lipídico. Nesta revisão, pretende-se expor alguns mecanismos de ação dos ácidos graxos n-3 e n-6 sobre o metabolismo de lipídeos e de lipoproteínas. Conclui-se que muitos aspectos que contribuem para o risco de doenças cardiovasculares são afetados pela ingestão de n-3. Além da redução de triglicérides, fatores como o aumento de adiponectina, a redução da concentração de colesterol plasmático e a melhora do transporte reverso de colesterol também são responsáveis pela redução do risco de aterosclerose promovida pelos ácidos graxos n-3. No entanto, ainda são necessários estudos adicionais para definir mais claramente os mecanismos celulares e moleculares responsáveis pelo efeito cardioprotetor dos ácidos graxos n-3.Atherosclerosis, the main cause of myocardial infarction, stroke, gangrene and other peripheral vascular diseases, also persists as the main cause of morbidity and

  17. Concentrações plasmáticas de testosterona, triiodotironina (T3 e tiroxina (T4 em bodes submetidos ao estresse calórico Plasma concentrations of testosterone, triiodothyronine (T3, and thyroxine (T4 in bucks submitted to heat stress

    Directory of Open Access Journals (Sweden)

    L.A. Coelho

    2008-12-01

    Full Text Available Para verificar o efeito do estresse calórico (EC nas concentrações plasmáticas de testosterona, triiodotironina (T3 e tiroxina (T4, oito bodes, das raças Saanen (n=4 e Alpina (n=4, foram mantidos em câmara bioclimática, sob condições de termoneutralidade (13,0ºC a 26,7ºC durante 30 dias e, após um período (60 dias de descanso, submetidos ao EC (23,7ºC a 34,0ºC por 30 dias. Para minimizar as variações sazonais nos perfis hormonais devido ao fotoperíodo, durante toda fase experimental, incluindo a de adaptação em condições de termoneutralidade (30 dias, o fotoperíodo foi controlado utilizando-se alternância de dias longos (16h de luz e 8h de escuro e de dias curtos (8h de luz e 16h de escuro a cada 30 dias. As amostras de sangue foram coletadas duas vezes por semana durante cinco semanas. No conjunto das raças, o EC não influenciou (P>0,05 as concentrações de testosterona (1,8±0,2 vs 1,3±0,2ng/ml e nem a de T4 (52,7±2,8 vs 50,0±2,8ng/ml. Houve declínio (PTo verify the effect of heat stress (HS on plasma testosterone, triiodothyronine (T3, and thyroxine (T4 concentrations, eight Saanen (n=4 and Alpine Brown (n=4 bucks were kept in climate chamber under thermal neutral conditions (13.0ºC to 26.7ºC for 30 days. After a resting period (60 days, the same bucks were submitted to heat stress (23.7ºC to 34.0ºC for another 30 days. To neutralize the seasonal variations of hormonal profiles throughout the period, the photoperiod was controlled every 30 days altering long (16 hours of light and 8 hours of darkness and short days (8 hours of light and 16 hours of darkness. The blood samples were collected twice a week during five weeks. In both breeds, there was no effect of HS (P>0.05 on plasma concentrations of testosterone (1.8±0.2 vs 1.3±0.2ng/ml and T4 (52.7±2.8 vs 50.0±2.8ng/ml. There was a decline (P<0.01 of plasma T3 concentrations (1.3±0.1 vs 1.0±0.1ng/ml after HS treatment, but this reduction was only

  18. Efeito de giberelina (GA3 e do bioestimulante 'Stimulate' na indução floral e produtividade do maracujazeiro-amarelo em condições de safra normal Effect of gibereline (GA3 and biostimulant 'Stimulate' in floral induction and yield of yellow passion fruit in conditions of normal growing season

    Directory of Open Access Journals (Sweden)

    Elma Machado Ataíde

    2006-12-01

    Full Text Available O objetivo do trabalho foi avaliar os efeitos de GA3, nas concentrações de 100; 200 e 300mg L-1 e do bioestimulante Stimulate®, em doses de 2,08; 4,17 e 6,25mL L-1, em duas aplicações via foliar, acrescidas de espalhante adesivo Silwett® a 0,05% e a exposição dos ramos à luminosidade, na indução floral e produtividade do maracujazeiro-amarelo, em condições de safra normal, em Araguari-MG. Aos 30 dias após a primeira aplicação dos tratamentos, iniciaram-se as avaliações do número de flores, com contagens diárias, nos dois lados da espaldeira, nos meses de setembro de 2002 a março de 2003. As colheitas dos frutos foram realizadas semanalmente, no período de novembro de 2002 a abril de 2003, observando-se a produção. O GA3 e o Stimulate não proporcionaram efeito significativo no número de flores, nas sete épocas, assim como no número total de flores. Não houve efeito dos tratamentos para a produtividade e produção total de frutos. Os ramos sob luminosidade pela tarde apresentaram maior número de flores, nos meses de setembro, dezembro, fevereiro e março. A interação entre os tratamentos e a exposição dos ramos à luminosidade não foi significativa para o número de flores, nas épocas avaliadas.The objective of this work was to evaluate the effects of GA3 , in concentrations of 100, 200 and 300mg L-1 and biostimulant StimulateTM, in doses of 2,08, 4,17 and 6,25 mL L-1, in two leaf applications, added with the adhesive spreader SilwettTM at 0,05% and branch exposure to brightness, on passion fruit in floral induction and yield, in conditions of normal growing season, in Araguari-MG. At 30 days after the first treatment application, the evaluation of flower number started, with daily counts, in both sides of the plants, from September 2002 to March 2003. Fruit harvest was realized weekly from November 2002 to April 2003, being observed the yield. GA3 and Stimulate did not provide significant effect on flower

  19. Disponibilidade de zinco para milho pelos extratores Mehlich-1, Mehlich-3 e DPTA em solos de Minas Gerais, na presença e ausência de calagem Zinc availability to maize in different soils with and without liming determined by Mehlich-1, Mehlich-3 and DTPA

    Directory of Open Access Journals (Sweden)

    Agna Almeida Menezes

    2010-04-01

    Full Text Available No Brasil, diversos extratores químicos são utilizados na determinação de Zn disponível para as plantas, destacando-se Mehlich-1 e DTPA. Este trabalho foi realizado com o objetivo de estudar a disponibilidade de Zn em solos de Minas Gerais em função de doses de Zn e de calcário e extratores químicos, utilizando-se milho como planta indicadora. Os extratores estudados foram: (a Mehlich-1 com filtragem lenta após a extração (M-1f; (b Mehlich-1 com retirada do sobrenadante após 16 h de repouco (M-1s; (c Mehlich-3 (M-3; e (d DTPA. As amostras receberam adubação básica com macro e micronutrientes (-Zn e cinco doses de Zn na forma de ZnSO4 (0, 2, 4 6 e 8 mg dm-3 de Zn na ausência ou presença de calagem. Quinze dias após a fertilização, subamostras foram coletadas para a determinação de Zn pelos extratores. Para Mehlich-1, o extrato foi obtido por meio de dois procedimentos: filtragem logo após extração (M-1f e retirada de alíquota após 16 h (M-1s. O restante do solo foi acondicionado em vasos plásticos, para o cultivo do milho durante 50 dias. A capacidade de extração variou na seguinte ordem: M-1s > M-1f > M-3 > DTPA, para todos os solos, na ausência e na presença de calagem. O M-1s e o M-3 não apresentaram diferenças na capacidade de extração com a calagem, enquanto M-1f e DTPA foram sensíveis à calagem. Os teores de Zn obtidos com todos os extratores correlacionaram-se significativa e negativamente com o teor de argila e a capacidade de campo dos solos, tanto na ausência como na presença de calagem. Os teores obtidos com DTPA apresentaram maior correlação com características de solo na presença de calagem, indicando que esse extrator aumentou sua sensibilidade à capacidade-tampão em valores mais elevados de pH. Todos os extratores mostraram correlações com o conteúdo de Zn na planta; portanto, podem ser utilizados na avaliação da disponibilidade de Zn do solo.In Brazil, plant-available Zn in the

  20. Frequency of the different mutations causing spinocerebellar ataxia (SCA1, SCA2, MJD/SCA3 and DRPLA in a large group of Brazilian patients Freqüência das mutações que causam ataxia espinocerebelar (SCA1, SCA2, MJD/SCA3 e DRPLA em um grupo numeroso de pacientes Brasileiros

    Directory of Open Access Journals (Sweden)

    Iscia Lopes-Cendesi

    1997-09-01

    genes responsáveis pelas três doenças. Portanto, para SCA 1, SCA2 e MJD/SCA3 o diagnóstico molecular é agora possível. A atrofia dentatorubropalidoluisiana (DRPLA é também causada pela expansão de trinucleotídeos CAG e pode por vezes se apresentar como uma SCA. Nós investigamos a freqüência das mutações responsáveis por SCA1, SCA2, MJD/SCA3 e DRPLA em um grupo de 328 pacientes brasileiros com SCA pertencentes a 90 famílias não aparentadas. Esses pacientes apresentavam padrões diferentes de herança genética e eram provenientes de várias regiões do Brasil. Nós identificamos mutações em 35 famílias, 32 das quais com herança claramente autossômica dominante. A freqüência da mutação SGA1 foi de 3% no grupo total de pacientes, e 6% nos pacientes com herança autossômica dominante. Nós encontramos a mutação SCA2 em 6% de todas as famílias e em 9% das famílias com herança autossômica dominante. A mutação MJD/SCA3 foi encontrada em 30% de todos os pacientes, e em 44% quando consideramos somente os pacientes com herança autossômica dominante. Nenhuma mutação DRPLA foi encontrada. Nós observamos também variabilidade na freqüência das diferentes mutações em pacientes provenientes de diferentes regiões geográficas, o que provavelmente se correlaciona com os padrões distintos de colonização do Brasil. Nossos resultados sugerem que os casos de SCA no Brasil podem ser causados ocasionalmente pela mutação SCA1 e SCA2, mas que a causa mais freqüente de SCA de herança autossômica dominante no Brasil é a mutação MJD/SCA3.

  1. Inter-regional changes in the performance and interpretation of spirometry in Spain: 3E study.

    Science.gov (United States)

    López-Campos, José Luis; Soriano, Joan B; Calle, Myriam

    2014-11-01

    This report shows the results of a nation-wide survey on spirometry to assess regional differences. Observational cross-sectional study conducted by means of a telephone survey in 805 primary care (PC) and specialized centers (SC) in all regions. The survey contacted technicians in charge of spirometry and consisted of 36 questions related to the test. The results showed major differences between regions. Most centers had 1-2 spirometers. The number of spirometry tests per week ranged from 2 to 8.9 in PC and between 34.3 and 98.3 in SC. Some training had been given in most centers (63.6-100% in PC and 60.0-100% in SC) but not on a regular basis. Most centers used several short-acting bronchodilators for the bronchodilation test, but with insufficient inhalations (2.0-3.8 in PC and 2.0-3.3 in SC) and frequently incorrect waiting time (29.4-83.3% PC and 33.3-87.5% in SC). Daily calibration was not performed in all centers (0-100% in PC and 66.7-100% in SC). Significant inter-regional differences in spirometry quality criteria were observed, with 6 or more criteria met in 9.1-84.6% of PC centers and 37.5-100% in SC. Our results show the current situation of spirometry in primary and specialized care in Spain, highlighting considerable variability and areas for improvement. This information should be considered by health officials to improve the quality and accessibility of such tests. Copyright © 2014 SEPAR. Published by Elsevier Espana. All rights reserved.

  2. Coplanar (e, 3e) differential cross-section of He atom

    Indian Academy of Sciences (India)

    -section (FDCS) for (, 3) process on He atom in low momentum transfer and high electron impact energy in shake-off mechanism. The formalism has been developed in Born approximation using plane waves, Byron and Joachain as well as ...

  3. MP3-e leiutajatele jäävad näpud / Patrick Jenkins

    Index Scriptorium Estoniae

    Jenkins, Patrick

    2005-01-01

    Tänu MP3-mängija iPod edukale müügile suurenes Apple Computeri I kvartali kasum 368% ning oli 295 miljonit dollarit. MP3 tehnoloogia leiutati Saksamaal peaaegu 20 aastat tagasi, kuid tookord ei saadud tehnoloogia rakendamiseks Euroopas tuge. Lisa: MPEG Layer 3 kodeerimine

  4. Tier 1 and Tier 3 eAdjudication Business Rule Validation

    Science.gov (United States)

    2018-04-01

    correct rejections. • Research ways to safely approve more cases through eAdjudication. PERSEREC has established a business rule test environment that can... WORK UNIT NUMBER: 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Defense Personnel and Security Research Center Office of People Analytics 400...interagency working group of personnel security and suitability experts on business rule development for T3 and T3R. The results of rule development and

  5. Coplanar (e, 3e) differential cross-section of He atom

    Indian Academy of Sciences (India)

    Department of Physics, College of Science Campus, M. L. S. University, ... double ionization, structure of the target and electron–electron correlation in ... Three mechanisms are involved in the direct ejection of two target electrons: the shake-.

  6. 5-Bromo-N3-[(E-(6-bromopyridin-2-ylmethylidene]pyridine-3,4-diamine

    Directory of Open Access Journals (Sweden)

    Mingjian Cai

    2011-12-01

    Full Text Available The title compound, C11H8Br2N4, is a Schiff base obtained from 6-bromopicolinaldehyde and 5-bromopyridine-3,4-diamine. The molecule has an E configuration about the C=N bond and the dihedral angle between the two pyridine rings is 14.02 (1°. The observed conformation is stabilised by an intramolecular N—H...N hydrogen bond. In the crystal, molecules are stacked along the b axis and are linked through N—H...N hydrogen bonds into chains along the c axis.

  7. Riboflavin and photoproducts in MC3T3-E1 differentiation

    NARCIS (Netherlands)

    Chaves Neto, Antonio Hernandes; Yano, Claudia Lumy; Paredes-Gamero, Edgar Julian; Machado, Daisy; Justo, Giselle Zenker; Peppelenbosch, Maikel P.; Ferreira, Carmen Verissima

    2010-01-01

    Photoderivatives of riboflavin can modulate the proliferation and survival of cancer cells. In this work, we examined the influence of riboflavin and photoderivatives on osteoblast differentiation induced by ascorbic acid and beta-glycerophosphate. These compounds decreased the osteoblast

  8. On the imaging of land mines using 3+ - e- pair production

    International Nuclear Information System (INIS)

    Crawford, J.F.; Arkuszewski, J.; Ritt, S.; Suwannakachorn, D.

    1998-01-01

    The problem of disposing of abandoned land mines is very serious in many countries. Anti-personnel land mines (APM's) contain as little as 50 gram or less of explosive, which is enough to take off an adult's foot, or to kill a child. Anti-tank mines (ATM's), designed to penetrate the armour on the bottom of a tank, are much larger. Current techniques of finding them are not adequate. All practical high explosives contain 20% or more of nitrogen, which has a thermal neutron cross section of 75 mbarn, producing γ's of up to 10.8 MeV. The idea of using this property to detect explosives has been tested by others, but because of backgrounds is unable to find anything less than several hundred grams of explosive. The refinement proposed here is to convert the γs, track the resulting e + - e - pairs in MWPC's, and use the information to locate the γ source, i.e. the mine. The directional information provided should reduce the backgrounds considerably. Result of an experimental test are presented, and possibilities for the future discussed. (author)

  9. GPM GROUND VALIDATION SATELLITE SIMULATED ORBITS MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The Satellite Simulator database is available for several campaigns: Light Precipitation Evaluation Experiment (LPVEX), Midlatitude Continental Convective Clouds...

  10. Quasi-binary incident electron–centre of mass collision in (e, 3e ...

    Indian Academy of Sciences (India)

    These two geometrical modes are such that the quasi-binary collision between the incident electron and centre of mass of the ejected electrons is in the scattering plane. The theoretical formalism has been developed using plane waves,. Le Sech wave function and approximated BBK-type wave function respectively for the.

  11. Quasi-binary incident electron–centre of mass collision in (e, 3e ...

    Indian Academy of Sciences (India)

    These two geometrical modes are such that the quasi-binary collision between the incident electron and centre of mass of the ejected electrons is in the scattering plane. The theoretical formalism has been developed using plane waves, Le Sech wave function and approximated BBK-type wave function respectively for the ...

  12. (e, 3e) Test on e–e correlations in helium

    Indian Academy of Sciences (India)

    £Present address: S.I.E.T., Dulehra Marg, Modipuram, Meerut 250 110, India ... A proper accounting of e–e correlation in the final state which contains three electrons in the field .... The results are however not very sensitive to its value. αb. , αc.

  13. Asymmetric Synthesis of the Epimeric (3S-3-((E-Hex-1-enyl-2-methylcyclohexanones

    Directory of Open Access Journals (Sweden)

    Pierre J. De Clercq

    2007-02-01

    Full Text Available The asymmetric rhodium-catalysed 1,4-addition of alkenylzirconium reagents to 2-cyclohexenone can be useful in the synthesis of 3-alkenyl-2-methylcyclohexanones, provided that formaldehyde is used in trapping the intermediate zirconium enolates. In this manner a four-step sequence leading to the two epimeric 3-hexenyl-2-methylcyclohexanones in enantiomeric form was developed.

  14. S. E. A. Clam. Vol. 3E. Technical appraisal. [Wave energy converter

    Energy Technology Data Exchange (ETDEWEB)

    1983-06-01

    A detailed technical appraisal of the wave energy device known as a 'Celam' is presented by a team of Consultants. The scheme assessed is a 2 GW array based off the coast of Skye. The cost of energy from such an array is assessed both by the Consultants and by the development team and the discrepancies between the two discussed.

  15. Energy and environment: for harmonization of 3E's. Energy, environment and economies

    International Nuclear Information System (INIS)

    Fujime, Kazuya

    1996-01-01

    When the future society of Asian countries is considered, three points of view have to be taken into account. As to energy security, the rate of oil self-supply in this region, which is 45% now, is expected to decrease, and oil import will be required. As to environmental protection, the increase of energy consumption results in the increase of pollutant emission which causes acid rain, global warming and so on. Economic development involves the expansion of energy consumption, the lowering of energy supply stability, and the increase of harmful gas emission. It partly depends on policy administration whether the three Es described above can be brought into well balanced harmony. In Asia, it is essential to transfer technologies from industrialized nations to developing countries. The problems of sulfur oxides and carbon dioxide are discussed. The harmonization of the three Es should be carried out at the regional level of whole Asia through international cooperation. The dependence on coal in total energy demand is as high as 60% in East Asia. Long term energy supply/demand outlooks for East Asian countries and the positioning of coal, and coal-related environmental measures are reported. (K.I.)

  16. Scaling of cross-sections for asymmetric (e, 3e) process on helium ...

    Indian Academy of Sciences (India)

    An approximate simple scaling law is obtained for asymmetric (, 3) process on helium-like ions for double ionization by fast electrons. It is based on the equation ( Z ′ 3 / ) exp [ − Z ′ ( r 1 + r 2 ) ] , Z ′ = Z − ( 5 / 16 ) for ground state wave function of helium- like ions and Z ′ 2 scaling of energies. The scaling law is ...

  17. Histopathology and immunocytochemical study of type 3 and type 4 complement receptors in the liver and spleen of dogs naturally and experimentally infected with Leishmania (Leishmania chagasi Histopatologia e estudo imunocitoquímico dos receptores do tipo 3 e 4 do complemento no fígado e baço de cães natural e experimentalmente infectados com Leishmaniose Visceral

    Directory of Open Access Journals (Sweden)

    Wagner Luiz Tafuri

    1996-04-01

    Full Text Available The objective of this study was to compare the histopathological changes and expression of CR3 and CR4 in the liver and spleen of dogs naturally and experimentally infected with L. chagasi. The basic histopathological lesions observed mainly in naturally infected dogs were: epithelioid hepatic granulomas, hyperplasia and hypertrophy of Kupffer cells, Malpigui follicles and mononucleated cells of the red pulp of the spleen. Sections from the liver and spleen by immunocytochemistry technique showed the presence of CD11b,cCD 18 antigens in the control and infected animals and no qualitative or quantitative differences in the liver. Nevertheless, CD18 was always increased in the spleen of naturally and experimentally infected dogs. These results indicate that there is a difference in the activaton of CD 18 in both experimental and natural cases of canine visceral leishmaniasis that should play an important role in the immunological response to Leishmania chagasi infection.Os objetivos deste trabalho visaram uma análise comparativa das alterações histopatológicas e da expressão de CR3 e CR4 no fígado e baço de cães natural e experimentalmente infectados com L. chagasi. As lesões histopatológicas fundamentais observadas principalmente nos cães naturalmente infectados foram: os granulomas epitelióides hepáticos, a hiperplasia e a hipertrofia das células de Kupffer, dos folículos de Malpighi e das células mononucleadas da polpa vermelha do baço. Os cortes de fígado e baço corados pela técnica de imunocitoquímica mostraram a presença dos antígenos CD11b,cCD18 nos animais controles e infectados, sem diferenças qualitativas e quantitativas no fígado. Entretanto, no baço dos cães natural e experimentalmente infectados a expressão de CD 18 (subunidade beta2 da molécula comum aos leucócitos foi sempre aumentada. Em leishmaniose a resposta imune celular é considerada a mais importante na resolução da doença. A expressão de CD

  18. Inactivation of the Sema5a gene results in embryonic lethality and defective remodeling of the cranial vascular system

    NARCIS (Netherlands)

    Fiore, Roberto; Rahim, Belquis; Christoffels, Vincent M.; Moorman, Antoon F. M.; Püschel, Andreas W.

    2005-01-01

    The semaphorins are a large family of proteins involved in the patterning of both the vascular and the nervous systems. In order to analyze the function of the membrane-bound semaphorin 5A (Sema5A), we generated mice homozygous for a null mutation in the Sema5a gene. Homozygous null mutants die

  19. Validación de una metodología por cromatografía líquida de alta eficiencia para la determinación simultánea de vitaminas A, D3 y E en inyectables de uso veterinario Validação de metodologia por cromatografia líquida de alta eficiência para a determinação simultânea de vitaminas A, D3 e E em injetáveis de uso veterinário

    Directory of Open Access Journals (Sweden)

    Noralba Sierra

    2007-12-01

    Full Text Available Se presentan en este artículo los resultados del desarrollo y de la validación de una metodología analítica para la cuantificación simultánea de vitamina A palmitato, vitamina D3 y vitamina E acetato en inyectables de uso pecuario. El procedimiento consiste en una separación por cromatografía líquida de alta eficiencia (CLAE en fase inversa empleando como fase móvil una mezcla de acetonitrilo, metanol, agua (45:50:2.5, una columna C18 a 45 °C y detección a una longitud de onda de 280 nm. Se encontró que el método es selectivo, lineal y preciso. Estas características junto con su sencillez hacen que el método sea adecuado y conveniente para el objetivo propuesto. La robustez de la metodología fue también investigada. El método validado se aplicó para la determinación de las vitaminas en tres productos inyectables del mercado colombiano con registro sanitario del Instituto Colombiano Agropecuario (ICA.Neste artigo se apresentam os resultados do desenvolvimento e validação da metodologia analítica para a determinação simultânea de palmitato de vitamina A, vitamina D3 e vitamina E em injetáveis para uso de acetato na pecuária. O procedimento consiste na separação cromatográfica por cromatografia liquida de alta eficiência (CLAE em fase reversa, utilizando como fase móvel mistura de acetonitrila, metanol, água (45:50:2.5, coluna C18 a 45 °C e detecção em comprimento de onda de 280 nm. O método mostrou-se seletivo, linear e preciso. As características e a facilidade de execução do método indicam que ele é adequado e conveniente para o objetivo proposto. A robustez do método também foi pesquisada. O método validado foi aplicado para a determinação de vitaminas em três produtos injetáveis do mercado colombiano com registro no ICA (Instituto Colombiano Agropecuário.

  20. A genomic characterization of the influence of silver nanoparticles on bone differentiation in MC3T3-E1 cells.

    Science.gov (United States)

    Qing, Tao; Mahmood, Meena; Zheng, Yuanting; Biris, Alexandru S; Shi, Leming; Casciano, Daniel A

    2018-02-01

    Silver nanoparticles (AgNPs) have been widely used in a variety of biomedical applications. Previous studies demonstrated that AgNPs significantly enhanced bone cell mineralization and differentiation in MC3T3-1 cells, a model in vitro system, when compared to several other NPs. This increased bone deposition was evaluated by phenotypic measurements and assessment of the expression of miRNAs associated with regulation of bone morphogenic proteins. In the present study, we used RNA-seq technology, a more direct measurement of gene expression, to investigate further the mechanisms of bone differentiation induced by AgNP treatment. Key factors associated with the osteoclast pathway were significantly increased in response to AgNP exposure including Bmp4, Bmp6 and Fosl1. In addition, genes of metabolism and toxicity pathways were significantly regulated as well. Although this study suggests the potential for AgNPs to influence bone morphogenesis in injury or disease applications, further investigation into the efficacy and safety of AgNPs in bone regeneration is warranted. Copyright © 2017 John Wiley & Sons, Ltd.

  1. Approaches to lung cancer treatment using the CD3E x GP-2-directed bispecific monoclonal antibody BIS-1

    NARCIS (Netherlands)

    Kroesen, BJ; Nieken, J; Sleijfer, DT; Molema, G; deVries, EGE; Groen, HJM; Helfrich, W; The, TH; Mulder, NH; deLeij, L

    1997-01-01

    The bispecific monoclonal antibody (bsAb) BIS-1 combines a monoclonal-antibody(mAb)-defined specificity for the CD3 complex, as present on all T lymphocytes, with a mAb-defined specificity for the pancarcinoma/epithelium associated glycoprotein EGP-2. In vitro studies indicate that BIS-1 can direct

  2. Compounding of vitamin A, D3, E and K3 supplements for cystic fibrosis patients: formulation and stability study.

    Science.gov (United States)

    Huyghebaert, N; De Beer, J; Vervaet, C; Remon, J P

    2007-10-01

    Cystic fibrosis (CF) patients suffer from malabsorption of fat-soluble vitamins (A, D, E and K). These vitamins are available as water-dispersible (A, D(3) and E) or water-soluble grades (K(3)), which is favoured in CF patients as they fail to absorb oil-based products. The objective of this study was to determine stability of these raw materials after opening the original package and to develop a compounded formulation of acceptable quality, stability and taste, allowing flexible dose adaptation and being appropriate for administration to children and elderly people. The raw materials were stored after opening their original package for 8 months at 8 degrees C and room temperature (RT). Stability was assessed using a validated HPLC method after extraction of the vitamin from the cold water-soluble matrix (vitamin A acetate, D(3) and E) or using a spectrophotometrical method (vitamin K(3)). These materials were mixed with an appropriate lactose grade (lactose 80 m for vitamins A and D(3); lactose 90 m for vitamin E, lactose very fine powder for vitamin K(3)) and filled in hard gelatin capsules. Mass and content uniformity were determined and stability of the vitamins in the capsules was assessed after 2 months storage at 8 degrees C and RT. All raw materials showed good stability during storage in the opened original package for 8 months storage at 8 degrees C as well as RT (>95% of the initial content). The compounded formulations complied with the requirements of the European Pharmacopoeia for mass and content uniformity and can be stored for 2 months at 8 degrees C or RT while maintaining the vitamin content between 90% and 110%. As these fat-soluble vitamins are not commercially available on the Belgian market, compounded formulations are a valuable alternative for prophylactic administration of these vitamins to CF patients, i.e. a stable formulation, having an acceptable taste, allowing flexible dose adaptation and being appropriate for administration to children and elderly people.

  3. SVILUPPO DI UNA NUOVA MAIONESE FUNZIONALE RICCA IN ACIDI GRASSI OMEGA 3 E 6: CARATTERIZZAZIONE STRUMENTALE E SENSORIALE

    OpenAIRE

    D'Amore, Amalia

    2008-01-01

    Lo scopo primario della dieta è fornire nutrienti sufficienti a soddisfare le esigenze nutrizionali della persona. Sono sempre di più le prove scientifiche a sostegno dell’ipotesi che alcuni alimenti e componenti alimentari abbiano effetti benefici, fisiologici e psicologici, che vanno oltre l’apporto dei nutrienti di base. Tra i componenti alimentari biologicamente attivi e potenzialmente in grado di ottimizzare il benessere fisico e mentale e di ridurre il rischio di malattie ca...

  4. 3-{(E-[4-(4-Hydroxy-3-methoxyphenylbutan-2-ylidene]amino}-1-phenylurea: crystal structure and Hirshfeld surface analysis

    Directory of Open Access Journals (Sweden)

    Ming Yueh Tan

    2018-01-01

    Full Text Available Two independent molecules (A and B comprise the asymmetric unit of the title compound, C18H21N3O3. The urea moiety is disubstituted with one amine being linked to a phenyl ring, which is twisted out of the plane of the CN2O urea core [dihedral angles = 25.57 (11 (A and 29.13 (10° (B]. The second amine is connected to an imine (E conformation, which is linked in turn to an ethane bridge that links a disubstituted benzene ring. Intramolecular amine-N—H...N(imine and hydroxyl-O—H...O(methoxy hydrogen bonds close S(5 loops in each case. The molecules have twisted conformations with the dihedral angles between the outer rings being 38.64 (81 (A and 48.55 (7° (B. In the crystal, amide-N—H...O(amide hydrogen bonds link the molecules A and B via an eight-membered {...HNCO}2 synthon. Further associations between molecules, leading to supramolecular layers in the ac plane, are hydrogen bonds of the type hydroxyl-O—H...N(imine and phenylamine-N—H...O(methoxy. Connections between layers, leading to a three-dimensional architecture, comprise benzene-C—H...O(hydroxy interactions. A detailed analysis of the calculated Hirshfeld surfaces shows molecules A and B participate in very similar intermolecular interactions and that any variations relate to conformational differences between the molecules.

  5. Shield fabrication development of ITER primary wall modules by powder HIP. ITER task T216-Subtask 3E1

    International Nuclear Information System (INIS)

    Lind, A.

    1997-12-01

    A research and development program for the blanket shield in the International Thermonuclear Experimental Reactor (ITER) has been implemented to provide input for the design and manufacture of full scale production components. It comprises fabrication and testing of mock-ups and prototype modules. The design, materials, manufacture, examination, testing and inspection of the mock-ups representing future full scale production modules. This work applies to the development of a shield block fabrication method by Hot Isostatic Pressing (HIP) starting from a gas atomised powder and pre-fabricated cooling tube galleries. The size of the block is 1250 x 650 x 250 mm and the weight is about 1400 kg. Examination and testing of the block was performed to determine properties, achieved fabrication tolerances, and quality of bonding. It is concluded that the today's powder HIP route gives a 316 LN IG material with mechanical properties which fulfills the ITER material specification requirements and a fully dense block which is easy to examine with ultrasonic methods. The joints between tubes and matrix are excellent. In order to achieve and maintain accuracy in positioning of the tubes during fabrication improvements of the standard fabrication route have been identified, such as the positioning of tubes during welding, the powder particle distribution and the powder filling procedure. Modification of the actual HIP cycle may also be required

  6. Al2O3 e-Beam Evaporated onto Silicon (100)/SiO2, by XPS

    Energy Technology Data Exchange (ETDEWEB)

    Madaan, Nitesh; Kanyal, Supriya S.; Jensen, David S.; Vail, Michael A.; Dadson, Andrew; Engelhard, Mark H.; Samha, Hussein; Linford, Matthew R.

    2013-09-25

    We report the XPS characterization of a thin film of Al2O3 (35 nm) deposited via e-beam evaporation onto silicon (100). The film was characterized with monochromatic Al Ka radiation. An XPS survey scan, an Al 2p narrow scan, and the valence band spectrum were collected. The Al2O3 thin film is used as a diffusion barrier layer for templated carbon nanotube (CNT) growth in the preparation of microfabricated thin layer chromatography plates.

  7. Shield fabrication development of ITER primary wall modules by powder HIP. ITER task T216-Subtask 3E1

    Energy Technology Data Exchange (ETDEWEB)

    Lind, A

    1997-12-01

    A research and development program for the blanket shield in the International Thermonuclear Experimental Reactor (ITER) has been implemented to provide input for the design and manufacture of full scale production components. It comprises fabrication and testing of mock-ups and prototype modules. The design, materials, manufacture, examination, testing and inspection of the mock-ups representing future full scale production modules. This work applies to the development of a shield block fabrication method by Hot Isostatic Pressing (HIP) starting from a gas atomised powder and pre-fabricated cooling tube galleries. The size of the block is 1250 x 650 x 250 mm and the weight is about 1400 kg. Examination and testing of the block was performed to determine properties, achieved fabrication tolerances, and quality of bonding. It is concluded that the today`s powder HIP route gives a 316 LN IG material with mechanical properties which fulfills the ITER material specification requirements and a fully dense block which is easy to examine with ultrasonic methods. The joints between tubes and matrix are excellent. In order to achieve and maintain accuracy in positioning of the tubes during fabrication improvements of the standard fabrication route have been identified, such as the positioning of tubes during welding, the powder particle distribution and the powder filling procedure. Modification of the actual HIP cycle may also be required

  8. Evolution of Precipitation Particle Size Distributions within MC3E Systems and its Impact on Aerosol-Cloud-Precipitation Interactions

    Energy Technology Data Exchange (ETDEWEB)

    Grabowski, Wojciech [University Corporation for Atmospheric Research (UCAR), Boulder, CO (United States)

    2016-03-29

    This grant supported several observational and modeling activities as reviewed in the final report. Overall, over 20 papers (published, in press or still in preparation) acknowledge support from this grant; see the complete list in the final report (uploaded in this system).

  9. Cloud-Resolving Modeling Intercomparison Study of a Squall Line Case from MC3E - Properties of Convective Core

    Science.gov (United States)

    Fan, J.; Han, B.; Varble, A.; Morrison, H.; North, K.; Kollias, P.; Chen, B.; Dong, X.; Giangrande, S. E.; Khain, A.; Lin, Y.; Mansell, E.; Milbrandt, J.; Stenz, R.; Thompson, G.; Wang, Y.

    2016-12-01

    The large spread in CRM model simulations of deep convection and aerosol effects on deep convective clouds (DCCs) makes it difficult to (1) further our understanding of deep convection and (2) define "benchmarks" and then limit their use in parameterization developments. A constrained model intercomparsion study on a mid-latitude mesoscale squall line is performed using the Weather Research & Forecasting (WRF) model at 1-km horizontal grid spacing with eight cloud microphysics schemes to understand specific processes that lead to the large spreads of simulated convection and precipitation. Various observational data are employed to evaluate the baseline simulations. All simulations tend to produce a wider convective area but a much narrower stratiform area. The magnitudes of virtual potential temperature drop, pressure rise, and wind speed peak associated with the passage of the gust front are significantly smaller compared with the observations, suggesting simulated cool pools are weaker. Simulations generally overestimate the vertical velocity and radar reflectivity in convective cores compared with the retrievals. The modeled updraft velocity and precipitation have a significant spread across eight schemes. The spread of updraft velocity is the combination of both low-level pressure perturbation gradient (PPG) and buoyancy. Both PPG and thermal buoyancy are small for simulations of weak convection but both are large for those of strong convection. Ice-related parameterizations contribute majorly to the spread of updraft velocity, while they are not the reason for the large spread of precipitation. The understandings gained in this study can help to focus future observations and parameterization development.

  10. Titania nanotube delivery fetal bovine serum for enhancing MC3T3-E1 activity and osteogenic gene expression

    International Nuclear Information System (INIS)

    Peng, Jing; Zhang, Xinming; Li, Zhaoyang; Liu, Yunde; Yang, Xianjin

    2015-01-01

    Titania nanotube (TNT) delivery of fetal bovine serum (FBS) was conducted on titanium (Ti) to enhance bone tissue repair. Scanning electron microscopy (SEM) and energy dispersive spectrometer (EDS) showed FBS increased the tube wall thickness and decreased the tube diameter. Attenuated total reflectance Fourier transform infrared further confirmed that FBS completely covered the TNT and changed the surface composition. Water contact angle tests showed TNT/FBS possessed hydrophilic properties. Compared to original Ti, the TNT/FBS group had more attached osteoblasts after 2 h and enhanced filopodia growth at 0.5 h. Significantly, more osteoblasts were also observed on TNT/FBS after 7 d culturing. FBS was released steadily from TNT; about 70% of FBS had been released at 3 d and 90% at 5 d, as shown by the bicinchoninic acid method. TNT/FBS also enhanced subsequent osteoblast differentiation and gene expression; the quantum real-time polymerase chain reaction test showed that TNT/FBS up-regulated alkaline phosphatase and osteocalcin gene expression at 7 d and 14 d. Therefore, TNT/FBS delivered sustained in situ nutrition and enhanced osteoblast activity and osteogenic gene expression. - Highlights: • Fetal Bovine Serum (FBS) was filled in titania nanotube (TNT) structures. • FBS provided sustained-release in situ nutrition for surface osteoblast growth. • TNT/FBS enhanced osteoblast activity and osteogenic gene expression

  11. Synthetic Peptides Analogue to Enamel Proteins Promote Osteogenic Differentiation of MC3T3-E1 and Mesenchymal Stem Cells

    Czech Academy of Sciences Publication Activity Database

    Rubert, M.; Ramis, J. M.; Vondrášek, Jiří; Gaya, A.; Lyngstadaas, S. P.; Monjo, M.

    2011-01-01

    Roč. 1, č. 2 (2011), s. 198-209 ISSN 2157-9083 Grant - others:GA ČR(CZ) GAP302/10/0427 Institutional research plan: CEZ:AV0Z40550506 Keywords : proline-rich regions * synthetic peptides * bone formation * mineralization * In Vitro Subject RIV: EI - Biotechnology ; Bionics

  12. Completion of the L3 e.m. calorimeter with a lead-scintillating fibers spaghetti calorimeter

    International Nuclear Information System (INIS)

    Basti, G.; Boucham, A.; Campanelli, M.; Cecchi, C.; De Notaristefani, F.; Diemoz, M.; Ferroni, F.; Iaciofano, A.; Janssen, B.; Karyotakis, Y.; Lebeau, M.; Lesueur, J.; Longo, E.; Organtini, G.; Tsipolitis, Y.

    1995-01-01

    We report on the test-beam results for three prototype modules of a lead-scintillating fiber (spaghetti) calorimeter. We studied linearity, energy resolution and light collection. The results are in agreement with expectations from MC simulation. We also report on the studies for the optimal light guide to be used in the final design. (orig.)

  13. Enable, Engage and Evaluate: Introducing the 3E Social Media Strategy Canvas Based on the European Airline Industry

    NARCIS (Netherlands)

    Spil, Antonius A.M.; Effing, Robin; Both, Menno P.; Dwivedi, Yogesh K.; Mantymaki, Matti; Ravishankar, M.N.; Janssen, Marijn; Clement, Marc; Slade, Emma L.; Rana, Nripendra P.; Al-Sharhan, Salah; Simintiras, Antonis C.

    2016-01-01

    The strategic use of social media has increased in importance. However, there is a lack of theory to design and evaluate social media strategies. In a competitive environment, airlines need to excel on service, customer satisfaction and marketing. Social media could support those areas of business.

  14. The role of kaempferol-induced autophagy on differentiation and mineralization of osteoblastic MC3T3-E1 cells.

    Science.gov (United States)

    Kim, In-Ryoung; Kim, Seong-Eon; Baek, Hyun-Su; Kim, Bok-Joo; Kim, Chul-Hoon; Chung, In-Kyo; Park, Bong-Soo; Shin, Sang-Hun

    2016-08-31

    Kaempferol, a kind of flavonol, has been reported to possess various osteogenic biological activities, such as inhibiting bone resorption of osteoclasts and promoting the differentiation and mineralization of preosteoblasts. However, the precise cellular mechanism of action of kaempferol in osteogenesis is elusive. Autophagy is a major intracellular degradation system, which plays an important role in cell growth, survival, differentiation and homeostasis in mammals. Recent studies showed that autophagy appeared to be involved in the degradation of osteoclasts, osteoblasts and osteocytes, potentially pointing to a new pathogenic mechanism of bone homeostasis and bone marrow disease. The potential correlation between autophagy, osteogenesis and flavonoids is unclear. The present study verified that kaempferol promoted osteogenic differentiation and mineralization and that it elevated osteogenic gene expression based on alkaline phosphatase (ALP) activity, alizarin red staining and quantitative PCR. And then we found that kaempferol induced autophagy by acridine orange (AO) and monodansylcadaverine (MDC) staining and autophagy-related protein expression. The correlation between kaempferol-induced autophagy and the osteogenic process was confirmed by the autophagy inhibitor 3-methyladenine (3-MA). Kaempferol promoted the proliferation, differentiation and mineralization of osteoblasts at a concentration of 10 μM. Kaempferol showed cytotoxic properties at concentrations above 50 μM. Concentrations above 10 μM decreased ALP activity, whereas those up to 10 μM increased ALP activity. Kaempferol at concentrations up to 10 μM also increased the expression of the osteoblast- activated factors RUNX-2, osterix, BMP-2 and collagen I according to RT-PCR analyses. 10 μM or less, the higher of the concentration and over time, kaempferol promoted the activity of osteoblasts. Kaempferol induced autophagy. It also increased the expression of the autophagy-related factors beclin-1, SQSTM1/p62 and the conversion of LC3-II from LC3-I. The application of 3-MA decreased the activity of ALP and the autophagy induced by kaempferol. In the RT-PCR analysis, the expression of RUNX-2, osterix, BMP-2 and collagen I was decreased. The present study showed that kaempferol stimulated the osteogenic differentiation of cultured osteoblasts by inducing autophagy.

  15. (e,3e) and (e,3-1e) differential cross sections for the double ionization of water molecule

    International Nuclear Information System (INIS)

    Mansouri, A.; Dal Cappello, C.; Kada, I.; Champion, C.; Roy, A.C.

    2009-01-01

    We report new results for differential cross sections for the double ionization of water molecule by 1 keV electron impact. The present calculation is based on the first Born approximation. We describe the water molecule by a single centre wave function of Moccia. For the final state, an approximation of the well-known 3C wave function is used. An extensive study has been made by varying the angles of detection and the energies of each ejected electron. We have investigated the double ionization of each molecular state (1b 1 , 3a 1 , 1b 2 and 2a 1 ) and identified the mechanisms of this process.

  16. Titania nanotube delivery fetal bovine serum for enhancing MC3T3-E1 activity and osteogenic gene expression

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Jing, E-mail: pengjingtd@163.com [Airport College, Civil Aviation University of China, Tianjin 300300 (China); Zhang, Xinming, E-mail: xinmingmail@163.com [Tianjin Product Quality Inspection Technology Research Institute, Tianjin 300384 (China); School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Li, Zhaoyang [School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Liu, Yunde [School of Medical Laboratory, Tianjin Medical University, Tianjin 300203 (China); Yang, Xianjin [School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China)

    2015-11-01

    Titania nanotube (TNT) delivery of fetal bovine serum (FBS) was conducted on titanium (Ti) to enhance bone tissue repair. Scanning electron microscopy (SEM) and energy dispersive spectrometer (EDS) showed FBS increased the tube wall thickness and decreased the tube diameter. Attenuated total reflectance Fourier transform infrared further confirmed that FBS completely covered the TNT and changed the surface composition. Water contact angle tests showed TNT/FBS possessed hydrophilic properties. Compared to original Ti, the TNT/FBS group had more attached osteoblasts after 2 h and enhanced filopodia growth at 0.5 h. Significantly, more osteoblasts were also observed on TNT/FBS after 7 d culturing. FBS was released steadily from TNT; about 70% of FBS had been released at 3 d and 90% at 5 d, as shown by the bicinchoninic acid method. TNT/FBS also enhanced subsequent osteoblast differentiation and gene expression; the quantum real-time polymerase chain reaction test showed that TNT/FBS up-regulated alkaline phosphatase and osteocalcin gene expression at 7 d and 14 d. Therefore, TNT/FBS delivered sustained in situ nutrition and enhanced osteoblast activity and osteogenic gene expression. - Highlights: • Fetal Bovine Serum (FBS) was filled in titania nanotube (TNT) structures. • FBS provided sustained-release in situ nutrition for surface osteoblast growth. • TNT/FBS enhanced osteoblast activity and osteogenic gene expression.

  17. Sites of instability in the human TCF3 (E2A) gene adopt G-quadruplex DNA structures in vitro

    Science.gov (United States)

    Williams, Jonathan D.; Fleetwood, Sara; Berroyer, Alexandra; Kim, Nayun; Larson, Erik D.

    2015-01-01

    The formation of highly stable four-stranded DNA, called G-quadruplex (G4), promotes site-specific genome instability. G4 DNA structures fold from repetitive guanine sequences, and increasing experimental evidence connects G4 sequence motifs with specific gene rearrangements. The human transcription factor 3 (TCF3) gene (also termed E2A) is subject to genetic instability associated with severe disease, most notably a common translocation event t(1;19) associated with acute lymphoblastic leukemia. The sites of instability in TCF3 are not randomly distributed, but focused to certain sequences. We asked if G4 DNA formation could explain why TCF3 is prone to recombination and mutagenesis. Here we demonstrate that sequences surrounding the major t(1;19) break site and a region associated with copy number variations both contain G4 sequence motifs. The motifs identified readily adopt G4 DNA structures that are stable enough to interfere with DNA synthesis in physiological salt conditions in vitro. When introduced into the yeast genome, TCF3 G4 motifs promoted gross chromosomal rearrangements in a transcription-dependent manner. Our results provide a molecular rationale for the site-specific instability of human TCF3, suggesting that G4 DNA structures contribute to oncogenic DNA breaks and recombination. PMID:26029241

  18. Ácidos graxos ômega 3 e tratamento da esquizofrenia Omega 3 fatty acid and schizophrenia treatment

    Directory of Open Access Journals (Sweden)

    Juliane Costa Silva Zemdegs

    2010-01-01

    Full Text Available CONTEXTO: A esquizofrenia é uma desordem psiquiátrica complexa e debilitante cujo tratamento de base é realizado com medicamentos antipsicóticos. No entanto, evidências sugerem que a suplementação dietética com ácidos graxos ômega 3 (n-3 pode ser benéfica em diversas desordens psiquiátricas. OBJETIVO: Revisar a eficácia do n-3 como coadjuvante no tratamento farmacológico da esquizofrenia. MÉTODOS: Realizou-se uma pesquisa nas bases de dados eletrônicas Medline, Lilacs e SciELO. A estratégia de busca também incluiu a busca em árvore. Todos os estudos randomizados e controlados relevantes foram incluídos nesta revisão, independentemente do ano de publicação. RESULTADOS: Até o momento, foram divulgados seis estudos randomizados, duplo-cegos placebo controlados; cinco deles apresentaram resultados positivos na melhora dos sintomas da esquizofrenia, assinalando, ainda, superioridade do ácido graxo eicosapentaenoico (EPA em relação ao ácido graxo docosaexaenoico. Em geral, o consumo de 2 g/dia de EPA conjuntamente com a medicação antipsicótica usual parece reduzir a sintomatologia da esquizofrenia, particularmente os sintomas positivos. CONCLUSÃO: A terapia nutricional com EPA mostrou-se útil como coadjuvante no tratamento da esquizofrenia. Por conseguinte, sugere-se que os pacientes esquizofrênicos sejam encorajados a consumir refeições balanceadas e saudáveis ricas em EPA e, caso a quantidade ideal não seja atingida pela dieta, a suplementação pode ser benéfica.BACKGROUND: Schizophrenia is a complex and debilitating psychiatric disorder, whose primary pharmacological intervention is the use of antipsychotics. There is, however, growing evidence that dietary supplementation with omega 3 fatty acids (n-3 may be beneficial in several psychiatric conditions. OBJECTIVE: To review the efficacy of n-3 as a treatment for schizophrenia. METHODS: Electronic searches of the following databases were performed: Medline, Lilacs e SciELO. The search strategy also included cited reference searching. All relevant randomized controlled trials were included in the review. RESULTS: To date, five out of six randomized, double-blind, and placebo controlled studies obtained improvement in the symptoms of the psychosis. Besides, an advantage in the intake of eicosapentaenoic fatty acid (EPA in relation to docosahexaenoic fatty acid was designated. Essentially, the intake of 2 g/day of EPA in addition to the standard medication was effective in decreasing the symptoms of schizophrenia. DISCUSSION: The nutritional therapy with EPA revealed to be useful as coadjutant in the treatment of schizophrenia. Therefore, we suggest that the schizophrenic patients should be encouraged to consume balanced and healthy meals rich in EPA and, if the ideal amount is not reached by the diet, the supplementation is likely to be beneficial.

  19. Fission cross section of 245Cm from 10-3 eV to 104 eV

    International Nuclear Information System (INIS)

    White, R.M.; Browne, J.C.; Howe, R.E.; Landrum, J.H.; Becker, J.A.

    1979-01-01

    The neutron-induced fission cross section of 245 Cm measured from .001 eV to 10 keV using the LLL 100-MeV Linac. The resonance data are analyzed with a multilevel-multichannel R-matrix code. The statistical distribution of R-matrix parameters extracted from the analysis are investigated and comparisons are made with previous work. 4 reference

  20. GPM GROUND VALIDATION NOAA S-BAND PROFILER RAW DATA NETCDF FORMAT MC3E V1

    Data.gov (United States)

    National Aeronautics and Space Administration — The S-band Profiler Raw dataset was saved in two data formats: netCDF anda proprietary Vaisala SPC format. The numeric values in both formats are exactly the same....

  1. Radio frequency shielding behaviour of silane treated Fe2O3/E-glass fibre reinforced epoxy hybrid composite

    Science.gov (United States)

    Arun prakash, V. R.; Rajadurai, A.

    2016-10-01

    In this work, radio frequency shielding behaviour of polymer (epoxy) matrixes composed of E-glass fibres and Fe2O3 fillers have been studied. The principal aim of this project is to prepare suitable shielding material for RFID application. When RFID unit is pasted on a metal plate without shielding material, the sensing distance is reduced, resulting in a less than useful RFID system. To improve RF shielding of epoxy, fibres and fillers were utilized. Magnetic behaviour of epoxy polymer composites was measured by hysteresis graphs (B-H) followed by radio frequency identifier setup. Fe2O3 particles of sizes 800, 200 and 100 nm and E-glass fibre woven mat of 600 g/m2 were used to make composites. Particle sizes of 800 nm and 200 nm were prepared by high-energy ball milling, whereas particles of 100 nm were prepared by sol-gel method. To enhance better dispersion of particles within the epoxy matrix, a surface modification process was carried out on fillers by an amino functional coupling agent called 3-Aminopropyltrimethoxysilane (APTMS). Crystalline and functional groups of siliconized Fe2O3 particles were characterized by XRD and FTIR spectroscopy analysis. Variable quantity of E-glass fibre (25, 35, and 45 vol%) was laid down along with 0.5 and 1.0 vol% of 800, 200, and 100 nm size Fe2O3 particles into the matrix, to fabricate the hybrid composites. Scanning electron microscopy and transmission electron microscopy images reveal the shape and size of Fe2O3 particles for different milling times and particle dispersion in the epoxy matrix. The maximum improved sensing distance of 45.2, 39.4 and 43.5 % was observed for low-, high-, and ultra-high radio frequency identifier setup along with shielding composite consist of epoxy, 1 vol% 200 nm Fe2O3 particles and 45 vol% of E-glass fibre.

  2. N-{(Z-3-Oxo-3-[(E-(pyridin-2-ylmethyldiazenyl]-1-(thiophen-2-ylprop-1-en-2-yl}benzamide

    Directory of Open Access Journals (Sweden)

    Devinder K. Sharma

    2016-08-01

    Full Text Available In the title compound, C20H16N4O2S, the thiophene ring subtends dihedral angles of 58.6 (3 and 9.8 (3° with the benzamide and pyridine rings, respectively, whereas these two rings are inclined to one another by 59.3 (3°. There is an intramolecular C—H...π interaction present involving the pyridine and benzamide rings. In the crystal, molecules are linked by N—H...O hydrogen bonds, forming chains along the [010] direction. The chains are linked by C—H...S hydrogen bonds and C—H...π interactions, forming sheets parallel to the ab plane.

  3. Optical properties of TiBe2 in the range from 0.5 to 3.3 eV

    NARCIS (Netherlands)

    Wijers, C.; Groot, R.A. de; Vroomen, A.R. de; Mueller, F.M.

    1984-01-01

    The optical properties of polycrystalline TiBe2 have been determined by ellipsometry in the visible and infrared region. The most predominant features of the spectra are in excellent agreement with a calculation of the optical conductivity.

  4. TCR's genetically linked to CD28 and CD3e do not mispair with endogous TCR chains and mediate enhanced T cell persistance and anti-melanoma activity

    NARCIS (Netherlands)

    Govers, C.C.F.M.; Sebestyen, Z.; Roszik, J.; Brakel, van M.; Berrevoets, C.; Szoor, A.; Panoutsopoulou, K.; Broertjes, M.; Van, T.; Vereb, G.; Szollosi, J.; Debets, R.

    2014-01-01

    Adoptive transfer of T cells that are gene engineered to express a defined TCR represents a feasible and promising therapy for patients with tumors. However, TCR gene therapy is hindered by the transient presence and effectiveness of transferred T cells, which are anticipated to be improved by

  5. Eukaryotic initiation factor 3 (eIF3) and 5’ mRNA leader sequences as agents of translational regulation in Arabidopsis. Final report

    Energy Technology Data Exchange (ETDEWEB)

    von Arnim, Albrecht G. [Univ. of Tennessee, Knoxville, TN (United States)

    2015-02-04

    Protein synthesis, or translation, consumes a sizable fraction of the cell’s energy budget, estimated at 5% and up to 50% in differentiated and growing cells, respectively. Plants also invest significant energy and biomass to construct and maintain the translation apparatus. Translation is regulated by a variety of external stimuli. Compared to transcriptional control, attributes of translational control include reduced sensitivity to stochastic fluctuation, a finer gauge of control, and more rapid responsiveness to environmental stimuli. Yet, our murky understanding of translational control allows few generalizations. Consequently, translational regulation is underutilized in the context of transgene regulation, although synthetic biologists are now beginning to appropriate RNA-level gene regulation into their regulatory circuits. We also know little about how translational control contributes to the diversity of plant form and function. This project explored how an emerging regulatory mRNA sequence element, upstream open reading frames (uORFs), is integrated with the general translation initiation machinery to permit translational regulation on specific mRNAs.

  6. Crystal structure of (2E,3E-N2,N3-bis(3-ethyl-[1,1′-biphenyl]-4-ylbutane-2,3-diimine

    Directory of Open Access Journals (Sweden)

    Yan Zhao

    2015-04-01

    Full Text Available In the title compound, C32H32N2, synthesized by the condensation reaction of 2-ethyl-4-phenylaniline and 2,3-butanedione, the conformation about the C=N bonds is E and the substituted biphenyl units are trans to one another. In the two biphenyl ring systems, the planes of the two rings are inclined to one another by 25.25 (19 and 28.01 (19°. The planes of the ethyl-substituted benzene rings are inclined to one another by 20.23 (19° and to the mean plane of the butane-2,3-diimine unit [maximum deviation = 0.014 (4 Å] by 83.19 (19 and 63.38 (19°. In the crystal, molecules are linked by C—H...π interactions, forming sheets lying parallel to (101.

  7. Biotransformation of (±)-4,8-dimethylcyclodeca-3(E),7(E)-dien-1β-ol and (+)-Hedycaryol by Cichorium intybus.

    NARCIS (Netherlands)

    Piet, Dennis P.; Minnaard, Adriaan J.; Heyden, Karel A. van der; Franssen, Maurice C.R.; Wijnberg, Joannes B.P.A.; Groot, Aede de

    1995-01-01

    The biotransformation of the synthetic (E,E)-1,5-cyclodecadienol 5 and (+)-hedycaryol (11) by a root suspension of fresh chicory has been investigated. Incubation of 5 with a root suspension gave a 2 : 1 mixture of the epimeric eudesmanediols 7a and 7b whereas 11 was selectively converted into

  8. 3-{2-[(3-{(E-2-[4-(Dimethylaminophenyl]ethenyl}quinoxalin-2-yloxy]ethyl}-1,3-oxazolidin-2-one monohydrate

    Directory of Open Access Journals (Sweden)

    Youssef Ramli

    2012-01-01

    Full Text Available In the title compound, C23H24N4O3·H2O, the 1,3-oxazoline ring is nearly planar [maximum deviation = 0.059 (2 Å] and its mean plane is twisted by 30.12 (8° with respect to the quinoxaline fused-ring system; the benzene ring is nearly coplanar with the quinoxaline fused-ring system [dihedral angle = 2.52 (2°]. The water molecule of crystallization is hydrogen-bond donor to an N atom of the quinoxaline ring system as well as an O atom of the oxazolinone unit, the two hydrogen bonds generating a chain running along the c axis.

  9. EMC3-eIRENE simulation of impurity transport in comparison with EUV emission measurements in the stochastic layer of LHD: effects of force balance and transport coefficients

    Energy Technology Data Exchange (ETDEWEB)

    Dai, S. [National Institute for Fusion Science, Toki (Japan); Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Ministry of Education), School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian (China); Kobayashi, M.; Morita, S.; Oishi, T.; Suzuki, Y. [National Institute for Fusion Science, Toki (Japan); Department of Fusion Science, School of Physical Sciences, SOKENDAI (The Graduate University for Advanced Studies), Toki (Japan); Kawamura, G. [National Institute for Fusion Science, Toki (Japan); Zhang, H.M.; Huang, X.L. [Department of Fusion Science, School of Physical Sciences, SOKENDAI (The Graduate University for Advanced Studies), Toki (Japan); Feng, Y. [Max-Planck-Institut fuer Plasmaphysik, Greifswald (Germany); Wang, D.Z. [Key Laboratory of Materials Modification by Laser, Ion and Electron Beams (Ministry of Education), School of Physics and Optoelectronic Technology, Dalian University of Technology, Dalian (China); Collaboration: The LHD experiment group

    2016-08-15

    The transport properties and line emissions of the intrinsic carbon in the stochastic layer of the Large Helical Device have been investigated with the three-dimensional edge transport code EMC3-EIRENE. The simulations of impurity transport and emissivity have been performed to study the dedicated experiment in which the carbon emission distributions are measured by a space-resolved EUV spectrometer system. A discrepancy of the CIV impurity emission between the measurement and simulation is obtained, which is studied with the variation of the ion thermal force, friction force and the perpendicular diffusivity in the impurity transport model. An enhanced ion thermal force or a reduced friction force in the modelling can increase the CIV impurity emission at the inboard X-point region. Furthermore, the impact of the perpendicular diffusivity Dimp is studied which shows that the CIV impurity emission pattern is very sensitive to Dimp. It is found that the simulation results with the increased Dimp tend to be closer to the experimental observation. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place. Part 3 (E&E Reisen - Hiawatha Rubber Co)

    Science.gov (United States)

    1990-01-01

    w ui 3j W3A b a w ww w w u i U j L A u a w Wa 4*to a o a N C4 anL (a "Cc cm em an a aD a A a GOO F6 46 404 S. >0 I.J man com 04 R 12 CM e4cc ~ m I...I WC: I co r aCCa 001 I-I 0. 0 NCJ o #1.U0 1-- 44 4 -4W C )C (JN -4~y 001 4 4 1I~ C’I1- mmcoco 44 I I. 4 C . a I- U. >- -4.- 010 00 - 1 . Za -C 4 vm...6W1-6z x. z-z- U~.L 4c -C I.--.4- z~L L W~mm 09~ ac -4- U..CI -I io ACLZ 0 U 3 0 0 (0 62 0 z I. zzz (A 6 000 Csd 314" 6 6 CA (ft 4.WU U . U A F4 F6 I I

  11. Knockdown of Indian hedgehog protein induces an inhibition of cell growth and differentiation in osteoblast MC3T3-E1 cells

    OpenAIRE

    Deng, Ang; Zhang, Hongqi; Hu, Minyu; Liu, Shaohua; Gao, Qile; Wang, Yuxiang; Guo, Chaofeng

    2017-01-01

    Indian hedgehog protein (Ihh) is evolutionarily conserved and serves important roles in controlling the differentiation of progenitor cells into osteoblasts. Ihh null mutant mice exhibit a failure of osteoblast development in endochondral bone. Although studies have demonstrated that Ihh signaling is a potent local factor that regulates osteoblast differentiation, the specific transcription factors that determine osteoblast differentiation remain unclear. Further studies are required to deter...

  12. Structure of a yeast 40S-eIF1-eIF1A-eIF3-eIF3j initiation complex.

    Science.gov (United States)

    Aylett, Christopher H S; Boehringer, Daniel; Erzberger, Jan P; Schaefer, Tanja; Ban, Nenad

    2015-03-01

    Eukaryotic translation initiation requires cooperative assembly of a large protein complex at the 40S ribosomal subunit. We have resolved a budding yeast initiation complex by cryo-EM, allowing placement of prior structures of eIF1, eIF1A, eIF3a, eIF3b and eIF3c. Our structure highlights differences in initiation-complex binding to the ribosome compared to that of mammalian eIF3, demonstrates a direct contact between eIF3j and eIF1A and reveals the network of interactions between eIF3 subunits.

  13. The genetic impact of the Lake Chad Basin population in North Africa as documented by mitochondrial diversity and internal variation of the L3e5 haplogroup

    Czech Academy of Sciences Publication Activity Database

    Podgorná, E.; Soares, P.; Pereira, L.; Černý, Viktor

    2013-01-01

    Roč. 77, č. 6 (2013), s. 513-523 ISSN 0003-4800 R&D Projects: GA ČR GA13-37998S Institutional support: RVO:67985912 Keywords : Africa * mtDNA * migration * Holocene Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.926, year: 2013

  14. Crystal structure of 2-hydroxy-N-(2-hydroxyethyl-N-{2-hydroxy-3-[(E-N-hydroxyethanimidoyl]-5-methylbenzyl}ethanaminium acetate monohydrate

    Directory of Open Access Journals (Sweden)

    Gary S. Nichol

    2015-03-01

    Full Text Available The structure of the title hydrated molecular salt, C14H23N2O4+·C2H3O2−·H2O, was determined as part of a wider study on the use of the molecule as a polydentate ligand in the synthesis of MnIII clusters with magnetic properties. The cation features intramolecular O—H...N and N—H...O hydrogen-bond interactions. The crystal structure features a range of intermolecular hydrogen-bonding interactions, principally O—H...O interactions between all three species in the asymmetric unit. An R24(8 graph-set hydrogen-bonding motif between the anion and water molecules serves as a unit which links to the cation via the diethanolamine group. Each O atom of the acetate anion accepts two hydrogen bonds.

  15. Cloud-resolving model intercomparison of an MC3E squall line case: Part I-Convective updrafts: CRM Intercomparison of a Squall Line

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Jiwen [Pacific Northwest National Laboratory, Richland Washington USA; Han, Bin [Pacific Northwest National Laboratory, Richland Washington USA; School of Atmospheric Sciences, Nanjing University, Nanjing China; Varble, Adam [Department of Atmospheric Sciences, University of Utah, Salt Lake City Utah USA; Morrison, Hugh [National Center for Atmospheric Research, Boulder Colorado USA; North, Kirk [Department of Atmospheric and Oceanic Sciences, McGill University, Montreal Quebec USA; Kollias, Pavlos [Department of Atmospheric and Oceanic Sciences, McGill University, Montreal Quebec USA; School of Marine and Atmospheric Sciences, Stony Brook University, Stony Brook New York USA; Chen, Baojun [School of Atmospheric Sciences, Nanjing University, Nanjing China; Dong, Xiquan [Department of Hydrology and Atmospheric Sciences, University of Arizona, Tucson Arizona USA; Giangrande, Scott E. [Environmental and Climate Sciences Department, Brookhaven National Laboratory, Upton New York USA; Khain, Alexander [The Institute of the Earth Science, The Hebrew University of Jerusalem, Jerusalem Israel; Lin, Yun [Department of Atmospheric Sciences, Texas A& M University, College Station Texas USA; Mansell, Edward [NOAA/OAR/National Severe Storms Laboratory, Norman Oklahoma USA; Milbrandt, Jason A. [Meteorological Research Division, Environment and Climate Change Canada, Dorval Canada; Stenz, Ronald [Department of Atmospheric Sciences, University of North Dakota, Grand Forks North Dakota USA; Thompson, Gregory [National Center for Atmospheric Research, Boulder Colorado USA; Wang, Yuan [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena California USA

    2017-09-06

    A constrained model intercomparison study of a mid-latitude mesoscale squall line is performed using the Weather Research & Forecasting (WRF) model at 1-km horizontal grid spacing with eight cloud microphysics schemes, to understand specific processes that lead to the large spread of simulated cloud and precipitation at cloud-resolving scales, with a focus of this paper on convective cores. Various observational data are employed to evaluate the baseline simulations. All simulations tend to produce a wider convective area than observed, but a much narrower stratiform area, with most bulk schemes overpredicting radar reflectivity. The magnitudes of the virtual potential temperature drop, pressure rise, and the peak wind speed associated with the passage of the gust front are significantly smaller compared with the observations, suggesting simulated cool pools are weaker. Simulations also overestimate the vertical velocity and Ze in convective cores as compared with observational retrievals. The modeled updraft velocity and precipitation have a significant spread across the eight schemes even in this strongly dynamically-driven system. The spread of updraft velocity is attributed to the combined effects of the low-level perturbation pressure gradient determined by cold pool intensity and buoyancy that is not necessarily well correlated to differences in latent heating among the simulations. Variability of updraft velocity between schemes is also related to differences in ice-related parameterizations, whereas precipitation variability increases in no-ice simulations because of scheme differences in collision-coalescence parameterizations.

  16. Thermal analysis and phase diagrams of the LiF BiF3 e NaF BiF3 systems

    International Nuclear Information System (INIS)

    Nakamura, Gerson Hiroshi de Godoy

    2013-01-01

    Investigations of the binary systems LiF-BiF 3 and NaF-BiF 3 were performed with the objective of clarifying the thermal behavior and phase equilibria of these systems and their intermediary phases, an important requisite for high-quality crystal growth. Several samples in the entire range of compositions (0 to 100 mol% BiF 3 ) of both systems were subjected to experiments of differential thermal analysis (DTA) and thermogravimetry (TG), and also of differential scanning calorimetry (DSC). A few specific compositions were selected for X-ray diffraction to supplement the experimental data. Due to the high vulnerability of BiF 3 to oxygen contamination, its volatility and propensity to destroy metal parts upon heating, it was necessary to determine the optimal conditions for thermal analysis before investigating the systems themselves. Phase relations in the system LiF-BiF 3 were completely clarified and a phase diagram was calculated and evaluated via the commercial software Factsage. The diagram itself consists in a simple peritectic system in which the only intermediary compound, LiBiF 4 , decomposes into LiF and a liquid phase. The NaF-BiF 3 system could not be completely elucidated and the phase relations in the NaF poor side (> 50% BiF 3 ) are still unknown. In the NaF rich side, however, the possible peritectoid decomposition of the compound NaBiF 4 was identified. In both systems X-ray diffraction yielded crystal structures discrepant with the literature for the intermediary phases, LiBiF 4 , NaBiF 4 and a solid solution of NaF and BiF 3 called I. The observed structures remain unknown and explanations for the discrepancies were proposed. (author)

  17. Ácido Giberélico (GA3 e maturação de frutos das tangerinas 'Mexerica Montenegrina'e 'Poncã'

    Directory of Open Access Journals (Sweden)

    Marur Celso Jamil

    1999-01-01

    Full Text Available Na região norte do estado do Paraná, Brasil, as tangerinas `Ponkan' (Citrus reticulata e `Montenegrina' (Citrus deliciosa geralmente são colhidas em maio e julho, respectivamente. Aplicações de produtos à base de GA3 podem estender o período de produção, permitindo aos produtores programar a colheita e obter melhores preços. Neste trabalho foi estudado o efeito do GA3 sobre a maturação dos frutos de ambas as espécies, nos anos de 1996 e 1997. Os tratamentos constaram de concentrações compreendidas entre 20 e 60 mg L-1 de GA3 aplicadas ao início da mudança de cor dos frutos e quando a coloração alaranjada estava mais avançada. A cada 21 dias a maturação dos frutos foi visualmente avaliada e 6 frutos por parcela foram amostrados para análises do grau Brix e acidez. Com os resultados obtidos, pode-se concluir que a aplicação do produto parece ser mais eficiente quando efetuada no início de mudança de coloração do fruto, por mantê-los verdes por um período maior. Para ambas as espécies parece não ter havido diferenças entre as concentrações do produto, que estenderam o período de colheita por aproximadamente 3 semanas. Verificou-se, também, que o produto aplicado agiu somente na aparência da casca, sem alterar as características do suco.

  18. Aplicação de AG3 e CPPU na qualidade da uva 'Itália' em Porto Feliz-SP

    Directory of Open Access Journals (Sweden)

    Alessandro Rodrigues

    2011-03-01

    Full Text Available A videira 'Itália' (Vitis vinifera L. é a cultivar de uva fina para mesa mais consumida no Brasil. A qualidade dos cachos é uma característica fundamental, sendo o tamanho das bagas o componente mais valorizado pelos consumidores. Uma das alternativas para incrementar a qualidade das bagas é o uso de biorreguladores. Avaliaram-se, em três ciclos de produção, os efeitos de doses de ácido giberélico (AG3 isolado e associado com forchlorfenuron (CPPU, na qualidade dos cachos de uva Itália produzida em Porto Feliz-SP. A aplicação dos biorreguladores foi realizada aos 25 dias após o florescimento, em delineamento experimental inteiramente casualizado, em fatorial 4X4 (zero, 10; 20 e 30 mg L-1 AG3 X zero, 5; 10 e 15 mg L-1 CPPU, com oito repetições para o primeiro ciclo, e fatorial 3X3 (zero, 20 e 30 mg L-1 AG3 X zero, 10 e 20 mg L-1 CPPU com dez repetições para o segundo e terceiro ciclos. A mistura de 20 mg L-1 de AG3 com 10 mg L-1 de CPPU promoveu o incremento do comprimento e do diâmetro das bagas sem prejuízo da massa dos cachos, melhorando sua qualidade, em Porto Feliz-SP. O uso de CPPU isoladamente acarretou em redução do teor de sólidos solúveis das bagas.

  19. The Effect of Exogenous Zinc Concentration on the Responsiveness of MC3T3-E1 Pre-Osteoblasts to Surface Microtopography: Part II (Differentiation

    Directory of Open Access Journals (Sweden)

    Kathryn Dorst

    2014-02-01

    Full Text Available Osseointegration of bone implants is a vital part of the recovery process. Numerous studies have shown that micropatterned geometries can promote cell-substrate associations and strengthen the bond between tissue and the implanted material. As demonstrated previously, exogenous zinc levels can influence the responsiveness of pre-osteoblasts to micropatterns and modify their migratory behavior. In this study, we sought to determine the effect of exogenous zinc on differentiation of osteoblasts cultured on micropatterned vs. planar substrates. Levels of activated metalloproteinase-2 (MMP-2 and transforming growth factor-beta 1 (TGF-β1, as well as early stage differentiation marker alkaline phosphatase, were altered with the addition of zinc. These results suggest that exogenous zinc concentration and micropatterning may interdependently modulate osteoblast differentiation.

  20. Manual risk zoning wind turbines. Final version. 3rd updated version May 2013. 3 ed.; Handboek risicozonering windturbines. Eindversie. 3e geactualiseerde versie mei 2013

    Energy Technology Data Exchange (ETDEWEB)

    Faasen, C.J.; Franck, P.A.L.; Taris, A.M.H.W. [DNV KEMA, Arnhem (Netherlands)

    2013-05-15

    The title manual has been drafted to be able to quickly inventory the safety risks of wind turbines, which can speed up the licensing procedures for the installation of wind turbines. Attention is paid to the following categories: building areas, roads, waterways, railroads, industrial areas, underground cables and mains, aboveground cables, power transmission lines, dikes and dams, and telecommunication. For each of these categories the risks are calculated. This is an updated version of the manual which was first published in 2000 and updated in 2005 [Dutch] Dit is een actualisatie van het Handboek uit 2005. Het oorspronkelijke Handboek is in 2000 opgesteld. Het in 2000 verschenen Handboek is door ECN samengesteld in opdracht van Novem (nu: Agentschap NL) met als doel een uniforme methode te bieden voor het uitvoeren van kwantitatieve risicoanalyses en voor het toetsen van de resultaten aan acceptatiecriteria. Dit Handboek bood antwoord op de vraag van zowel projectontwikkelaars als overheden naar een algemeen geldende methode om veiligheidsrisico's van windturbines te berekenen voor diverse omgevingsaspecten. In 2005 is een actualisatie van het Handboek uitgebracht door ECN en KEMA in opdracht van SenterNovem (nu onderdeel van Agentschap NL). Daarin is verder ingegaan op turbines met grotere vermogens en is het Handboek aangevuld met rekenvoorbeelden. Vanwege de verdere ontwikkeling van de windturbinetechnologie, aangepaste wetgeving, het feit dat rekenmodellen verouderd waren en dat diverse infrastructuur steeds vaker gebundeld of geclusterd met windturbines wordt gerealiseerd, is het wenselijk / noodzakelijk de eventuele risico's op een consistente en eenduidige wijze in kaart te brengen. Daarom heeft Agentschap NL in 2012 opdracht gegeven aan DNV KEMA om het Handboek opnieuw te actualiseren. Hierbij zijn de resultaten van het rapport: 'Rekenmethodiek zonering windturbines in relatie tot gas- en elektrische infrastructuur' (2012), dat in opdracht van Gasunie en TenneT tot stand is gekomen, overgenomen. In dat rapport zijn nieuwe faalfrequenties voor windturbines afgeleid, is een aanpassing van de rekenmodellen van gasinfrastructuur doorgevoerd en zijn rekenmodellen voor hoogspanningsinfrastructuur toegevoegd.

  1. POLIMERIZACIÓN ESTEREOSELECTIVA DE ESTIRENO CON PRECURSORES CATALÍTICOS DE CpTiCl3 e IndTiCl3

    Directory of Open Access Journals (Sweden)

    Alexander Contreras

    2008-02-01

    Full Text Available En este trabajo se realizaron reacciones de polimerización estereoselectiva de estireno con los precursores catalíticos( 5-ciclopentadienil-triclorotitanio [1] e (5-indenil-triclorotitanio [2] utilizando polimetilaluminoxano (MAO como cocatalizador. Se encontró que la polimerización de 1/MAO sólo requiere de relaciones de Al/Ti de 3500 con una actividad de 1,31 x 107g/mol2.h a 50 °C (diez veces superior a la conocida hasta el momento disminuyendo la cantidad de cocatalizador, precursor catalítico y tiempo de reacción. La polimerización de 2/MAO presenta una mayor actividad (1,9 x 107g/mol2.h y estereoselectividad (96,8% sindiotáctico que 1/MAO en las mismas condiciones de polimerización y alcanzando un valor máximo de 3,5 x 107 (g/mol2h a valores Al/Ti de 4000. El poliestireno sindiotáctico obtenido en estas reacciones fue caracterizado completamente por IR, DSC solubilidad y pesomolecular por viscosimetría.

  2. Proliferation and differentiation of osteoblast-like MC3T3-E1 cells ons biomimetically and electrolytically deposited calcium phosphate coatings

    NARCIS (Netherlands)

    Wang, J.; de Boer, Jan; de Groot, K.

    2009-01-01

    Biomimetic and electrolytic deposition are versatile methods to prepare calcium phosphate coatings. In this article, we compared the effects of biomimetically deposited octacalcium phosphate and carbonate apatite coatings as well as electrolytically deposited carbonate apatite coating on the

  3. Effects of density functionals and dispersion interactions on geometries, bond energies and harmonic frequencies of Etbnd UX3 (E = N, P, CH; X = H, F, Cl)

    Science.gov (United States)

    Pandey, Krishna Kumar; Patidar, Pankaj; Patidar, Sunil Kumar; Vishwakarma, Ravi

    2014-12-01

    Quantum-chemical calculations have been performed to evaluate the geometries, bonding nature and harmonic frequencies of the compounds [Etbnd UX3] at DFT, DFT-D3, DFT-D3(BJ) and DFT-dDSc levels using different density functionals BP86, BLYP, PBE, revPBE, PW91, TPSS and M06-L. The stretching frequency of Utbnd N bond in [Ntbnd UF3] calculated with DFT/BLYP closely resembles with the experimental value. The performance of different density functionals for accurate Utbnd N vibrational frequencies follows the order BLYP > revPBE > BP86 > PW91 > TPSS > PBE > M06-L. The BLYP functional gives accurate value of the Utbnd E bond distances. The uranium atom in the studied compounds [Etbnd UX3] is positively charged. Upon going from [Etbnd UF3] to [Etbnd UCl3], the partial Hirshfeld charge on uranium atom decreases because of the lower electronegativity of chlorine compared to flourine. The Gopinathan-Jug bond order for Utbnd E bonds ranges from 2.90 to 3.29. The Utbnd E bond dissociation energies vary with different density functionals as M06-L < TPSS < BLYP < revPBE < BP86 < PBE ≈ PW91. The orbital interactions ΔEorb, in all studied compounds [Etbnd UX3] are larger than the electrostatic interaction ΔEelstat, which means the Utbnd N bonds in these compound have greater degree of covalent character (in the range 63.8-77.2%). The Usbnd E σ-bonding interaction is the dominant bonding interaction in the nitride and methylidyne complexes while it is weaker in [Ptbnd UX3]. The dispersion energy contributions to the total bond dissociation energies are rather small. Compared to the Grimme's D3(BJ) corrections, the Corminboeuf's dispersion corrections are larger with metaGGA functionals (TPSS, M06-L) while smaller with GGA functionals.

  4. The Einstein Observatory catalog of IPC x ray sources. Volume 3E: Right ascension range 04h 00m to 07h 59m

    Science.gov (United States)

    Harris, D. E.; Forman, W.; Gioia, I. M.; Hale, J. A.; Harnden, F. R., Jr.; Jones, C.; Karakashian, T.; Maccacaro, T.; Mcsweeney, J. D.; Primini, F. A.

    1993-01-01

    The Einstein Observatory (HEAO-2, launched November 13, 1978) achieved radically improved sensitivity over previous x-ray missions through the use of focusing optics which simultaneously afforded greatly reduced background and produced true images. During its 2.5-yr mission, the Einstein X-Ray Telescope was pointed toward some 5,000 celestial targets, most of which were detected, and discovered several thousand additional 'serendipitous' sources in the observed fields. This catalog contains contour diagrams and source data, obtained with the imaging proportional counter in the 0.16 to 3.5 keV energy band, and describes methods for recovering upper limits for any sky position within the observed images. The main catalog consists of six volumes (numbered 2 through 7) of right ascension ordered pages, each containing data for one observation. Along with the primary documentation describing how the catalog was constructed, volume 1 contains a complete source list, results for merged fields, a reference system to published papers and data useful for calculating upper limits and fluxes.

  5. Thermal analysis and phase diagrams of the LiF BiF{sub 3} e NaF BiF{sub 3} systems; Analise termica e diagramas de fase dos sistemas LiF-BiF{sub 3} e NaF-BiF{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, Gerson Hiroshi de Godoy

    2013-07-01

    Investigations of the binary systems LiF-BiF{sub 3} and NaF-BiF{sub 3} were performed with the objective of clarifying the thermal behavior and phase equilibria of these systems and their intermediary phases, an important requisite for high-quality crystal growth. Several samples in the entire range of compositions (0 to 100 mol% BiF{sub 3}) of both systems were subjected to experiments of differential thermal analysis (DTA) and thermogravimetry (TG), and also of differential scanning calorimetry (DSC). A few specific compositions were selected for X-ray diffraction to supplement the experimental data. Due to the high vulnerability of BiF{sub 3} to oxygen contamination, its volatility and propensity to destroy metal parts upon heating, it was necessary to determine the optimal conditions for thermal analysis before investigating the systems themselves. Phase relations in the system LiF-BiF{sub 3} were completely clarified and a phase diagram was calculated and evaluated via the commercial software Factsage. The diagram itself consists in a simple peritectic system in which the only intermediary compound, LiBiF{sub 4}, decomposes into LiF and a liquid phase. The NaF-BiF{sub 3} system could not be completely elucidated and the phase relations in the NaF poor side (> 50% BiF{sub 3}) are still unknown. In the NaF rich side, however, the possible peritectoid decomposition of the compound NaBiF{sub 4} was identified. In both systems X-ray diffraction yielded crystal structures discrepant with the literature for the intermediary phases, LiBiF{sub 4}, NaBiF{sub 4} and a solid solution of NaF and BiF{sub 3} called {sup I.} The observed structures remain unknown and explanations for the discrepancies were proposed. (author)

  6. Efeito de ácido giberélico, GA3, e GA4 + GA7 em pós-colheita de crisântemo e solidago.

    Directory of Open Access Journals (Sweden)

    Denise Laschii

    1999-05-01

    Full Text Available O experimento foi instalado no laboratório do Departamento de Horticultura da FCA/ UNESP, no período de 14 de novembro a 3 de dezembro de 1998. As hastes de crisântemo (Dendranthema grandiflora Tzvelev e solidago (Solidago canadensis L. foram selecionadas e colocadas em solução de "pulsing", por 24 horas, visando avaliar as respostas aos seguintes tratamentos: Água (testemunha, GA3 10 mg.L-1 (Pro-Gibb; GA3 20 mg.L-I; GA3 30 mg.L-I; GA4 + GA7 10 mg.L-1 (Pro-Vibe, GA4 + GA7 20 mg.L-1 e GA4 + GA7 30 mg.L-1. Após os tratamentos de "pulsing", as hastes foram colocadas em recipientes contendo 1.000 mL de água, que foi trocada a cada dois dias. Avaliou-se o número de dias até o descarte, tanto para hastes de solidago quanto para crisântemo, para cada tratamento testado. Avaliou--se também a qualidade das folhas de solidago conforme o seguinte critério: índice de qualidade (IQ = 3 (folhas verdes, IQ = 2 (folhas em início de amarelecimento e IQ = 1 (folhas amarelas ou queimadas. Pelos resultados concluiu-se que: hastes cortadas de solidago e crisântemo diferiram quanto às respostas aos tratamentos pós-colheita, em relação ao tipo de giberelina utilizada; GA4 + GA7 10 mg.L-1 foi eficiente na manutenção da qualidade de hastes cortadas de solidago, e GA3 nas concentrações utilizadas no experimento apresentaram efeito deletério nas folhas de solidago; GA3 10 e 20 mg.L-1 foram mais eficientes na manutenção da qualidade pós-colheita de hastes de crisântemo.

  7. Co-ordinated research programme on benchmark study for the seismic analysis and testing of WWER-type nuclear power plants. V. 3E. Kozloduy NPP units 5/6: Analysis/testing. Working material

    International Nuclear Information System (INIS)

    1996-01-01

    The Co-ordinated research programme on the benchmark study for the seismic analysis and testing of WWER-type nuclear power plants was initiated subsequent to the request from representatives of Member States. The conclusions adopted at the Technical Committee Meeting on Seismic Issues related to existing nuclear power plants held in Tokyo in 1991 called for the harmonization of methods and criteria used in Member States in issues related to seismic safety. The Consulltants' Meeting which followed resulted in producing a working document for CRP. It was decided that a benchmark study is the most effective way to achieve the principal objective. Two types of WWER reactors (WWER-440/213 and WWER-1000) were selected as prototypes for the benchmark exercise to be tested on a full scale using explosions and/or vibration generators. The two prototypes are Kozloduy Units 5/6 for WWER-1000 and Paks for WWER-440/213 nuclear power plants. This volume of Working material contains reports on data related to floor response spectra of Kozloduy NPP; calculational-experimental examination and ensuring of equipment and pipelines seismic resistance at starting and operating WWER-type NPPs; analysis of design floor response spectra and testing of the electrical systems; experimental investigations and seismic analysis Kozloduy NPP; testing of components on the shaking table facilities and contribution to full scale dynamic testing of Kozloduy NPP; seismic evaluation of the main steam line, piping systems, containment pre-stressing and steel ventilation chimney of Kozloduy NPP

  8. Filmes finos de LaNiO3 e PZT preparados pelo métodos das soluções precursoras poliméricas e depositados em substratos de silício

    OpenAIRE

    Souza, Éder Carlos Ferreira de [UNESP

    2006-01-01

    Nesta tese estudou-se a preparação de filmes finos de PZT não dopados e dopados com Nióbio, depositados sobre substratos de Pt/Ti/SiO2/Si para aplicações em memórias não voláteis de acesso randômico (NVRAM) e memórias ferroelétricas de acesso randômico (FeRAM). A dopagem dos filmes de PZT com Nióbio foi realizada visando obter valores ótimos nas propriedades ferroelétricas para a aplicação destes filmes como memórias ferroelétricas. Todavia, problemas como imprint, corrente de fuga e fadiga n...

  9. Comparative study of perovskite Pr_(_1_-_x_)Ca_xCoO_3 e Gd_(_1_-_x_)Ca_xCoO_3 (x=0,2) synthesized by gelatin modified route for application in automotive catalysis

    International Nuclear Information System (INIS)

    Araujo, E.M. de; Medeiros, M.R.A.; Paiva, A.K.O.; Borges, F.M.M.; Ruiz, J.A.C.

    2016-01-01

    Increased air pollution intensified the search for materials that could convert pollutant gases into less harmful substances. Thus, mixed oxides with perovskite structure began to be developed for presenting important features for the automotive catalysis. In this study has been compared the chemical composition of the materials with Pr_(_1_-_x_)Ca_xCoO_3 and Gd_(_1_-_x_)Ca_xCoO_3 (x = 0.2) synthesized by the method gelatine. The samples were characterized by techniques: Thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), X-Ray Diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS), X-ray fluorescence (XRF) and subjected to the catalytic test in methane combustion reaction. The evaluation of the catalytic activity showed that gadolinium catalyst is more efficient compared with the praseodymium catalyst, although they have similar maximum conversion of methane at high temperature, during the catalytic test the material with gadolinium showed higher catalytic activity and stability. (author)

  10. Functional Characterization of the Role of the N-terminal Domain of the c/Nip1 Subunit of Eukaryotic Initiation Factor 3 (eIF3) in AUG Recognition

    Czech Academy of Sciences Publication Activity Database

    Karásková, Martina; Gunišová, Stanislava; Herrmannová, Anna; Wagner, Susan; Munzarová, Vanda; Valášek, Leoš Shivaya

    2012-01-01

    Roč. 287, č. 34 (2012), s. 28420-28434 ISSN 0021-9258 R&D Projects: GA ČR GAP305/10/0335 Institutional support: RVO:61388971 Keywords : START CODON SELECTION * 40S RIBOSOMAL-SUBUNIT * GCN4 TRANSLATIONAL CONTROL Subject RIV: CE - Biochemistry Impact factor: 4.651, year: 2012

  11. Repercussões dos ácidos graxos polinsaturados em gestantes e recém-nascidos suplementados com ômega-3 e óleo de linhaça dourada

    OpenAIRE

    Merey, Leila Simone Foerster

    2014-01-01

    Os lipídeos são componentes nutritivos com funções variadas no organismo humano como o armazenamento energético ao transporte de vitaminas lipossolúveis e precursores hormonais. Podem ainda ser considerados elementos funcionais devido à presença de certos grupamentos na sua estrutura química, que difere pelo tamanho da cadeia carbônica da molécula. A partir dessa definição existem os ácidos graxos polinsaturados que compõem famílias de ácidos graxos com duplas ligações nos carbonos n-9, n-6 e...

  12. Aplicação de AG3 e CPPU na qualidade da uva 'Itália' em Porto Feliz-SP GA3 and CPPU application on 'Itália' grapes grown in Porto Feliz-SP

    Directory of Open Access Journals (Sweden)

    Alessandro Rodrigues

    2011-03-01

    Full Text Available A videira 'Itália' (Vitis vinifera L. é a cultivar de uva fina para mesa mais consumida no Brasil. A qualidade dos cachos é uma característica fundamental, sendo o tamanho das bagas o componente mais valorizado pelos consumidores. Uma das alternativas para incrementar a qualidade das bagas é o uso de biorreguladores. Avaliaram-se, em três ciclos de produção, os efeitos de doses de ácido giberélico (AG3 isolado e associado com forchlorfenuron (CPPU, na qualidade dos cachos de uva Itália produzida em Porto Feliz-SP. A aplicação dos biorreguladores foi realizada aos 25 dias após o florescimento, em delineamento experimental inteiramente casualizado, em fatorial 4X4 (zero, 10; 20 e 30 mg L-1 AG3 X zero, 5; 10 e 15 mg L-1 CPPU, com oito repetições para o primeiro ciclo, e fatorial 3X3 (zero, 20 e 30 mg L-1 AG3 X zero, 10 e 20 mg L-1 CPPU com dez repetições para o segundo e terceiro ciclos. A mistura de 20 mg L-1 de AG3 com 10 mg L-1 de CPPU promoveu o incremento do comprimento e do diâmetro das bagas sem prejuízo da massa dos cachos, melhorando sua qualidade, em Porto Feliz-SP. O uso de CPPU isoladamente acarretou em redução do teor de sólidos solúveis das bagas.'Itália' grape (Vitis vinifera L. is one of the main varieties for fresh market in Brazil. Cluster quality is determinant for commercialization and the berry size is highly valued by consumers. An alternative for improving berry size is the use of growth regulators. The effect of increasing concentrations of gibberellic acid (GA3 and forchlorfenuron (CPPU applied alone or in mixtures was evaluated during three production cycles. Growth regulators were applied 25 days after flowering in the "pea berry size" phenologic stage. Experimental design was completely randomized 4x4 factorial (zero, 10, 20 and 30 mg L-1 GA3 X zero, 5, 10 and 15 mg L-1 CPPU with eight replications for the first cycle, and 3X3 factorial (zero, 20 and 30 mg L-1 GA3 X zero, 10 and 20 mg L-1 CPPU with ten replications for the others cycles. The application of GA3 at 20 mg L-1 associated with CPPU at 10 mg L-1 improved berry size without affecting cluster mass, leading to higher grape quality in Porto Feliz, SP. CPPU single application reduced total soluble solids content of the berries.

  13. A FORMAÇÃO DA CAMADA PROTETORA DE FeCO3 E O CONTROLE DA CORROSÃO POR CO2 EM CONDIÇOES DE FLUXO TURBULENTO

    Directory of Open Access Journals (Sweden)

    Lilian R. M. Ferreira

    Full Text Available The formation of a protective layer of iron carbonate (FeCO3 can reduce the rates of corrosion and prolong the useful life of carbon steel. However, turbulent flow conditions in this layer can easily be damaged and thus compromise the protection of the steel. In this work, will be presented a methodology based on the chemical aspects of the mechanism of formation of iron carbonate layer in a Thin Channel Flow Cell (TCFC. Electrochemical techniques were used to measure the corrosion rate and corrosion potential on the surface of steel API X65 exposed to aqueous solution of 1 wt.% NaCl purged with CO2 at 2 atm, pH 6.6 and 80°C in turbulent flow conditions. The surfaces and cross sections of the samples were characterized by means of Scanning Electron Microscopy (SEM and Energy-Dispersive X-ray (EDS analysis. The results confirm the nucleation and growth of iron carbonate layer: the extension of supersaturation of the solution and the corrosion rate have decreased, and the corrosion potential has increased. The surface analysis showed dense and uniform FeCO3 layer with c.a. 20 µm thick after 120 hours in turbulent flow conditions.

  14. Measurement of the ROT effect in the neutron induced fission of 235U in the 0.3 eV resonance at a hot source of polarized neutrons

    Science.gov (United States)

    Kopatch, Yuri; Novitsky, Vadim; Ahmadov, Gadir; Gagarsky, Alexei; Berikov, Daniyar; Danilyan, Gevorg; Hutanu, Vladimir; Klenke, Jens; Masalovich, Sergey

    2018-03-01

    The TRI and ROT asymmetries in fission of heavy nuclei have been extensively studied during more than a decade. The effects were first discovered in the ternary fission in a series of experiments performed at the ILL reactor (Grenoble) by a collaboration of Russian and European institutes, and were carefully measured for a number of fissioning nuclei. Later on, the ROT effect has been observed in the emission of prompt gamma rays and neutrons in fission of 235U and 233U, although its value was an order of magnitude smaller than in the α-particle emission from ternary fission. All experiments performed so far are done with cold polarized neutrons, what assumes a mixture of several spin states, the weights of these states being not well known. The present paper describes the first attempt to get "clean" data by performing the measurement of gamma and neutron asymmetries in an isolated resonance of 235U at the POLI instrument of the FRM2 reactor in Garching.

  15. Measurement of the ROT effect in the neutron induced fission of 235U in the 0.3 eV resonance at a hot source of polarized neutrons

    Directory of Open Access Journals (Sweden)

    Kopatch Yuri

    2018-01-01

    Full Text Available The TRI and ROT asymmetries in fission of heavy nuclei have been extensively studied during more than a decade. The effects were first discovered in the ternary fission in a series of experiments performed at the ILL reactor (Grenoble by a collaboration of Russian and European institutes, and were carefully measured for a number of fissioning nuclei. Later on, the ROT effect has been observed in the emission of prompt gamma rays and neutrons in fission of 235U and 233U, although its value was an order of magnitude smaller than in the α-particle emission from ternary fission. All experiments performed so far are done with cold polarized neutrons, what assumes a mixture of several spin states, the weights of these states being not well known. The present paper describes the first attempt to get “clean” data by performing the measurement of gamma and neutron asymmetries in an isolated resonance of 235U at the POLI instrument of the FRM2 reactor in Garching.

  16. Kohstall Florian et Vairel Frédéric (dir., Fabrique des élections, Égypte. Monde Arabe, n°7, 3e série, 2010-2011

    Directory of Open Access Journals (Sweden)

    Sarah Ben Néfissa

    2012-04-01

    Full Text Available Suite aux soulèvements et révolutions, un vaste chantier électoral attend les pays arabes. La légitimité des « urnes » va progressivement succéder à la légitimité de la « rue », et la sociologie électorale est en bonne voie de réactualisation et de renouvellement de ses paradigmes avec les exemples des pays de la région. Cette étape historique particulière rehausse l’importance de la publication récente du numéro de la revue du CEDEJ, Égypte-Monde arabe, intitulé Fabrique des élections, et di...

  17. Estimative of dilution factor for radioactive liquid effluents employing the H-3 and Cs-137 radiotracers present as pollutant; Estimativa do fator de diluicao para efluentes radioativos liquidos empregando os radiotracadores H-3 e Cs-137 presentes como poluentes

    Energy Technology Data Exchange (ETDEWEB)

    Nisti, Marcelo Bessa; Santos, Adir Janete Godoy dos, E-mail: mbnisti@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    It was estimated the dilution factor for liquid effluents at the discharge points of the IPEN, Sao Paulo, Brazil, employing as radiotracers the radioisotope routinely liberated for the sewage of 'Cidade Universitaria Armando de Salles Oliveira' - CUASO {sup 3}H and {sup 137}Cs, not generating either monetary or environmental cost associated to the estimation. The {sup 137}Cs was determined by gamma spectrometry and the {sup 3}H was determined liquid phase scintillation. The results showed that the dilution factor varied according to the employed radiotracer in a crescent order of {sup 3}H and {sup 137}Cs according to the characteristics of each element. The average of dilution factors obtained at the first and second liberation day were 4.3 and 7.4 respectively for the {sup 3}H and 6.2 and 13.9 for the {sup 137}Cs. The ratio of dilution factors of calculated {sup 3}H and {sup 137}Cs were coherent with the ratio verified at the twelve hydrometers distributed by the IPEN campus. The dilution factors were estimated in operational and laboratory study, in a single controlled discharge of the TR1 tank

  18. Preparação de LiNbO3 e LiNbO3:Eu3+ pelo método dos precursores poliméricos

    Directory of Open Access Journals (Sweden)

    Souza Luciana A.

    2002-01-01

    Full Text Available The ferroelectric compound LiNbO3 was prepared by the polymeric precursors method in the polycrystalline form containing different concentrations of Eu3+. The compounds were characterized by X-ray diffraction, vibrational and electronic spectroscopy. Electronic spectroscopy was shown to be sensitive to small concentrations of contaminating phases allowing a good control of the compound purity. The presence of Eu3+ ions leads to the formation of the LiNb3O8 phase in the range of 500 to 800 degreesC. Above this temperature range LiNbO3 and tetragonal (T' EuNbO4 were obtained.

  19. Progression of itching intensity and expression of growth factor proteins in skin of people suffering from atopic dermatitis under the influence of ultraviolet phototherapy

    Directory of Open Access Journals (Sweden)

    A. A. Kubanova

    2015-01-01

    Full Text Available Study of progression of itching intensity and expression of growth factor proteins in skin of people suffering from atopic dermatitis under the influence of narrowband (311Nm phototherapy. Material and methods. 30 patients with atopic dermatitis were treated by using narrowband (311Nm phototherapy. SCORAD index was used to assess the severity of the clinical responses. Itching intensity was assessed using visual analogue scale. Expression of growth factor of nerves, semaphorine-3A, amphiregulin, and PGP9.5, a protein marker for nerve fibers, was investigated by means of indirect immunofluorescence. Results. Increased expression level of nerves growth factor, decreased expression level of semaphorine-3A, and increase in the number, average length and luminous intensity of PGP9.5+ -nerve fibers were found in the patients’ epidermis. Course of narrowband (311 Nm phototherapy resulted in a decrease of the severity of the disease and itching intensity, and semaphorine-3A expression increase, reduction of number and average length of nerve fibers in the epidermis. A direct correlation relationship between the itching intensity and expression level of nerve growth factor, number and average length of PGP9.5+ -nerve fibers in the epidermis as well as an inverse correlation relationship between itching intensity and expression level of semaphorine-3A in the epidermis were found. Conclusion. Treating patients suffering from atopic dermatitis with narrowband (311 Nm phototherapy leads to a decrease of the itching intensity associated with a decreased intensity of innervation of the epidermis. This decrease in course of phototherapy is facilitated by decrease of nerve growth factor expression level and increase of semaphorine-3A expression.

  20. Assessing the itching intensity using visual analogue scales in atopic dermatitis patients against the background of a therapy with calcineurin inhibitors

    Directory of Open Access Journals (Sweden)

    V. V. Chikin

    2016-01-01

    Full Text Available Goal. To assess the effect of topical treatment of atopic dermatitis patients with the 0.1% tacrolimus ointment on the itching intensity and skin expression level of growth factor proteins affecting the intensity of cutaneous innervation. Materials and methods. Fifteen patients suffering from atopic dermatitis underwent treatment with the 0.1% tacrolimus ointment. The SCORAD index was calculated to assess the severity of clinical manifestations. The itching intensity was assessed using a visual analogue scale. The skin expression of nerve growth factors, amphiregulin, semaphorin 3A and PGP9.5 protein (a nerve fiber marker was assessed by the indirect immunofluorescence method. Results. An increased expression of the nerve growth factor and reduced semaphorin 3A expression levels were noted in the patients’ epidermis; there was an increase in the quantity, mean length and fluorescence intensity of PGP9.5+ nerve fibers. As a result of the treatment, the disease severity and itching intensity were reduced, the nerve growth factor expression level was reduced while semaphorin 3A expression level increased in the epidermis, and the mean length and fluorescence intensity of PGP9.5+ nerve fibers was also reduced. A positive correlation among the itching intensity and nerve growth factor expression level, quantity and mean length of PGP9.5+ nerve fibers in the epidermis was revealed, and negative correlation between the itching intensity and semaphorin 3A expression level in the epidermis was established. Conclusion. Topical treatment with the 0.1% Tacrolimus ointment reduces the itching intensity in atopic dermatitis patients, which is related to the therapy-mediated reduction in the epidermis innervation level, decreased expression of epidermal nerve growth factor and increased semaphorin 3A expression level.

  1. Crystal structure of the plexin A3 intracellular region reveals an autoinhibited conformation through active site sequestration

    Energy Technology Data Exchange (ETDEWEB)

    He, Huawei; Yang, Taehong; Terman, Jonathan R.; Zhang, Xuewu; (UTSMC)

    2010-01-20

    Plexin cell surface receptors bind to semaphorin ligands and transduce signals for regulating neuronal axon guidance. The intracellular region of plexins is essential for signaling and contains a R-Ras/M-Ras GTPase activating protein (GAP) domain that is divided into two segments by a Rho GTPase-binding domain (RBD). The regulation mechanisms for plexin remain elusive, although it is known that activation requires both binding of semaphorin to the extracellular region and a Rho-family GTPase (Rac1 or Rnd1) to the RBD. Here we report the crystal structure of the plexin A3 intracellular region. The structure shows that the N- and C-terminal portions of the GAP homologous regions together form a GAP domain with an overall fold similar to other Ras GAPs. However, the plexin GAP domain adopts a closed conformation and cannot accommodate R-Ras/M-Ras in its substrate-binding site, providing a structural basis for the autoinhibited state of plexins. A comparison with the plexin B1 RBD/Rnd1 complex structure suggests that Rnd1 binding alone does not induce a conformational change in plexin, explaining the requirement of both semaphorin and a Rho GTPase for activation. The structure also identifies an N-terminal segment that is important for regulation. Both the N-terminal segment and the RBD make extensive interactions with the GAP domain, suggesting the presence of an allosteric network connecting these three domains that integrates semaphorin and Rho GTPase signals to activate the GAP. The importance of these interactions in plexin signaling is shown by both cell-based and in vivo axon guidance assays.

  2. SEMA3A, a gene involved in axonal pathfinding, is mutated in patients with Kallmann syndrome.

    Science.gov (United States)

    Hanchate, Naresh Kumar; Giacobini, Paolo; Lhuillier, Pierre; Parkash, Jyoti; Espy, Cécile; Fouveaut, Corinne; Leroy, Chrystel; Baron, Stéphanie; Campagne, Céline; Vanacker, Charlotte; Collier, Francis; Cruaud, Corinne; Meyer, Vincent; García-Piñero, Alfons; Dewailly, Didier; Cortet-Rudelli, Christine; Gersak, Ksenija; Metz, Chantal; Chabrier, Gérard; Pugeat, Michel; Young, Jacques; Hardelin, Jean-Pierre; Prevot, Vincent; Dodé, Catherine

    2012-08-01

    Kallmann syndrome (KS) associates congenital hypogonadism due to gonadotropin-releasing hormone (GnRH) deficiency and anosmia. The genetics of KS involves various modes of transmission, including oligogenic inheritance. Here, we report that Nrp1(sema/sema) mutant mice that lack a functional semaphorin-binding domain in neuropilin-1, an obligatory coreceptor of semaphorin-3A, have a KS-like phenotype. Pathohistological analysis of these mice indeed showed abnormal development of the peripheral olfactory system and defective embryonic migration of the neuroendocrine GnRH cells to the basal forebrain, which results in increased mortality of newborn mice and reduced fertility in adults. We thus screened 386 KS patients for the presence of mutations in SEMA3A (by Sanger sequencing of all 17 coding exons and flanking splice sites) and identified nonsynonymous mutations in 24 patients, specifically, a frameshifting small deletion (D538fsX31) and seven different missense mutations (R66W, N153S, I400V, V435I, T688A, R730Q, R733H). All the mutations were found in heterozygous state. Seven mutations resulted in impaired secretion of semaphorin-3A by transfected COS-7 cells (D538fsX31, R66W, V435I) or reduced signaling activity of the secreted protein in the GN11 cell line derived from embryonic GnRH cells (N153S, I400V, T688A, R733H), which strongly suggests that these mutations have a pathogenic effect. Notably, mutations in other KS genes had already been identified, in heterozygous state, in five of these patients. Our findings indicate that semaphorin-3A signaling insufficiency contributes to the pathogenesis of KS and further substantiate the oligogenic pattern of inheritance in this developmental disorder.

  3. SEMA3A, a gene involved in axonal pathfinding, is mutated in patients with Kallmann syndrome.

    Directory of Open Access Journals (Sweden)

    Naresh Kumar Hanchate

    2012-08-01

    Full Text Available Kallmann syndrome (KS associates congenital hypogonadism due to gonadotropin-releasing hormone (GnRH deficiency and anosmia. The genetics of KS involves various modes of transmission, including oligogenic inheritance. Here, we report that Nrp1(sema/sema mutant mice that lack a functional semaphorin-binding domain in neuropilin-1, an obligatory coreceptor of semaphorin-3A, have a KS-like phenotype. Pathohistological analysis of these mice indeed showed abnormal development of the peripheral olfactory system and defective embryonic migration of the neuroendocrine GnRH cells to the basal forebrain, which results in increased mortality of newborn mice and reduced fertility in adults. We thus screened 386 KS patients for the presence of mutations in SEMA3A (by Sanger sequencing of all 17 coding exons and flanking splice sites and identified nonsynonymous mutations in 24 patients, specifically, a frameshifting small deletion (D538fsX31 and seven different missense mutations (R66W, N153S, I400V, V435I, T688A, R730Q, R733H. All the mutations were found in heterozygous state. Seven mutations resulted in impaired secretion of semaphorin-3A by transfected COS-7 cells (D538fsX31, R66W, V435I or reduced signaling activity of the secreted protein in the GN11 cell line derived from embryonic GnRH cells (N153S, I400V, T688A, R733H, which strongly suggests that these mutations have a pathogenic effect. Notably, mutations in other KS genes had already been identified, in heterozygous state, in five of these patients. Our findings indicate that semaphorin-3A signaling insufficiency contributes to the pathogenesis of KS and further substantiate the oligogenic pattern of inheritance in this developmental disorder.

  4. Neurotrophin Promotes Neurite Outgrowth by Inhibiting Rif GTPase Activation Downstream of MAPKs and PI3K Signaling.

    Science.gov (United States)

    Tian, Xiaoxia; Yan, Huijuan; Li, Jiayi; Wu, Shuang; Wang, Junyu; Fan, Lifei

    2017-01-13

    Members of the well-known semaphorin family of proteins can induce both repulsive and attractive signaling in neural network formation and their cytoskeletal effects are mediated in part by small guanosine 5'-triphosphatase (GTPases). The aim of this study was to investigate the cellular role of Rif GTPase in the neurotrophin-induced neurite outgrowth. By using PC12 cells which are known to cease dividing and begin to show neurite outgrowth responding to nerve growth factor (NGF), we found that semaphorin 6A was as effective as nerve growth factor at stimulating neurite outgrowth in PC12 cells, and that its neurotrophic effect was transmitted through signaling by mitogen-activated protein kinases (MAPKs) and phosphatidylinositol-3-kinase (PI3K). We further found that neurotrophin-induced neurite formation in PC12 cells could be partially mediated by inhibition of Rif GTPase activity downstream of MAPKs and PI3K signaling. In conclusion, we newly identified Rif as a regulator of the cytoskeletal rearrangement mediated by semaphorins.

  5. Alternative Splicing in Adhesion- and Motility-Related Genes in Breast Cancer

    Directory of Open Access Journals (Sweden)

    Rosanna Aversa

    2016-01-01

    Full Text Available Breast cancer is the most common tumor and the second leading cause of cancer death among woman, mainly caused by the metastatic spread. Tumor invasiveness is due to an altered expression of adhesion molecules. Among them, semaphorins are of peculiar interest. Cancer cells can manipulate alternative splicing patterns to modulate the expression of adhesion- and motility-related molecules, also at the isoform level. In this study, combining RNA-Sequencing on MCF-7 to targeted experimental validations—in human breast cell lines and breast tumor biopsies—we identified 12 new alternative splicing transcripts in genes encoding adhesion- and motility-related molecules, including semaphorins, their receptors and co-receptors. Among them, a new SEMA3F transcript is expressed in all breast cell lines and breast cancer biopsies, and is translated into a new semaphorin 3F isoform. In silico analysis predicted that most of the new putative proteins lack functional domains, potentially missing some functions and acquiring new ones. Our findings better describe the extent of alternative splicing in breast cancer and highlight the need to further investigate adhesion- and motility-related molecules to gain insights into breast cancer progression.

  6. Comparative study of perovskite Pr{sub (1-x)}Ca{sub x}CoO{sub 3} e Gd{sub (1-x)}Ca{sub x}CoO{sub 3} (x=0,2) synthesized by gelatin modified route for application in automotive catalysis; Estudo comparativo das perovsquitas Pr{sub (1-x)}Ca{sub x}CoO{sub 3} e Gd{sub (1-x)}Ca{sub x}CoO{sub 3} (x=0,2) sintetizadas pela rota modificada gelatina para aplicacao em catalise automotiva

    Energy Technology Data Exchange (ETDEWEB)

    Araujo, E.M. de; Medeiros, M.R.A.; Paiva, A.K.O.; Borges, F.M.M., E-mail: eduardamedeirosdearaujo@gmail.com [Universidade Federal do Rio Grande do Norte (UFRN), RN (Brazil); Ruiz, J.A.C. [Centro de Tecnologia do Gas e Energias Renovaveis (CTGAS-ER), RN (Brazil)

    2016-07-01

    Increased air pollution intensified the search for materials that could convert pollutant gases into less harmful substances. Thus, mixed oxides with perovskite structure began to be developed for presenting important features for the automotive catalysis. In this study has been compared the chemical composition of the materials with Pr{sub (1-x)}Ca{sub x}CoO{sub 3} and Gd{sub (1-x)}Ca{sub x}CoO{sub 3} (x = 0.2) synthesized by the method gelatine. The samples were characterized by techniques: Thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), X-Ray Diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS), X-ray fluorescence (XRF) and subjected to the catalytic test in methane combustion reaction. The evaluation of the catalytic activity showed that gadolinium catalyst is more efficient compared with the praseodymium catalyst, although they have similar maximum conversion of methane at high temperature, during the catalytic test the material with gadolinium showed higher catalytic activity and stability. (author)

  7. Influência de aditivos dispersantes nas propriedades de concretos refratários de Al2O3 e Al2O3-MgO Influence of dispersants in Al2O3 and Al2O3-MgO refractory castables

    Directory of Open Access Journals (Sweden)

    I. R. de Oliveira

    2004-03-01

    Full Text Available O estado de dispersão das partículas constituintes da matriz de concretos apresenta uma influência direta no comportamento reológico desses materiais, determinando as técnicas que podem ser usadas para a sua aplicação. Diferentes aditivos são utilizados visando uma dispersão eficiente, a qual constitui um requisito importante na otimização do empacotamento das partículas e da resistência mecânica de concretos. Entretanto, a influência desses aditivos nas propriedades de concretos tem sido muito pouco estudada. Neste trabalho investigou-se o efeito de três dispersantes nas propriedades e desempenho na secagem de diferentes composições refratárias. A presença de poliacrilato de sódio resultou em concretos com elevada permeabilidade e maior porosidade. Por outro lado, em composições no sistema Al2O3-MgO a presença de hexametafosfato de sódio proporcionou concretos com permeabilidade extremamente baixa acarretando numa secagem mais lenta, enquanto o ácido cítrico apresentou um desempenho intermediário. Tais efeitos nas propriedades dos concretos foram correlacionados às características intrínsecas dos aditivos.The state of dispersion of the castables matrix particles presents a direct influence in their rheological behavior, determining the techniques that can be used for their installation. Different additives have been used aiming an efficient dispersion, which constitutes an important requirement in the optimization of the particles packing and mechanical resistance of castables. However, the influence of those additives in the castables properties has not been extensively studied. In this work, the effect of 3 dispersants was investigated in the properties and drying behavior of different refractory compositions. The presence of sodium polyacrylate resulted in castables with higher permeability and larger porosity. On the other hand, in Al2O3-MgO compositions the presence of sodium hexametaphosphate provided extremely low permeability castables resulting in a slower drying, whereas the citric acid presented an intermediate behavior. Such effects in the castables properties were correlated to intrinsic characteristics of the additives.

  8. Prolongamento do período de colheita da tangerineira Ponkan com aplicação de GA3 e 2,4-D Harvest season extent of tangerin 'Ponkan' fruits with the application of GA3 AND 2,4-D

    Directory of Open Access Journals (Sweden)

    José Carlos Moraes Rufini

    2008-06-01

    Full Text Available Conduziu-se, este experimento em pomar comercial, dez anos após o plantio, localizado no município de São João Del Rei - MG, visando ampliar o período de colheita de frutos da tangerineira 'Ponkan' (Citrus reticulata Blanco. Foram avaliados os efeitos do ácido giberélico (GA3 à 0, 10, 20 e 30 mg.L-1 e do Ácido 2,4-diclorofenoxiacético (2,4-D à 0 e 10 mg.L-1 aplicados em duas vezes: 24/4 e 17/5 quando os frutos apresentavam-se com coloração verde da casca e foram realizadas duas avaliações sendo a primeira no dia 25/7, quando já se aproximava a fase final de colheita da região, e a segunda 30 dias após. O delineamento experimental utilizado foi em blocos casualizados, em esquema fatorial 4 x 2 x 2, com quatro repetições em parcelas subdivididas. Os resultados mostraram que o 2,4-D, à 10 mg.L-1 influenciou na textura dos frutos, propiciando o prolongamento da colheita de tangerina 'Ponkan'; ¹ aumentou a acidez dos frutos e reduziu a relação sólidos solúveis totais /acidez; que a utilização de 20 mg.L-1 de GA3 promoveu incremento no diâmetro e no peso dos frutos; que o maior rendimento foi obtido no mês de agosto e que não houve diferença no teor de sólidos solúveis nas diferentes épocas de colheita.This experiment was carried out on a ten year-old commercial orchard in São João Del Rei county-MG in order to extend the harvest season of tangerine Ponkan (Citrus reticulate Blanco. One evaluated the effects of Giberelic Acid (GA3 at 0, 10, 20 and 30 mg.0L-1 and Diclorofenoxiacetic acid (2,4- D at 0 and 10 mg.L-1 applied two times: on 4/24 and 5/17 when the fruits still had a green peel color the evaluations were made: the first one on 7/25, when the harvest time in the region was ending, and the second 30 days after. The experimental design adopted was the one of randomized blocks, with a factorial of 4 x 2 x 2, with four split-plot replicates. The results showed that 2,4-D at 10 mg.L-1 influenced fruits texture and extended the harvest and also increased fruit acidity and reduced the ratio; GA3 at 20mg.L-1 increased the diameter and weight of the fruits harvested in August and presented higher juice rate and there was no difference on total soluble sugar in solid solute tenor.

  9. Análise da acetilação de histona 3 e sua relação com proliferação celular e transição epitélio mesênquima em leucoplasias e carcinomas espinocelulares de boca

    OpenAIRE

    Liana Preto Webber

    2015-01-01

    O desenvolvimento e a progressão do câncer bucal envolvem processos complexos de múltiplas etapas levando a modificações fenotípicas nas células epiteliais, aumento da proliferação e invasão dos tecidos subjacentes. Diversos fatores vem sendo associados à carcinogênese, dentre eles os mecanismos epigenéticos como a acetilação de histonas, que promovem mudanças na expressão de genes independente de mutações. O objetivo do presente estudo observacional transversal foi analisar a relação entre a...

  10. Recherches de la Communauté Européenne en matière d'énergie géothermique. 3e Colloque International, Munich, 29 novembre- 1er décembre 1983 Research on Geothermal Energy by the European Community. 3rd International Symposium, Munich, 29 November-1 December 1983

    Directory of Open Access Journals (Sweden)

    Bertrand A. R. V.

    2006-11-01

    Full Text Available Ce colloque, tenu sous le thème Mise à jour de la géothermie européenne, avait pour objectif principal de passer en revue les résultats du deuxième programme de R&D, qui vient de s'achever, et de faire le point sur les opérations de démonstration en cours ou terminées. On en retiendra : - les progrès de la géothermie basse enthalpie (eau de chauffage dont la faisabilité technique et les conditions de rentabïlité économique sont maintenant établies ; - les difficultés de la géothermie haute enthalpie et surtout de la géothermie en roche sèche dont les développements sont loin d'atteindre le stade de l'industrialisation ; - l'apport modeste de la géothermie commerciable qui n'atteindra en 2000 que l'équivalent de 4 % de la production pétrolière actuelle (2,5 Mtep pour la France très bien placée en géothermie basse enthalpie, soit environ 1 % de sa consommation énergétique. Le prochain programme communautaire devrait être axé sur les géothermies à haute enthalpie et à roche sèche. This symposium, on the topic of European Geothermal Update, had the main goal of reviewing the results of the second R&D program which bas just been completed, and to ascertain the state-of-the art of ongoing or completed demonstration operations. Emphasis was placed on the following three aspects: Progress in low-enthalpy geothermal energy (heating water, for which the technical feasibility and the economic profitability criteria have now been established. Difficulties in high-enthalpy geothermal energy and in particular in that from dry rocks, where developments are far from having reached the stage of industrialization. The modest contribution of marketable geothermal energy which, in the year 2000, will account for the equivalent of only 4% of current petroleum production (2. 5 MtOE for France which is in a very good position for low-enthalpy geothermal energy which provides about 1% of its energy consumption. The next EC R&D program should concentrate on high-enthalpy and dry-rock geothermal energy.

  11. Development and characterization of nickel catalysts supported in CeO2-ZrO2-Al2O3, CeO2-La2O3-Al2O3 e ZrO2-La2O3-Al2O3 matrixes evaluated for methane reforming reactions

    International Nuclear Information System (INIS)

    Abreu, Amanda Jordão de

    2012-01-01

    Nowadays, the methane reforming is large interest industrial for the take advantage of these gas in production the hydrogen and synthesis gas (syngas). Among in the reactions of methane stand of the reactions steam reforming and carbon dioxide reforming of methane. The main catalysts uses in the methane reforming is Ni/Al 2 O 3 . However, the supported-nickel catalyst is susceptible to the deactivation or the destruction by coke deposition. The carbon dissolves in the nickel crystallite and its diffuses through the nickel, leading for formation of the carbon whiskers, which results in fragmentation of the catalyst. Modification of such catalysts, like incorporation of suitable promoters, is desirable to achieve reduction of the methane hydrogenolysis and/or promotion of the carbon gasification. Catalysts 5%Ni/Al 2 O 3 supported on solid solutions formed by ZrO 2 -CeO 2 , La 2 O 3 and CeO 2 -ZrO 2 -La 2 O 3 were prepared, characterized and evaluated in reactions steam and carbon dioxide reforming and partial oxidation of methane with objective the value effect loading solution solid in support. The supports were prepared by co-precipitation method and catalysts were prepared by impregnation method and calcined at 500 deg C. The supports and catalysts were characterized by Nitrogen Adsorption, method -rays diffraction (XRD), X-rays dispersive spectroscopy (XDS), spectroscopy in the region of the ultraviolet and the visible (UV-vis NIR) to and temperature programmed reduction (TPR), Raman Spectroscopy, X-ray absorption spectroscopy and Thermogravimetric Analysis. After all the catalytic reactions check which the addition of solid solution is beneficial for Ni/Al 2 O 3 catalysts and the best catalysts are Ni/CeO 2 -La 2 O 3 -Al 2 O 3 . (author)

  12. Complemento hemolítico total, C3 e taxa de conversão de C3 nas formas cardíaca e indeterminada da doença de Chagas Levels of hemolytic complement, total C3 and degree of conversion of native C3 in cardiac and indeterminate form of Chagas' disease

    Directory of Open Access Journals (Sweden)

    M. A. Shikanai-Yasuda

    1984-02-01

    Full Text Available Os valores de complemento hemolítico total, C3 total (nativo + produtos de degradação e o grau de conversão de C3 nativo foram estudados em dois subgrupos de pacientes chagásicos, nas formas cardíaca e indeterminada, e em um subgrupo de indivíduos não chagásicos, clinicamente sadios. Os níveis de C3 total e as taxas de conversão de C3 em seus produtos de degradação foram semelhantes nos três subgrupos. Os valores de complemento hemolítico total foram estatisticamente diferentes nos três subgrupos (nível de significância descritivo p = 0,0757, tendo sido observada média aritmética mais baixa no subgrupo de cardíacos e mais elevada no subgrupo de controles. Maior amplitude de variação dos níveis de complemento hemolítico total foi notada no subgrupo de cardíacos, no qual se encontraram os valores extremos (máximo e mínimo, considerando-se todos os subgrupos.The levels of hemolytic complement and total C3 (native C3 plus its degration products and the degree of conversion of native C3 into its breakdown products were studied in sera from two subgroups of chagasic patients (indeterminate and cardiac forms and from non chagasic individuals (control subgroup. The levels of total C3 and the degree of conversion of native C3 into its breakdown products were similar in the three subgroups. The levels of hemolytic complement were statistically different among the three subgroups. The lowest average was observed in the subgroup of cardiac patients and the highest average in the control subgroup of non chagasic individuals. The widest variation on levels of hemolytic complement was observed in the subgroup of cardiac patients in which we found the maximum and minimum values among all the subgroups.

  13. Recalculation of loads on LOFT penetrations 1A, 2A, 3E, 3F, 5A, 5B, 5C, 5D, 5E, 5F, 7A, 9A, 11C, 17A, 17B, 20A, 20B, 20C, 21A

    International Nuclear Information System (INIS)

    McFadden, D.F.

    1978-01-01

    The loads on the piping nozzles penetrating the LOFT containment vessel are presented. Since the design and construction of the containment vessel, piping systems that penetrate the nozzles have been changed. Consequently, the moments and forces on the containment vessel are different than those stated in LOFT specification S-1. Two combined load cases were tabulated, deadweight plus thermal expansion plus operating basis earthquake and deadweight plus safe shutdown earthquake

  14. Resposta à restrição calórica por meio de uma intervenção dietética para redução de peso em mulheres obesas portadoras de polimorfismos dos genes ADRB2, ADRB3 e GHRL

    OpenAIRE

    Saliba, Louise Farah

    2014-01-01

    Orientadora : Profª Drª Lupe Furtado Alle Tese (doutorado) - Universidade Federal do Paraná, Setor de Ciências Biológicas, Programa de Pós-Graduação em Genética. Defesa: Curitiba, 09/05/2014 Inclui referências Área de concentração :Genética Resumo: Ainda que as formas de tratamento da obesidade estejam estabelecidas, existe uma variação interindividual na resposta aos tratamentos, assim, genes relacionados à obesidade, os chamados genes candidatos à obesidade e seus polim...

  15. Desenvolvimento do pigmento condutor SnO2 -Sb2O3 e sua aplicação em vidrados semicondutores Development of a SnO2 -Sb2O3 conductor pigment and its applications in semiconductor glazes

    Directory of Open Access Journals (Sweden)

    R. Aguiar

    2004-06-01

    Full Text Available Esmaltes semicondutores são utilizados no recobrimento de isoladores elétricos para evitar descargas superficiais nos isoladores, associadas a grandes diferenças de potencial, proporcionando uma melhora no desempenho sob poluição ambiental. Como os vidrados utilizados nas indústrias cerâmicas são isolantes, uma maneira de torná-los semicondutores é adicionando óxidos condutores. Misturou-se ao esmalte porcentagens variadas do pigmento condutor SnO2 dopado com 5% de Sb2O3. O esmalte foi aplicado sobre peças de porcelana a verde e queimado a 1250 ºC. Por microscopia eletrônica de varredura verificou-se que a concentração de pigmento na superfície das amostras é baixa e não influencia a condutividade elétrica. Na fratura, a porcentagem de pigmento ficou próxima de 35%. Assim, a superfície ficou com aspecto visual de ótima qualidade. A resistividade elétrica ocorreu pelo interior do vidrado, obtendo-se valores próximos de 10(4 Ohm.m.Semiconductor glazes are employed on electrical insulators to avoid surface discharge under conditions of intense electric fields, providing better performance in polluted environments. Semiconductor enamels are of great interest for electrical insulator coatings to avoid surface discharges, related to large potential differences. This enhances the performance of the insulator under polluted environments. Glazes used in ceramic industries are not conductive. The addition of conductive oxides to the glaze composition results in a semiconductor enamel. Sb2O3-doped SnO2 was mixed with the enamel in different concentrations. The resulting enamel was applied over green porcelain and fired at 1250 ºC. Scanning electron microscopy characterization was performed and it was verified that the pigment concentration on the surface is low and does not affect the electrical conductivity. The pigment concentration on the fracture surface is approximately 35%. The insulator surface presents a high quality visual aspect and low surface roughness. The electrical resistivity is approximately 10(4 Ohm.m and occurs through the bulk of the glaze.

  16. Sintering of Si C by hot-pressing with addition of Al{sub 2}O{sub 3} and concentrate of rare earths; Sinterizacao por prensagem a quente com SiC com adicao de Al{sub 2}O{sub 3} e concentrado de terras raras

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, M.K.; Silva, C.R.M. [Centro Tecnico Aeroespacial (CTA-IAE), Sao Jose dos Campos, SP (Brazil). Inst. de Atividades Espaciais]. E-mail: miriamk@iae.cta.br; Nono, M.C.A.; Vieira, R.A. [Instituto Nacional de Pesquisas Espaciais (INPE), Sao Jose dos Campos, SP (Brazil)

    2004-07-01

    Silicon carbide (SiC) has essentially covalent bonds ({approx}88%). The high covalency bond is responsible for the good mechanical properties, although it induces a low self diffusion coefficient, making densification more difficult. For a successful densification is necessary to apply pressure on the samples, and/or the addition of sintering additives, which improves the densification. In this SiC samples with alumina (Al2O3) and concentrate of rare earth (CRE) addition were sintered by hot pressing in argon atmospheric at 20 MPa of pressure, heating rate of 20 deg C/min up to 1800 deg C and a dwell time of 1 h. Initially the CRE was calcined at 1000 deg C during 1 h. After that, three mixtures were prepared with distinct concentrations in high energy mill and the samples were sintered. The aim of this work is to improve SiC densification by the liquid phase formation during sintering owing to the additives reactions between itself. The pressure intensify the driving force for densification, taking the liquid phase to drain easier through the grain boundaries, making possible best accommodation and rearrangement of the grains. The application of the pressure on the samples during sintering contributes to improve densification and becomes possible sintering in lower temperature than conventional one. The phases of the sintered samples were analyzed by X-ray diffraction and the morphology were verified by scanning electron microscopy. (author)

  17. Balanço entre ácidos graxos ômega-3 e 6 na resposta inflamatória em pacientes com câncer e caquexia Omega-3 and 6 fatty acids balance in inflammatory response in patients with cancer and cachexia

    Directory of Open Access Journals (Sweden)

    Adriana Garófolo

    2006-10-01

    Full Text Available O emagrecimento, associado à perda de massa magra, é um fenômeno observado com freqüência em pacientes com câncer. Tal condição predispõe o paciente ao maior risco de infecções, pior resposta aos tratamentos implantados e, como conseqüência, desfavorece o prognóstico de cura. Além disso, a desnutrição também está associada à pior qualidade de vida. Dessa forma, algumas terapias têm sido propostas na tentativa de reverter o catabolismo, por meio da atenuação da resposta inflamatória, observado em grande porcentagem de pacientes com câncer e caquexia. Entre elas, a suplementação com ácidos graxos da família ômega-3 pode representar uma estratégia na redução da formação de citocinas pró-inflamatórias, favorecendo a tolerância metabólica dos substratos energéticos e atenuando o catabolismo protéico, com o intuito de melhorar o prognóstico de cura de pacientes com câncer. Entretanto, os estudos mostram alguns resultados conflitantes da suplementação com ômega-3 na resposta imunológica. Por outro lado, em pacientes com câncer, os ensaios clínicos mostraram atenuar a resposta inflamatória e melhorar o estado nutricional. O objetivo deste artigo é realizar uma revisão criteriosa do assunto.Emaciation and loss of lean body mass is a frequent phenomenon observed in cancer patients. This condition leads to infection risk and a poor response to treatment, thus reducing the chances of cure. Furthermore, malnutrition is also associated with a poor quality of life. Therefore, therapies have been proposed in attempt to revert the catabolism observed in most of these patients by attenuating the inflammatory response. Among them, omega-3 fatty acid supplementation may be a strategy to reduce the production of pro-inflammatory cytokines and improve metabolic substrate tolerance, decreasing protein catabolism in order to ameliorate the prognosis of cure in cancer patients. However, studies demonstrate some conflicting results of ômega-3 supplementation on immune response. On the other hand, clinical trials in cancer patients demonstrate that the inflammatory response decreases and the nutritional status improves. The aim of this paper is to elaborate a strict review of the subject.

  18. Characterization of cathode materials SrCoO3 and La0,2Sr0,8CoO3 for use in solid oxide fuel cells (SOFC); Caracterizacao de materiais catodicos SrCoO3 e La0,2Sr0,8CoO3 para aplicacao em celulas a combustivel de oxido solido (SOFC)

    Energy Technology Data Exchange (ETDEWEB)

    Galvao, G.O.; Aquino, F.M; Silva, R.M.; Medeiros, I.D.M. de, E-mail: gabriela.galvao@cear.ufpb.br [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil)

    2016-07-01

    Mixed oxide ceramics with chemical structure of ABO{sub 3} type are promising candidates for cathodes of solid oxide fuel cells (SOFC) for performing well on the electrical conductivity and thermal stability. Various methods of preparation have been studied and used for the synthesis of these materials. In this study, SrCoO{sub 3} and La{sub 0,2}Sr{sub 0,8}CoO{sub 3} perovskites were synthesized using gelatin as directing agent with the purpose of producing homogeneous and porous particles. The powders obtained at 350 ° C / 2 h were calcined at 600, 800 and 1000 ° C for 4 hours and characterized by X-ray diffraction (XRD) and scanning electron microscopy (SEM). The results showed that gelatin is a good polymerizing agent for metal ions as the material showed characteristic peaks of perovskite, with good porosity and uniformity. Furthermore, the method of synthesis employed has advantages related to cost and toxicity, which are very low. (author)

  19. Avaliação dos Hábitos Alimentares de Crianças entre os 3 e os 7 anos de Idade do Externato Lisbonense : Trabalho de Investigação : Assessment of Eating Habits of Children between 3 and 7 years of age Externato Lisbonense

    OpenAIRE

    Santos, Nádia Patrícia Pestana

    2010-01-01

    Contém um relatório de estágio curricular realizado nos Cuidados de Saúde Primários e e Cuidados de Saúde Hospitalares da Região Autónoma da Madeira (Centro de Saúde Bom Jesus, Hospital dos Marmeleiros e Hospital Dr. Nélio Mendonça), no âmbito da licenciatura em Ciências da Nutrição pela Faculdade de Ciências da Nutrição e Alimentação da Universidade do Porto. O exemplar do relatório de estágio existe apenas em formato papel e está disponível para consulta na Biblioteca da FCNAUP...

  20. Serum levels of triiodothyronine (T{sub 3}) and thyroxine (T{sub 4}) in buffalo (Bubalus bubalis Lin.) raised in Amazon region; Niveis sericos de triiodotironina (T{sub 3}) e tiroxina (T{sub 4}) em bubalinos (Bubalus bubalis Lin.) criados na regiao Amazonica

    Energy Technology Data Exchange (ETDEWEB)

    Silva, A O.A. da

    1991-08-01

    Through the use of radioimmunoassay (RIA) it was determined blood serum concentration of triiodothyronine (T{sub 3}) and thyroxine (T{sub 4}) (n=78) for two different water buffalo racial groups. Blood serum was collected from young and adult animals belonging to two farms in Castanhal country, state of Para, Brazil, through the year of 1988. The serum levels of T{sub 3} and T{sub 4} were statistically correlated with climatic parameters, e.g., pluviometric precipitation, environmental temperature, humidity, light intensity variation and physiological factors such as age, breed and sex. It was identified two seasons during experiment, one season the rainfall period with high precipitation rates and the other one was considered as dry season, with low precipitation rates. The average rate of temperature and humidity have shown no significant statistic difference between the two seasons. On the other hand, it was found a significant relationship between luminosity and seasons, since when the luminosity decreases the pluviometric rates increases. (author). 51 refs, 15 figs, 15 tabs.

  1. Lack of association between VNTR polymorphism of dopamine transporter gene (SLC6A3 and schizophrenia in a Brazilian sample Ausência de associação entre o polimorfismo VNTR do gene do transportador de dopamina (SLC6A3 e esquizofrenia em uma população brasileira

    Directory of Open Access Journals (Sweden)

    Quirino Cordeiro

    2004-12-01

    Full Text Available A role of dopaminergic dysfunction has been postulated in the aetiology of schizophrenia. We hypothesized that variations in the dopamine transporter gene (SLC6A3 may be associated with schizophrenia. We conducted case-control and family based analysis on the polymorphic SLC6A3 variable number tandem repeat (VNTR in a sample of 220 schizophrenic patients, 226 gender and ethnic matched controls, and 49 additional case-parent trios. No differences were found in allelic or genotypic distributions between cases and controls and no significant transmission distortions from heterozygous parents to schizophrenic offspring were detected. Thus, our results do not support an association of the SLC6A3 VNTR with schizophrenia in our sample.Genes do sistema dopaminérgico são de escolha para a pesquisa de susceptibilidade para a esquizofrenia. Desse modo, possível contribuição do polimorfismo do gene do transportador de dopamina (SLC6A3 no aumento da vulnerabilidade para a esquizofrenia foi investigada no presente estudo. Analisou-se a distribuição do sítio polimórfico do gene do transportador de dopamina (VNTR em uma população de 220 pacientes com esquizofrenia (critério diagnóstico: DSM-IV e comparou-se com a distribuição em uma população controle de 226 indivíduos pareados para sexo e etnia. Nenhuma diferença foi observada na distribuição dos alelos entre casos e controles. O mesmo polimorfismo também foi investigado em uma segunda amostra composta por 49 trios (pais e probando. O resultado também foi negativo. Tais dados não dão suporte para a participação do polimorfismo do gene do transportador de dopamina no aumento de susceptibilidade para esquizofrenia na amostra estudada.

  2. Evaluation of omega-3 fatty acids content and antioxidant activity in wheat (Triticum aestivum L. leaves Avaliação do teor de ácidos graxos ômega-3 e atividade antioxidante em folhas de trigo (Triticum aestivum L.

    Directory of Open Access Journals (Sweden)

    Ana Carolina de Aguiar

    2011-08-01

    Full Text Available The objective of this study was to quantify alpha-linolenic acid (LNA, 18:3n-3 of dried wheat leaves, harvested at different development stages (20, 40 and 80 days, to determine the antioxidant potential and the total phenolic compounds of leaves harvested at 80 days, as well as to perform mineral analysis (Na, K, Fe, Ca, Mg, P, Zn, Cu and Mn. It was observed a predominance of polyunsaturated fatty acids (PUFA compared to saturated fatty acids (SFA in the lipid fraction of leaves. Leaves collected in all periods presented ratios of PUFA/SFA, omega-6 and omega-3 fatty acids (n-6/n-3 considered suitable for food. The highest content of LNA was found in leaves harvested at 60 days, corresponding to 2.146,72 mg 100 g-1 dried matter. The range time between 60 and 80 days showed a decline of nearly 30% in the concentration of LNA. The acetate fraction was the most effective over DPPH radical assay, showing IC50 value of 154 µg mL-1, and the phenolic compounds content was 615.4 ± 36.4 mg EAG L-1, both analyses carried out in leaves harvested at 80 days. In this development stage, wheat leaves showed significant levels of the minerals P, Zn, Cu and Mn. These results reinforce the potential of using wheat leaves in foods, according to its antioxidant content and significant levels of LNA.Conduziu-se este estudo, com o objetivo de quantificar o ácido alfa-linolênico (LNA, 18:3n-3 em folhas de trigo secas e colhidas em diferentes estádios de desenvolvimento (20, 40 e 80 dias, determinar o potencial antioxidante e o conteúdo de fenólicos totais em folhas colhidas aos 80 dias, assim como realizar a analise de minerais (Na, K, Fe, Ca, Mg, P, Zn, Cu e Mn. Foi verificada uma predominância de ácidos graxos poli-insaturados (AGPI comparado com os ácidos graxos saturados (AGS na fração lipídica das folhas. As folhas colhidas em todos os períodos apresentaram razões de AGPI/AGS e de ácidos graxos ômega-6 e ômega-3 (n-6/n-3, dentro dos valores considerados adequados para a alimentação. O maior teor de LNA foi encontrado nas folhas colhidas aos 60 dias, correspondendo a 2.146,72 mg 100 g-1 de matéria seca. Entre 60 e 80 dias, observou-se uma queda de cerca de 30% na concentração de LNA. A fração acetato foi eficiente na inibição do radical DPPH, apresentando valor de IC50 de 154 µg mL-1, e o teor de compostos fenólicos foi de 615,4 ± 36,4 mg EAG L-1, ambas as análises para as folhas colhidas aos 80 dias. Nesse estádio de crescimento, as folhas apresentaram consideráveis teores dos minerais P, Zn, Cu e Mn. Tais resultados reforçam a importância do uso de folhas de trigo para alimentação humana, em função de seu potencial antioxidante e consideráveis teores de LNA.

  3. Synthesis and characterization of magnetic nanoparticles of oxides for dual MnFe2O4 bioseparation, stabilized in fatty acid and the system chitosan - Eu(TTA)3(TPPO)2. Studies on the influence of doping with Gd3+, Tb3+, Ho3+ e Eu3+ in structural and magnetic properties

    International Nuclear Information System (INIS)

    Kovacs, Thelma Antunes Rodrigues

    2014-01-01

    This work was synthesized and characterized ferrite magnetic nanoparticles manganese, using the chemical coprecipitation method. By varying the heating time under 98°C (0, 10,20,40,60 3 80 minutes), the molar percentage of doping (1, 3, 5, 7, and 10%), gadolinium, europium, terbium and holmium. Magnetic ferrite nanoparticles and manganese ferrite doped with manganese were synthesized by coprecipitation method starting with chloride solutions of metals (iron (III), manganese (II), europium (III), gadolinium (III), terbium (III) and holmium (III)) and NaOH 5mol.L -1 as precipitating agent. The magnetic nanoparticles were characterized by scanning electron microscopy, infrared spectroscopy, X-ray diffraction, magnetization curves, and thermal analysis. Most of manganese ferrite particles showed superparamagnetic behavior. After the characterization it was found that the samples synthesized manganese ferrite with more than 40 minutes heating time, crystal structure showed the characteristic pattern of the inverted manganese ferrite spinel type. The stabilization of the samples in oleic acid nanoparticles produced with a hydrophobic outer layer and facilitated by coating chitosan biopolymer, since this has a positive charge. Among the doped samples there was no significant change in the magnetic behavior. Several techniques for characterizing these materials have been used such as X-ray diffraction spectrum in the infrared region, magnetization curves and thermal analysis. The resins were tested as magnetic material for the separation of biological materials. In this paper, are used as biological targets separation of bovine serum albumin. (author)

  4. Níveis séricos de 25-hidroxivitamina D3 e sua associação com parâmetros clínicos e laboratoriais em pacientes com lúpus eritematoso sistêmico 25-Hydroxyivitamin D3 levels in patients with systemic lupus erythematosus and its association with clinical parameters and laboratory tests

    Directory of Open Access Journals (Sweden)

    Thiago Sotero Fragoso

    2012-02-01

    Full Text Available INTRODUÇÃO: O papel imunorregulatório da vitamina D tem sido alvo de um crescente número de estudos em pacientes com lúpus eritematoso sistêmico (LES. Objetivos: Determinar os níveis séricos de 25-hidroxivitamina D3 [25(OHD] em pacientes com LES e verificar a associação da insuficiência/deficiência de 25(OHD com parâmetros clínicos e laboratoriais. MÉTODOS:Estudo de corte transversal, prospectivo, realizado no ambulatório de LES do Serviço de Reumatologia do Hospital das Clínicas da Universidade Federal de Pernambuco. Foram incluídos 78 pacientes portadores de LES e 64 voluntários (grupo de comparação pareados por gênero e idade. RESULTADOS: Constatou-se insuficiência/deficiência de 25(OHD em 45 (57,7% pacientes com LES e em 25 (39% indivíduos do grupo de comparação. Os níveis séricos médios de 25(OHD foram 29,3 ng/mL (6,1-55,2 ng/mL nos pacientes com LES e 33,12 ng/mL (15,9-63,8 ng/mL no grupo de comparação; essa diferença é considerada estatisticamente significante (P = 0,041. Não houve diferença estatisticamente significante entre as médias de idade dos dois grupos. Não houve associação estatisticamente significante entre insuficiência/deficiência de 25(OHD e tempo de diagnóstico, atividade de doença (SLEDAI > 6, fadiga, uso de corticosteroides e de antimaláricos e anti-DNA. CONCLUSÕES:Foi constatada alta prevalência de insuficiência/deficiência de 25(OHD nos pacientes com LES (57,7%, com diferença estatisticamente significante em relação ao grupo de comparação. Não evidenciamos associação de insuficiência/deficiência de vitamina D com as variáveis clínicas e laboratoriais estudadas. Os autores enfatizam a importância da determinação dos níveis séricos de 25(OHD em todos os pacientes com LES, independente de onde residam e do tempo de diagnóstico da doençaINTRODUCTION: The immunoregulatory role of vitamin D has been the object of a growing number of studies in patients with systemic lupus erythematosus (SLE. OBJECTIVES: To determine the serum levels of 25-hydroxyvitamin D3 [25(OH D] in patients with SLE, and to assess the association of 25(OHD insufficiency/deficiency with clinical parameters and laboratory tests. METHODS: Cross-sectional, prospective study performed at the SLE Clinic, Department of Rheumatology, Hospital das Clínicas, Universidade Federal de Pernambuco with convenience sampling, including 78 patients with SLE and 64 volunteers (comparison group, matched by gender and age. RESULTS: Insufficiency/deficiency of 25(OHD was found in 45 (57.7% patients with SLE and 25 (39% individuals in the comparison group. The mean serum levels of 25(OHD were 29.3 ng/mL (6.1-55.2 ng/mL in patients with SLE and 33.12 ng/mL (15.9-63.8 ng/mL in the comparison group, and this difference was statistically significant (P = 0.041. No statistically significant difference was observed between the mean ages of both groups. No statistically significant association was observed between 25(OHD insufficiency/deficiency and the following: time to diagnosis; disease activity (SLEDAI > 6; fatigue; use of corticosteroids and antimalarials; and anti-DNA. CONCLUSIONS: High prevalence of 25(OHD insufficiency/deficiency was found in patients with SLE (57.7%, with statistically significant difference as compared with the comparison group. No association of vitamin D insufficiency/deficiency was observed with the clinical variables and laboratory tests studied. The authors emphasize the importance of determining 25(OHD serum levels in all patients with SLE, regardless of where they live and time to disease diagnosis

  5. Decreased number of interneurons and increased seizures in neuropilin 2 deficient mice: implications for autism and epilepsy.

    Science.gov (United States)

    Gant, John C; Thibault, Oliver; Blalock, Eric M; Yang, Jun; Bachstetter, Adam; Kotick, James; Schauwecker, Paula E; Hauser, Kurt F; Smith, George M; Mervis, Ron; Li, YanFang; Barnes, Gregory N

    2009-04-01

    Clinically, perturbations in the semaphorin signaling system have been associated with autism and epilepsy. The semaphorins have been implicated in guidance, migration, differentiation, and synaptic plasticity of neurons. The semaphorin 3F (Sema3F) ligand and its receptor, neuropilin 2 (NPN2) are highly expressed within limbic areas. NPN2 signaling may intimately direct the apposition of presynaptic and postsynaptic locations, facilitating the development and maturity of hippocampal synaptic function. To further understand the role of NPN2 signaling in central nevous system (CNS) plasticity, structural and functional alterations were assessed in NPN2 deficient mice. In NPN2 deficient mice, we measured seizure susceptibility after kainic acid or pentylenetetrazol, neuronal excitability and synaptic throughput in slice preparations, principal and interneuron cell counts with immunocytochemical protocols, synaptosomal protein levels with immunoblots, and dendritic morphology with Golgi-staining. NPN2 deficient mice had shorter seizure latencies, increased vulnerability to seizure-related death, were more likely to develop spontaneous recurrent seizure activity after chemical challenge, and had an increased slope on input/output curves. Principal cell counts were unchanged, but GABA, parvalbumin, and neuropeptide Y interneuron cell counts were significantly reduced. Synaptosomal NPN2 protein levels and total number of GABAergic synapses were decreased in a gene dose-dependent fashion. CA1 pyramidal cells showed reduced dendritic length and complexity, as well as an increased number of dendritic spines. These data suggest the novel hypothesis that the Sema 3F signaling system's role in appropriate placement of subsets of hippocampal interneurons has critical downstream consequences for hippocampal function, resulting in a more seizure susceptible phenotype.

  6. Cellular toxicity following application of adeno-associated viral vector-mediated RNA interference in the nervous system

    Directory of Open Access Journals (Sweden)

    Verhaagen Joost

    2010-02-01

    Full Text Available Abstract Background After a spinal cord lesion, axon regeneration is inhibited by the presence of a diversity of inhibitory molecules in the lesion environment. At and around the lesion site myelin-associated inhibitors, chondroitin sulfate proteoglycans (CSPGs and several axon guidance molecules, including all members of the secreted (class 3 Semaphorins, are expressed. Interfering with multiple inhibitory signals could potentially enhance the previously reported beneficial effects of blocking single molecules. RNA interference (RNAi is a tool that can be used to simultaneously silence expression of multiple genes. In this study we aimed to employ adeno-associated virus (AAV mediated expression of short hairpin RNAs (shRNAs to target all Semaphorin class 3 signaling by knocking down its receptors, Neuropilin 1 (Npn-1 and Neuropilin 2 (Npn-2. Results We have successfully generated shRNAs that knock down Npn-1 and Npn-2 in a neuronal cell line. We detected substantial knockdown of Npn-2 mRNA when AAV5 viral vector particles expressing Npn-2 specific shRNAs were injected in dorsal root ganglia (DRG of the rat. Unexpectedly however, AAV1-mediated expression of Npn-2 shRNAs and a control shRNA in the red nucleus resulted in an adverse tissue response and neuronal degeneration. The observed toxicity was dose dependent and was not seen with control GFP expressing AAV vectors, implicating the shRNAs as the causative toxic agents. Conclusions RNAi is a powerful tool to knock down Semaphorin receptor expression in neuronal cells in vitro and in vivo. However, when shRNAs are expressed at high levels in CNS neurons, they trigger an adverse tissue response leading to neuronal degradation.

  7. Studies of the energy transfer processes from Er{sup 3+} and Ho{sup 3+} to Nd{sup 3+}, Tb{sup 3+} or Eu{sup 3+} in LiYF{sub 4} crystal and ZBLAN glass for the laser media optimization operating near 3{mu}m region; Estudos dos processos de transferencia de energia dos ions de Er{sup 3+} e Ho{sup 3+} para os ions de Nd{sup 3+}, Tb{sup 3+} e Eu{sup 3+} no cristal de LiYF{sub 4} e no vidro ZBLAN para a otimizacao de meios laser ativos que operam na regiao de 3{mu}m

    Energy Technology Data Exchange (ETDEWEB)

    Jagosich, Fabio Henrique

    2006-07-01

    The energy transfer processes (ET) from the {sup 4}I{sub 13/2}; {sup 4}I{sub 11/2} levels of Er{sup 3+} and {sup 5}I{sub 6} levels of Ho{sup 3+} ions in LiYF{sub 4} (YLF) crystal and ZBLAN glass to Nd{sup 3+}, Tb{sup 3+} or Eu{sup 3+} deactivators ions were studied. The micro parameters of these energy transfer processes were determined using the overlap integral method, and showed that Eu{sup 3+} ion is the best deactivator of the first excited state of the Ho{sup 3+} in YLF, and Nd{sup 3+} is the best deactivator of the Er{sup 3+} in YLF and ZBLAN materials. The 1.5 and 2.7{mu}m emissions of Er{sup 3+} and 2.1 and 2.9{mu}m fluorescence of Ho{sup 3+} were measured using short laser pulses excitations from a tunable OPO pumped 2w-Nd:YAG laser system. We proposed a criterion for discriminating the energy transfer processes assisted by excitation migration (diffusion or hopping) among donors. It was observed that diffusion model describes the ET process from the second excited state of the donor (Er{sup 3+} or Ho{sup 3+}) independently of the C{sub D-D}/C{sub D-A} ratio, while the hopping model can describe the ET process involving the first excited state of donor. We proposed a modification of the hopping model in order to describe the experimental results for systems having C{sub D-D}/C{sub D-A} {>=} 10. Using the ET parameters, we determined that the best systems for laser action at 3{mu}m are the Ho:Eu:YLF, Ho:Nd:YLF and Er:Nd:YLF systems. On the other hand, we found that Er{sup 3+} doped (1.5 mol%) ZBLAN glasses, single and co-doped with Nd{sup 3+}, Tb{sup 3+} or Eu{sup 3+}, do not show potential for laser action at 2.8{mu}m. The up-conversion processes were studied in Er:YLF systems as a function of the Er{sup 3+} concentration, and the excited state absorption (ESA) and up conversion by energy transfer (ETU) processes were discriminated using a time resolved fluorescence decays. It was observed that 980 nm is the most convenient wavelength for pumping the Er:YLF system for quasi cw laser operation at 2.8{mu}m. The pump-probe technique was used to investigate the lifetime effects in Er:YLF system showing that the excitation migration contribution to the lifetime of the first and second excited states of Er{sup 3+} decrease with the laser pump power increasing. Using the ET experimental rates determined for the best systems previously chosen based on the R{sub N} parameter as the input in the rate equation system numeric solved by Runge-Kutta (4{sup th} order), it was possible to evaluate the population density inversion for 2.8{mu}m (Er{sup 3+}) and 2.9{mu}m (Ho{sup 3+}) as a function of the pumping rate, activators and deactivators concentrations. The best concentration found for Er:YLF system was 20 mol%. The best concentrations in the case of Er:Nd:YLF system are 4 mol% of Er{sup 3+} and 1.5 mol% of Nd{sup 3+}. A frequency increasing from 14Hz to 391 Hz has been estimated as the maximum operation frequency for the Er(20 mol%):YLF and Er(4 mol%):Nd(1.5 mol%):YLF, respectively, based on the measured {sup 4}I{sub 13/2} excited state lifetime of Er{sup 3+}. The best concentrations of Ho{sup 3+} and deactivators found for the Ho-laser in YLF are Ho(0.6 mol%):Nd(1.5 mol%) and Ho(3 mol%):Eu(1.2 mol%). The Ho(3 mol%):Eu(1.2 mol%) system showed a population density inversion 2.4 times bigger than the one verified in Ho(0.6 mol%):Nd(1.5 mol%) system. (author)

  8. Synthesis and characterization of magnetic nanoparticles of oxides for dual MnFe{sub 2}O{sub 4} bioseparation, stabilized in fatty acid and the system chitosan - Eu(TTA){sub 3}(TPPO){sub 2}. Studies on the influence of doping with Gd{sup 3+}, Tb{sup 3+}, Ho{sup 3+} e Eu{sup 3+} in structural and magnetic properties; Sintese e caracterizacao de nanoparticulas magneticas de oxidos duplos de MnFe{sub 2}O{sub 4} para biosseparacao, estabilizadas em acido graxo e recobertas pelo sistema quitosana - Eu(TTA){sub 3}(TPPO){sub 2}. Estudo da influencia da dopagem com Gd{sup 3+}, Tb{sup 3+}, Ho{sup 3+} e Eu{sup 3+} nas propriedades estruturais e magneticas

    Energy Technology Data Exchange (ETDEWEB)

    Kovacs, Thelma Antunes Rodrigues

    2014-07-01

    This work was synthesized and characterized ferrite magnetic nanoparticles manganese, using the chemical coprecipitation method. By varying the heating time under 98°C (0, 10,20,40,60 3 80 minutes), the molar percentage of doping (1, 3, 5, 7, and 10%), gadolinium, europium, terbium and holmium. Magnetic ferrite nanoparticles and manganese ferrite doped with manganese were synthesized by coprecipitation method starting with chloride solutions of metals (iron (III), manganese (II), europium (III), gadolinium (III), terbium (III) and holmium (III)) and NaOH 5mol.L{sup -1} as precipitating agent. The magnetic nanoparticles were characterized by scanning electron microscopy, infrared spectroscopy, X-ray diffraction, magnetization curves, and thermal analysis. Most of manganese ferrite particles showed superparamagnetic behavior. After the characterization it was found that the samples synthesized manganese ferrite with more than 40 minutes heating time, crystal structure showed the characteristic pattern of the inverted manganese ferrite spinel type. The stabilization of the samples in oleic acid nanoparticles produced with a hydrophobic outer layer and facilitated by coating chitosan biopolymer, since this has a positive charge. Among the doped samples there was no significant change in the magnetic behavior. Several techniques for characterizing these materials have been used such as X-ray diffraction spectrum in the infrared region, magnetization curves and thermal analysis. The resins were tested as magnetic material for the separation of biological materials. In this paper, are used as biological targets separation of bovine serum albumin. (author)

  9. Sema4D, the ligand for Plexin B1, suppresses c-Met activation and migration and promotes melanocyte survival and growth.

    Science.gov (United States)

    Soong, Joanne; Chen, Yulin; Shustef, Elina M; Scott, Glynis A

    2012-04-01

    Semaphorins are secreted and membrane-bound proteins involved in neural pathfinding, organogenesis, and tumor progression, through Plexin and neuropilin receptors. We recently reported that Plexin B1, the Semaphorin 4D (Sema4D) receptor, is a tumor-suppressor protein for melanoma, which functions, in part, through inhibition of the oncogenic c-Met tyrosine kinase receptor. In this report, we show that Sema4D is a protective paracrine factor for normal human melanocyte survival in response to UV irradiation, and that it stimulates proliferation and regulates the activity of the c-Met receptor. c-Met receptor signaling stimulates melanocyte migration, partly through downregulation of the cell adhesion molecule E-cadherin. Sema4D suppressed activation of c-Met in response to its ligand, hepatocyte growth factor (HGF), and partially blocked the suppressive effects of HGF on E-cadherin expression in melanocytes and HGF-dependent migration. These data demonstrate a role for Plexin B1 in maintenance of melanocyte survival and proliferation in the skin, and suggest that Sema4D and Plexin B1 act cooperatively with HGF and c-Met to regulate c-Met-dependent effects in human melanocytes. Because our data show that Plexin B1 is profoundly downregulated by UVB in melanocytes, loss of Plexin B1 may accentuate HGF-dependent effects on melanocytes, including melanocyte migration.

  10. A reverse signaling pathway downstream of Sema4A controls cell migration via Scrib.

    Science.gov (United States)

    Sun, Tianliang; Yang, Lida; Kaur, Harmandeep; Pestel, Jenny; Looso, Mario; Nolte, Hendrik; Krasel, Cornelius; Heil, Daniel; Krishnan, Ramesh K; Santoni, Marie-Josée; Borg, Jean-Paul; Bünemann, Moritz; Offermanns, Stefan; Swiercz, Jakub M; Worzfeld, Thomas

    2017-01-02

    Semaphorins comprise a large family of ligands that regulate key cellular functions through their receptors, plexins. In this study, we show that the transmembrane semaphorin 4A (Sema4A) can also function as a receptor, rather than a ligand, and transduce signals triggered by the binding of Plexin-B1 through reverse signaling. Functionally, reverse Sema4A signaling regulates the migration of various cancer cells as well as dendritic cells. By combining mass spectrometry analysis with small interfering RNA screening, we identify the polarity protein Scrib as a downstream effector of Sema4A. We further show that binding of Plexin-B1 to Sema4A promotes the interaction of Sema4A with Scrib, thereby removing Scrib from its complex with the Rac/Cdc42 exchange factor βPIX and decreasing the activity of the small guanosine triphosphatase Rac1 and Cdc42. Our data unravel a role for Plexin-B1 as a ligand and Sema4A as a receptor and characterize a reverse signaling pathway downstream of Sema4A, which controls cell migration. © 2017 Sun et al.

  11. Teores de nitrato (NO3- e amônio (NH4+ nas águas do aqüífero Barreiras nos bairros do Reduto, Nazaré e Umarizal - Belém/PA Nitrate (NO3- and ammonium (NH4+ contents in the Barreiras aquifer waters in the districts of Reduto, Nazaré and Umarizal - Belém, PA

    Directory of Open Access Journals (Sweden)

    Natalina Maria Tinôco Cabral

    2007-01-01

    Full Text Available This paper evaluates the occurrence of nitrate and ammonium in the Barreiras aquifer in the metropolitan area of Belém, Pará State, Brazil. The results show that some wells display ammonium and nitrate concentrations above or close to the limits of water potability regulations. The main cause of the pollution of these waters is related the local disposal of domestic effluents and/or leakage from pipes of old sewage systems.

  12. Comparative study between traditional and modified Pechini synthesis methods in the preparation of LaNiO{sub 3} and LaNi{sub 0,8}Co{sub 0,2}O{sub 3} catalysts; Estudo comparativo entre os metodos de sintese Pechini tradicional e modificado na confeccao dos catalisadores LaNiO{sub 3} e LaNi{sub 0,8}Co{sub 0,2}O{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Silva, F.E.F.; Aquino, F.M.; Silva, M.C.M.F., E-mail: fabio@cear.ufpb.br [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Departamento de Engenharia de Energias Renovaveis

    2016-07-01

    One of the ways of obtaining hydrogen is from the methane reforming reaction, which is an endothermic and non-spontaneous reaction. In order to minimize this energy, nickel catalysts are used. This work aims to synthesize and characterize the catalysts LaNiO{sub 3} and LaNi{sub 0,8}Co{sub 0,2}O{sub 3} using the Pechini method, making use of citric acid and ethylene glycol and modified Pechini, using the edible gelatin as a chelating and polymerizing agent. The obtained materials were characterized by X-Ray Diffraction (XRD), where the formation of peaks characteristic of perovskite and monophasic structures was observed. Scanning Electron Microscopy (SEM) showed that porosity and powders with few agglomerates were observed by both methods. In the analysis of determination of the specific surface area (BET) the materials were shown with areas that are according to the literature.

  13. Production, characterization and application of Gd{sub 2}O{sub 3} and Er{sub 2}O{sub 3} nanoparticles as radiosensitizers in radiotherapy beams; Produção, caracterização e aplicação de nanopartículas de Gd{sub 2}O{sub 3} e Er{sub 2}O{sub 3} como radiossensibilizadores em feixes de radioterapia

    Energy Technology Data Exchange (ETDEWEB)

    Corrêa, Eduardo de Lima

    2017-07-01

    In this study Gd{sub 2}O{sub 3} and Er{sub 2}O{sub 3} nanoparticles were produced for application as radiosensitizers in radiotherapy beams. They were synthesized at the Hyperfine Interactions Laboratory, IPEN, using thermal decomposition method and characterized by X-ray diffraction, to verify crystalline structure, transmission electron microscopy, to obtain information about shape, size and size distribution, neutron activation analysis, whereby it was possible to determine samples purity and gadolinium and erbium concentration. Magnetization and perturbed γ-γ angular correlation (PAC) measurements were performed in order to study particles magnetic behavior and quadrupole interactions, respectively. Characterization results showed a bixbyite structure, 5 nm diameter post-synthesis particles with narrow size distribution. Rare-earth mass determination in each sample was important to perform normalization in magnetic susceptibility measurements, making possible the view of a high magnetization under 30 K for post-synthesis samples, what was not observed in larger particles, together with an effective magnetic moment enhancement for nanoparticles, not seen in bulk samples, and a change in the antiferromagnetic ordering temperature for Er{sub 2}O{sub 3}. PAC spectroscopy results show possible surface effects. The absence of a well-defined frequency in 5 nm samples indicates the amount of {sup 111}In({sup 111}Cd) at particle surface is bigger than in the core, resulting in a non-evident hyperfine interaction between the probe nuclei and the host. The X-ray diffraction and PAC spectroscopy joint was vital to understand the particles structural damage caused by {sup 60}Co irradiation. About radiosensitizer measurements a dose enhancement factor (DEF) of up to 1,67 and 1,09 for Gd{sub 2}O{sub 3} nanoparticles under {sup 60}Co and 6MV irradiation, respectively, were observed. Under same conditions DEF values of up to 1,37 and 1,06 were found for Er{sub 2}O{sub 3} samples. Results reached in this study provide not only important data for rare-earth oxides study in condensed matter physics but also a solid ground for the application of these elements as radiosensitizers in radiotherapy beams, allowing the use of magnetic resonance imaging to locate and obtain the concentration of these particles inside patient body, increasing cancer treatment efficiency. (author)

  14. Production and characterization of ceramic composite Al{sub 2}O{sub 3}-TiO{sub 2} reinforced with Y{sub 2}O{sub 3} and its stability in crude oil for internal coating of petroleum tankers; Producao e caracterizacao de compositos ceramicos Al{sub 2}O{sub 3}-TiO{sub 2} reforcado com Y{sub 2}O{sub 3} e sua estabilidade em petroleo cru para revestimento interno de navios petroleiros

    Energy Technology Data Exchange (ETDEWEB)

    Yadava, Y.P.; David, N.R.; Sanguinetti Ferreira, R.A.; Shinohara, A.H., E-mail: yadava@ufpe.br, E-mail: natielle.ramos@hotmail.com [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Engenharia Mecanica

    2014-07-01

    The internal surfaces of crude petroleum tankers are subjected to corrosive environments, therefore it is of great importance to research coatings for the protection of those structures. Ceramic materials generally exhibit characteristic chemical inertness and are shown as material option for this application. In this study alumina-titania ceramic composites have been produced and reinforced with yttria. These composites were produced by thermo-mechanical process, sintered at 1350 ° C for 24 hours, and left to cool down in the oven. The structural and microstructural characterization of the sintered material was tested by X-ray diffraction and scanning electron microscopy. And its mechanical property was studied by Vickers microhardness test. After this characterization, the samples underwent a stability test where they were immersed in crude oil at room temperature for 60 days, during which were periodically subjected to tests related to stability, which was found found that the material was free from cracks, fissures or fractures, presenting for these reasons characteristics of inertia when subjected to crude oil environment. (author)

  15. Insights into function of PSI domains from structure of the Met receptor PSI domain

    International Nuclear Information System (INIS)

    Kozlov, Guennadi; Perreault, Audrey; Schrag, Joseph D.; Park, Morag; Cygler, Miroslaw; Gehring, Kalle; Ekiel, Irena

    2004-01-01

    PSI domains are cysteine-rich modules found in extracellular fragments of hundreds of signaling proteins, including plexins, semaphorins, integrins, and attractins. Here, we report the solution structure of the PSI domain from the human Met receptor, a receptor tyrosine kinase critical for proliferation, motility, and differentiation. The structure represents a cysteine knot with short regions of secondary structure including a three-stranded antiparallel β-sheet and two α-helices. All eight cysteines are involved in disulfide bonds with the pattern consistent with that for the PSI domain from Sema4D. Comparison with the Sema4D structure identifies a structurally conserved core comprising the N-terminal half of the PSI domain. Interestingly, this part links adjacent SEMA and immunoglobulin domains in the Sema4D structure, suggesting that the PSI domain serves as a wedge between propeller and immunoglobulin domains and is responsible for the correct positioning of the ligand-binding site of the receptor

  16. Two Classes of Secreted Synaptic Organizers in the Central Nervous System.

    Science.gov (United States)

    Yuzaki, Michisuke

    2018-02-10

    Research in the last two decades has identified many synaptic organizers in the central nervous system that directly regulate the assembly of pre- and/or postsynaptic molecules, such as synaptic vesicles, active zone proteins, and neurotransmitter receptors. They are classified into secreted factors and cell adhesion molecules, such as neurexins and neuroligins. Certain secreted factors are termed extracellular scaffolding proteins (ESPs) because they are components of the synaptic extracellular matrix and serve as a scaffold at the synaptic cleft. These include Lgi1, Cbln1, neuronal pentraxins, Hevin, thrombospondins, and glypicans. Diffusible secreted factors, such as Wnts, fibroblast growth factors, and semaphorins, tend to act from a distance. In contrast, ESPs remain at the synaptic cleft and often help synaptic adhesion and/or accumulation of postsynaptic receptors. Many fundamental questions remain about when, how, and why various synaptic organizers establish and modify the vast numbers of connections during development and throughout life.

  17. mTOR Complex Signaling through the SEMA4A-Plexin B2 Axis Is Required for Optimal Activation and Differentiation of CD8+ T Cells.

    Science.gov (United States)

    Ito, Daisuke; Nojima, Satoshi; Nishide, Masayuki; Okuno, Tatsusada; Takamatsu, Hyota; Kang, Sujin; Kimura, Tetsuya; Yoshida, Yuji; Morimoto, Keiko; Maeda, Yohei; Hosokawa, Takashi; Toyofuku, Toshihiko; Ohshima, Jun; Kamimura, Daisuke; Yamamoto, Masahiro; Murakami, Masaaki; Morii, Eiichi; Rakugi, Hiromi; Isaka, Yoshitaka; Kumanogoh, Atsushi

    2015-08-01

    Mammalian target of rapamycin (mTOR) plays crucial roles in activation and differentiation of diverse types of immune cells. Although several lines of evidence have demonstrated the importance of mTOR-mediated signals in CD4(+) T cell responses, the involvement of mTOR in CD8(+) T cell responses is not fully understood. In this study, we show that a class IV semaphorin, SEMA4A, regulates CD8(+) T cell activation and differentiation through activation of mTOR complex (mTORC) 1. SEMA4A(-/-) CD8(+) T cells exhibited impairments in production of IFN-γ and TNF-α and induction of the effector molecules granzyme B, perforin, and FAS-L. Upon infection with OVA-expressing Listeria monocytogenes, pathogen-specific effector CD8(+) T cell responses were significantly impaired in SEMA4A(-/-) mice. Furthermore, SEMA4A(-/-) CD8(+) T cells exhibited reduced mTORC1 activity and elevated mTORC2 activity, suggesting that SEMA4A is required for optimal activation of mTORC1 in CD8(+) T cells. IFN-γ production and mTORC1 activity in SEMA4A(-/-) CD8(+) T cells were restored by administration of recombinant Sema4A protein. In addition, we show that plexin B2 is a functional receptor of SEMA4A in CD8(+) T cells. Collectively, these results not only demonstrate the role of SEMA4A in CD8(+) T cells, but also reveal a novel link between a semaphorin and mTOR signaling. Copyright © 2015 by The American Association of Immunologists, Inc.

  18. Rare Copy Number Variations in Adults with Tetralogy of Fallot Implicate Novel Risk Gene Pathways

    Science.gov (United States)

    Costain, Gregory; Merico, Daniele; Migita, Ohsuke; Liu, Ben; Yuen, Tracy; Rickaby, Jessica; Thiruvahindrapuram, Bhooma; Marshall, Christian R.; Scherer, Stephen W.; Bassett, Anne S.

    2012-01-01

    Structural genetic changes, especially copy number variants (CNVs), represent a major source of genetic variation contributing to human disease. Tetralogy of Fallot (TOF) is the most common form of cyanotic congenital heart disease, but to date little is known about the role of CNVs in the etiology of TOF. Using high-resolution genome-wide microarrays and stringent calling methods, we investigated rare CNVs in a prospectively recruited cohort of 433 unrelated adults with TOF and/or pulmonary atresia at a single centre. We excluded those with recognized syndromes, including 22q11.2 deletion syndrome. We identified candidate genes for TOF based on converging evidence between rare CNVs that overlapped the same gene in unrelated individuals and from pathway analyses comparing rare CNVs in TOF cases to those in epidemiologic controls. Even after excluding the 53 (10.7%) subjects with 22q11.2 deletions, we found that adults with TOF had a greater burden of large rare genic CNVs compared to controls (8.82% vs. 4.33%, p = 0.0117). Six loci showed evidence for recurrence in TOF or related congenital heart disease, including typical 1q21.1 duplications in four (1.18%) of 340 Caucasian probands. The rare CNVs implicated novel candidate genes of interest for TOF, including PLXNA2, a gene involved in semaphorin signaling. Independent pathway analyses highlighted developmental processes as potential contributors to the pathogenesis of TOF. These results indicate that individually rare CNVs are collectively significant contributors to the genetic burden of TOF. Further, the data provide new evidence for dosage sensitive genes in PLXNA2-semaphorin signaling and related developmental processes in human cardiovascular development, consistent with previous animal models. PMID:22912587

  19. A cytosolic juxtamembrane interface modulates plexin A3 oligomerization and signal transduction.

    Directory of Open Access Journals (Sweden)

    Rachael Barton

    Full Text Available Plexins (plxns are transmembrane (TM receptors involved in the guidance of vascular, lymphatic vessel, and neuron growth as well as cancer metastasis. Plxn signaling results in cytosolic GTPase-activating protein activity, and previous research implicates dimerization as important for activation of plxn signaling. Purified, soluble plxn extracellular and cytosolic domains exhibit only weak homomeric interactions, suggesting a role for the plxn TM and juxtamembrane regions in homooligomerization. In this study, we consider a heptad repeat in the Danio rerio PlxnA3 cytosolic juxtamembrane domain (JM for its ability to influence PlxnA3 homooligomerization in TM-domain containing constructs. Site-directed mutagenesis in conjunction with the AraTM assay and bioluminescent energy transfer (BRET² suggest an interface involving a JM heptad repeat, in particular residue M1281, regulates PlxnA3 homomeric interactions when examined in constructs containing an ectodomain, TM and JM domain. In the presence of a neuropilin-2a co-receptor and semaphorin 3F ligand, disruption to PlxnA3 homodimerization caused by an M1281F mutation is eliminated, suggesting destabilization of the PlxnA3 homodimer in the JM is not sufficient to disrupt co-receptor complex formation. In contrast, enhanced homodimerization of PlxnA3 caused by mutation M1281L remains even in the presence of ligand semaphorin 3F and co-receptor neuropilin-2a. Consistent with this pattern of PlxnA3 dimerization in the presence of ligand and co-receptor, destabilizing mutations to PlxnA3 homodimerization (M1281F are able to rescue motor patterning defects in sidetracked zebrafish embryos, whereas mutations that enhance PlxnA3 homodimerization (M1281L are not. Collectively, our results indicate the JM heptad repeat, in particular residue M1281, forms a switchable interface that modulates both PlxnA3 homomeric interactions and signal transduction.

  20. Altered Satellite Cell Responsiveness and Denervation Implicated in Progression of Rotator-Cuff Injury.

    Directory of Open Access Journals (Sweden)

    Deanna Gigliotti

    Full Text Available Rotator-cuff injury (RCI is common and painful; even after surgery, joint stability and function may not recover. Relative contributions to atrophy from disuse, fibrosis, denervation, and satellite-cell responsiveness to activating stimuli are not known.Potential contributions of denervation and disrupted satellite cell responses to growth signals were examined in supraspinatus (SS and control (ipsilateral deltoid muscles biopsied from participants with RCI (N = 27. Biopsies were prepared for explant culture (to study satellite cell activity, immunostained to localize Pax7, BrdU, and Semaphorin 3A in satellite cells, sectioning to study blood vessel density, and western blotting to measure the fetal (γ subunit of acetylcholine receptor (γ-AchR. Principal component analysis (PCA for 35 parameters extracted components identified variables that contributed most to variability in the dataset. γ-AchR was higher in SS than control, indicating denervation. Satellite cells in SS had a low baseline level of activity (Pax7+ cells labelled in S-phase versus control; only satellite cells in SS showed increased proliferative activity after nitric oxide-donor treatment. Interestingly, satellite cell localization of Semaphorin 3A, a neuro-chemorepellent, was greater in SS (consistent with fiber denervation than control muscle at baseline. PCAs extracted components including fiber atrophy, satellite cell activity, fibrosis, atrogin-1, smoking status, vascular density, γAchR, and the time between symptoms and surgery. Use of deltoid as a control for SS was supported by PCA findings since "muscle" was not extracted as a variable in the first two principal components. SS muscle in RCI is therefore atrophic, denervated, and fibrotic, and has satellite cells that respond to activating stimuli.Since SS satellite cells can be activated in culture, a NO-donor drug combined with stretching could promote muscle growth and improve functional outcome after RCI. PCAs

  1. Abundant expression of guidance and synaptogenic molecules in the injured spinal cord.

    Directory of Open Access Journals (Sweden)

    Anne Jacobi

    Full Text Available BACKGROUND: Spinal interneurons have emerged as crucial targets of supraspinal input during post-injury axonal remodelling. For example, lesioned corticospinal projections use propriospinal neurons as relay stations to form intraspinal detour circuits that circumvent the lesion site and contribute to functional recovery. While a number of the molecules that determine the formation of neuronal circuits in the developing nervous system have been identified, it is much less understood which of these cues are also expressed in the injured spinal cord and can thus guide growing collaterals and initiate synaptogenesis during circuit remodelling. METHODOLOGY/PRINCIPAL FINDINGS: To address this question we characterized the expression profile of a number of guidance and synaptogenic molecules in the cervical spinal cord of healthy and spinal cord-injured mice by in situ hybridization. To assign the expression of these molecules to distinct populations of interneurons we labeled short and long propriospinal neurons by retrograde tracing and glycinergic neurons using a transgenically expressed fluorescent protein. Interestingly, we found that most of the molecules studied including members of slit-, semaphorin-, synCAM-, neuroligin- and ephrin- families as well as their receptors are also present in the adult CNS. While many of these molecules were abundantly expressed in all interneurons examined, some molecules including slits, semaphorin 7a, synCAM4 and neuroligin 1 showed preferential expression in propriospinal interneurons. Overall the expression pattern of guidance and synaptogenic molecules in the cervical spinal cord appeared to be stable over time and was not substantially altered following a midthoracic spinal cord injury. CONCLUSIONS: Taken together, our study indicates that many of the guidance and synaptogenic cues that regulate neuronal circuit formation in development are also present in the adult CNS and therefore likely contribute to the

  2. Connexin 43-mediated modulation of polarized cell movement and the directional migration of cardiac neural crest cells.

    Science.gov (United States)

    Xu, Xin; Francis, Richard; Wei, Chih Jen; Linask, Kaari L; Lo, Cecilia W

    2006-09-01

    Connexin 43 knockout (Cx43alpha1KO) mice have conotruncal heart defects that are associated with a reduction in the abundance of cardiac neural crest cells (CNCs) targeted to the heart. In this study, we show CNCs can respond to changing fibronectin matrix density by adjusting their migratory behavior, with directionality increasing and speed decreasing with increasing fibronectin density. However, compared with wild-type CNCs, Cx43alpha1KO CNCs show reduced directionality and speed, while CNCs overexpressing Cx43alpha1 from the CMV43 transgenic mice show increased directionality and speed. Altered integrin signaling was indicated by changes in the distribution of vinculin containing focal contacts, and altered temporal response of Cx43alpha1KO and CMV43 CNCs to beta1 integrin function blocking antibody treatment. High resolution motion analysis showed Cx43alpha1KO CNCs have increased cell protrusive activity accompanied by the loss of polarized cell movement. They exhibited an unusual polygonal arrangement of actin stress fibers that indicated a profound change in cytoskeletal organization. Semaphorin 3A, a chemorepellent known to inhibit integrin activation, was found to inhibit CNC motility, but in the Cx43alpha1KO and CMV43 CNCs, cell processes failed to retract with semaphorin 3A treatment. Immunohistochemical and biochemical analyses suggested close interactions between Cx43alpha1, vinculin and other actin-binding proteins. However, dye coupling analysis showed no correlation between gap junction communication level and fibronectin plating density. Overall, these findings indicate Cx43alpha1 may have a novel function in mediating crosstalk with cell signaling pathways that regulate polarized cell movement essential for the directional migration of CNCs.

  3. Altered Satellite Cell Responsiveness and Denervation Implicated in Progression of Rotator-Cuff Injury.

    Science.gov (United States)

    Gigliotti, Deanna; Leiter, Jeff R S; MacDonald, Peter B; Peeler, Jason; Anderson, Judy E

    Rotator-cuff injury (RCI) is common and painful; even after surgery, joint stability and function may not recover. Relative contributions to atrophy from disuse, fibrosis, denervation, and satellite-cell responsiveness to activating stimuli are not known. Potential contributions of denervation and disrupted satellite cell responses to growth signals were examined in supraspinatus (SS) and control (ipsilateral deltoid) muscles biopsied from participants with RCI (N = 27). Biopsies were prepared for explant culture (to study satellite cell activity), immunostained to localize Pax7, BrdU, and Semaphorin 3A in satellite cells, sectioning to study blood vessel density, and western blotting to measure the fetal (γ) subunit of acetylcholine receptor (γ-AchR). Principal component analysis (PCA) for 35 parameters extracted components identified variables that contributed most to variability in the dataset. γ-AchR was higher in SS than control, indicating denervation. Satellite cells in SS had a low baseline level of activity (Pax7+ cells labelled in S-phase) versus control; only satellite cells in SS showed increased proliferative activity after nitric oxide-donor treatment. Interestingly, satellite cell localization of Semaphorin 3A, a neuro-chemorepellent, was greater in SS (consistent with fiber denervation) than control muscle at baseline. PCAs extracted components including fiber atrophy, satellite cell activity, fibrosis, atrogin-1, smoking status, vascular density, γAchR, and the time between symptoms and surgery. Use of deltoid as a control for SS was supported by PCA findings since "muscle" was not extracted as a variable in the first two principal components. SS muscle in RCI is therefore atrophic, denervated, and fibrotic, and has satellite cells that respond to activating stimuli. Since SS satellite cells can be activated in culture, a NO-donor drug combined with stretching could promote muscle growth and improve functional outcome after RCI. PCAs suggest

  4. IL-3 Maintains Activation of the p90S6K/RPS6 Pathway and Increases Translation in Human Eosinophils.

    Science.gov (United States)

    Esnault, Stephane; Kelly, Elizabeth A B; Shen, Zhong-Jian; Johansson, Mats W; Malter, James S; Jarjour, Nizar N

    2015-09-15

    IL-5 is a major therapeutic target to reduce eosinophilia. However, all of the eosinophil-activating cytokines, such as IL-5, IL-3, and GM-CSF, are typically present in atopic diseases, including allergic asthma. As a result of the functional redundancy of these three cytokines on eosinophils and the loss of IL-5R on airway eosinophils, it is important to take IL-3 and GM-CSF into account to efficiently reduce tissue eosinophil functions. Moreover, these three cytokines signal through a common β-chain receptor but yet differentially affect protein production in eosinophils. Notably, the increased ability of IL-3 to induce the production of proteins, such as semaphorin-7A, without affecting mRNA levels suggests a unique influence of IL-3 on translation. The purpose of this study was to identify the mechanisms by which IL-3 distinctively affects eosinophil function compared with IL-5 and GM-CSF, with a focus on protein translation. Peripheral blood eosinophils were used to study intracellular signaling and protein translation in cells activated with IL-3, GM-CSF, or IL-5. We establish that, unlike GM-CSF or IL-5, IL-3 triggers prolonged signaling through activation of ribosomal protein S6 (RPS6) and the upstream kinase 90-kDa ribosomal S6 kinase (p90S6K). Blockade of p90S6K activation inhibited phosphorylation of RPS6 and IL-3-enhanced semaphorin-7A translation. Furthermore, in an allergen-challenged environment, in vivo phosphorylation of RPS6 and p90S6K was enhanced in human airway compared with circulating eosinophils. Our findings provide new insights into the mechanisms underlying differential activation of eosinophils by IL-3, GM-CSF, and IL-5. These observations identify IL-3 and its downstream intracellular signals as novel targets that should be considered to modulate eosinophil functions. Copyright © 2015 by The American Association of Immunologists, Inc.

  5. IL-3 maintains activation of the P90S6K/RPS6 pathway and increases translation in human eosinophils1

    Science.gov (United States)

    Esnault, Stephane; Kelly, Elizabeth A.B.; Shen, Zhong-Jian; Johansson, Mats W.; Malter, James S.; Jarjour, Nizar N.

    2015-01-01

    IL-5 is a major therapeutic target to reduce eosinophilia. However, all of the eosinophil-activating cytokines IL-5, IL-3, and GM-CSF are typically present in atopic diseases including allergic asthma. Due to the functional redundancy of these 3 cytokines on eosinophils and the loss of IL-5 receptor on airway eosinophils, it is important to take IL-3 and GM-CSF into account to efficiently reduce tissue eosinophil functions. Moreover, these 3 cytokines signal through a common β-chain receptor, and yet differentially affect protein production in eosinophils. Notably, the increased ability of IL-3 to induce production of proteins such as semaphorin-7A without affecting mRNA level suggests a unique influence by IL-3 on translation. The purpose of this study is to identify the mechanisms by which IL-3 distinctively affects eosinophil function compared to IL-5 and GM-CSF, with a focus on protein translation. Peripheral blood eosinophils were used to study intracellular signaling and protein translation in cells activated with IL-3, GM-CSF or IL-5. We establish that, unlike GM-CSF or IL-5, IL-3 triggers prolonged signaling through activation of ribosomal protein (RP) S6 and the upstream kinase, p90S6K. Blockade of p90S6K activation inhibited phosphorylation of RPS6 and IL-3-enhanced semaphorin-7A translation. Furthermore, in an allergen-challenged environment, in vivo phosphorylation of RPS6 and p90S6K was enhanced in human airway compared to circulating eosinophils. Our findings provide new insights into the mechanisms underlying differential activation of eosinophils by IL-3, GM-CSF, and IL-5. These observations place IL-3 and its downstream intracellular signals as novel targets that should be considered to modulate eosinophil functions. PMID:26276876

  6. A suplementação de ácidos graxos ômega 3 e triglicérides de cadeia média não alteram os indicadores metabólicos em um teste de exaustão La suplementacion de ácidos grasos omega 3 en los trigliceridos de cadena media como alteración en los indicadores metabólicos en un test de agotamiento The supplementation of omega-3 lipids and medium chain triglicerides do not affect metabolic indicators in the exhaustion test

    Directory of Open Access Journals (Sweden)

    Carlos Alexandre Fett

    2004-02-01

    Full Text Available PROPÓSITO: Este estudo compara os efeitos do treinamento de força (TF com ou sem a suplementação de lipídios ômega 3 (W-3 ou triglicérides de cadeia média (TCM, nos indicadores metabólicos em um teste de exaustão (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 anos de idade; 82,6 ± 10kg e grupo TCM (GTCM: n = 5, 18,8 ± 1,3 ano de idade; 74,6 ± 9,7kg com 11 meses mínimos em TF. Houve dois momentos de TE: depois de 28 dias somente com TF e coletas de sangue antes (M1a e após (M1d, e após mais 28 dias de TF mais a suplementação com W-3 ou TCM e repetindo o mesmo procedimento (M2a e M2d. RESULTADOS: O hematócrito (Ht, osmolalidade (Os, sódio (Na+ e pressão de dióxido de carbono (PCO2 não tiveram mudanças significativas em nenhum momento, grupo ou D M2 (P > 0,05. A pressão de oxigênio (PO2 aumentou significativamente após TE nos dois momentos e grupos (P PROPÓSITO: Este estudio compara los efectos de entrenamiento de fuerza (TF con o sin la suplementación de lípidos omega 3 (W-3 o triglicéridos de cadena media (TCM, los indicadores metabólicos en un test de agotamiento (TE. MÉTODOS: Grupo W-3 (GW-3: n = 7, 26,7 ± 6 años de idade; 82,6 ± 10 kg y grupo TCM (GTCM: n = 5, 18,8 ± 1,3 año de edad; 74,6 ± 9,7 kg con 11 meses mínimos en TF. Hubo 2 momentos de TE: después de 28 días solamente con TF y colectas de sangre antes (M1a y después (M1d, y después de mas de 28 días de TF más la suplementación con W-3 o TCM y repitiendo el mismo procedimiento (M2a e M2d. RESULTADOS: El hematocrito (Ht, osmolalidad (Os, sodio (Na+ y presión de dióxido de carbono (PCO2 no tuvieron cambios significativos en ningún momento, grupo de D M2 (P > 0,05. La presión de oxígeno (PO2 aumentó significativamente después TE los dos momentos y grupos (P OBJECTIVE: This study compares the effects of strength training (ST with or without supplementation of omega-3 lipids (W-3 or medium chain triglycerides (MCT in metabolic indicators in the exhaustion test (ET. METHODS: The subjects 12 males with minimum 11 months of ST of experience were divided in group W-3 (GW-3: n = 7, 26.7 ± 6.0 years old; 82.6 ± 10 kg and group MCT (GMCT: n = 5, 18.8 ± 1.3 years old; 74.6 ± 9.7 kg. There were 2 moments of ET: after 28 days only with ST and blood collection samples before (M1b and after (M1a, and after 28 more days of ST plus supplementation with 4 g/d of W-3 or 4 g/d of MCT repeating the same procedure (M2b and M2a. RESULTS: The hematocrite (Ht, osmolality (Os, sodium (Na+ and PCO2 showed no significant change at any moment, group or D M2 (P > 0.05. The PO2 increased significantly after ET in two moments and groups (P < 0.05. The glucose and HCO3 had significant increase in M1 to GW-3 and HCO3 in M2 to GMCT (P < 0.05, without other changes. The LDH increased significantly only in M2 to GW-3 (P < 0.05 and pH decreased in M1 to both groups (P < 0.05, without other significant changes. CONCLUSIONS: The ET per se altered the major metabolic indicators but a great standard deviation occurred. The tests induced acidosis without influencing fat acids supplementation.

  7. Validación de una metodología por cromatografía líquida de alta eficiencia para la determinación simultánea de vitaminas A, D3 y E en inyectables de uso veterinario Validação de metodologia por cromatografia líquida de alta eficiência para a determinação simultânea de vitaminas A, D3 e E em injetáveis de uso veterinário

    OpenAIRE

    Noralba Sierra; Jaime H. Rojas; Yvonne Cuadra; Andrea Sisa; Gloria Castro

    2007-01-01

    Se presentan en este artículo los resultados del desarrollo y de la validación de una metodología analítica para la cuantificación simultánea de vitamina A palmitato, vitamina D3 y vitamina E acetato en inyectables de uso pecuario. El procedimiento consiste en una separación por cromatografía líquida de alta eficiencia (CLAE) en fase inversa empleando como fase móvil una mezcla de acetonitrilo, metanol, agua (45:50:2.5), una columna C18 a 45 °C y detección a una longitud de onda de 280 nm...

  8. Spectroscopic characterization and temporal dynamics of energy transfer process between Tm{sup 3+} -Ho{sup 3+} and Yb{sup 3+} -Tm{sup 3+} ions in LiYF{sub 4} and LiLuF{sub 4} crystals; Caracterizacao espectroscopica e dinamica temporal dos processos de transferencia de energia entre os ions Tm{sup 3+} -Ho{sup 3+} e Yb{sup 3+} -Tm{sup 3+} em cristais de LiYF{sub 4} and LiLuF{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Tarelho, Luiz Vicente Gomes

    2001-07-01

    In this work, we perform spectroscopic studies to characterize the energy transfer processes occurring in rare-earth doped lithium fluoride systems, aiming the optimization of the population inversion of these media. Yb{sup 3+} ion was used in order to probe the electron-phonon coupling in LiYF{sub 4}, LiGdF{sub 4} and LiLuF{sub 4} matrices. In these systems it was obtained the average phononenergy, the vibronic transition probability and Huang-Rhys coupling constant. These parameters are dependent on the crystal host and the LiLuF{sub 4} system presents excluded correlation effects, an electronic repulsion that weakens the vibronic coupling. The Tm:Ho:LiYF{sub 4} system was studied under diode laser pumping at 796 nm, aiming the 2 {mu}m emission optimization. The ideal conditions of concentration and laser power were determined favouring the latter emission. Upconversion processes of two photons were identified besides the energy transfer among ions. The dynamic processes of luminescence of donors and acceptors allowed one to classify the energy transfer process as an energy transfer process assisted by fast diffusion among donors. The spectroscopic study of the Yb:Tm:LiYF{sub 4} allowed the determination of efficient non resonant transfer mechanisms between ({sup 2}F{sub 5/2}) Ytterbium level and ({sup 3}H{sub 5}) Thulium level, assisted by two phonon with hopping migration among donors ( Foerster-Burshtein model). The repopulation process of the Yb donor level is due to a cooperative sensitization between Yb-Tm pairs followed by an energy transfer process. (author)

  9. Development and characterization of nickel catalysts supported in CeO{sub 2}-ZrO{sub 2}-Al{sub 2}O{sub 3}, CeO{sub 2}-La{sub 2}O{sub 3}-Al{sub 2}O{sub 3} e ZrO{sub 2}-La{sub 2}O{sub 3}-Al{sub 2}O{sub 3} matrixes evaluated for methane reforming reactions; Desenvolvimento e caracterização de catalisadores de níquel suportados em matrizes CeO{sub 2}-ZrO{sub 2}-Al{sub 2}O{sub 3}, CeO{sub 2}-La{sub 2}O{sub 3}-Al{sub 2}O{sub 3} e ZrO{sub 2}-La{sub 2}O{sub 3}-Al{sub 2}O{sub 3} avaliados para as reações de reforma do metano

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, Amanda Jordão de

    2012-07-01

    Nowadays, the methane reforming is large interest industrial for the take advantage of these gas in production the hydrogen and synthesis gas (syngas). Among in the reactions of methane stand of the reactions steam reforming and carbon dioxide reforming of methane. The main catalysts uses in the methane reforming is Ni/Al{sub 2}O{sub 3}. However, the supported-nickel catalyst is susceptible to the deactivation or the destruction by coke deposition. The carbon dissolves in the nickel crystallite and its diffuses through the nickel, leading for formation of the carbon whiskers, which results in fragmentation of the catalyst. Modification of such catalysts, like incorporation of suitable promoters, is desirable to achieve reduction of the methane hydrogenolysis and/or promotion of the carbon gasification. Catalysts 5%Ni/Al{sub 2}O{sub 3} supported on solid solutions formed by ZrO{sub 2}-CeO{sub 2}, La{sub 2}O{sub 3} and CeO{sub 2}-ZrO{sub 2}-La{sub 2}O{sub 3} were prepared, characterized and evaluated in reactions steam and carbon dioxide reforming and partial oxidation of methane with objective the value effect loading solution solid in support. The supports were prepared by co-precipitation method and catalysts were prepared by impregnation method and calcined at 500 deg C. The supports and catalysts were characterized by Nitrogen Adsorption, method -rays diffraction (XRD), X-rays dispersive spectroscopy (XDS), spectroscopy in the region of the ultraviolet and the visible (UV-vis NIR) to and temperature programmed reduction (TPR), Raman Spectroscopy, X-ray absorption spectroscopy and Thermogravimetric Analysis. After all the catalytic reactions check which the addition of solid solution is beneficial for Ni/Al{sub 2}O{sub 3} catalysts and the best catalysts are Ni/CeO{sub 2}-La{sub 2}O{sub 3}-Al{sub 2}O{sub 3}. (author)

  10. Dicty_cDB: Contig-U06506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-08 3 ( DJ019170 ) Molecular Nephrotoxicology Modeling. 54 3e-08 3 ( DJ007525 ) Primary rat hepatocyte tox...icity modeling. 54 3e-08 3 ( DD269914 ) Molecular Hepatotoxicology Modeling. 54 3e-08 3 ( BD301471 ) Identif

  11. Gene : CBRC-PMAR-01-0780 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 3e-20 35% MNAELIARSEIQRCRGHPTPVTCRLLQNGEGFSVCLLQHHHLQQHICIRICSICIIICISSSICSSSFCSISSCIISSCISSCIISSCISSCI...ISSCISSCIISSCISSCIISSCICCISSCICCISSCICCISSCICCISSCICCISSCICCISSCICCISSCICCISSCICCISSCICCISSCICSCICCICSCI...CCISSCICCISSCICCISSCICCISSCICCDVKFEFGANRGFTRAQPIRARRNAPPFQRLGAAAATPIHCSGCWGGEGACFVVSFTRSS ...

  12. Gene : CBRC-GGOR-01-0712 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available o sapiens] 3e-46 36% MPCPHLGCCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHSIQPTPHPVHTPSSLRPIQTTLHPVHTPSRPHPIQSTPHPDHTPSSPHPIQSTLHTVHAPSRPHP...IQSTPHPDHTPSSPCPIQTTTPSSPHCIQTSVHLSSPHLTQTNLHPVHTPSSPYPIKITTPSSPHSILSTPHPVHTPSRPHPIQSTPHPVHTPSSPHPIQSTPLLVYTPSRPHP...IQSTLHPVHTPSRPHLTQTTPHPVHTPSSHTASSPHPIQSTPHPVHTPSSPHPIQSTPHPVHTPSRPHP...IQSTLHTVHAPSRPHPIQSTLHTVHAPSSPRPIHSTPHPDHTPSSHTASSPHPIQSTPHPDHTSPRPHPIQSTLHPDHTVSSPRPIQTIPHPDHTPCSSHSPKSTPHPVHVPSSSCPTQTTLHPIHAPPRPLLHPVHTPSSPLSTPTMFI ...

  13. Gene : CBRC-PMAR-01-0532 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 71 3e-05 23% MLLHWHCCYIGIVTALASLLHWALLLHGHCCYIGIAATLALLLHWHCCYIGIAAALTLLLHCCCIGIVTALALLLHWHCCCISIVATLA...LLLHWHCCYIGIAAALALLLHWHCCCIGIDAAMALLLHWHCCCIGIVATLALLLHWHCCYIGIAATLALLLHWHCCCIGIVATLALLLH ...

  14. Gene : CBRC-ACAR-01-0971 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available vectensis] 3e-11 32% MLFLLEISTCAPWRLYGYLPPVMLFLLEISTCAPWRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLEISTC...APVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLITVAPAFRLI ...

  15. The neurovascular relation in oxygen-induced retinopathy.

    Science.gov (United States)

    Akula, James D; Mocko, Julie A; Benador, Ilan Y; Hansen, Ronald M; Favazza, Tara L; Vyhovsky, Tanya C; Fulton, Anne B

    2008-01-01

    Longitudinal studies in rat models of retinopathy of prematurity (ROP) have demonstrated that abnormalities of retinal vasculature and function change hand-in-hand. In the developing retina, vascular and neural structures are under cooperative molecular control. In this study of rats with oxygen-induced retinopathy (OIR) models of ROP, mRNA expression of vascular endothelial growth factor (VEGF), semaphorin (Sema), and their neuropilin receptor (NRP) were examined during the course of retinopathy to evaluate their roles in the observed neurovascular congruency. Oxygen exposures designed to induce retinopathy were delivered to Sprague-Dawley rat pups (n=36) from postnatal day (P) 0 to P14 or from P7 to P14. Room-air-reared controls (n=18) were also studied. Sensitivities of the rod photoreceptors (S(rod)) and the postreceptor cells (Sm) were derived from electroretinographic (ERG) records. Arteriolar tortuosity, T(A), was derived from digital fundus images using Retinal Image multi-Scale Analysis (RISA) image analysis software. mRNA expression of VEGF(164), semaphorin IIIA (Sema3A), and neuropilin-1 (NRP-1) was evaluated by RT-PCR of retinal extracts. Tests were performed at P15-P16, P18-P19, and P25-P26. Relations among ERG, RISA, and PCR parameters were evaluated using linear regression on log transformed data. Sm was low and T(A) was high at young ages, then both resolved by P25-P26. VEGF(164) and Sema3A mRNA expression were also elevated early and decreased with age. Low Sm was significantly associated with high VEGF(164) and Sema3A expression. Low S(rod) was also significantly associated with high VEGF(164). S(rod) and Sm were both correlated with T(A). NRP-1 expression was little affected by OIR. The postreceptor retina appears to mediate the vascular abnormalities that characterize OIR. Because of the relationships revealed by these data, early treatment that targets the neural retina may mitigate the effects of ROP.

  16. The Genome of a Tortoise Herpesvirus (Testudinid Herpesvirus 3) Has a Novel Structure and Contains a Large Region That Is Not Required for Replication In Vitro or Virulence In Vivo

    Science.gov (United States)

    Gandar, Frédéric; Wilkie, Gavin S.; Gatherer, Derek; Kerr, Karen; Marlier, Didier; Diez, Marianne; Marschang, Rachel E.; Mast, Jan; Dewals, Benjamin G.

    2015-01-01

    ABSTRACT Testudinid herpesvirus 3 (TeHV-3) is the causative agent of a lethal disease affecting several tortoise species. The threat that this virus poses to endangered animals is focusing efforts on characterizing its properties, in order to enable the development of prophylactic methods. We have sequenced the genomes of the two most studied TeHV-3 strains (1976 and 4295). TeHV-3 strain 1976 has a novel genome structure and is most closely related to a turtle herpesvirus, thus supporting its classification into genus Scutavirus, subfamily Alphaherpesvirinae, family Herpesviridae. The sequence of strain 1976 also revealed viral counterparts of cellular interleukin-10 and semaphorin, which have not been described previously in members of subfamily Alphaherpesvirinae. TeHV-3 strain 4295 is a mixture of three forms (m1, m2, and M), in which, in comparison to strain 1976, the genomes exhibit large, partially overlapping deletions of 12.5 to 22.4 kb. Viral subclones representing these forms were isolated by limiting dilution assays, and each replicated in cell culture comparably to strain 1976. With the goal of testing the potential of the three forms as attenuated vaccine candidates, strain 4295 was inoculated intranasally into Hermann's tortoises (Testudo hermanni). All inoculated subjects died, and PCR analyses demonstrated the ability of the m2 and M forms to spread and invade the brain. In contrast, the m1 form was detected in none of the organs tested, suggesting its potential as the basis of an attenuated vaccine candidate. Our findings represent a major step toward characterizing TeHV-3 and developing prophylactic methods against it. IMPORTANCE Testudinid herpesvirus 3 (TeHV-3) causes a lethal disease in tortoises, several species of which are endangered. We have characterized the viral genome and used this information to take steps toward developing an attenuated vaccine. We have sequenced the genomes of two strains (1976 and 4295), compared their growth in

  17. Dicty_cDB: Contig-U07450-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ration Library Syntrich... 208 3e-52 2 ( CN205665 ) Tor6072 Gametophyte rehydration... Library Syntrichi... 208 3e-52 2 ( CN202424 ) Tor2583 Gametophyte rehydration Li...brary Syntrichi... 208 3e-52 2 ( CN207120 ) Tor7541 Gametophyte rehydration Library Syntrichi... 208 3e-52 2...... 224 1e-54 1 ( BJ958614 ) Physcomitrella patens subsp. patens cDNA clone:pp... 216 3e-52 1 ( CN200625 ) Tor10291 Gametophyte rehyd

  18. A systematic expression analysis implicates Plexin-B2 and its ligand Sema4C in the regulation of the vascular and endocrine system.

    Science.gov (United States)

    Zielonka, Matthias; Xia, Jingjing; Friedel, Roland H; Offermanns, Stefan; Worzfeld, Thomas

    2010-09-10

    Plexins serve as receptors for semaphorins and play important roles in the developing nervous system. Plexin-B2 controls decisive developmental programs in the neural tube and cerebellum. However, whether Plexin-B2 also regulates biological functions in adult nonneuronal tissues is unknown. Here we show by two methodologically independent approaches that Plexin-B2 is expressed in discrete cell types of several nonneuronal tissues in the adult mouse. In the vasculature, Plexin-B2 is selectively expressed in functionally specialized endothelial cells. In endocrine organs, Plexin-B2 localizes to the pancreatic islets of Langerhans and to both cortex and medulla of the adrenal gland. Plexin-B2 expression is also detected in certain types of immune and epithelial cells. In addition, we report on a systematic comparison of the expression patterns of Plexin-B2 and its ligand Sema4C, which show complementarity or overlap in some but not all tissues. Furthermore, we demonstrate that Plexin-B2 and its family member Plexin-B1 display largely nonredundant expression patterns. This work establishes Plexin-B2 and Sema4C as potential regulators of the vascular and endocrine system and provides an anatomical basis to understand the biological functions of this ligand-receptor pair. Copyright 2010 Elsevier Inc. All rights reserved.

  19. MICAL, the Flavoenzyme Participating in Cytoskeleton Dynamics

    Directory of Open Access Journals (Sweden)

    Daniela Zucchini

    2013-03-01

    Full Text Available MICAL (from the Molecule Interacting with CasL indicates a family of recently discovered cytosolic, multidomain proteins, which uniquely couple an N-terminal FAD-containing monooxygenase-like domain to typical calponine homology, LIM and coiled-coil protein-interaction modules. Genetic and cell biology approaches have demonstrated an essential role of the catalytic activity of the monooxygenase-like domain in transducing the signal initiated by semaphorins interaction with their plexin receptors, which results in local actin cytoskeleton disassembly as part of fundamental processes that include differentiation, migration and cell-cell contacts in neuronal and non-neuronal cell types. This review focuses on the structure-function relations of the MICAL monooxygenase-like domain as they are emerging from the available in vitro studies on mouse, human and Drosophila MICAL forms that demonstrated a NADPH-dependent actin depolymerizing activity of MICAL. With Drosophila MICAL forms, actin depolymerization was demonstrated to be associated to conversion of Met44 to methionine sulfone through a postulated hydroxylating reaction. Arguments supporting the concept that MICAL effect on F-actin may be reversible will be discussed.

  20. LDL receptor-related protein 1 regulates the abundance of diverse cell-signaling proteins in the plasma membrane proteome.

    Science.gov (United States)

    Gaultier, Alban; Simon, Gabriel; Niessen, Sherry; Dix, Melissa; Takimoto, Shinako; Cravatt, Benjamin F; Gonias, Steven L

    2010-12-03

    LDL receptor-related protein 1 (LRP1) is an endocytic receptor, reported to regulate the abundance of other receptors in the plasma membrane, including uPAR and tissue factor. The goal of this study was to identify novel plasma membrane proteins, involved in cell-signaling, that are regulated by LRP1. Membrane protein ectodomains were prepared from RAW 264.7 cells in which LRP1 was silenced and control cells using protease K. Peptides were identified by LC-MS/MS. By analysis of spectral counts, 31 transmembrane and secreted proteins were regulated in abundance at least 2-fold when LRP1 was silenced. Validation studies confirmed that semaphorin4D (Sema4D), plexin domain-containing protein-1 (Plxdc1), and neuropilin-1 were more abundant in the membranes of LRP1 gene-silenced cells. Regulation of Plxdc1 by LRP1 was confirmed in CHO cells, as a second model system. Plxdc1 coimmunoprecipitated with LRP1 from extracts of RAW 264.7 cells and mouse liver. Although Sema4D did not coimmunoprecipitate with LRP1, the cell-surface level of Sema4D was increased by RAP, which binds to LRP1 and inhibits binding of other ligands. These studies identify Plxdc1, Sema4D, and neuropilin-1 as novel LRP1-regulated cell-signaling proteins. Overall, LRP1 emerges as a generalized regulator of the plasma membrane proteome.

  1. Pharmacokinetics, Biodistribution, and Toxicity Evaluation of Anti-SEMA3A (F11) in In Vivo Models.

    Science.gov (United States)

    Lee, Jaehyun; Kim, Donggeon; Son, Eunju; Yoo, Su-Ji; Sa, Jason K; Shin, Yong Jae; Yoon, Yeup; Nam, DO-Hyun

    2018-05-01

    The aim of our study was to investigate the pharmacokinetics (PK), tissue distribution and toxicity of F11 antibody to semaphorin 3A in mouse models and explore its anti-angiogenic and tumor-inhibitory effect. Patient-derived xenograft (PDX) models were established via subcutaneous implantation of glioblastoma multiforme (GBM) cells and treated with F11. F11 significantly attenuated tumor growth and angiogenesis in the GBM PDX model. Within the range of administered doses, the PK of F11 in serum demonstrated a linear fashion, consistent with general PK profiles of soluble antigen-targeting antibodies. Additionally, the clearance level was detected at between 4.63 and 7.12 ml/d/kg, while the biological half-life was measured at 6.9 and 9.4 days. Tissue distribution of F11 in kidney, liver and heart was consistent with previously reported antibody patterns. However, the presence of F11 in the brain was an interesting finding. Collectively, our results revealed angiogenic and tumor-inhibitory effect of F11 antibody and its potential therapeutic use within a clinical framework based on PK, biodistribution and toxicity evaluation in mouse models. Copyright© 2018, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  2. The transcription factor SOX18 regulates the expression of matrix metalloproteinase 7 and guidance molecules in human endothelial cells.

    Directory of Open Access Journals (Sweden)

    Martina Hoeth

    Full Text Available Mutations in the transcription factor SOX18 are responsible for specific cardiovascular defects in humans and mice. In order to gain insight into the molecular basis of its action, we identified target genes of SOX18 and analyzed one, MMP7, in detail.SOX18 was expressed in HUVEC using a recombinant adenoviral vector and the altered gene expression profile was analyzed using microarrays. Expression of several regulated candidate SOX18 target genes was verified by real-time PCR. Knock-down of SOX18 using RNA interference was then used to confirm the effect of the transcription factor on selected genes that included the guidance molecules ephrin B2 and semaphorin 3G. One gene, MMP7, was chosen for further analysis, including detailed promoter studies using reporter gene assays, electrophoretic mobility shift analysis and chromatin-immunoprecipitation, revealing that it responds directly to SOX18. Immunohistochemical analysis demonstrated the co-expression of SOX18 and MMP7 in blood vessels of human skin.The identification of MMP7 as a direct SOX18 target gene as well as other potential candidates including guidance molecules provides a molecular basis for the proposed function of this transcription factor in the regulation of vessel formation.

  3. Nrp2 is sufficient to instruct circuit formation of mitral-cells to mediate odour-induced attractive social responses.

    Science.gov (United States)

    Inokuchi, Kasumi; Imamura, Fumiaki; Takeuchi, Haruki; Kim, Ryang; Okuno, Hiroyuki; Nishizumi, Hirofumi; Bito, Haruhiko; Kikusui, Takefumi; Sakano, Hitoshi

    2017-07-21

    Odour information induces various innate responses that are critical to the survival of the individual and for the species. An axon guidance molecule, Neuropilin 2 (Nrp2), is known to mediate targeting of olfactory sensory neurons (primary neurons), to the posteroventral main olfactory bulb (PV MOB) in mice. Here we report that Nrp2-positive (Nrp2 + ) mitral cells (MCs, second-order neurons) play crucial roles in transmitting attractive social signals from the PV MOB to the anterior part of medial amygdala (MeA). Semaphorin 3F, a repulsive ligand to Nrp2, regulates both migration of Nrp2 + MCs to the PV MOB and their axonal projection to the anterior MeA. In the MC-specific Nrp2 knockout mice, circuit formation of Nrp2 + MCs and odour-induced attractive social responses are impaired. In utero, electroporation demonstrates that activation of the Nrp2 gene in MCs is sufficient to instruct their circuit formation from the PV MOB to the anterior MeA.

  4. Retrograde Signaling from Progranulin to Sort1 Counteracts Synapse Elimination in the Developing Cerebellum.

    Science.gov (United States)

    Uesaka, Naofumi; Abe, Manabu; Konno, Kohtarou; Yamazaki, Maya; Sakoori, Kazuto; Watanabe, Takaki; Kao, Tzu-Huei; Mikuni, Takayasu; Watanabe, Masahiko; Sakimura, Kenji; Kano, Masanobu

    2018-02-21

    Elimination of redundant synapses formed early in development and strengthening of necessary connections are crucial for shaping functional neural circuits. Purkinje cells (PCs) in the neonatal cerebellum are innervated by multiple climbing fibers (CFs) with similar strengths. A single CF is strengthened whereas the other CFs are eliminated in each PC during postnatal development. The underlying mechanisms, particularly for the strengthening of single CFs, are poorly understood. Here we report that progranulin, a multi-functional growth factor implicated in the pathogenesis of frontotemporal dementia, strengthens developing CF synaptic inputs and counteracts their elimination from postnatal day 11 to 16. Progranulin derived from PCs acts retrogradely onto its putative receptor Sort1 on CFs. This effect is independent of semaphorin 3A, another retrograde signaling molecule that counteracts CF synapse elimination. We propose that progranulin-Sort1 signaling strengthens and maintains developing CF inputs, and may contribute to selection of single "winner" CFs that survive synapse elimination. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Multifaceted Role of Neuropilins in the Immune System: Potential Targets for Immunotherapy.

    Science.gov (United States)

    Roy, Sohini; Bag, Arup K; Singh, Rakesh K; Talmadge, James E; Batra, Surinder K; Datta, Kaustubh

    2017-01-01

    Neuropilins (NRPs) are non-tyrosine kinase cell surface glycoproteins expressed in all vertebrates and widely conserved across species. The two isoforms, such as neuropilin-1 (NRP1) and neuropilin-2 (NRP2), mainly act as coreceptors for class III Semaphorins and for members of the vascular endothelial growth factor family of molecules and are widely known for their role in a wide array of physiological processes, such as cardiovascular, neuronal development and patterning, angiogenesis, lymphangiogenesis, as well as various clinical disorders. Intriguingly, additional roles for NRPs occur with myeloid and lymphoid cells, in normal physiological as well as different pathological conditions, including cancer, immunological disorders, and bone diseases. However, little is known concerning the molecular pathways that govern these functions. In addition, NRP1 expression has been characterized in different immune cellular phenotypes including macrophages, dendritic cells, and T cell subsets, especially regulatory T cell populations. By contrast, the functions of NRP2 in immune cells are less well known. In this review, we briefly summarize the genomic organization, structure, and binding partners of the NRPs and extensively discuss the recent advances in their role and function in different immune cell subsets and their clinical implications.

  6. SEMA6D Expression and Patient Survival in Breast Invasive Carcinoma

    Directory of Open Access Journals (Sweden)

    Dongquan Chen

    2015-01-01

    Full Text Available Breast cancer (BC is the second most common cancer diagnosed in American women and is also the second leading cause of cancer death in women. Research has focused heavily on BC metastasis. Multiple signaling pathways have been implicated in regulating BC metastasis. Our knowledge of regulation of BC metastasis is, however, far from complete. Identification of new factors during metastasis is an essential step towards future therapy. Our labs have focused on Semaphorin 6D (SEMA6D, which was implicated in immune responses, heart development, and neurogenesis. It will be interesting to know SEMA6D-related genomic expression profile and its implications in clinical outcome. In this study, we examined the public datasets of breast invasive carcinoma from The Cancer Genome Atlas (TCGA. We analyzed the expression of SEMA6D along with its related genes, their functions, pathways, and potential as copredictors for BC patients’ survival. We found 6-gene expression profile that can be used as such predictors. Our study provides evidences for the first time that breast invasive carcinoma may contain a subtype based on SEMA6D expression. The expression of SEMA6D gene may play an important role in promoting patient survival, especially among triple negative breast cancer patients.

  7. Mechanism of selective VEGF-A binding by neuropilin-1 reveals a basis for specific ligand inhibition.

    Directory of Open Access Journals (Sweden)

    Matthew W Parker

    Full Text Available Neuropilin (Nrp receptors function as essential cell surface receptors for the Vascular Endothelial Growth Factor (VEGF family of proangiogenic cytokines and the semaphorin 3 (Sema3 family of axon guidance molecules. There are two Nrp homologues, Nrp1 and Nrp2, which bind to both overlapping and distinct members of the VEGF and Sema3 family of molecules. Nrp1 specifically binds the VEGF-A(164/5 isoform, which is essential for developmental angiogenesis. We demonstrate that VEGF-A specific binding is governed by Nrp1 residues in the b1 coagulation factor domain surrounding the invariant Nrp C-terminal arginine binding pocket. Further, we show that Sema3F does not display the Nrp-specific binding to the b1 domain seen with VEGF-A. Engineered soluble Nrp receptor fragments that selectively sequester ligands from the active signaling complex are an attractive modality for selectively blocking the angiogenic and chemorepulsive functions of Nrp ligands. Utilizing the information on Nrp ligand binding specificity, we demonstrate Nrp constructs that specifically sequester Sema3 in the presence of VEGF-A. This establishes that unique mechanisms are used by Nrp receptors to mediate specific ligand binding and that these differences can be exploited to engineer soluble Nrp receptors with specificity for Sema3.

  8. Unique topics and issues in rheumatology and clinical immunology.

    Science.gov (United States)

    Selmi, Carlo

    2014-08-01

    Clinicians are facing unexpected issues in everyday practice, and these may become counterintuitive or challenging. Illustrative examples are provided by the hypersensitivity to universally used immunosuppressants such as corticosteroids or antibiotics such as beta-lactam. Secondly, additional issues are represented by the discovery of new pathogenetic mechanisms involved in rheumatoid and psoriatic arthritis or other chronic inflammatory diseases, genomic susceptibility to enigmatic diseases such as giant cell arteritis, or the shared role of specific mediators such as semaphorins. Third, the therapeutic armamentarium has dramatically changed over the past decade following the introduction of biotechnological drugs, and new mechanisms are being proposed to reduce adverse events or increase the drug effectiveness, particularly on cardiovascular comorbidities. Finally, rare diseases continue to represent difficult cases, as for Cogan's syndrome, with limited literature available for clinical recommendations. For these reason, the present issue of Clinical Reviews in Allergy and Immunology is timely and dedicated to these and other unique topics in clinical immunology and allergy. The aim of this issue is thus to help clinicians involved in internal medicine as well as allergists and clinical immunologists while discussing new pathways that will prove important in the near future.

  9. The SEMA5A gene is associated with hippocampal volume, and their interaction is associated with performance on Raven's Progressive Matrices.

    Science.gov (United States)

    Zhu, Bi; Chen, Chuansheng; Xue, Gui; Moyzis, Robert K; Dong, Qi; Chen, Chunhui; Li, Jin; He, Qinghua; Lei, Xuemei; Wang, Yunxin; Lin, Chongde

    2014-03-01

    The Allen Brain Atlas shows that the semaphorin 5A (SEMA5A) gene, which encodes an important protein for neurogenesis and neuronal apoptosis, is predominantly expressed in the human hippocampus. Structural and functional neuroimaging studies have further shown that the hippocampus plays an important role in the performance on Raven's Progressive Matrices (RPM), a measure of reasoning ability and general fluid intelligence. Thus far, however, no study has examined the relationships between the SEMA5A gene polymorphism, hippocampal volume, and RPM performance. The current study collected both structural MRI, genetic, and behavioral data in 329 healthy Chinese adults, and examined associations between SEMA5A variants, hippocampal volume, and performance on RAPM (the advanced form of RPM). After controlling for intracranial volume (ICV), sex, and age, SEMA5A genetic polymorphism at the SNP rs42352 had the strongest association with hippocampal volume (p=0.00000552 and 0.000103 for right and left hippocampal volumes, respectively), with TT homozygotes having higher hippocampal volume than the other genotypes. Furthermore, there was a high correlation between right hippocampal volume and RAPM performance (r=0.42, p=0.0000509) for SEMA5A rs42352 TT homozygotes. This study provides the first evidence for the involvement of the SEMA5A gene in hippocampal structure and their interaction on RAPM performance. Future studies of the hippocampus-RPM associations should consider genetic factors as potential moderators. Copyright © 2013 Elsevier Inc. All rights reserved.

  10. DRG axon elongation and growth cone collapse rate induced by Sema3A are differently dependent on NGF concentration.

    Science.gov (United States)

    Kaselis, Andrius; Treinys, Rimantas; Vosyliūtė, Rūta; Šatkauskas, Saulius

    2014-03-01

    Regeneration of embryonic and adult dorsal root ganglion (DRG) sensory axons is highly impeded when they encounter neuronal growth cone-collapsing factor semaphorin3A (Sema3A). On the other hand, increasing evidence shows that DRG axon's regeneration can be stimulated by nerve growth factor (NGF). In this study, we aimed to evaluate whether increased NGF concentrations can counterweight Sema3A-induced inhibitory responses in 15-day-old mouse embryo (E15) DRG axons. The DRG explants were grown in Neurobasal-based medium with different NGF concentrations ranging from 0 to 100 ng/mL and then treated with Sema3A at constant 10 ng/mL concentration. To evaluate interplay between NGF and Sema3A number of DRG axons, axon outgrowth distance and collapse rate were measured. We found that the increased NGF concentrations abolish Sema3A-induced inhibitory effect on axon outgrowth, while they have no effect on Sema3A-induced collapse rate.

  11. Muscle-type Identity of Proprioceptors Specified by Spatially Restricted Signals from Limb Mesenchyme.

    Science.gov (United States)

    Poliak, Sebastian; Norovich, Amy L; Yamagata, Masahito; Sanes, Joshua R; Jessell, Thomas M

    2016-01-28

    The selectivity with which proprioceptive sensory neurons innervate their central and peripheral targets implies that they exhibit distinctions in muscle-type identity. The molecular correlates of proprioceptor identity and its origins remain largely unknown, however. In screens to define muscle-type proprioceptor character, we find all-or-none differences in gene expression for proprioceptors that control antagonistic muscles at a single hindlimb joint. Analysis of three of these genes, cadherin13 (cdh13), semaphorin5a (sema5a), and cartilage-acidic protein-1 (crtac1), reveals expression in proprioceptor subsets that supply muscle groups located at restricted dorsoventral and proximodistal domains of the limb. Genetically altering the dorsoventral character of the limb mesenchyme elicits a change in the profile of proprioceptor cdh13, sema5a, and crtac1 expression. These findings indicate that proprioceptors acquire aspects of their muscle-type identity in response to mesenchymal signals expressed in restricted proximodistal and dorsoventral domains of the developing limb. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Muscle-type identity of proprioceptors specified by spatially-restricted signals from limb mesenchyme

    Science.gov (United States)

    Poliak, Sebastian; Norovich, Amy L.; Yamagata, Masahito; Sanes, Joshua R.; Jessell, Thomas M.

    2016-01-01

    The selectivity with which proprioceptive sensory neurons innervate their central and peripheral targets implies that they exhibit distinctions in muscle-type identity. The molecular correlates of proprioceptor identity and its origins remain largely unknown, however. In screens to define muscle-type proprioceptor character we find all-or-none differences in gene expression for proprioceptors that control antagonistic muscles at a single hindlimb joint. Analysis of three of these genes, cadherin13 (cdh13), semaphorin5a (sema5a) and cartilage-acidic protein-1 (crtac1), reveals expression in proprioceptor subsets that supply muscle-groups located at restricted dorso-ventral and proximo-distal domains of the limb. Genetically altering the dorso-ventral character of the limb mesenchyme elicits a change in the profile of proprioceptor cdh13, sema5a and crtac1 expression. These findings indicate that proprioceptors acquire aspects of their muscle-type identity in response to mesenchymal signals expressed in restricted proximo-distal and dorso-ventral domains of the developing limb. PMID:26824659

  13. Axon guidance pathways served as common targets for human speech/language evolution and related disorders.

    Science.gov (United States)

    Lei, Huimeng; Yan, Zhangming; Sun, Xiaohong; Zhang, Yue; Wang, Jianhong; Ma, Caihong; Xu, Qunyuan; Wang, Rui; Jarvis, Erich D; Sun, Zhirong

    2017-11-01

    Human and several nonhuman species share the rare ability of modifying acoustic and/or syntactic features of sounds produced, i.e. vocal learning, which is the important neurobiological and behavioral substrate of human speech/language. This convergent trait was suggested to be associated with significant genomic convergence and best manifested at the ROBO-SLIT axon guidance pathway. Here we verified the significance of such genomic convergence and assessed its functional relevance to human speech/language using human genetic variation data. In normal human populations, we found the affected amino acid sites were well fixed and accompanied with significantly more associated protein-coding SNPs in the same genes than the rest genes. Diseased individuals with speech/language disorders have significant more low frequency protein coding SNPs but they preferentially occurred outside the affected genes. Such patients' SNPs were enriched in several functional categories including two axon guidance pathways (mediated by netrin and semaphorin) that interact with ROBO-SLITs. Four of the six patients have homozygous missense SNPs on PRAME gene family, one youngest gene family in human lineage, which possibly acts upon retinoic acid receptor signaling, similarly as FOXP2, to modulate axon guidance. Taken together, we suggest the axon guidance pathways (e.g. ROBO-SLIT, PRAME gene family) served as common targets for human speech/language evolution and related disorders. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Paracrine control of vascularization and neurogenesis by neurotrophins.

    Science.gov (United States)

    Emanueli, Costanza; Schratzberger, Peter; Kirchmair, Rudolf; Madeddu, Paolo

    2003-10-01

    The neuronal system plays a fundamental role in the maturation of primitive embryonic vascular network by providing a paracrine template for blood vessel branching and arterial differentiation. Furthermore, postnatal vascular and neural regeneration cooperate in the healing of damaged tissue. Neurogenesis continues in adulthood although confined to specific brain regions. Following ischaemic insult, neural staminal cells contribute towards the healing process through the stimulation of neurogenesis and vasculogenesis. Evidence indicates that nerves and blood vessels exert a reciprocal control of their own growth by paracrine mechanisms. For instance, guidance factors, including vascular endothelial growth factor A (VEGF-A) and semaphorins, which share the ability of binding neuropilin receptors, play a pivotal role in the tridimensional growth pattern of arterial vessels and nerves. Animal models and clinical studies have demonstrated a role of VEGF-A in the pathogenesis of ischaemic and diabetic neuropathies. Further, supplementation with VEGF-A ameliorates neuronal recovery by exerting protective effects on nerves and stimulating reparative neovascularization. Human tissue kallikrein, a recently discovered angiogenic and arteriogenic factor, accelerates neuronal recovery by stimulating the growth of vasa nervorum. Conversely, the neurotrophin nerve growth factor, known to regulate neuronal survival and differentiation, is now regarded as a stimulator of angiogenesis and arteriogenesis. These results indicate that angiogenesis and neurogenesis are paracrinally regulated by growth factors released by endothelial cells and neurons. Supplementation of these growth factors, alone or in combination, could benefit the treatment of ischaemic diseases and neuropathies.

  15. Whole transcriptome profiling of taste bud cells.

    Science.gov (United States)

    Sukumaran, Sunil K; Lewandowski, Brian C; Qin, Yumei; Kotha, Ramana; Bachmanov, Alexander A; Margolskee, Robert F

    2017-08-08

    Analysis of single-cell RNA-Seq data can provide insights into the specific functions of individual cell types that compose complex tissues. Here, we examined gene expression in two distinct subpopulations of mouse taste cells: Tas1r3-expressing type II cells and physiologically identified type III cells. Our RNA-Seq libraries met high quality control standards and accurately captured differential expression of marker genes for type II (e.g. the Tas1r genes, Plcb2, Trpm5) and type III (e.g. Pkd2l1, Ncam, Snap25) taste cells. Bioinformatics analysis showed that genes regulating responses to stimuli were up-regulated in type II cells, while pathways related to neuronal function were up-regulated in type III cells. We also identified highly expressed genes and pathways associated with chemotaxis and axon guidance, providing new insights into the mechanisms underlying integration of new taste cells into the taste bud. We validated our results by immunohistochemically confirming expression of selected genes encoding synaptic (Cplx2 and Pclo) and semaphorin signalling pathway (Crmp2, PlexinB1, Fes and Sema4a) components. The approach described here could provide a comprehensive map of gene expression for all taste cell subpopulations and will be particularly relevant for cell types in taste buds and other tissues that can be identified only by physiological methods.

  16. Guidance of vascular development: lessons from the nervous system.

    Science.gov (United States)

    Larrivée, Bruno; Freitas, Catarina; Suchting, Steven; Brunet, Isabelle; Eichmann, Anne

    2009-02-27

    The vascular system of vertebrates consists of an organized, branched network of arteries, veins, and capillaries that penetrates all the tissues of the body. One of the most striking features of the vascular system is that its branching pattern is highly stereotyped, with major and secondary branches forming at specific sites and developing highly conserved organ-specific vascular patterns. The factors controlling vascular patterning are not yet completely understood. Recent studies have highlighted the anatomic and structural similarities between blood vessels and nerves. The 2 networks are often aligned, with nerve fibers and blood vessels following parallel routes. Furthermore, both systems require precise control over their guidance and growth. Several molecules with attractive and repulsive properties have been found to modulate the proper guidance of both nerves and blood vessels. These include the Semaphorins, the Slits, and the Netrins and their receptors. In this review, we describe the molecular mechanisms by which blood vessels and axons achieve proper path finding and the molecular cues that are involved in their guidance.

  17. Axon guidance molecules in vascular patterning.

    Science.gov (United States)

    Adams, Ralf H; Eichmann, Anne

    2010-05-01

    Endothelial cells (ECs) form extensive, highly branched and hierarchically organized tubular networks in vertebrates to ensure the proper distribution of molecular and cellular cargo in the vertebrate body. The growth of this vascular system during development, tissue repair or in disease conditions involves the sprouting, migration and proliferation of endothelial cells in a process termed angiogenesis. Surprisingly, specialized ECs, so-called tip cells, which lead and guide endothelial sprouts, share many feature with another guidance structure, the axonal growth cone. Tip cells are motile, invasive and extend numerous filopodial protrusions sensing growth factors, extracellular matrix and other attractive or repulsive cues in their tissue environment. Axonal growth cones and endothelial tip cells also respond to signals belonging to the same molecular families, such as Slits and Roundabouts, Netrins and UNC5 receptors, Semaphorins, Plexins and Neuropilins, and Eph receptors and ephrin ligands. Here we summarize fundamental principles of angiogenic growth, the selection and function of tip cells and the underlying regulation by guidance cues, the Notch pathway and vascular endothelial growth factor signaling.

  18. EphA4 blockers promote axonal regeneration and functional recovery following spinal cord injury in mice.

    Directory of Open Access Journals (Sweden)

    Yona Goldshmit

    Full Text Available Upregulation and activation of developmental axon guidance molecules, such as semaphorins and members of the Eph receptor tyrosine kinase family and their ligands, the ephrins, play a role in the inhibition of axonal regeneration following injury to the central nervous system. Previously we have demonstrated in a knockout model that axonal regeneration following spinal cord injury is promoted in the absence of the axon guidance protein EphA4. Antagonism of EphA4 was therefore proposed as a potential therapy to promote recovery from spinal cord injury. To further assess this potential, two soluble recombinant blockers of EphA4, unclustered ephrin-A5-Fc and EphA4-Fc, were examined for their ability to promote axonal regeneration and to improve functional outcome following spinal cord hemisection in wildtype mice. A 2-week administration of either of these blockers following spinal cord injury was sufficient to promote substantial axonal regeneration and functional recovery by 5 weeks following injury. Both inhibitors produced a moderate reduction in astrocytic gliosis, indicating that much of the effect of the blockers may be due to promotion of axon growth. These studies provide definitive evidence that soluble inhibitors of EphA4 function offer considerable therapeutic potential for the treatment of spinal cord injury and may have broader potential for the treatment of other central nervous system injuries.

  19. Modulators of axonal growth and guidance at the brain midline with special reference to glial heparan sulfate proteoglycans

    Directory of Open Access Journals (Sweden)

    CAVALCANTE LENY A.

    2002-01-01

    Full Text Available Bilaterally symmetric organisms need to exchange information between the left and right sides of their bodies to integrate sensory input and to coordinate motor control. Thus, an important choice point for developing axons is the Central Nervous System (CNS midline. Crossing of this choice point is influenced by highly conserved, soluble or membrane-bound molecules such as the L1 subfamily, laminin, netrins, slits, semaphorins, Eph-receptors and ephrins, etc. Furthermore, there is much circumstantial evidence for a role of proteoglycans (PGs or their glycosaminoglycan (GAG moieties on axonal growth and guidance, most of which was derived from simplified models. A model of intermediate complexity is that of cocultures of young neurons and astroglial carpets (confluent cultures obtained from medial and lateral sectors of the embryonic rodent midbrain soon after formation of its commissures. Neurite production in these cocultures reveals that, irrespective of the previous location of neurons in the midbrain, medial astrocytes exerted an inhibitory or non-permissive effect on neuritic growth that was correlated to a higher content of both heparan and chondroitin sulfates (HS and CS. Treatment with GAG lyases shows minor effects of CS and discloses a major inhibitory or non-permissive role for HS. The results are discussed in terms of available knowledge on the binding of HSPGs to interative proteins and underscore the importance of understanding glial polysaccharide arrays in addition to its protein complement for a better understanding of neuron-glial interactions.

  20. The human cumulus--oocyte complex gene-expression profile

    Science.gov (United States)

    Assou, Said; Anahory, Tal; Pantesco, Véronique; Le Carrour, Tanguy; Pellestor, Franck; Klein, Bernard; Reyftmann, Lionel; Dechaud, Hervé; De Vos, John; Hamamah, Samir

    2006-01-01

    BACKGROUND The understanding of the mechanisms regulating human oocyte maturation is still rudimentary. We have identified transcripts differentially expressed between immature and mature oocytes, and cumulus cells. METHODS Using oligonucleotides microarrays, genome wide gene expression was studied in pooled immature and mature oocytes or cumulus cells from patients who underwent IVF. RESULTS In addition to known genes such as DAZL, BMP15 or GDF9, oocytes upregulated 1514 genes. We show that PTTG3 and AURKC are respectively the securin and the Aurora kinase preferentially expressed during oocyte meiosis. Strikingly, oocytes overexpressed previously unreported growth factors such as TNFSF13/APRIL, FGF9, FGF14, and IL4, and transcription factors including OTX2, SOX15 and SOX30. Conversely, cumulus cells, in addition to known genes such as LHCGR or BMPR2, overexpressed cell-tocell signaling genes including TNFSF11/RANKL, numerous complement components, semaphorins (SEMA3A, SEMA6A, SEMA6D) and CD genes such as CD200. We also identified 52 genes progressively increasing during oocyte maturation, comprising CDC25A and SOCS7. CONCLUSION The identification of genes up and down regulated during oocyte maturation greatly improves our understanding of oocyte biology and will provide new markers that signal viable and competent oocytes. Furthermore, genes found expressed in cumulus cells are potential markers of granulosa cell tumors. PMID:16571642

  1. Negative Effects of High Glucose Exposure in Human Gonadotropin-Releasing Hormone Neurons

    Directory of Open Access Journals (Sweden)

    Annamaria Morelli

    2013-01-01

    Full Text Available Metabolic disorders are often associated with male hypogonadotropic hypogonadism, suggesting that hypothalamic defects involving GnRH neurons may impair the reproductive function. Among metabolic factors hyperglycemia has been implicated in the control of the reproductive axis at central level, both in humans and in animal models. To date, little is known about the direct effects of pathological high glucose concentrations on human GnRH neurons. In this study, we investigated the high glucose effects in the human GnRH-secreting FNC-B4 cells. Gene expression profiling by qRT-PCR, confirmed that FNC-B4 cells express GnRH and several genes relevant for GnRH neuron function (KISS1R, KISS1, sex steroid and leptin receptors, FGFR1, neuropilin 2, and semaphorins, along with glucose transporters (GLUT1, GLUT3, and GLUT4. High glucose exposure (22 mM; 40 mM significantly reduced gene and protein expression of GnRH, KISS1R, KISS1, and leptin receptor, as compared to normal glucose (5 mM. Consistent with previous studies, leptin treatment significantly induced GnRH mRNA expression at 5 mM glucose, but not in the presence of high glucose concentrations. In conclusion, our findings demonstrate a deleterious direct contribution of high glucose on human GnRH neurons, thus providing new insights into pathogenic mechanisms linking metabolic disorders to reproductive dysfunctions.

  2. Gene : CBRC-MMUS-23-0035 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 152306 /ug=Mm.330279 /len=4633 3e-71 52% MIFSFLAIFHVKQWTYLNVLSFSVFLVIFHVIKCIFLIFRDSQVSRHISGHRVCISHFSRFSVILSF...FKSSCGCFSFSKIFSFLAIFHVLQWTFLNSPHISVFLAIFHIIKCVFLIFRDFQFSRHIPGPTLCISHFPCFSVIHYIFIGLQCVSHFPRFSVFLTYSGSYSVCVSFS...TFFSLPAIFQILQCAYLIFQVSLNVPRHIPISTVCVPHFQIFLVFLPYSYAFHIFDVFHFSPHILGPTVCVCLLYHIFHHSCNIPGPTECISHLSIFFSASCHM ...

  3. Dicty_cDB: Contig-U03781-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 135 3e-31 EF421063_1( EF421063 |pid:none) Lyophyllum ambustum strain CBS452.... 135 3e-31 DQ782901_1( D...Q782901 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 135 3e-31 DQ782892_1( DQ782892 |pid:none) Physcia a

  4. Dicty_cDB: Contig-U02828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EU080666_1( EU080666 |pid:none) Phytophthora cuyabensis isolate PD... 73 3e-12 AF240877_1( AF240877 |pid:no...a isola... 73 3e-12 EU080373_1( EU080373 |pid:none) Phytophthora cuyabensis isolate PD... 73 3e-12 EU369017_

  5. Dicty_cDB: Contig-U15463-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 40 |pid:none) Bazzania tayloriana voucher NSW712... 248 3e-64 DQ406895_1( DQ406895 |pid:none) Sabia sp. Qiu ...248 3e-64 CP000439_1615( CP000439 |pid:none) Francisella tularensis subsp. n... 248 3e-64 EF101040_1( EF1010

  6. Dicty_cDB: Contig-U15667-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 80732 |pid:none) Anabas testudineus cyclin B mRNA, ... 50 3e-04 AF086634_1( AF086...B... 50 3e-04 AM920436_191( AM920436 |pid:none) Penicillium chrysogenum Wisconsi... 50 3e-04 EU780732_1( EU7

  7. Dicty_cDB: SSL190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C

  8. Dicty_cDB: SSE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trep. 216 3e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3...H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510...165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3...C. 216 3e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. ...216 3e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloni

  9. Dicty_cDB: SSB539 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available or pDXA-3strep. 222 3e-56 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 222 3e-56 2 X8...5122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 222 3e-56 2 AJ510...165 |AJ510165.1 Cloning vector pDXA-3FLAG. 222 3e-56 2 X85118 |X85118.1 Artificial sequences cloning vector ...DNA pDXA-3C. 222 3e-56 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 222 3e-56