WorldWideScience

Sample records for self-pollination squash generations

  1. Effects of open- and self-pollination treatments on genetic estimations in maize diallel experiment

    Energy Technology Data Exchange (ETDEWEB)

    Kahriman, F.; Egesel, C.O.; Zorlu, E.

    2015-07-01

    This study investigated the effects of open- and self-pollination treatments on genetic estimations and kernel biochemical content in a maize diallel experiment. A 7×7 complete reciprocal diallel set (7 parents and 42 hybrids) was used as plant material. Measured traits were: kernel weight per plant, protein content, oil content and carbohydrate content. General combining ability (GCA), specific combining ability (SCA), maternal effects (MAT), non-maternal effects (NMAT) and heterosis values were compared in open- and self-pollination treatments for measured traits. Results showed that the pollination treatments had a significant effect on all investigated traits. Parental lines and hybrid combinations gave different responses. Parents had relatively higher protein and oil content in self-pollination but hybrids had lower values in self-pollination compared with open-pollination. A considerable number of genotypes showed significant differences for genetic estimations (GCA, SCA, MAT, NMAT) and heterosis between open- and self-pollination treatments. Overall, findings suggest that evaluation of kernel quality traits should be made on selfed ear samples; however, evaluation for yield should be carried out on open-pollinated samples. (Author)

  2. BIODIVERSITY OF NATIONAL SQUASH CULTIVAR ACCESSIONS

    Directory of Open Access Journals (Sweden)

    A. F. Bukharov

    2017-01-01

    Full Text Available The squash is one of  the most  ancient plants, bearing numerous qualities. The squash gave high yield and is unpretentious plant, the fruit of which is long-stored and can be used as boiled, stewed, baked, fried product, and be added to bread, mush and pudding, and be prepared as puree, jam, candied fruit and other meals. Owing to useful characteristics the squash is a valuable source or raw  material for  food  canning  industry,  for  health-care and functional foodstuff production. Its best cultivar accessions contain to 30% of dry matter, to 12% of sugars  and  to  36%  of  carotene.  The  species  of  squash includes 4 subspecies and 20 varieties. One accession that came from Spain in 1937 served as an initial breeding accession for many other table cultivars for long time. For 80 years of national breeding program the many cultivars for  table  use have been released. There are the classic cultivars, such as ‘Mramornaya’, ‘Stolovaya Zimnaya’,  Gribovskaya Zimnaya’,  ‘Donskaya  Sladkaya’, ‘Michurinskaya’ that are selected or developed from first Spanish accession. This richness and originality of cultivar squash accessions should be carefully preserved. There are the new generation cultivars, such as ‘Kroshka’, ‘Malishka’,    ‘Rossiyanka’,    ‘Konfetka’,    ‘Moskvichka’, ‘Vnuchka’ and many others, which are short-tendrils and suitable for  modern  mechanized cultivation  technology. Moreover the development of new cultivars, bearing resistance to biotic and abiotic stress is the main goal of nearest breeding program.

  3. Mechanical vs. Beetle-mediated Self-pollination in (Malvaceae, an Endangered Shrub

    Directory of Open Access Journals (Sweden)

    Kyra N. Krakos

    2010-01-01

    Full Text Available Experimental hand pollinations of the endangered, Hawaiian, endemic, Gossypium tomentosum Nutt. Ex. (Malvaceae showed that it was self-compatible, but self-pollination resulted in reduced reproductive output. Field observations and pollen tube analyses using fluorescence microscopy showed that mechanical self-pollination in this species included a mechanism known as bending stigmas. A receptive stigma bent backwards and contacted dehiscent anthers in 7% of flowers found on 17 G. tomentosum plants. The yellow flowers were nectarless and were not visited by most anthophilous insects in situ except for the introduced, nitidulid beetle, Aethina concolor Macleay. Collections and insect GI-tract dissections showed that A. concolor carried and ate the pollen of the host flower. Field observations recorded regular contact between beetles and stigma lobes as these insects exited the flowers effecting self-pollination. Behavioral experiments showed that the beetles responded positively to a yellow visual cue. Under some circumstances, an introduced pollen vector may help maintain a low level of reproductive success in an insular endemic.

  4. Cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch).

    Science.gov (United States)

    Nanasato, Yoshihiko; Tabei, Yutaka

    2015-01-01

    We established improved methods for Agrobacterium-mediated transformation of cucumber (Cucumis sativus L.) and kabocha squash (Cucurbita moschata Duch). Vacuum infiltration of cotyledonary explants with Agrobacterium suspension enhanced the Agrobacterium infection efficiency in the proximal regions of explants. Wounding treatment was also essential for kabocha squash. Cocultivation on filter paper wicks suppressed necrosis of explants, keeping regeneration efficacy. Putative transgenic plants were screened by kanamycin resistance and green fluorescent protein (GFP) fluorescence. These putative transgenic plants grew normally and T1 seeds were obtained, and stable integration and transmission of the transgene in T1 generations were confirmed by Southern hybridization and PCR. The average transgenic efficiency for cucumber and kabocha squash was 11.9 ± 3.5 and 9.2 ± 2.9 %, respectively.

  5. A comparison of controlled self-pollination and open pollination results based on maize grain quality

    Directory of Open Access Journals (Sweden)

    Hanna Sulewska

    2014-05-01

    Full Text Available Maize (Zea mays L. grain endosperm is triploid (3n, of which 2n come from the male (transferred by pollen and only 1n from the female plant, thus a major impact of the male form can be expected on grain quality parameters. A good example of this relationship is the phenomenon of xenia. The aim of this study was to determine the effect of pollen on grain quality. The field experiment was conducted in 2011; seeds were harvested from eight cultivars: Bosman, Blask, Tur, Kozak, Bielik, Smok, SMH 220 and Kresowiak, derived from free pollination and controlled self-pollination of maize. Analyses of nutrient contents and starch content in the grain were conducted in the laboratory. In addition, 1000 grain weight and the hectoliter weight of all grain samples were recorded. The results confirmed differences in grain quality of maize hybrids obtained by self-pollination and by open pollination. Grain of maize plants obtained by open-pollination was characterised by higher contents of N-free extract and starch, and lower protein content. Undertaking further studies on this subject may indicate specific recommendations for agricultural practice, such as mixtures of hybrids with good combining abilities, which will contribute to improved grain quality without additional costs.

  6. Squashed entanglement in infinite dimensions

    International Nuclear Information System (INIS)

    Shirokov, M. E.

    2016-01-01

    We analyse two possible definitions of the squashed entanglement in an infinite-dimensional bipartite system: direct translation of the finite-dimensional definition and its universal extension. It is shown that the both definitions produce the same lower semicontinuous entanglement measure possessing all basis properties of the squashed entanglement on the set of states having at least one finite marginal entropy. It is also shown that the second definition gives an adequate lower semicontinuous extension of this measure to all states of the infinite-dimensional bipartite system. A general condition relating continuity of the squashed entanglement to continuity of the quantum mutual information is proved and its corollaries are considered. Continuity bound for the squashed entanglement under the energy constraint on one subsystem is obtained by using the tight continuity bound for quantum conditional mutual information (proved in the Appendix by using Winter’s technique). It is shown that the same continuity bound is valid for the entanglement of formation. As a result the asymptotic continuity of the both entanglement measures under the energy constraint on one subsystem is proved.

  7. Investigation of Differences in Fertility among Progenies from Self-Pollinated Chrysanthemum

    Directory of Open Access Journals (Sweden)

    Fan Wang

    2018-03-01

    Full Text Available Most chrysanthemum cultivars are self-incompatible, so it is very difficult to create pure lines that are important in chrysanthemum breeding and theoretical studies. In our previous study, we obtained a self-compatible chrysanthemum cultivar and its self-pollinated seed set was 56.50%. It was interesting that the seed set of its ten progenies ranged from 0% to 37.23%. Examination of the factors causing the differences in the seed set will lead to an improved understanding of chrysanthemum self-incompatibility, and provide valuable information for creating pure lines. Pollen morphology, pollen germination percentage, pistil receptivity and embryo development were investigated using the in vitro culture method, the paraffin section technique, scanning electron microscopy and transmission electron microscopy. Moreover, RNA sequencing and bioinformatics were applied to analyzing the transcriptomic profiles of mature stigmas and anthers. It was found that the self-pollinated seed set of “Q10-33-1①”,”Q10-33-1③”,”Q10-33-1④” and “Q10-33-1⑩” were 37.23%, 26.77%, 7.97% and 0%, respectively. The differences in fertility among four progenies were mainly attributable to differences in pollen germination percentage and pistil receptivity. Failure of the seed set in “Q10-33-1⑩” was possibly due to self-incompatibility. In the transcriptomic files, 22 potential stigma S genes and 8 potential pollen S genes were found out.

  8. Fusion potentials for Gk and handle squashing

    International Nuclear Information System (INIS)

    Crescimanno, M.

    1993-01-01

    Using Chern-Simons gauge theory, we show that the fusion ring of the conformal field theory G k (G any Lie algebra) is isomorphic to P[u]/(∇V) where (∇V) is the ideal generated by conditions ∇V=0. We explicitly construct V for all G k . We also derive a residue-like formula for the correlation functions in the Chern-Simons theory thus providing an RCFT version of the residue formula for the topological Landau-Ginzburg model. An operator that acts like a measure in this residue formula has the interpretation of a handle-squashing operator and explicit formulae for this operator are given. (orig.)

  9. The Interest for Practicing Squash in Timisoara

    Directory of Open Access Journals (Sweden)

    Marcel RĂSĂDEAN

    2013-12-01

    Full Text Available Squash is a complex sport between two players (singles or between four players (doubles, who use special racquets to alternatively strike a rubber ball in a four-walled court with a dedicated layout; by practicing this sport, an individual may gain a number of benefits: squash optimizes the overall state of health, improves coordination, flexibility, agility and speed of reaction, develops the capacity to concentrate and the attention span, fosters a competitive spirit, reduces stress levels, increases the resistance to effort and constitutes an activity that may successfully counteract sedentariness and obesity. Furthermore, squash is a means by which one may socialize and strengthen interpersonal relations. Taking into account that, even though squash is not extensively known in Romania, it is on the rise both from the point of view of the number of people who practice it and from the perspective of institutional organization. In order to accelerate the promotion of squash both on a national and on a regional level, a qualitative research has been conducted among squash players in Timisoara. The purpose of this research is to identify the reasons which determine one to practice squash and the interest dedicated by those who practice squash to competitions.

  10. Using the Animal Model to Accelerate Response to Selection in a Self-Pollinating Crop

    Science.gov (United States)

    Cowling, Wallace A.; Stefanova, Katia T.; Beeck, Cameron P.; Nelson, Matthew N.; Hargreaves, Bonnie L. W.; Sass, Olaf; Gilmour, Arthur R.; Siddique, Kadambot H. M.

    2015-01-01

    We used the animal model in S0 (F1) recurrent selection in a self-pollinating crop including, for the first time, phenotypic and relationship records from self progeny, in addition to cross progeny, in the pedigree. We tested the model in Pisum sativum, the autogamous annual species used by Mendel to demonstrate the particulate nature of inheritance. Resistance to ascochyta blight (Didymella pinodes complex) in segregating S0 cross progeny was assessed by best linear unbiased prediction over two cycles of selection. Genotypic concurrence across cycles was provided by pure-line ancestors. From cycle 1, 102/959 S0 plants were selected, and their S1 self progeny were intercrossed and selfed to produce 430 S0 and 575 S2 individuals that were evaluated in cycle 2. The analysis was improved by including all genetic relationships (with crossing and selfing in the pedigree), additive and nonadditive genetic covariances between cycles, fixed effects (cycles and spatial linear trends), and other random effects. Narrow-sense heritability for ascochyta blight resistance was 0.305 and 0.352 in cycles 1 and 2, respectively, calculated from variance components in the full model. The fitted correlation of predicted breeding values across cycles was 0.82. Average accuracy of predicted breeding values was 0.851 for S2 progeny of S1 parent plants and 0.805 for S0 progeny tested in cycle 2, and 0.878 for S1 parent plants for which no records were available. The forecasted response to selection was 11.2% in the next cycle with 20% S0 selection proportion. This is the first application of the animal model to cyclic selection in heterozygous populations of selfing plants. The method can be used in genomic selection, and for traits measured on S0-derived bulks such as grain yield. PMID:25943522

  11. Are squash players protecting their eyes?

    OpenAIRE

    Eime, R; Finch, C; Sherman, C; Garnham, A

    2002-01-01

    Methods: A survey of 303 players (aged ≥18 years) was conducted at three squash venues in Melbourne, Australia over a three week period in June 2000 to obtain information about protective eyewear use.

  12. Prevalence of musculoskeletal injuries among adolescent squash ...

    African Journals Online (AJOL)

    relatively more competitive levels of play compared with 20 years ago.10 This ... Squash is a high-intensity sport that requires high-speed movements around ..... nals that flexibility and neuromusculoskeletal training should be encouraged in ...

  13. Efeito da autofecundação em cultivares de abacaxi Effects of self pollination in pineapple cultivars

    Directory of Open Access Journals (Sweden)

    José Renato Santos Cabral

    2003-04-01

    pineapple breeding program in conduction at Embrapa Cassava and Fruit Crops. On the other hand, the effects of self fertilization are not well known on pineapple, however this strategy may lead to significant advances in the improvement of that crop. The objective of this work was to evaluate the effects of self pollination in pineapple cultivars. Inflorescences of the cultivars Primavera, Perolera, Roxo-de-Tefé, Pérola and Smooth Cayenne were covered before anthesis in order to promote self fertilization. The resulting seeds were transferred to Petri dishes containing MS medium supplemented with 30 g.L-1 for germination and incubed in growth chamber. During germination it was observed that 16% of the seeds from 'Roxo-de-Tefe' generated albino plantlets. Forty three plants from 'Primavera', five from 'Perolera', eleven from 'Roxo-de-Tefé' and none from 'Pérola' and 'Smooth Cayenne' were obtained. All plants from Primavera presented spineless leaf margin (piping type, suggesting homozygosis for that characteristics, while in the 'Perolera" progeny three plants showed spineless leaf margin and two showed spiny leaves, showing segregation for the character presence of spine. Regarding to 'Roxo-de-Tefé' progeny, eight plants showed violet colored leaves and three with green colored leaves, expressing segregation for leaf color, but all leaves were spiny. The low percentage of germination, slow growth rate and low vigor observed in plants kept under greenhouse conditions as well as nursery, indicate the occurrence of depression by endogamy during these developmental phases.

  14. The NUTs and Bolts of squashed holography

    Energy Technology Data Exchange (ETDEWEB)

    Bobev, Nikolay; Hertog, Thomas; Vreys, Yannick [Institute for Theoretical Physics, KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium)

    2016-11-23

    We evaluate the partition function of the free O(N) model on a two-parameter family of squashed three spheres. We also find new solutions of general relativity with negative cosmological constant and the same double squashed boundary geometry and analyse their thermodynamic properties. Remarkably, both systems exhibit a qualitatively similar behaviour over the entire configuration space of boundary geometries. Recent formulations of dS/CFT enable one to interpret the field theory partition function as a function of the two squashing parameters as the Hartle-Hawking wave function in a minisuperspace model of anisotropic deformations of de Sitter space. The resulting probability distribution is normalisable and globally peaked at the round three sphere, with a low amplitude of boundary geometries with negative scalar curvature.

  15. Self-pollination rate and floral-display size in Asclepias syriaca (Common Milkweed) with regard to floral-visitor taxa.

    Science.gov (United States)

    Howard, Aaron F; Barrows, Edward M

    2014-06-23

    Animals fertilize thousands of angiosperm species whose floral-display sizes can significantly influence pollinator behavior and plant reproductive success. Many studies have measured the interactions among pollinator behavior, floral-display size, and plant reproductive success, but few studies have been able to separate the effects of pollinator behavior and post-pollination processes on angiosperm sexual reproduction. In this study, we utilized the highly self-incompatible pollinium-pollination system of Asclepias syriaca (Common Milkweed) to quantify how insect visitors influenced male reproductive success measured as pollen removal, female reproductive success measured as pollen deposition, and self-pollination rate. We also determined how floral-display size impacts both visitor behavior and self-pollination rate. Four insect taxonomic orders visited A. syriaca: Coleoptera, Diptera, Hymenoptera, and Lepidoptera. We focused on three groups of visitor taxa within two orders (Hymenoptera and Lepidoptera) with sample sizes large enough for quantitative analysis: Apis mellifera (Western Honey Bee), Bombus spp. (bumble bees) and lepidopterans (butterflies and moths). Qualitatively, lepidopterans had the highest pollinator importance values, but the large variability in the lepidopteran data precluded meaningful interpretation of much of their behavior. The introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition. However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate as compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in the native Bombus spp. Apis mellifera's high rate of self-pollination may have significant negative effects on both male and female reproductive successes

  16. Squash inhibitor family of serine proteinases

    International Nuclear Information System (INIS)

    Otlewski, J.; Krowarsch, D.

    1996-01-01

    Squash inhibitors of serine proteinases form an uniform family of small proteins. They are built of 27-33 amino-acid residues and cross-linked with three disulfide bridges. The reactive site peptide bond (P1-P1') is between residue 5 (Lys, Arg or Leu) and 6 (always Ile). High resolution X-ray structures are available for two squash inhibitors complexed with trypsin. NMR solution structures have also been determined for free inhibitors. The major structural motif is a distorted, triple-stranded antiparallel beta-sheet. A similar folding motif has been recently found in a number of proteins, including: conotoxins from fish-hunting snails, carboxypeptidase inhibitor from potato, kalata B1 polypeptide, and in some growth factors (e.g. nerve growth factor, transforming growth factor β2, platelet-derived growth factor). Squash inhibitors are highly stable and rigid proteins. They inhibit a number of serine proteinases: trypsin, plasmin, kallikrein, blood clotting factors: X a and XII a , cathepsin G. The inhibition spectrum can be much broadened if specific amino-acid substitutions are introduced, especially at residues which contact proteinase. Squash inhibitors inhibit proteinases via the standard mechanism. According to the mechanism, inhibitors are substrates which exhibit at neutral pH a high k cat /K m index for hydrolysis and resynthesis of the reactive site, and a low value of the hydrolysis constant. (author)

  17. Prevalence of musculoskeletal injuries among adolescent squash ...

    African Journals Online (AJOL)

    years ago.10 This shift in focus among young people from en- joyment of physical ... 106 squash players aged 13 - 18 years participating in the study. Setting. ..... index, height, fitness level), an extended study period, infor- mation on the ...

  18. Prevalence of musculoskeletal injuries among young squash ...

    African Journals Online (AJOL)

    The aim of the study was to investigate the prevalence of musculoskeletal injuries sustained by young squash players in Malaysia. This study was conducted retrospectively by using. Standardized Nordic Questionnaire (NSQ) during SUKMA 2016 at Kuching, Sarawak, Malaysia. The questionnaires were distributed to the ...

  19. Stability of squashed Kaluza-Klein black holes

    International Nuclear Information System (INIS)

    Kimura, Masashi; Ishihara, Hideki; Murata, Keiju; Soda, Jiro

    2008-01-01

    The stability of squashed Kaluza-Klein black holes is studied. The squashed Kaluza-Klein black hole looks like a five-dimensional black hole in the vicinity of horizon and looks like a four-dimensional Minkowski spacetime with a circle at infinity. In this sense, squashed Kaluza-Klein black holes can be regarded as black holes in the Kaluza-Klein spacetimes. Using the symmetry of squashed Kaluza-Klein black holes, SU(2)xU(1)≅U(2), we obtain master equations for a part of the metric perturbations relevant to the stability. The analysis based on the master equations gives strong evidence for the stability of squashed Kaluza-Klein black holes. Hence, the squashed Kaluza-Klein black holes deserve to be taken seriously as realistic black holes in the Kaluza-Klein spacetime.

  20. Are squash players protecting their eyes?

    Science.gov (United States)

    Eime, R M; Finch, C F; Sherman, C A; Garnham, A P

    2002-09-01

    To determine factors associated with adult squash players' protective eyewear behaviours. A survey of 303 players (aged >or =18 years) was conducted at three squash venues in Melbourne, Australia over a three week period in June 2000 to obtain information about protective eyewear use. Of 303 participants the response rate was 98.1%; 66.1% were males, with a mean age of 40.5 years. The majority (68.4%) had played squash for 10 years or more. Although 18.8% of players reported using protective eyewear, only 8.9% reported wearing approved eyewear. Both age group (peye injuries (50.0%) and knowledge of eye injury risk (33.9%). A commonly reported barrier was restriction of vision (34.2%). These findings demonstrate a low prevalence of voluntary use of appropriate protective eyewear. Future prevention strategies incorporating education campaigns should focus on increasing players' knowledge of risks. The barriers to use and misconceptions about which types of eyewear is most protective need to be addressed as a priority.

  1. Real squashing mode in textures in 3He-B

    International Nuclear Information System (INIS)

    Mineev, V.P.

    1985-01-01

    The shape of the absorption line of ultrasound due to various components of the real squashing mode in textures in 3 He-B is investigated. An explanation is presented of the additional splitting of the absorption line for the M=0 component of the real squashing model in a magnetic field and of the absence of such splitting of lines with M=+-1, +-2 in the case of place geometry. The peculiarities of the shape of the ultrasound absorption lines for various components of the real squashing mode in a rotating cylindrical vessel with 3 He-B are discussed

  2. Ecological context of the evolution of self-pollination in Clarkia xantiana: population size, plant communities, and reproductive assurance.

    Science.gov (United States)

    Moeller, David A; Geber, Monica A

    2005-04-01

    The repeated evolutionary transition from outcrossing to self-pollination in flowering plants has been suggested to occur because selfing provides reproductive assurance. Reports from biogeographical and ecological surveys indicate that selfing taxa are often associated with stressful and ephemeral environments, situations in which plant abundance is low (e.g., Baker's law) and with novel plant communities, however experimental tests of ecological hypotheses are few. In this study, we examined the ecological context of selection on mating system traits (herkogamy and protandry) in a California annual, Clarkia xantiana, where natural selfing populations differ from outcrossing populations in that they are often of small size or low density and occur mainly outside the range of pollinator-sharing congeners. We constructed artificial populations of plants with broad genetic variation in floral traits and manipulated two ecological factors, plant population size, and the presence versus absence of pollinator-sharing congeners, in the center of the geographic range of outcrossing populations. We found evidence for context-dependent selection on herkogamy and protandry via female fitness in which reduced traits, which promote autonomous selfing, were favored in small populations isolated from congeners whereas selection was comparatively weak in large populations or when congeners were present. In small, isolated populations, the fertility of plants with low herkogamy or protandry was elevated by 66% and 58%, respectively, compared to those with high herkogamy or protandry. The presence of pollinator-sharing congeners augmented bee visitation rates to C. xantiana flowers by 47% for all bees and by 93% for pollen specialists. By facilitating pollinator visitation, congeners mitigated selection on mating system traits in small populations, where outcross mating success is often low (the Allee effect). We also found support for the hypothesis that pollinator availability

  3. Study of self-pollination and capitula characteristics in globe artichoke (Cynara cardunculus var. scolymus Hayek L. under different irrigation regimes

    Directory of Open Access Journals (Sweden)

    Nouraei, Sina

    2016-07-01

    Full Text Available In order to estimate the drought effects on capitula characteristics and self-pollination of globe artichoke (Cynara cardunculus var. scolymus Hayek L., the randomized complete block design was carried out with three irrigation regimes (20 %, 50 % and 80 % depletion of soil available water and six replicates. The artichoke is mostly open-pollinated, however, after covering the buds and isolation of flowers to prevent cross pollination, 1.79 % self-pollination was observed and this amount was not affected by different irrigation regimes. In stress conditions (50 % and 80 % water depletion as well as non-stress condition (20 % water depletion, plants with respectively one and two medium capitula and without small capitula had most relative frequencies in the population and drought stress increased these relative frequencies by reducing the number of medium and small capitula in plants. In addition, Capitula size and dry weight were significantly affected by water stress. Water shortage induced severe decrease in length and dry weight of all capitula including large, medium and small, although capitula width was less affected by water deficit and only slight decline in medium (12.5 % and small capitula (23.7 % was observed under severe stress condition.

  4. Combing Ability Analysis ofamong Early Generation Maize Inbred ...

    African Journals Online (AJOL)

    dagne.cimdom

    estimate combining ability effects of locally developed and introduced early generation maize inbred lines for grain yield, yield .... mass selection followed by self-pollination for generating inbred lines. The inbred lines ... for the experiment was an alpha (0, 1) lattice (Patterson and Williams, 1996) with two replications at each ...

  5. Sensory Acceptability of Squash (Cucurbita Maximain Making Ice Cream

    Directory of Open Access Journals (Sweden)

    Raymund B. Moreno

    2015-02-01

    Full Text Available - This experimental research was conducted to determine the sensory acceptability of mashed squash (Cucurbita Maxima of different proportions in making ice cream in terms of appearance, aroma, texture, taste and general acceptability. Five treatments were formulated in the study—four of which utilized mashed squash at various proportions and one treatment was used as the control variable which contains no mashed squash at all. The respondents of the study were the 20 Food Technology students and 10 faculty members of West Visayas State University Calinog Campus who were selected through random sampling. The respondents evaluated the finished products using a modified sensory evaluation score sheet based on Six Point Hedonic Scale. The statistical tools used were the means, standard deviation, Wilcoxon Signed Rank Test. The 0.01 alpha level was used as the criterion for acceptance or rejection of the null hypothesis. The result of the study led to the conclusion that there is a significant difference that existed in the level of acceptability of mashed squash in making ice cream in terms of appearance, aroma, and general acceptability, therefore the null hypothesis is rejected. However, no significant difference in the level of acceptability of using mashed squash in making ice cream in terms of taste and texture.

  6. Evaluating the rebound velocity of squash racquets | Sharp | African ...

    African Journals Online (AJOL)

    ... with statistical assessment using Statistica version 10. The results of the study indicated that there were differences in rebound velocities of different racquets if controlled for string tension. This research is an attempt to develop assessment methods into rebound characteristics of the lesser known racquet sport, squash.

  7. The phenotypic diversity and fruit characterization of winter squash ...

    African Journals Online (AJOL)

    PRECIOUS

    2010-01-11

    Jan 11, 2010 ... collected from different provinces of the Black Sea region in 2006 and 2007 and phenotypic ... Picture of the diversity fruit size, shape and color for Cucurbita maxima ... Fruit traits used winter squash (C. maxima Duch) population characterization. S/N ..... Group J: There were a total of 18 populations in this.

  8. Tennis-Badminton-Squash Guide. June 1974-June 1976.

    Science.gov (United States)

    Sherman, Patricia, Ed.; And Others

    This guide is a collection of essays by various authors on tennis, badminton, and squash. The document is divided into three sections, one for each sport. The topics covered include general teaching methods, methods to employ for teaching specific skills such as the lob or the backhand, the use of visual aids, conditioning drills, study questions,…

  9. Comparison of management strategies for squash bugs (Hemiptera: Coreidae) in watermelon.

    Science.gov (United States)

    Dogramaci, Mahmut; Shrefler, James W; Roberts, B Warren; Pair, Sam; Edelson, J V

    2004-12-01

    Two watermelon pest management practices, a squash trap crop and a standard recommendation using soil-applied carbofuran, were compared using large-scale field plots to assess trap crop suitability as a replacement for the standard in 2000, 2001, and 2002. In both systems, foliar insecticide applications were used to control squash bugs when populations exceeded threshold levels. During 2001 and 2002, a treatment of untreated watermelon was used. Early season adult insects, from seedling to fruit set, are most critical for watermelon. Significantly fewer early adult bugs were found on watermelon in the trap crop than in the standard recommended practice in 1 of 3 yr. In both years, significantly fewer adult squash bugs were found in watermelon in the trap crop than in untreated fields. The standard recommended practice significantly reduced adult squash bugs in watermelon compared with the untreated in 1 of 2 yr. There was no significant correlation of watermelon yield and squash bug density, indicating that squash bug densities were too low to impact yield. Although squash bugs were reduced significantly by the trap crop, marketable watermelon yields were lower in the squash trap crop than in untreated watermelon, suggesting that pest management treatments may interfere with crop productivity factors other than squash bug colonization. Results suggest that mid-season production squash bug should be managed by monitoring populations and using insecticides as needed rather than using at-plant treatment. Further research is needed to compare treatments during early-season production.

  10. Evolution of perturbations of squashed Kaluza-Klein black holes: Escape from instability

    International Nuclear Information System (INIS)

    Ishihara, Hideki; Kimura, Masashi; Konoplya, Roman A.; Murata, Keiju; Soda, Jiro; Zhidenko, Alexander

    2008-01-01

    The squashed Kaluza-Klien (KK) black holes differ from the Schwarzschild black holes with asymptotic flatness or the black strings even at energies for which the KK modes are not excited yet, so that squashed KK black holes open a window in higher dimensions. Another important feature is that the squashed KK black holes are apparently stable and, thereby, let us avoid the Gregory-Laflamme instability. In the present paper, the evolution of scalar and gravitational perturbations in time and frequency domains is considered for these squashed KK black holes. The scalar field perturbations are analyzed for general rotating squashed KK black holes. Gravitational perturbations for the so-called zero mode are shown to be decayed for nonrotating black holes, in concordance with the stability of the squashed KK black holes. The correlation of quasinormal frequencies with the size of extra dimension is discussed.

  11. An overview of winter squash (Cucurbita maxima Duch. and pumpkin (Cucurbita moschata Duch. growing in Turkey

    Directory of Open Access Journals (Sweden)

    Ahmet Balkaya

    2015-06-01

    Full Text Available Cucurbita L. species of the pumpkin and winter squash are grown all over the world. Winter squash and pumpkin are two of the most important Cucurbit vegetable crops in Turkey. Turkey is one of the important diversity areas, for the cultivated cucurbits because of their adaptation to diverse ecological conditions as a result of both natural selection and also the selection by farmers. Farmers have maintained the local population of winter squash and pumpkin, which are mainly sold in local markets. Only one improved cultivar of the winter squash is currently grown commercially in Turkey. It is a traditional vegetable often grown in small gardens. In this contribution, the last status of winter squash and pumpkin production in Turkey, the growing techniques and problems of these winter squash and pumpkin species, their genetic collection and characterization, and the utilization of the presented species in Turkey are examined.

  12. Quantitative and qualitative parameters in Acorn squash cultivar in the conditions of the Slovak Republic

    Directory of Open Access Journals (Sweden)

    Miroslav Šlosár

    2018-02-01

    Full Text Available The species Cucurbita pepo includes several types of squashes; in Slovak Republic, well-known and oftenly grown squash types are patisson, zucchini, spaghetti squash, oil pumpkin etc. Several interesting squash types of Cucurbita pepo are grown abroad, including Acorn squash which is well-known mainly in USA. The aim of this study was to evaluate the important quantitative (yield per hectare, average fruit weight and qualitative (total carotenoids, ascorbic acid, antioxidant activity, total soluble solids yield parameters of Acorn squash fruits in comparison with patisson which is typical squash type of Cucurbita pepo in Slovak Republic. The field trial was realised in Košice-Šaca in 2016. Within experiment, four cultivars of Acorn type pumpkin were tested (Thelma Sanders; Jet Set; Table Gold; Cream of The Crop. The patisson 'Orfeus' was used as a comparative cultivar for evaluation of individual parameters of Acorn type pumpkin cultivars. Matured pumpkin fruits were harvested on the 7th September 2016. From aspect of yield quantity, Acorn cultivars are appeared as very interesting squash type with good yield potential for growing. The highest yield of squash fruits was found in the cultivar 'Cream of The Crop' (17.8 t.ha-1. In mentioned Acorn cultivar, the yield was higher about 87.4% compared to the tested patisson cultivar 'Orfeus' (9.5 t.ha-1. On the contrary, the average weight of squash fruits was reached in patisson cultivar 'Orfeus' (780.7 g. The qualitative parameters of fruits were expressively influenced by squash cultivar. The content of total carotenoids, ascorbic acid and total soluble solids was markedly higher in all Acorn cultivars, compared to the patisson cultivar 'Orfeus'. The highest content of total carotenoids (26.74 mg.kg-1 fresh weight and ascorbic acid (238.79 mg.kg-1 f. w. was found in the squash cultivar 'Table Gold'. The highest content of total soluble solids was determined in the cultivar 'Jet Set' (3.8

  13. 7 CFR 319.56-48 - Conditions governing the entry of baby squash and baby courgettes from Zambia.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Conditions governing the entry of baby squash and baby... Fruits and Vegetables § 319.56-48 Conditions governing the entry of baby squash and baby courgettes from Zambia. Baby squash (Curcurbita maxima Duchesne) and baby courgettes (C. pepo. L.) measuring 10 to 25...

  14. 7 CFR 319.56-36 - Watermelon, squash, cucumber, and oriental melon from the Republic of Korea.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Watermelon, squash, cucumber, and oriental melon from... QUARANTINE NOTICES Fruits and Vegetables § 319.56-36 Watermelon, squash, cucumber, and oriental melon from the Republic of Korea. Watermelon (Citrullus lanatus), squash (Cucurbita maxima), cucumber (Cucumis...

  15. Universal squash model for optical communications using linear optics and threshold detectors

    International Nuclear Information System (INIS)

    Fung, Chi-Hang Fred; Chau, H. F.; Lo, Hoi-Kwong

    2011-01-01

    Transmission of photons through open-air or optical fibers is an important primitive in quantum-information processing. Theoretical descriptions of this process often consider single photons as information carriers and thus fail to accurately describe experimental implementations where any number of photons may enter a detector. It has been a great challenge to bridge this big gap between theory and experiments. One powerful method for achieving this goal is by conceptually squashing the received multiphoton states to single-photon states. However, until now, only a few protocols admit a squash model; furthermore, a recently proven no-go theorem appears to rule out the existence of a universal squash model. Here we show that a necessary condition presumed by all existing squash models is in fact too stringent. By relaxing this condition, we find that, rather surprisingly, a universal squash model actually exists for many protocols, including quantum key distribution, quantum state tomography, Bell's inequality testing, and entanglement verification.

  16. Acid phosphatases in seeds and developing of squash (Cucurbita ficifolia

    Directory of Open Access Journals (Sweden)

    Irena Lorenc-Kubis

    2014-01-01

    Full Text Available Changes in protein content and acid phosphatase activity were followed during germination (imbition through seedlings development in extracts from cotyledons of squash (Cucurbita ficifolia. It has been shown that the activity of acid phosphatase was initially low and than increased to a maximum after 6 days of imbition. Acid phosphates were isolated from cotyledons of seeds and from 6-, 10- and 22-days old seedlings by extraction the proteins with 0.1 M acetate buffer pH 5.1, precipitation with ethanol and by affinity chromatography on con A-Sepharose. Two glycoprotein enzymes AcPase Ba and AcPase Bb which differ in their affinity to immobilized con A were obtained. Both acid phosphatates retained the enzyme activity after binding to free con A. Rocket affinity electrophoresis of AcPase Ba and AcPase Bb, isolated from cotyledons of seeds and seedlings, revealed differences in their ability to bind to con A during seeds germination and seedling develop-ment indicating changes in their sugar component. Con A was found to activate both enzymes. The enzymes cross-reacted with monospecific antibodies raised against grass seed acid phosphatate Ba indicating an antigenic relationship between squash and grass acid phosphatases.

  17. Efisiensi Tular Benih Squash mosaic virus pada Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Susanti Mugi Lestari

    2014-09-01

    Full Text Available Infection of viruses on Cucurbitaceae may cause high yield and economic losses. Squash mosaic virus is a seed borne virus and among the most important virus infecting Cucurbitaceae. The aims of these research was to detect infection of several viruses on Cucurbitaceae and to examine seed transmission efficiency of SqMV. Detection of Cucumber mosaic virus (CMV, Squash mosaic virus (SqMV, Watermelon mosaic virus-2 (WMV-2, Zucchini yellow mosaic virus (ZYMV, and Tobacco ringspot virus (TRSV from field samples and seeds was conducted using Indirect-ELISA method. Infection of CMV, SqMV and ZYMV was detected from field samples. Seed transmission of SqMV on commercial seeds of bottle gourd, watermelon, zucchini, cabocha, cucumber, and melon was 13, 13, 33, 73, 100, and 100%, respectively. Seed transmission of ZYMV was only occurred on bottle gourd and zucchini, i.e. 13.3% and 26.67%, respectively. Infection of SqMV through F2 seed was determined from cucumber, bottle gourd, and melon, i.e. 93, 100, and 100%, respectively. Therefore, the status of SqMV as quarantine pest should be evaluated since SqMV was already found in West Java.

  18. Squashed Toric Sigma Models and Mock Modular Forms

    Science.gov (United States)

    Gupta, Rajesh Kumar; Murthy, Sameer

    2018-05-01

    We study a class of two-dimensional N}=(2,2)} sigma models called squashed toric sigma models, using their Gauged Linear Sigma Models (GLSM) description. These models are obtained by gauging the global {U(1)} symmetries of toric GLSMs and introducing a set of corresponding compensator superfields. The geometry of the resulting vacuum manifold is a deformation of the corresponding toric manifold in which the torus fibration maintains a constant size in the interior of the manifold, thus producing a neck-like region. We compute the elliptic genus of these models, using localization, in the case when the unsquashed vacuum manifolds obey the Calabi-Yau condition. The elliptic genera have a non-holomorphic dependence on the modular parameter {τ} coming from the continuum produced by the neck. In the simplest case corresponding to squashed {C / Z_{2 the elliptic genus is a mixed mock Jacobi form which coincides with the elliptic genus of the {N=(2,2)} {SL(2,R) / U(1)} cigar coset.

  19. STUDY OF INTRAOPERATIVE SQUASH CYTOLOGY OF INTRACRANIAL AND SPINAL CORD LESIONS WITH HISTOPATHOLOGICAL AND IHC STUDY

    Directory of Open Access Journals (Sweden)

    Naval Kishore Bajaj

    2016-07-01

    Full Text Available BACKGROUND The causes of discordant diagnoses achieved at squash cytology of intracranial and spinal cord tumours were ascertained. Lesions having the advantage of diagnostic accuracy by squash cytology of intracranial and spinal cord lesions was also determined. METHODS Squash preparations of 72 patients suspected to have neoplasia were made and stained with rapid haematoxylin and eosin stain and toluidine blue stain. The smears were classified according to the cytomorphological criteria and the squash cytodiagnoses were compared. RESULTS Total 72 cases were studied, 93.9% were neoplastic and 6.1% non-neoplastic on histopathology. Amongst neoplasms, Astrocytic tumours constituted 26.3% of cases followed by Meningiomas comprising 20.8%. Amongst the benign lesions, Tuberculoma was seen most frequently (6.95%. Overall diagnostic accuracy of squash was 98.65%. On statistical analysis, Sensitivity, Specificity, Positive Predictive value (PPV and Negative Predictive Value (NPV of squash cytology were 98.6%, 100%, 100% and 80% respectively. CONCLUSION Intraoperative Squash is reliable, accurate, cost effective diagnostic modality when combined with histopathological and immunohistochemical techniques.

  20. Squashed, magnetized black holes in D = 5 minimal gauged supergravity

    Science.gov (United States)

    Blázquez-Salcedo, Jose Luis; Kunz, Jutta; Navarro-Lérida, Francisco; Radu, Eugen

    2018-02-01

    We construct a new class of black hole solutions in five-dimensional Einstein-Maxwell-Chern-Simons theory with a negative cosmological constant. These configurations are cohomogeneity-1, with two equal-magnitude angular momenta. In the generic case, they possess a non-vanishing magnetic potential at infinity with a boundary metric which is the product of time and a squashed three-dimensional sphere. Both extremal and non-extremal black holes are studied. The non-extremal black holes satisfying a certain relation between electric charge, angular momenta and magnitude of the magnetic potential at infinity do not trivialize in the limit of vanishing event horizon size, becoming particle-like (non-topological) solitonic configurations. Among the extremal black holes, we show the existence of a new one-parameter family of supersymmetric solutions, which bifurcate from a critical Gutowski-Reall configuration.

  1. 78 FR 25620 - Importation of Female Squash Flowers From Israel Into the Continental United States

    Science.gov (United States)

    2013-05-02

    ... for dishes, desserts, and salads, and as an ingredient in other dishes. Marketing of commercially grown edible flowers is typically directed to upscale restaurants. Farms that solely produce squash...

  2. Squashed Entanglement, k-Extendibility, Quantum Markov Chains, and Recovery Maps

    Science.gov (United States)

    Li, Ke; Winter, Andreas

    2018-02-01

    Squashed entanglement (Christandl and Winter in J. Math. Phys. 45(3):829-840, 2004) is a monogamous entanglement measure, which implies that highly extendible states have small value of the squashed entanglement. Here, invoking a recent inequality for the quantum conditional mutual information (Fawzi and Renner in Commun. Math. Phys. 340(2):575-611, 2015) greatly extended and simplified in various work since, we show the converse, that a small value of squashed entanglement implies that the state is close to a highly extendible state. As a corollary, we establish an alternative proof of the faithfulness of squashed entanglement (Brandão et al. Commun. Math. Phys. 306:805-830, 2011). We briefly discuss the previous and subsequent history of the Fawzi-Renner bound and related conjectures, and close by advertising a potentially far-reaching generalization to universal and functorial recovery maps for the monotonicity of the relative entropy.

  3. The effect of squash training on shoulder girdle mobility and frequency of injury among player

    Directory of Open Access Journals (Sweden)

    Mikołaj Gajewski

    2017-05-01

    Full Text Available Introduction: Squash is a relatively new field in the Polish sports market. Its specification is based primarily on dynamic movements, often taking place at the end of its scope. This condition is an increased risk of injury as well as numerous compensations throughout the body. Aim: The aim of the study was to examine the impact of squash training on shoulder mobility of active athletes and to identify factors likely to increase trauma among players. Does squash game cause hypermobility in all dimension? Do long-term breaks in squash training increase the frequency of injuries? Does pre-training warm up affect trauma? Material and method: The study consists 110 active players: 19 women (17% and 91 men (83% age between 17 and 50 years. The research tool was an author’s questionnaire consisting of metrics and closed questions, which examined the problem and testing the mobility of the shoulder girdle using  an inclinometer and functional tests. Descriptive statistics were made. The greatest limitation of the range of motion in the shoulder joint is observed in the sagittal plane - flexion. No injury was associated with a prolonged break from training. Conclusion: Squash players did not have hypomobility in the shoulder joint and even had a limited range of motion. Long-term breaks in squash training do not increase the level of trauma.

  4. Reliability of the Danish version of the short questionnaire to assess health-enhancing physical activity (SQUASH)

    DEFF Research Database (Denmark)

    Sørensen, Lotte; Mikkelsen, Lone Ramer; Jacobsen, Julie Sandell

    2018-01-01

    Objective: To translate and cross-cultural adapt the short questionnaire to assess health-enhancing physical activity (SQUASH) to Danish, and to investigate the Danish version’s reliability. Methods: The study was conducted according to the COSMIN guidelines. The reliability was evaluated in 53...... and indicates that the Danish version of SQUASH can be used to distinguish between individuals; however, the absolute reliability was poor and SQUASH is not considered suitable for easuring physical activity on an individual level....

  5. Heavy metals in summer squash fruits grown in soil amended with municipal sewage sludge.

    Science.gov (United States)

    Antonious, George F; Snyder, John C; Dennis, Sam O

    2010-02-01

    The increasing awareness of the value of vegetables and fruits in the human diet requires monitoring of heavy metals in food crops. The effects of amending soil with compost made from municipal sewage sludge (MSS) and MSS mixed with yard waste (MSS-YW) on Cd, Cr, Mo, Cu, Zn, Pb, and Ni concentrations in soil and the potential bioaccumulation of heavy metals in squash fruits at harvest were investigated. A field study was conducted in a silty-loam soil at Kentucky State University Research Farm. Eighteen plots of 22 x 3.7 m each were separated using metal borders and the soil in six plots was mixed with MSS at 15 t acre(-1), six plots were mixed with MSS-YW at 15 t acre(-1) (on dry weight basis), and six unamended plots (no-mulch) were used for comparison purposes. Plots were planted with summer squash and heavy metals were analyzed in soil and mature fruits at harvest. Analysis of heavy metals in squash fruits was conducted using inductively coupled plasma spectrometry. Zinc and Cu concentrations in soil mixed with MSS were extremely high compared to other metals. In squash fruits, concentrations of Zn were generally greater than Cu. Total squash marketable yield was greatest in MSS-YW and MSS treatments compared to no-mulch conventional soil. Concentrations of Cd and Pb in soil amended with MSS averaged 0.1 and 1.4 mg kg(-1), respectively. These levels were much lower than the limits in the U.S. guidelines for using MSS in land farming. Data revealed that maximum concentrations of Cd and Pb in squash fruits were 0.03 and 0.01 microg g(-1) dry fruit, respectively. Nickel concentration in squash fruits fluctuated among harvest dates reaching a maximum of 2.5 microg g(-1) dry fruit. However, these concentrations were far below their permissible limits in edible fruits.

  6. Grafting of watermelon (Citrullus lanatus cv. Mahbubi) onto different squash rootstocks as a means to minimize cadmium toxicity.

    Science.gov (United States)

    Shirani Bidabadi, Siamak; Abolghasemi, Reza; Zheng, Si-Jun

    2018-06-07

    To test the possibility that using appropriate rootstocks could improve the tolerance of watermelon to cadmium (Cd) toxicity, a greenhouse experiment was conducted to determine growth and antioxidant activities of watermelons, either nongrafted or grafted onto summer squash and winter squash. We provided nutrient solutions having four levels (0, 50, 100, and 200 μM) of cadmium to treat the plants. Shoot and root biomass reduction were significantly lower in summer squash rootstock-grafted watermelon than winter squash rootstock-grafted and nongrafted watermelons. Cadmium induced a smaller decrease in leaf area index in grafted watermelons compared with nongrafted plants. The Cd- related reductions in chlorophyll content and efficiency of photosynthesis were more severe in nongrafted watermelons compared with dose grafted onto summer squash. Cd accumulation in shoot at the highest dose (200 µM) of CdCl 2 was significantly lower (19.76 mg/kg) in summer squash rootstock-grafted watermelon compared with winter squash rootstock-grafted (37.58 mg/kg) and nongrafted watermelon (72.12 mg/kg). H 2 O 2 , MDA production and electrolyte leakage of summer squash rootstock-grafted watermelon showed less increase, which was associated with a significant increase in the activities of antioxidant. The improved crop performance of grafted watermelons was attributed to their strong capacity to inhibit Cd accumulation in the aerial parts.

  7. Comparison of perimeter trap crop varieties: effects on herbivory, pollination, and yield in butternut squash.

    Science.gov (United States)

    Adler, L S; Hazzard, R V

    2009-02-01

    Perimeter trap cropping (PTC) is a method of integrated pest management (IPM) in which the main crop is surrounded with a perimeter trap crop that is more attractive to pests. Blue Hubbard (Cucurbita maxima Duch.) is a highly effective trap crop for butternut squash (C. moschata Duch. ex Poir) attacked by striped cucumber beetles (Acalymma vittatum Fabricius), but its limited marketability may reduce adoption of PTC by growers. Research comparing border crop varieties is necessary to provide options for growers. Furthermore, pollinators are critical for cucurbit yield, and the effect of PTC on pollination to main crops is unknown. We examined the effect of five border treatments on herbivory, pollination, and yield in butternut squash and manipulated herbivory and pollination to compare their importance for main crop yield. Blue Hubbard, buttercup squash (C. maxima Duch.), and zucchini (C. pepo L.) were equally attractive to cucumber beetles. Border treatments did not affect butternut leaf damage, but butternut flowers had the fewest beetles when surrounded by Blue Hubbard or buttercup squash. Yield was highest in the Blue Hubbard and buttercup treatments, but this effect was not statistically significant. Native bees accounted for 87% of pollinator visits, and pollination did not limit yield. There was no evidence that border crops competed with the main crop for pollinators. Our results suggest that both buttercup squash and zucchini may be viable alternatives to Blue Hubbard as borders for the main crop of butternut squash. Thus, growers may have multiple border options that reduce pesticide use, effectively manage pests, and do not disturb mutualist interactions with pollinators.

  8. Effect of Fusarium isolates and their filtrates on respiratory rate and chemical analysis of squash plants.

    Science.gov (United States)

    El-Shenawy, Z; Mansour, M A; El-Behrawi, S

    1978-01-01

    The highly pathogenic isolate stimulated the emergence of the squash seedlings first, caused, however, the highest death rate of the seedlings finally. Fusarium isolates and their culture filtrates inhibited the respiratory rate of squash plants significantly. However, F. oxysporum isolates inhibited respiration more than F. solani isolates. Seasonal changes of respiration decline show that the respiratory rate decreased with plant growth in the case of infested soil and of plants injected with culture filtrates. However, spraying Fusarium culture filtrates on the foliage gave opposite results when the plants grew older. Fusarium solani isolates decreased nitrogen content of squash stems and leaves, while F. oxysporum isolates gave reverse results. Injecting Fusarium culture filtrate into the plant decreased nitrogen content of both stems and leaves, while spraying the foliage with the filtrates increased nitrogen content more than that of the control. Phosphorus content of the stems of squash plants, sown in infested soil, was less than in the control when the plants were treated with F. solani and higher when they were treated with F. oxysporum isolates. On the other hand, the phosphorus content of squash leaves was higher than in the control. In the case of injected plants, however, the phosphorus content in stems and leaves was equal to that of the control or less, and with sprayed plants it was higher than in the control. Infesting the soil with Fusarium isolates and spraying the foliage with their culture filtrates increased potassium content of squash stems and leaves, while injecting the filtrates into the plants decreased potassium content of both stems and leaves.

  9. Health hazards and heavy metals accumulation by summer squash (Cucurbita pepo L.) cultivated in contaminated soils.

    Science.gov (United States)

    Galal, Tarek M

    2016-07-01

    The present study was carried out to investigate the heavy metal concentration accumulated by summer squash cultivated in contaminated soil and their health hazards for public consumers at south Cairo Province, Egypt. Soil and plants were sampled from contaminated and reference farms, using 1 m(2) quadrats, for biomass estimation and nutrient analysis. The daily intake of metals (DIM) and health risk index (HRI) were estimated. Significant differences in soil variables (except As) between contaminated and reference sites were recognized. Summer squash showed remarkable reduction in fresh and dry biomass, fruit production, and photosynthetic pigments under pollution stress. The inorganic and organic nutrients in the aboveground and belowground parts showed significant reduction in contaminated site. In addition, higher concentrations of heavy metals were accumulated in the edible parts and roots more than shoots. The bioaccumulation factor of summer squash for investigated metals was greater than 1, while the translocation factor did not exceed unity in both contaminated and reference sites. The DIM for all investigated metals in the reference site and in the contaminated site (except Fe and Mn) did not exceed 1 in both adults and children. However, HRI of Ni and Mn in the reference site and Pb, Cd, Cu, Ni, Fe, Mn, and Zn in the contaminated one exceeded unity indicating great potential to pose health risk to the consumers. The author recommends that people living in the contaminated area should not eat large quantities of summer squash, so as to avoid excess accumulation of heavy metals in their bodies.

  10. Using trap crops for control of Acalymma vittatum (Coleoptera: Chrysomelidae) reduces insecticide use in butternut squash.

    Science.gov (United States)

    Cavanagh, A; Hazzard, R; Adler, L S; Boucher, J

    2009-06-01

    Striped cucumber beetle, Acalymma vittatum F., is the primary insect pest of cucurbit crops in the northeastern United States. Adult beetles colonize squash crops from field borders, causing feeding damage at the seedling stage and transmitting bacterial wilt Erwinia tracheiphila Hauben et al. 1999. Conventional control methods rely on insecticide applications to the entire field, but surrounding main crops with a more attractive perimeter could reduce reliance on insecticides. A. cittatum shows a marked preference for Blue Hubbard squash (Cucurbita maxima Duchesne) over butternut squash (C. moschata Poir). Given this preference, Blue Hubbard squash has the potential to be an effective perimeter trap crop. We evaluated this system in commercial butternut fields in 2003 and 2004, comparing fields using perimeter trap cropping with Blue Hubbard to conventionally managed fields. In 2003, we used a foliar insecticide to control beetles in the trap crop borders, and in 2004, we compared systemic and foliar insecticide treatments for the trap crop borders. We found that using a trap crop system reduced or eliminated the need to spray the main crop area, reducing insecticide use by up to 94% compared with conventional control methods, with no increase in herbivory or beetle numbers. We surveyed the growers who participated in these experiments and found a high level of satisfaction with the effectiveness and simplicity of the system. These results suggest that this method of pest control is both effective and simple enough in its implementation to have high potential for adoption among growers.

  11. First report of Squash vein yellowing virus in watermelon in Guatemala

    Science.gov (United States)

    In this study, we report the first detection of Squash vein yellowing virus (SqVYV)-induced watermelon vine decline in Central America. Symptoms including wilt and collapse of plants at harvest, and non-marketable fruits with internal rind necrosis were observed. This report provides an overview o...

  12. Potential organic herbicides for squash production: Pelargonic acid herbicides AXXE (registered trademark) and Scythe (registered trademark)

    Science.gov (United States)

    Organic squash (Cucurbita pepo L.) producers need appropriate herbicides that can effectively provide season- long weed control. Research was conducted in southeast Oklahoma (Atoka County, Lane, OK) to determine the impact of potential organic herbicides on weed control efficacy, crop injury, and y...

  13. Fruit quality of seedless watermelon grafted onto squash rootstocks under different production systems.

    Science.gov (United States)

    Liu, Qianru; Zhao, Xin; Brecht, Jeffrey K; Sims, Charles A; Sanchez, Tatiana; Dufault, Nicholas S

    2017-11-01

    The market demand for seedless watermelon has been continuously increasing because of consumer preference. Grafting is a useful tool to manage soilborne diseases in watermelon production, but the use of squash rootstocks may negatively affect watermelon fruit quality. Currently, most research has focused on seeded cultivars, while grafting effects on seedless watermelons remain largely unknown. This multi-season study was conducted to assess the effects of squash rootstocks, including both Cucurbita maxima × C. moschata and C. moschata cultivars, with intact or excised and regenerated roots, on fruit quality of seedless watermelon 'Melody' using both instrumental and sensory measurements under different production scenarios. The grafted watermelon plants were also challenged by field inoculation with Fusarium oxysporum f.sp. niveum. A combination of instrumental measurements and consumer sensory analyses suggested that fruit quality of the seedless watermelon 'Melody' was not impacted by the use of the squash rootstocks used in this study, which included soluble solids content, titratable acidity, pH and most fruit sensory properties. Watermelon flesh firmness was increased by grafting but the grafting effect on lycopene content was inconclusive. Root excision and regeneration did not influence the grafting effect, whereas the grafting effect on flesh firmness varied among the rootstocks under Fusarium inoculation. Overall, grafting with squash rootstocks did not reduce fruit quality attributes of 'Melody' but improved texture. Our results support incorporating grafting into integrated management programs for seedless watermelon production. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  14. Tennis-Badminton-Squash Guide with Official Rules. June 1972 - June 1974.

    Science.gov (United States)

    Knight, Martha, Ed.; And Others

    Rules in tennis, badminton, and squash for girls and women from June 1972 - June 1974 are discussed. Standards in the sports are detailed along with the Division for Girls and Women's Sports (DGWS) statement of beliefs. Specific articles dealing with teaching techniques, officiating techniques, and rules for tennis and badminton are presented.…

  15. Crop domestication facilitated rapid geographic expansion of a specialist pollinator, the squash bee Peponapis pruinosa

    Science.gov (United States)

    Over the past 10,000 years, humans have facilitated rapid range expansions of animal, plants and microorganisms, often accompanying agriculture’s spread. Three squash species were early domesticates in the New World. Their spreading cultivation out of the Southwest across much of today’s USA has bee...

  16. Comparação de métodos para a produção de frutos autofecundados em pimenteiras ornamentais Testing methods for producing self-pollinated fruits in ornamental peppers

    Directory of Open Access Journals (Sweden)

    Elizanilda R do Rêgo

    2012-12-01

    peppers, including those of ornamental relevance. The use of protected cultivation is raising the demand for high-yielding hybrids, with higher commercial value, so as to turn this production system into a profitable investment. Hybrid seeds are obtained by crossing endogamic lines, which, in their turn, result from successive self-pollinations. The objective of this study was to compare two methods of protecting selfed flower buds from contamination with exogenous pollen in ornamental peppers. The experiment was carried out in a greenhouse, on a laboratory of the Universidade Federal da Paraíba. We took plants of 15 hybrids and their reciprocals to test two methods to protect selfed flower buds: 1= bud covering with aluminum foil; and 2= bud sealing with white glue. We carried out ten self-pollinations per hybrid, in pre-anthesis, for each method. We evaluated the average fruit set rate per method within each hybrid. The general fruit setting average in method 1 (16% was lower than in method 2 (51%; with not a single hybrid in which fruit set rate of method 1 has exceeded that of method 2. A few hybrids showed up to 90% fruit set after self-pollination when flower buds were sealed with white glue (method 2, in contrast to a maximum of 40% fruit set when using method 1. The direction of the cross, direct or reciprocal, also affected fruit set rate, causing either reduction or increase, but with no effects of the selfed bud protecting method. Considering our results, we indicate the use of white glue to seal selfed flower buds to secure the success of controlled selfing in pepper.

  17. A deformation of quantum affine algebra in squashed Wess-Zumino-Novikov-Witten models

    Energy Technology Data Exchange (ETDEWEB)

    Kawaguchi, Io; Yoshida, Kentaroh [Department of Physics, Kyoto University, Kyoto 606-8502 (Japan)

    2014-06-01

    We proceed to study infinite-dimensional symmetries in two-dimensional squashed Wess-Zumino-Novikov-Witten models at the classical level. The target space is given by squashed S³ and the isometry is SU(2){sub L}×U(1){sub R}. It is known that SU(2){sub L} is enhanced to a couple of Yangians. We reveal here that an infinite-dimensional extension of U(1){sub R} is a deformation of quantum affine algebra, where a new deformation parameter is provided with the coefficient of the Wess-Zumino term. Then we consider the relation between the deformed quantum affine algebra and the pair of Yangians from the viewpoint of the left-right duality of monodromy matrices. The integrable structure is also discussed by computing the r/s-matrices that satisfy the extended classical Yang-Baxter equation. Finally, two degenerate limits are discussed.

  18. Abbott-Deser-Tekin Charge of Dilaton Black Holes with Squashed Horizons

    Institute of Scientific and Technical Information of China (English)

    Jun-Jin Peng; Wen-Chang Xiang; Shao-Hong Cai

    2016-01-01

    We consider the conserved charge of static black holes with squashed horizons in the Einstein-Maxwell-dilaton theory via both the Abbott-Deser-Tekin (ADT) method and its off-shell generalization.We first make use of the original ADT method to compute the mass of the dilaton squashed black holes in terms of three different reference spacetimes,which are the asymptotic geometry,the fiat background and the spacetime of the KaluzaKlein monopole with boundary matched to the original metric,respectively.Each mass satisfies the first law of black hole thermodynamics,although the mass computed on the basis of the boundary matching the KaluzaKlein monopole is different from that of the other two reference spacetimes.Then the mass of the black holes is evaluated through the off-shell generalized ADT method.

  19. Climatic Suitability of Growing Summer Squash (Cucurbita pepo L. as a Medicinal Plant in Iran

    Directory of Open Access Journals (Sweden)

    Mohammad BANNAYAN

    2011-05-01

    Full Text Available Diversification of production by including a broader range of plant species, can significantly contribute to improve health and nutrition, livelihoods, household food security and ecological sustainability. Exploring the climate impact on any given crop is one of the first priorities to find new suitable areas for production and management of new crops. Summer squash (Cucurbita pepo L. is an economically valuable plant with various medicinal potentials. In order to investigate summer squash cultivation feasibility under Irans climate, three main agricultural regions (Azerbaijan, Khorasan and central part of Iran (Fars and Isfahan were selected. These regions suitability for summer squash cultivation were evaluated by considering three vital climate variables encompass temperature, precipitation, and sunshine hours. These regions show distinct and representative climatic conditions of Iran. Annual and growing season average of maximum, minimum, mean temperature, precipitation, and sunshine hours were calculated (May-September for all locations with 44 years historical weather data (1961-2005 for 8 locations (Oroomieh, Tabriz, Khoy, Mashhad, Sabzevar, Birjand, Shiraz and Isfahan, 39 years (1966-2005 for 2 locations (Kashan and Fassa, 28 years (1977-2005 for 4 locations (Ardebil, Abadeh, Bojnurd and Shargh Isfahan and 20 years (1985-2005 for 9 locations (Mahabad, Sarab, Maragheh, Parsabad, Khalkhal, Ferdous, Ghaen, Kashmar and Sarakhs. Climatic demands of summer squash were determined by four years field studies at four different locations in Iran. Our results showed Azerbaijan region has a suitable condition for this crop cultivation especially from precipitation and temperature perspectives. Central part of Iran and Khorasan were also found as partly suitable locations however as they are near to deserts with hotter and drier climate, there might be some other crops considered as priorities in these areas.

  20. Climatic Suitability of Growing Summer Squash (Cucurbita pepo L. as a Medicinal Plant in Iran

    Directory of Open Access Journals (Sweden)

    Mohammad BANNAYAN

    2011-05-01

    Full Text Available Diversification of production by including a broader range of plant species, can significantly contribute to improve health and nutrition, livelihoods, household food security and ecological sustainability. Exploring the climate impact on any given crop is one of the first priorities to find new suitable areas for production and management of new crops. Summer squash (Cucurbita pepo L. is an economically valuable plant with various medicinal potentials. In order to investigate summer squash cultivation feasibility under Iran�s climate, three main agricultural regions (Azerbaijan, Khorasan and central part of Iran (Fars and Isfahan were selected. These regions suitability for summer squash cultivation were evaluated by considering three vital climate variables encompass temperature, precipitation, and sunshine hours. These regions show distinct and representative climatic conditions of Iran. Annual and growing season average of maximum, minimum, mean temperature, precipitation, and sunshine hours were calculated (May-September for all locations with 44 years historical weather data (1961-2005 for 8 locations (Oroomieh, Tabriz, Khoy, Mashhad, Sabzevar, Birjand, Shiraz and Isfahan, 39 years (1966-2005 for 2 locations (Kashan and Fassa, 28 years (1977-2005 for 4 locations (Ardebil, Abadeh, Bojnurd and Shargh Isfahan and 20 years (1985-2005 for 9 locations (Mahabad, Sarab, Maragheh, Parsabad, Khalkhal, Ferdous, Ghaen, Kashmar and Sarakhs. Climatic demands of summer squash were determined by four years field studies at four different locations in Iran. Our results showed Azerbaijan region has a suitable condition for this crop cultivation especially from precipitation and temperature perspectives. Central part of Iran and Khorasan were also found as partly suitable locations however as they are near to deserts with hotter and drier climate, there might be some other crops considered as priorities in these areas.

  1. Studies on carotenoids and oxidative stability of winter squash seed and soybean oils

    Directory of Open Access Journals (Sweden)

    Helmy, H. E.

    1992-12-01

    Full Text Available Winter squash seed and soybean oils were extracted with commercial hexane. Carotenoids and other pigments m the oils were studied using spectrophotometric and thin layer chromatographic analysis. Three types of pigments were identified: carotenoids. mainly lutein and β-carotene, chlorophyll and some unidentified pigments. Carotenoids content were 70, 60, 0 ppm in crude, refined and bleached winter squash seed oil, and 80, 65, 0 ppm in crude, refined and bleached soybean oil respectively. Stability was evaluated for crude, refined and bleached winter squash seed and soybean oils and an 1:1 admixture. Mixing winter squash seed oil with soybean oil increased the stability of soybean oil. Crude oil showed greater stability than refined and bleached oils.

    Se han extraído con hexano comercial aceites de semilla de calabaza y de soja. Usando análisis espectrofotométrico y cromatografía en capa fina se han estudiado en estos aceites tres tipos de pigmentos: carotenoides, principalmente luteína y β-caroteno, clorofilas y otros no identificados. Los contenidos en carotenoides fueron 70, 60, 0 ppm en aceite de semilla de calabaza de invierno crudo, refinado y decolorado, y 80, 65, 0 ppm en aceite de soja crudo, refinado y decolorado respectivamente. Se ha evaluado la estabilidad de aceites de semilla de calabaza de invierno, soja y una mezcla 1:1 de ambos, en sus estados crudo, refinado y decolorado. La mezcla de semilla de calabaza de invierno con aceite de soja aumentó la estabilidad de este último. El aceite crudo mostró una mayor estabilidad que los aceites refinados y decolorados.

  2. Validation of the SQUASH Physical Activity Questionnaire in a Multi-Ethnic Population: The HELIUS Study.

    Directory of Open Access Journals (Sweden)

    M Nicolaou

    Full Text Available To investigate the reliability and validity of the SQUASH physical activity (PA questionnaire in a multi-ethnic population living in the Netherlands.We included participants from the HELIUS study, a population-based cohort study. In this study we included Dutch (n = 114, Turkish (n = 88, Moroccan (n = 74, South-Asian Surinamese (n = 98 and African Surinamese (n = 91 adults, aged 18-70 years. The SQUASH was self-administered twice to assess test-re-test reliability (mean interval 6-7 weeks and participants wore an accelerometer and heart rate monitor (Actiheart to enable assessment of construct validity.We observed low test-re-test reliability; Intra class correlation coefficients ranged from low (0.05 for moderate/high intensity PA in African Surinamese women to acceptable (0.78 for light intensity PA in Moroccan women. The discrepancy between self-reported and measured PA differed on the basis of the intensity of activity: self-reported light intensity PA was lower than measured but self-reported moderate/high intensity PA was higher than measured, with wide limits of agreement. The discrepancy between questionnaire and Actiheart measures of moderate intensity PA did not differ between ethnic minority and Dutch participants with correction for relevant confounders. Additionally, the SQUASH overestimated the number of participants meeting the Dutch PA norm; Cohen's kappas for the agreement were poor, the highest being 0.30 in Dutch women.We found considerable variation in the test-re-test reliability and validity of self-reported PA with no consistency based on ethnic origin. Our findings imply that the SQUASH does not provide a valid basis for comparison of PA between ethnic groups.

  3. Intraoperative squash smear cytology in CNS lesions: A study of 150 pediatric cases

    Directory of Open Access Journals (Sweden)

    Arpita Jindal

    2017-01-01

    Full Text Available Background: Tumors of the central nervous system in the pediatric age group occur relatively frequently during the early years of life. Brain tumors are the most common solid malignancies of childhood and only second to acute childhood leukemia. Squash cytology is an indispensable diagnostic aid to central nervous system (CNS lesions. The definitive diagnosis of brain lesions is confirmed by histological examination. Aim: To study the cytology of CNS lesions in pediatric population and correlate it with histopathology. Materials and Methods: One hundred and fifty cases of CNS lesions in pediatric patients were studied over a period of 2 years. Intraoperative squash smears were prepared, stained with hematoxylin and eosin, and examined. Remaining sample was subjected to histopathological examination. Results: Medulloblastoma (24.0% was the most frequently encountered tumor followed by pilocyctic astrocytoma (21.33% and ependymoma (13.33%. Diagnostic accuracy of squash smear technique was 94.67% when compared with histological diagnosis. Conclusion: Smear cytology is a fairly accurate tool for intraoperative CNS consultations.

  4. Carotenoid composition and vitamin A value of a squash and a pumpkin from northeastern Brazil.

    Science.gov (United States)

    Arima, H K; Rodríguez-Amaya, D B

    1990-06-01

    The carotenoid composition of a squash and a pumpkin from Northeastern Brazil was determined. Nineteen carotenoids were detected in Cucurbita moschata variety "Baianinha"; beta-carotene was the principal carotenoid, contributing about 74% of an average total carotenoid content of 317.8 micrograms/g. In C. maxima variety "Jerimum Caboclo", 11 carotenoids were found with lutein, and beta-carotene as the major pigments accounting for about 60% and 27%, respectively, of an average total carotenoid content of 78.4 micrograms/g. The abundance of beta-carotene in the C. moschata variety "Baianinha" makes this squash one of the richest sources of provitamin A. The average vitamin A value was 43,175 IU (International Units) per 100 g or 4,317 RE (retinol equivalents) per 100 g. Its vitamin A values is more than 11 times that of C. maxima variety "Jerimum Caboclo" and five times that of C. moschata cultivar "Menina Verde", the squash found previously to be highest in provitamin A among the Cucurbita vegetables most commercialized in São Paulo (Southeastern Brazil).

  5. Improved postharvest quality in patagonian squash (Cucurbita moschata) coated with radiation depolymerized chitosan

    Energy Technology Data Exchange (ETDEWEB)

    Pugliese, Maria Alicia; Goitia, Maria Teresa [Laboratorio de Investigaciones Basicas Aplicadas en Quitina, Departamento de Quimica, Universidad Nacional del Sur. Avenida Alem 1253, B8000CPB Bahia Blanca (Argentina); Yossen, Mariana [Instituto de Desarrollo Tecnologico para la Industria Quimica (INTEC), CONICET-Universidad Nacional del Litoral, Ruta Nacional 168-Paraje ' El Pozo' , 3000 Santa Fe (Argentina); Cifone, Norma; Agullo, Enrique [Laboratorio de Investigaciones Basicas Aplicadas en Quitina, Departamento de Quimica, Universidad Nacional del Sur. Avenida Alem 1253, B8000CPB Bahia Blanca (Argentina); Andreucetti, Noemi, E-mail: andreuce@criba.edu.ar [Laboratorio de Radioisotopos, Departamento de Quimica, Universidad Nacional del Sur, Avenida Alem 1253, B8000CPB Bahia Blanca (Argentina)

    2011-12-15

    Different molecular weight chitosans were evaluated on the decay of coated Anquito squashes (Cucurbita moschata) as well as the maintenance of the fruit quality along five storage months. The original chitosan (Mw=391 kDa, 83% DD), was depolymerized by gamma radiation. Apart from chain scission, other chemical changes were not detected by FTIR or UV-vis analyses. The molecular weight characterization of chitosans was done by size exclusion chromatography with dual light scattering and concentration detection (SEC-MALLS-RI). The coating effectiveness was evaluated on the following parameters: fungal decay incidence, weight loss, firmness, total reducing sugar, soluble solid, flesh color, carotene content, pH and titratable acidity. No sign of fungal decay was observed in squashes coated with 122 and 56 kDa chitosans, which were also the most effective treatments in reducing the weight loss. The chitosan with Mw=122 kDa was also the best treatment considering firmness, internal aspect, sugar and carotene content. Then, radiation degraded chitosan was better in C. moschata preservation than the original chitosan. - Highlights: > Original Chitosan was radiation depolymerized producing chitosans with lower molecular weights. > Gamma-irradiated chitosans only exhibit chain scission. > SEC-MALLS-RI chromatography is a useful tool in molecular weight analysis. > Depolymerized chitosans were the best in maintaining the quality and the storage life of coated squashes.

  6. Management of Powdery Mildew in Squash by Plant and Alga Extract Biopesticides.

    Science.gov (United States)

    Zhang, Shouan; Mersha, Zelalem; Vallad, Gary E; Huang, Cheng-Hua

    2016-12-01

    Although many fungicides are registered for use to control powdery mildew on cucurbits, management of resistance to fungicides in pathogen populations still remains a major challenge. Two biopesticides Regalia SC and HMO 736 were evaluated in the greenhouse and field for their efficacy against powdery mildew in squash. In greenhouses, Regalia SC alone significantly ( P powdery mildew compared to the nontreated control, and was as effective as the chemical standard Procure 480SC (triflumizole). In alternation with Procure 480SC, Regalia SC demonstrated greater or equivalent effects on reducing the disease. HMO 736 alone showed varying levels of disease control, but alternating with Procure 480SC significantly improved control efficacy. In addition, application of Regalia SC or HMO 736 each in alternation with Procure 480SC significantly increased the chlorophyll content in leaves and the total fresh weight of squash plants, when compared with the water control, Regalia SC and HMO 736 alone. In field trials, application of Regalia SC and HMO 736 each alone significantly reduced disease severity in one of two field trials during the early stage of disease development, but not during later stages when disease pressure became high. Both Regalia SC and HMO 736 each applied in alternation with Procure 480SC significantly improved the control efficacy compared to Procure 480SC alone. Results from this study demonstrated that an integrated management program can be developed for powdery mildew in squash by integrating the biopesticides Regalia SC, HMO 736 with the chemical fungicide Procure 480SC.

  7. Improved postharvest quality in patagonian squash (Cucurbita moschata) coated with radiation depolymerized chitosan

    International Nuclear Information System (INIS)

    Pugliese, Maria Alicia; Goitia, Maria Teresa; Yossen, Mariana; Cifone, Norma; Agullo, Enrique; Andreucetti, Noemi

    2011-01-01

    Different molecular weight chitosans were evaluated on the decay of coated Anquito squashes (Cucurbita moschata) as well as the maintenance of the fruit quality along five storage months. The original chitosan (Mw=391 kDa, 83% DD), was depolymerized by gamma radiation. Apart from chain scission, other chemical changes were not detected by FTIR or UV-vis analyses. The molecular weight characterization of chitosans was done by size exclusion chromatography with dual light scattering and concentration detection (SEC-MALLS-RI). The coating effectiveness was evaluated on the following parameters: fungal decay incidence, weight loss, firmness, total reducing sugar, soluble solid, flesh color, carotene content, pH and titratable acidity. No sign of fungal decay was observed in squashes coated with 122 and 56 kDa chitosans, which were also the most effective treatments in reducing the weight loss. The chitosan with Mw=122 kDa was also the best treatment considering firmness, internal aspect, sugar and carotene content. Then, radiation degraded chitosan was better in C. moschata preservation than the original chitosan. - Highlights: → Original Chitosan was radiation depolymerized producing chitosans with lower molecular weights. → Gamma-irradiated chitosans only exhibit chain scission. → SEC-MALLS-RI chromatography is a useful tool in molecular weight analysis. → Depolymerized chitosans were the best in maintaining the quality and the storage life of coated squashes.

  8. SENSITIVITY AND SPECIFICITY OF MONOCLONAL ANTIBODY DSSE10 IN HEAD SQUASH TOXORHYNCHITES SPLENDENS USING IMMUNOHISTOCHEMICAL PEROXIDASE TECHNIQUE

    Directory of Open Access Journals (Sweden)

    Tika Fiona Sari

    2014-06-01

    Full Text Available Dengue virus are transmitted from human to human by the bites of infective female Aedesmosquitoes from subgenus Stegomyia. One of the way to detect Dengue virus antigen is by usingimmunohistochemical technique. This method was reported to detect dengue vims antigen in lowlevels. The aims of this study is to measure sensitivity and specificity of monoclonal antibodyDSSE10 using SBPC to detect antigen Dengue virus in head squash Toxorhynchites splendenswere infected with dengue patient serum and RT-PCR as gold standart. Artificially-infected Tx.splendens mosquitoes with serum positif dengue virus were used as infectious samples and noninfectedTx. splendens mosquitoes were used as control negative. The immunohistochemichalSBPC assay using monoclonal antibody DSSE10 then applied in mosquitoes head squash todetect Dengue vims antigen. RT-PCR as a gold standart was applied in each mosquito thorax.The result were analyzed by descriptive stasistic test and 2x2 diagnostic test table. Monoclonalantibody DSSE10 using immunohistochemical SBPC assay in head squash Tx. splendens wasgave sensitivity 87,09% and specificity 92,5%. Conclussion of this study is DSSE10 Monoclonalantibodies can be used as primary antibodies for the detection of dengue vims antigen inmosquito head squashKeywords: Dengue viruses, SBPC, antibodies DSSE10, head squash, Toxorhynchitessplendens' Virus Dengue ditularkan dari orang ke orang melalui gigitan nyamuk Aedes dari subgenusStegomyia. Salah satu cara untuk mendeteksi antigen vims Dengue adalah dengan menggunakanteknik imunohistokimia. Metode imunohistokimia dilaporkan dapat mendeteksi antigen vimsDengue dalam kadar yang rendah. Tujuan penelitian ini adalah melakukan evaluasi sensitivitasdan spesifitas antibodi monoklonal DSSE10 dengan metode imunohistokimia Streptavidin BiotinPeroxidase Complex (SBPC untuk mendeteksi antigen Dengue melalui scdiaan head squashnyamuk Toxorhynchites splendens yang diinfeksi dengan scrum penderita

  9. Effects of butternut squash extract on dentate gyrus cell proliferation and spatial learning in male adult rats

    Institute of Scientific and Technical Information of China (English)

    Mohsen Marzban; Sara Soleimani Asl; Hassan Fallah Huseini; Mahdi Tondar; Samira Choopani; Mehdi Mehdizadeh

    2011-01-01

    Previous studies reported that some plants, including butternut squash, exert positive effects on the brain. However, few studies have examined the effects of butternut squash on learning, memory, and neurogenesis. This study studied the effects of butternut squash extract on spatial learning and cell proliferation in the dentate gyrus of healthy male rats. Thirty-five male Wistar rats were intrap-eritoneally injected with 0, 50, 100, 200 and 400 mg/kg butternut squash extract once daily for 2 months. After the last administration, rat's spatial memory was studied using the Morris water maze. Finally, rats were sacrificed and hippocampal sections were prepared for light microscopy and bromodeoxyuridine immunohistochemistry studies. The results revealed that escape latency and swim distance decreased in all treatment groups compared with the control rats, and that the number of bromodeoxyuridine-positive cells in the dentate gyrus was significantly increased in the treatment groups compared with the controls. These findings suggest that butternut squash extract improves the learning and memory abilities of male rats, and increases the proliferation of dentate gyrus cells.

  10. Transcriptome profile analysis of young floral buds of fertile and sterile plants from the self-pollinated offspring of the hybrid between novel restorer line NR1 and Nsa CMS line in Brassica napus

    Directory of Open Access Journals (Sweden)

    Yan Xiaohong

    2013-01-01

    Full Text Available Abstract Background The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. Results In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste and 253,507 (Fer distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs. In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE data. Conclusions A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in

  11. Transcriptome profile analysis of young floral buds of fertile and sterile plants from the self-pollinated offspring of the hybrid between novel restorer line NR1 and Nsa CMS line in Brassica napus.

    Science.gov (United States)

    Yan, Xiaohong; Dong, Caihua; Yu, Jingyin; Liu, Wanghui; Jiang, Chenghong; Liu, Jia; Hu, Qiong; Fang, Xiaoping; Wei, Wenhui

    2013-01-16

    The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste) and 253,507 (Fer) distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs). In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE) data. A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in Nsa line, fertility restoration and improved agronomic

  12. On the Magnetic Squashing Factor and the Lie Transport of Tangents

    Energy Technology Data Exchange (ETDEWEB)

    Scott, Roger B.; Pontin, David I.; Hornig, Gunnar [University of Dundee Nethergate, Dundee (United Kingdom)

    2017-10-20

    The squashing factor (or squashing degree) of a vector field is a quantitative measure of the deformation of the field line mapping between two surfaces. In the context of solar magnetic fields, it is often used to identify gradients in the mapping of elementary magnetic flux tubes between various flux domains. Regions where these gradients in the mapping are large are referred to as quasi-separatrix layers (QSLs), and are a continuous extension of separators and separatrix surfaces. These QSLs are observed to be potential sites for the formation of strong electric currents, and are therefore important for the study of magnetic reconnection in three dimensions. Since the squashing factor, Q , is defined in terms of the Jacobian of the field line mapping, it is most often calculated by first determining the mapping between two surfaces (or some approximation of it) and then numerically differentiating. Tassev and Savcheva have introduced an alternative method, in which they parameterize the change in separation between adjacent field lines, and then integrate along individual field lines to get an estimate of the Jacobian without the need to numerically differentiate the mapping itself. But while their method offers certain computational advantages, it is formulated on a perturbative description of the field line trajectory, and the accuracy of this method is not entirely clear. Here we show, through an alternative derivation, that this integral formulation is, in principle, exact. We then demonstrate the result in the case of a linear, 3D magnetic null, which allows for an exact analytical description and direct comparison to numerical estimates.

  13. Management of Powdery Mildew in Squash by Plant and Alga Extract Biopesticides

    Directory of Open Access Journals (Sweden)

    Shouan Zhang

    2016-12-01

    Full Text Available Although many fungicides are registered for use to control powdery mildew on cucurbits, management of resistance to fungicides in pathogen populations still remains a major challenge. Two biopesticides Regalia SC and HMO 736 were evaluated in the greenhouse and field for their efficacy against powdery mildew in squash. In greenhouses, Regalia SC alone significantly (P < 0.05 reduced powdery mildew compared to the nontreated control, and was as effective as the chemical standard Procure 480SC (triflumizole. In alternation with Procure 480SC, Regalia SC demonstrated greater or equivalent effects on reducing the disease. HMO 736 alone showed varying levels of disease control, but alternating with Procure 480SC significantly improved control efficacy. In addition, application of Regalia SC or HMO 736 each in alternation with Procure 480SC significantly increased the chlorophyll content in leaves and the total fresh weight of squash plants, when compared with the water control, Regalia SC and HMO 736 alone. In field trials, application of Regalia SC and HMO 736 each alone significantly reduced disease severity in one of two field trials during the early stage of disease development, but not during later stages when disease pressure became high. Both Regalia SC and HMO 736 each applied in alternation with Procure 480SC significantly improved the control efficacy compared to Procure 480SC alone. Results from this study demonstrated that an integrated management program can be developed for powdery mildew in squash by integrating the biopesticides Regalia SC, HMO 736 with the chemical fungicide Procure 480SC.

  14. Electronic structure of trypsin inhibitor from squash seeds in aqueous solution

    Science.gov (United States)

    Zheng, Haoping

    2000-10-01

    The electronic structure of the trypsin inhibitor from seeds of the squash Cucurbita maxima (CMTI-I) in aqueous solution is obtained by ab initio, all-electron, full-potential calculations using the self-consistent cluster-embedding (SCCE) method. The reactive site of the inhibitor is explained theoretically, which is in agreement with the experimental results. It is shown that the coordinates of oxygen atoms in the inhibitor, determined by nuclear magnetic resonance and combination of distance geometry and dynamical simulated annealing, are systematically less accurate than that of other kinds of heavy atoms.

  15. Expression Profile of Carotenoid Cleavage Dioxygenase Genes in Summer Squash (Cucurbita pepo L.).

    Science.gov (United States)

    González-Verdejo, Clara I; Obrero, Ángeles; Román, Belén; Gómez, Pedro

    2015-06-01

    Carotenoids are important dietary components that can be found in vegetable crops. The accumulation of these compounds in fruit and vegetables is altered by the activity of carotenoid cleavage dioxygenases (CCDs) enzymes that produce their degradation. The aim of this work was to study the possible implication of CCD genes in preventing carotenoid storage in the horticultural crop summer squash (Cucurbita pepo L.). The relationship between the presence of these compounds and gene expression for CCDs was studied in three varieties showing different peel and flesh colour. Expression analysis for the CCD genes CpNCED1, CpNCED2, CpNCED3, CpNCED9, CpCCD1, CpCCD4a, CpCCD4b and CpCCD8 was carried out on different organs and at several fruit developmental stages. The results showed that the CpCCD4a and CpCCD4b genes were highly expressed in the variety with lowest carotenoid content suggesting a putative role in carotenoid accumulation pattern in summer squash fruit.

  16. Relationship Between Seed Yield And Some of Fruit Traits in Iranian Squash (Cucurbita pepo L. Accissions

    Directory of Open Access Journals (Sweden)

    R. Barzegar

    2016-02-01

    Full Text Available In order to evaluation of squash (Cucurbita pepo seed yield per fruit and its relations with other characteristics of fruit include: length, diameter, length: diameter ratio (fruit shape, flesh thickness, thousand seed weight and fruit weight, an experiment was conducted using 24 accessions of squash as a randomized complete-block design with three replications. Morphological traits were evaluated according to UPOV descriptor and UPGMA clustering algorithm clustered the accessions in 4 groups (predominantly on the basis of fruit shape. Correlation, regression and path analysis were done for mentioned characteristics in 4 type-fruit groups. There was negative correlation between seed yield of individual fruit and its length and fruit length: diameter ratio. But fruit weight, fruit diameter, and thousand seeds weight had positive correlation with seed yield. Seed weight: fruit weight ratio had negative relationship with fruit weight. Therefore small size fruit is more suitable for seed yield per area. Path analysis was showed fruit weight had the most positive direct effect on seed yield per fruit in all groups.

  17. Improved postharvest quality in patagonian squash ( Cucurbita moschata) coated with radiation depolymerized chitosan

    Science.gov (United States)

    Pugliese, Maria Alicia; Goitia, Maria Teresa; Yossen, Mariana; Cifone, Norma; Agulló, Enrique; Andreucetti, Noemi

    2011-12-01

    Different molecular weight chitosans were evaluated on the decay of coated Anquito squashes ( Cucurbita moschata) as well as the maintenance of the fruit quality along five storage months. The original chitosan (Mw=391 kDa, 83% DD), was depolymerized by gamma radiation. Apart from chain scission, other chemical changes were not detected by FTIR or UV-vis analyses. The molecular weight characterization of chitosans was done by size exclusion chromatography with dual light scattering and concentration detection (SEC-MALLS-RI). The coating effectiveness was evaluated on the following parameters: fungal decay incidence, weight loss, firmness, total reducing sugar, soluble solid, flesh color, carotene content, pH and titratable acidity. No sign of fungal decay was observed in squashes coated with 122 and 56 kDa chitosans, which were also the most effective treatments in reducing the weight loss. The chitosan with Mw=122 kDa was also the best treatment considering firmness, internal aspect, sugar and carotene content. Then, radiation degraded chitosan was better in C. moschata preservation than the original chitosan.

  18. Recovering stereo vision by squashing virtual bugs in a virtual reality environment.

    Science.gov (United States)

    Vedamurthy, Indu; Knill, David C; Huang, Samuel J; Yung, Amanda; Ding, Jian; Kwon, Oh-Sang; Bavelier, Daphne; Levi, Dennis M

    2016-06-19

    Stereopsis is the rich impression of three-dimensionality, based on binocular disparity-the differences between the two retinal images of the same world. However, a substantial proportion of the population is stereo-deficient, and relies mostly on monocular cues to judge the relative depth or distance of objects in the environment. Here we trained adults who were stereo blind or stereo-deficient owing to strabismus and/or amblyopia in a natural visuomotor task-a 'bug squashing' game-in a virtual reality environment. The subjects' task was to squash a virtual dichoptic bug on a slanted surface, by hitting it with a physical cylinder they held in their hand. The perceived surface slant was determined by monocular texture and stereoscopic cues, with these cues being either consistent or in conflict, allowing us to track the relative weighting of monocular versus stereoscopic cues as training in the task progressed. Following training most participants showed greater reliance on stereoscopic cues, reduced suppression and improved stereoacuity. Importantly, the training-induced changes in relative stereo weights were significant predictors of the improvements in stereoacuity. We conclude that some adults deprived of normal binocular vision and insensitive to the disparity information can, with appropriate experience, recover access to more reliable stereoscopic information.This article is part of the themed issue 'Vision in our three-dimensional world'. © 2016 The Author(s).

  19. Comparison of squashing and self-consistent input-output models of quantum feedback

    Science.gov (United States)

    Peřinová, V.; Lukš, A.; Křepelka, J.

    2018-03-01

    The paper (Yanagisawa and Hope, 2010) opens with two ways of analysis of a measurement-based quantum feedback. The scheme of the feedback includes, along with the homodyne detector, a modulator and a beamsplitter, which does not enable one to extract the nonclassical field. In the present scheme, the beamsplitter is replaced by the quantum noise evader, which makes it possible to extract the nonclassical field. We re-approach the comparison of two models related to the same scheme. The first one admits that in the feedback loop between the photon annihilation and creation operators, unusual commutation relations hold. As a consequence, in the feedback loop, squashing of the light occurs. In the second one, the description arrives at the feedback loop via unitary transformations. But it is obvious that the unitary transformation which describes the modulator changes even the annihilation operator of the mode which passes by the modulator which is not natural. The first model could be called "squashing model" and the second one could be named "self-consistent model". Although the predictions of the two models differ only a little and both the ways of analysis have their advantages, they have also their drawbacks and further investigation is possible.

  20. Influence of cultivar, cooking, and storage on cell-wall polysaccharide composition of winter squash (Cucurbita maxima).

    Science.gov (United States)

    Ratnayake, R M Sunil; Melton, Laurence D; Hurst, Paul L

    2003-03-26

    Changes in the cell-wall polysaccharides (CWP) of the edible tissues of four winter squash cultivars during storage and after cooking were investigated. A procedure for isolating cell walls of tissues containing high levels of starch was used. The starch-free CWP were sequentially fractionated using CDTA, dilute Na(2)CO(3), and 4 M KOH. Cellulose made up 40-42% of the total CWP for three cultivars (Delica, CF 2, and CF 4) at harvest but was 35% in the softer Red Warren. The pectic polysaccharides of Delica, CF 2, and CF 4 cell walls are more branched than those from Red Warren squash. The higher proportion of uronic acid in the pectic polysaccharides of Red Warren squash correlates with its lower firmness. Cooking resulted in an increase in the water-soluble pectins and a decrease in the pectins associated with cellulose. The total CWP content of the squash cultivars remained unchanged for up to 2 months of storage and then markedly decreased between 2 and 3 months of storage. The galactose content of Delica and Red Warren cell walls remained relatively constant from harvest to 2 months of storage and then decreased markedly during 2-3 months of storage.

  1. DETERMINATION OF FERTILITY AND POLLEN VIABILITY OF BREEDING LINE OF PATTYUPAN SQUASH WITH MALE STERILITY OF FUNCTIONAL TYPE

    Directory of Open Access Journals (Sweden)

    A. M. Shantasov

    2014-01-01

    Full Text Available This article describes the features of the development of male sterility trait of functional type in patty"pan squash. The viability of pollen grains in different periods of vegetation was studied. The determined fertility ability of pollen can be used for hybrid seed production of different varieties of pumpkin.

  2. 75 FR 6346 - Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash...

    Science.gov (United States)

    2010-02-09

    ...] Notice of Availability of a Pest Risk Analysis for the Importation of Fresh Male Summer Squash Flowers.... ACTION: Notice. SUMMARY: We are advising the public that we have prepared a pest risk analysis that... for approving the importation of commodities that, based on the findings of a pest risk analysis, can...

  3. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib

    1984-01-01

    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  4. Revisiting the ADT mass of the five-dimensional rotating black holes with squashed horizons

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Jun-Jin [Guizhou Normal University, Guizhou Provincial Key Laboratory of Radio Astronomy and Data Processing, Guiyang (China)

    2017-10-15

    We evaluate the Abbott-Deser-Tekin (ADT) mass of the five-dimensional rotating black holes with squashed horizons on two different on-shell reference backgrounds, which are the flat background and the boundary matched Kaluza-Klein (KK) monopole. The mass on the former, identified with the one on the background of the asymptotic geometry, differs from the mass on the latter by that of the KK monopole. However, each mass satisfies the first law of black hole thermodynamics. To test the results in five dimensions, we compute the mass in the context of the dimensionally reduced theory. Finally, in contrast with the original ADT formulation, its off-shell generalisation is applied to calculate the mass as well. (orig.)

  5. Revisiting the ADT mass of the five-dimensional rotating black holes with squashed horizons

    International Nuclear Information System (INIS)

    Peng, Jun-Jin

    2017-01-01

    We evaluate the Abbott-Deser-Tekin (ADT) mass of the five-dimensional rotating black holes with squashed horizons on two different on-shell reference backgrounds, which are the flat background and the boundary matched Kaluza-Klein (KK) monopole. The mass on the former, identified with the one on the background of the asymptotic geometry, differs from the mass on the latter by that of the KK monopole. However, each mass satisfies the first law of black hole thermodynamics. To test the results in five dimensions, we compute the mass in the context of the dimensionally reduced theory. Finally, in contrast with the original ADT formulation, its off-shell generalisation is applied to calculate the mass as well. (orig.)

  6. Revisiting the ADT mass of the five-dimensional rotating black holes with squashed horizons

    Science.gov (United States)

    Peng, Jun-Jin

    2017-10-01

    We evaluate the Abbott-Deser-Tekin (ADT) mass of the five-dimensional rotating black holes with squashed horizons on two different on-shell reference backgrounds, which are the flat background and the boundary matched Kaluza-Klein (KK) monopole. The mass on the former, identified with the one on the background of the asymptotic geometry, differs from the mass on the latter by that of the KK monopole. However, each mass satisfies the first law of black hole thermodynamics. To test the results in five dimensions, we compute the mass in the context of the dimensionally reduced theory. Finally, in contrast with the original ADT formulation, its off-shell generalisation is applied to calculate the mass as well.

  7. Entropy for gravitational Chern-Simons terms by squashed cone method

    International Nuclear Information System (INIS)

    Guo, Wu-Zhong; Miao, Rong-Xin

    2016-01-01

    In this paper we investigate the entropy of gravitational Chern-Simons terms for the horizon with non-vanishing extrinsic curvatures, or the holographic entanglement entropy for arbitrary entangling surface. In 3D there is no anomaly of entropy. But the original squashed cone method can not be used directly to get the correct result. For higher dimensions the anomaly of entropy would appear, still, we can not use the squashed cone method directly. That is becasuse the Chern-Simons action is not gauge invariant. To get a reasonable result we suggest two methods. One is by adding a boundary term to recover the gauge invariance. This boundary term can be derived from the variation of the Chern-Simons action. The other one is by using the Chern-Simons relation dΩ_4_n_−_1=tr(R"2"n). We notice that the entropy of tr(R"2"n) is a total derivative locally, i.e. S=ds_C_S. We propose to identify s_C_S with the entropy of gravitational Chern-Simons terms Ω_4_n_−_1. In the first method we could get the correct result for Wald entropy in arbitrary dimension. In the second approach, in addition to Wald entropy, we can also obtain the anomaly of entropy with non-zero extrinsic curvatures. Our results imply that the entropy of a topological invariant, such as the Pontryagin term tr(R"2"n) and the Euler density, is a topological invariant on the entangling surface.

  8. Purification, characterization and cloning of an aspartic proteinase inhibitor from squash phloem exudate.

    Science.gov (United States)

    Christeller, J T; Farley, P C; Ramsay, R J; Sullivan, P A; Laing, W A

    1998-05-15

    Phloem exudate from squash fruit contains heat-inactivated material which inhibits pepsin activity. This inhibitory activity was purified by mild acid treatment, chromatography on trypsin-agarose, Sephadex G-75 and reverse-phase HPLC, resulting in the elution of three peaks with pepsin-inhibitory activity. N-terminal sequencing indicated a common sequence of MGPGPAIGEVIG and the presence of minor species with seven- or two-amino-acid N-terminal extensions beyond this point. Microheterogeneity in this end sequence was exhibited within and between two preparations. Internal sequencing of a major peak after a trypsin digestion gave the sequence FYNVVVLEK. The common N-terminal sequence was used to design a degenerate primer for 3' rapid amplification of cDNA ends and cDNA clones encoding two isoforms of the inhibitor were obtained. The open reading frames of both cDNAs encoded proteins (96% identical) which contained the experimentally determined internal sequence. The amino acid content calculated from the predicted amino acid sequence was very similar to that measured by amino acid analysis of the purified inhibitor. The two predicted amino acid sequences (96 residues) had neither similarity to any other aspartic proteinase inhibitor nor similarity to any other protein. The inhibitors have a molecular mass of 10,552 Da, measured by matrix-assisted laser-desorption ionisation time-of-flight mass spectrometry and approximately 10,000 Da by SDS/PAGE, and behave as dimers of approximately 21,000 Da during chromatography on Superdex G-75 gel-filtration medium. The calculated molecular masses from the predicted amino acid sequences were 10,551 Da and 10,527 Da. The inhibitor was capable of inhibiting pepsin (Ki = 2 nM) and a secreted aspartic proteinase from the fungus Glomerella cingulata (Ki = 20 nM). The inhibitor, which is stable over acid and neutral pH, has been named squash aspartic proteinase inhibitor (SQAPI).

  9. Amino-acid sequence of two trypsin isoinhibitors, ITD I and ITD III from squash seeds (Cucurbita maxima).

    Science.gov (United States)

    Wilusz, T; Wieczorek, M; Polanowski, A; Denton, A; Cook, J; Laskowski, M

    1983-01-01

    The amino-acid sequences of two trypsin isoinhibitors, ITD I and ITD III, from squash seeds (Cucurbita maxima) were determined. Both isoinhibitors contain 29 amino-acid residues, including 6 half cystine residues. They differ only by one amino acid. Lysine in position 9 of ITD III is substituted by glutamic acid in ITD I. Arginine in position 5 is present at the reactive site of both isoinhibitors. The previously published sequence of ITD III has been shown to be incorrect.

  10. The Impact of Location and Growing Medium on Harvest Yield and Flavor of Basil and Squash Microgreens

    Science.gov (United States)

    Leal, J.; Ventura, C. J.

    2016-12-01

    The purpose of this experiment is to discover the most efficient, feasible way to produce a high yield of flavorful microgreens within the best growing medium and building location at the Stanford Educational Farm. In recent years, microgreens, young, small edible greens utilized as flavor garnishes for fine dining, have evolved into an immensely profitable market that will continue to expand and prosper. To capitalize on such opportunities, the primary metrics focused upon are harvest yield and flavor of basil and squash microgreens, as they develop in different concentrations of quick root and compost while located in either a greenhouse or lath house. It was hypothesized that if basil and squash microgreens were grown in a mixture of 50% compost and 50% quick root in the greenhouse, then they would produce the greatest harvest yield and maximum amount of flavor. The general experimental protocol includes monitoring the growth of the microgreens, then harvesting directly after the first true leaves begin to emerge. Upon harvest, each set of microgreens are separated into different clear glass jars to place on a small scale for weighing to determine the yield and tasting the leaves to analyze the flavor content. The highest yield of basil (63 grams) developed in a tray of 100% quick root in the lath house, while the greatest yield of squash (51 grams) succeeded in 100% quick root in the greenhouse. Overall however, the basil grew fastest in the greenhouse but tasted stronger in the lath house. Additionally, because the harvest yield and flavor results were so poor in all other locations and growing mediums for squash during the first trial, it cannot be considered a viable microgreen. In the future, more trials should be conducted for greater numbers of trays of microgreens to collect more data. The nutritional value of microgreens should also be explored further to obtain a holistic approach to the value of these plants from seed to harvest to consumption.

  11. The effect of court location and available time on the tactical shot selection of elite squash players.

    Science.gov (United States)

    Vučković, Goran; James, Nic; Hughes, Mike; Murray, Stafford; Sporiš, Goran; Perš, Janez

    2013-01-01

    No previous research in squash has considered the time between shots or the proximity of the ball to a wall, which are two important variables that influence shot outcomes. The aim of this paper was to analyse shot types to determine the extent to which they are played in different court areas and a more detailed analysis to determine whether the time available had an influence on the shot selected. Ten elite matches, contested by fifteen of the world's top right handed squash players (age 27 ± 3.2, height 1.81 ± 0.06 m, weight 76.3 ± 3.7 kg), at the men's World Team Championships were processed using the SAGIT/Squash tracking system with shot information manually added to the system. Results suggested that shot responses were dependent upon court location and the time between shots. When these factors were considered repeatable performance existed to the extent that one of two shots was typically played when there was limited time to play the shot (tactics affect shot selections. Key pointsPrevious research has suggested that a playing strategy, elements decided in advance of the match, may be evident for elite players by examining court location and preceding shot type, however these parameters alone are unlikely to be sufficient predictors.At present there is no known analysis in squash, or indeed in any of the racket sports, that has quantified the time available to respond to different shot types. An understanding of the time interval between shots and the movement characteristics of the player responding to different shots according to the court positions might facilitate a better understanding of the dynamics that determine shot selection.Some elements of a general playing strategy were evident e.g. predominately hitting to the back left of the court, but tactical differences in shot selection were also evident on the basis of court location and time available to play a shot.

  12. Carotenoid accumulation and carotenogenic gene expression during fruit development in novel interspecific inbred squash lines and their parents.

    Science.gov (United States)

    Nakkanong, Korakot; Yang, Jing Hua; Zhang, Ming Fang

    2012-06-13

    Carotenoid levels and composition during squash fruit development were compared in Cucurbita moschata , Cucurbita maxima , and two lines of their interspecific inbred lines, namely, Maxchata1 and Maxchata2. Eight genes associated with carotenoid biosynthesis were analyzed by quantitative RT-PCR. The two squash species and their interspecific inbred lines exhibited different qualitative and quantitative carotenoid profiles and regulatory mechanisms. C. moschata had the lowest total carotenoid content and mainly accumulated α-carotene and β-carotene, as expected in a fruit with pale-orange flesh. Low carotenoid content in this species was probably due to the comparatively low expression of all genes investigated, especially PSY1 gene, compared to the other squashes. The predominant carotenoids in C. maxima were violaxanthin and lutein, which produced a corresponding yellow flesh color in mature fruit. The relationship between the expression of the CHYB and ZEP genes may result in almost equal concentrations of violaxanthin and lutein in C. maxima at fruit ripening. In contrast, their interspecific inbred lines principally accumulated lutein and β-carotene, leading to orange flesh color. The PSY1 gene exhibited higher expression levels at earlier stages of fruit development in the Maxchata lines, potentially triggering the increased carotenoid accumulation seen in these fruits. Likewise, the higher transcription level of CHYB gene observed in the two interspecific inbred lines might be correlated with high lutein in these hybrids. However, this study could not explain the observed β-carotene accumulation on the basis of gene expression.

  13. Discovering metabolic indices for early detection of squash (Cucurbita maxima) storage quality using GC-MS-based metabolite profiling.

    Science.gov (United States)

    Okazaki, K; Kimura, Y; Sugiyama, K; Kami, D; Nakamura, T; Oka, N

    2016-04-01

    Squash (Cucubita maxima) cultivars with good storage qualities are needed for breeding to improve poor crop supply during winter in Japan. We measured changes in squash constituents during different storage periods to identify compounds that were suitable to be used as indices of storage quality. Principal components analysis of compounds at 1-5 months after harvest showed that PC1 scores were lower for cultivars with a higher rather than lower SQ (storage quality) ranks. Partial least-squares regression analysis was performed using the peak areas of all compounds identified from the 15 cultivars at 1 month after harvest as explanation variables and SQ as the target variable. Variable influence on projection scores and rank correlation coefficients were higher for arabinose and xylose, which showed less temporal change during the storage period; hence, they were considered to be suitable indicators for storage evaluation. These data will be useful for future studies aiming to improve storage quality of squash. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. [Effects of soil moisture content and light intensity on the plant growth and leaf physiological characteristics of squash].

    Science.gov (United States)

    Du, She-ni; Bai, Gang-shuan; Liang, Yin-li

    2011-04-01

    A pot experiment with artificial shading was conducted to study the effects of soil moisture content and light intensity on the plant growth and leaf physiological characteristics of squash variety "Jingyingyihao". Under all test soil moisture conditions, 30% shading promoted the growth of "Jingyingyihao", with the highest yield at 70% - 80% soil relative moisture contents. 70% shading inhibited plant growth severely, only flowering and not bearing fruits, no economic yield produced. In all treatments, there was a similar water consumption trend, i. e., both the daily and the total water consumption decreased with increasing shading and decreasing soil moisture content. Among all treatments, 30% shading and 70% - 80% soil relative moisture contents had the highest water use efficiency (2.36 kg mm(-1) hm(-2)) and water output rate (1.57 kg mm(-1) hm(-2)). The net photosynthetic rate, transpiration rate, stomatal conductance, and chlorophyll content of squash leaves decreased with increasing shading, whereas the intercellular CO2 concentration was in adverse. The leaf protective enzyme activity and proline content decreased with increasing shading, and the leaf MAD content decreased in the order of 70% shading, natural radiation, and 30% shading. Under the three light intensities, the change characteristics of squash leaf photosynthesis, protective enzyme activity, and proline and MAD contents differed with the increase of soil relative moisture content.

  15. Genetic diversity in a collection of ornamental squash (Cucurbita pepo L.

    Directory of Open Access Journals (Sweden)

    Mladenović Emina

    2014-01-01

    Full Text Available The aim of this study is collecting and preserving of unique Cucurbita pepo germplasm in Serbia. This study also describes the intraspecific variation of C. pepo within twenty germplasm accessions. Conservation work aimed to develop a representative core collection of C. pepo germplasm, to guide future studies and breeding of its ornamental use. A wide range of C. pepo germplasm was collected from diferent parts of the world. Nineteen variables were recorded in 20 varieties to determine the overall degree of polymorphism and to detect similarities among them. Qualitative traits of fruit such is shape, color and texture, showed immense variation. Coefficient of variation were highest for fruit length, fruit weight and number of fruits per plant (CV=56.69161.32%, while they were the lowest for leaf length (CV=20.65%. Morphological characterization is need to facilitate the use of C. pepo varieties in breeding work. Based on the PCA results, 20 accessions of squash are separate in five groups. Those groups are unique in qualitative and quantitative traits. Knowledge of genetic divergence among varieties is essential for breeding.

  16. Cell lines derived from the squash bug, Anasa tristis (Coreidae: Hemiptera).

    Science.gov (United States)

    Goodman, Cynthia L; Ringbauer, Joseph A; Li, Yao-Fa; Lincoln, Tamra Reall; Stanley, David

    2017-05-01

    The squash bug, Anasa tristis, is a pest of cucurbits that exerts direct damage on crops and is a vector of plant pathogens. We established cell lines from this insect to serve as tools for basic biology, including virology and immunology, as well as applied studies, such as insecticide development programs. We initiated 15 cell cultures, using nine media or combinations of media. The media yielding the best results were a modification of Kimura's medium and a combination of two commercially available cell culture media (EX-CELL 420 and L15). We designated the two cell lines as BCIRL-AtE-CLG11 and BCIRL-AtE-CLG15. From the AtE-CLG15 line, we isolated two sub-lines, A and B. Of these, the most consistently replicating line was AtE-CLG15A. We determined the doubling time of this line (190 h) and its mean cell diameter (14.5 ± 0.7 μm). We characterized the AtE-CLG15A line using DAF-PCR. The BCIRL-AtE-CLG15A cell line is now available for researchers world-wide.

  17. Identification of suitable media based on hydroponic culture for production Zucchini squash

    Directory of Open Access Journals (Sweden)

    TP Suvo

    2016-12-01

    Full Text Available An experiment was conducted to identify the hydroponic culture based suitable media for the production of Zucchini Squash in the Biochemistry Laboratory, Patuakhali Science and Technology University, Dumki, Patuakhali, Bangladesh during 2014. Zucchini plant (Cucurbita pepo L. were grown in closed soilless systems to determine the effect of four different hydroponics media on plant growth, yield and nutrient contents (fruit moisture content, ascorbic acid content on fruit, fruit protein content, protein content in leaves. Three types of substrates (coconut husk, jute, cotton along with Hoagland solution were used in this experiment. Result revealed that media using Jute fiber showed significant effect on plant growth and nutritional values than the other media (media of cotton with Hoagland solution, coconut husk with Hoagland solution and only Hoagland solution. The plant grown using jute media showed the highest plant height (60.33 cm, number of leaves (17.33, yield (1.5 kg plant-1, fruit moisture content (97.33%, Ascorbic acid content in fruit (28.73 mg 100g-1, protein percentage in fruit (1.406% and percentage (1.326% in leaves than the other media. Therefore, with the controlled nutrient supply, less expense, less labor, no use of pesticides or fertilizer with controlled environment the use of jute fiber as a substrate with Hoagland solution can be an effective one.

  18. Movement of soil-applied imidacloprid and thiamethoxam into nectar and pollen of squash (Cucurbita pepo.

    Directory of Open Access Journals (Sweden)

    Kimberly A Stoner

    Full Text Available There has been recent interest in the threat to bees posed by the use of systemic insecticides. One concern is that systemic insecticides may translocate from the soil into pollen and nectar of plants, where they would be ingested by pollinators. This paper reports on the movement of two such systemic neonicotinoid insecticides, imidacloprid and thiamethoxam, into the pollen and nectar of flowers of squash (Cucurbita pepo cultivars "Multipik," "Sunray" and "Bush Delicata" when applied to soil by two methods: (1 sprayed into soil before seeding, or (2 applied through drip irrigation in a single treatment after transplant. All insecticide treatments were within labeled rates for these compounds. Pollen and nectar samples were analyzed using a standard extraction method widely used for pesticides (QuEChERS and liquid chromatography mass spectrometric analysis. The concentrations found in nectar, 10 ± 3 ppb (mean ± s.d for imidacloprid and 11 ± 6 ppb for thiamethoxam, are higher than concentrations of neonicotinoid insecticides in nectar of canola and sunflower grown from treated seed, and similar to those found in a recent study of neonicotinoids applied to pumpkins at transplant and through drip irrigation. The concentrations in pollen, 14 ± 8 ppb for imidacloprid and 12 ± 9 ppb for thiamethoxam, are higher than those found for seed treatments in most studies, but at the low end of the range found in the pumpkin study. Our concentrations fall into the range being investigated for sublethal effects on honey bees and bumble bees.

  19. Recovering stereo vision by squashing virtual bugs in a virtual reality environment

    Science.gov (United States)

    Vedamurthy, Indu; Knill, David C.; Huang, Samuel J.; Yung, Amanda; Ding, Jian; Kwon, Oh-Sang; Bavelier, Daphne

    2016-01-01

    Stereopsis is the rich impression of three-dimensionality, based on binocular disparity—the differences between the two retinal images of the same world. However, a substantial proportion of the population is stereo-deficient, and relies mostly on monocular cues to judge the relative depth or distance of objects in the environment. Here we trained adults who were stereo blind or stereo-deficient owing to strabismus and/or amblyopia in a natural visuomotor task—a ‘bug squashing’ game—in a virtual reality environment. The subjects' task was to squash a virtual dichoptic bug on a slanted surface, by hitting it with a physical cylinder they held in their hand. The perceived surface slant was determined by monocular texture and stereoscopic cues, with these cues being either consistent or in conflict, allowing us to track the relative weighting of monocular versus stereoscopic cues as training in the task progressed. Following training most participants showed greater reliance on stereoscopic cues, reduced suppression and improved stereoacuity. Importantly, the training-induced changes in relative stereo weights were significant predictors of the improvements in stereoacuity. We conclude that some adults deprived of normal binocular vision and insensitive to the disparity information can, with appropriate experience, recover access to more reliable stereoscopic information. This article is part of the themed issue ‘Vision in our three-dimensional world’. PMID:27269607

  20. Organic and mineral fertilization of squash plant with application of 1'5N staple isotope

    International Nuclear Information System (INIS)

    El-Sherbiny, A.E.; Dahdouh, S.M.; Galal, Y.G.M.; Habib, A.A.M.

    2012-01-01

    A field experiment was conducted on virgin sand soil under drip irrigation system using squash fertilized with ammonium sulfate fertilizer, commercial compost locally manufactured in Egypt and artificial compost prepared fertilizer were applied either completely (100%) of mineral or of organic; or 50%: 50% (mineral: organic) by the authors at the Atomic Energy Authority of Egypt. All fertilization treatments were either inoculated or not inoculated with Azospirillum. Inoculation increased roots fresh weight. This was more pronounced with application of 50% mineral fertilizer plus 50% commercial compost, 100% artificial compost and 100% commercial compost. Similar trends, but to high extent were noticed with shoot fresh weight as affected by microbial inoculation and different organic composts. The 50%: 50% treatments as well as 100% artificial compost treatment gave high root and shoot dry weights. Inoculation and 50%: 50% fertilization treatments were more effective on N uptake. Higher N uptake was by shoots than roots. Portion and absolute value of N derived by roots from mineral fertilizer were significantly affected by combined fertilization treatments. Nitrogen derived from air (Ndfa) was positively affected by addition of organic compost and bacterial inoculation. Reversible trend was noticed with N derived from soil (Ndfa) which decreased when treated with compost and bacterial inoculation. All measurements were high in shoots than roots

  1. Evolutionary and domestication history of Cucurbita (pumpkin and squash) species inferred from 44 nuclear loci.

    Science.gov (United States)

    Kates, Heather R; Soltis, Pamela S; Soltis, Douglas E

    2017-06-01

    Phylogenetics can facilitate the study of plant domestication by resolving sister relationships between crops and their wild relatives, thereby identifying the ancestors of cultivated plants. Previous phylogenetic studies of the six Cucurbita crop lineages (pumpkins and squashes) and their wild relatives suggest histories of deep coalescence that complicate uncovering the genetic origins of the six crop taxa. We investigated the evolution of wild and domesticated Cucurbita using the most comprehensive and robust molecular-based phylogeny for Cucurbita to date based on 44 loci derived from introns of single-copy nuclear genes. We discovered novel relationships among Cucurbita species and recovered the first Cucurbita tree with well-supported resolution within species. Cucurbita comprises a clade of mesophytic annual species that includes all six crop taxa and a grade of xerophytic perennial species that represent the ancestral xerophytic habit of the genus. Based on phylogenetic resolution within-species we hypothesize that the magnitude of domestication bottlenecks varies among Cucurbita crop lineages. Our phylogeny clarifies how wild Cucurbita species are related to the domesticated taxa. We find close relationships between two wild species and crop lineages not previously identified. Expanded geographic sampling of key wild species is needed for improved understanding of the evolution of domesticated Cucurbita. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. SLIP-SQUASHING FACTORS AS A MEASURE OF THREE-DIMENSIONAL MAGNETIC RECONNECTION

    International Nuclear Information System (INIS)

    Titov, V. S.; Mikic, Z.; Linker, J. A.; Forbes, T. G.; Priest, E. R.

    2009-01-01

    A general method for describing magnetic reconnection in arbitrary three-dimensional magnetic configurations is proposed. The method is based on the field-line mapping technique previously used only for the analysis of a magnetic structure at a given time. This technique is extended here so as to analyze the evolution of a magnetic structure. Such a generalization is made with the help of new dimensionless quantities called s lip-squashing factors.Their large values define the surfaces that border the reconnected or to-be-reconnected magnetic flux tubes for a given period of time during the magnetic evolution. The proposed method is universal, since it assumes only that the time sequence of evolving magnetic field and the tangential boundary flows are known. The application of the method is illustrated for simple examples, one of which was considered previously by Hesse and coworkers in the framework of the general magnetic reconnection theory. The examples help us to compare these two approaches; it reveals also that, just as for magnetic null points, hyperbolic and cusp minimum points of a magnetic field serve as favorable sites for magnetic reconnection. The new method admits a straightforward numerical implementation and provides a powerful tool for the diagnostics of magnetic reconnection in numerical models of solar-flare-like phenomena in space and laboratory plasmas.

  3. Gourds and squashes (Cucurbita spp.) adapted to megafaunal extinction and ecological anachronism through domestication.

    Science.gov (United States)

    Kistler, Logan; Newsom, Lee A; Ryan, Timothy M; Clarke, Andrew C; Smith, Bruce D; Perry, George H

    2015-12-08

    The genus Cucurbita (squashes, pumpkins, gourds) contains numerous domesticated lineages with ancient New World origins. It was broadly distributed in the past but has declined to the point that several of the crops' progenitor species are scarce or unknown in the wild. We hypothesize that Holocene ecological shifts and megafaunal extinctions severely impacted wild Cucurbita, whereas their domestic counterparts adapted to changing conditions via symbiosis with human cultivators. First, we used high-throughput sequencing to analyze complete plastid genomes of 91 total Cucurbita samples, comprising ancient (n = 19), modern wild (n = 30), and modern domestic (n = 42) taxa. This analysis demonstrates independent domestication in eastern North America, evidence of a previously unknown pathway to domestication in northeastern Mexico, and broad archaeological distributions of taxa currently unknown in the wild. Further, sequence similarity between distant wild populations suggests recent fragmentation. Collectively, these results point to wild-type declines coinciding with widespread domestication. Second, we hypothesize that the disappearance of large herbivores struck a critical ecological blow against wild Cucurbita, and we take initial steps to consider this hypothesis through cross-mammal analyses of bitter taste receptor gene repertoires. Directly, megafauna consumed Cucurbita fruits and dispersed their seeds; wild Cucurbita were likely left without mutualistic dispersal partners in the Holocene because they are unpalatable to smaller surviving mammals with more bitter taste receptor genes. Indirectly, megafauna maintained mosaic-like landscapes ideal for Cucurbita, and vegetative changes following the megafaunal extinctions likely crowded out their disturbed-ground niche. Thus, anthropogenic landscapes provided favorable growth habitats and willing dispersal partners in the wake of ecological upheaval.

  4. Movement of Soil-Applied Imidacloprid and Thiamethoxam into Nectar and Pollen of Squash (Cucurbita pepo)

    Science.gov (United States)

    Stoner, Kimberly A.; Eitzer, Brian D.

    2012-01-01

    There has been recent interest in the threat to bees posed by the use of systemic insecticides. One concern is that systemic insecticides may translocate from the soil into pollen and nectar of plants, where they would be ingested by pollinators. This paper reports on the movement of two such systemic neonicotinoid insecticides, imidacloprid and thiamethoxam, into the pollen and nectar of flowers of squash (Cucurbita pepo cultivars “Multipik,” “Sunray” and “Bush Delicata”) when applied to soil by two methods: (1) sprayed into soil before seeding, or (2) applied through drip irrigation in a single treatment after transplant. All insecticide treatments were within labeled rates for these compounds. Pollen and nectar samples were analyzed using a standard extraction method widely used for pesticides (QuEChERS) and liquid chromatography mass spectrometric analysis. The concentrations found in nectar, 10±3 ppb (mean ± s.d) for imidacloprid and 11±6 ppb for thiamethoxam, are higher than concentrations of neonicotinoid insecticides in nectar of canola and sunflower grown from treated seed, and similar to those found in a recent study of neonicotinoids applied to pumpkins at transplant and through drip irrigation. The concentrations in pollen, 14±8 ppb for imidacloprid and 12±9 ppb for thiamethoxam, are higher than those found for seed treatments in most studies, but at the low end of the range found in the pumpkin study. Our concentrations fall into the range being investigated for sublethal effects on honey bees and bumble bees. PMID:22761727

  5. Combining ability of summer-squash lines with different degrees of parthenocarpy and PRSV-W resistance

    OpenAIRE

    Nogueira, Douglas Willian; Maluf, Wilson Roberto; Figueira, Antonia dos Reis; Maciel, Gabriel Mascarenhas; Gomes, Luiz Antonio Augusto; Benavente, Cesar Augusto Ticona

    2011-01-01

    The aim was to assess heterosis in a set of 16 summer-squash hybrids, and evaluate the combining capacity of the respective parental lines, which differed as to the degree of parthenocarpy and resistance to PRSV-W (Papaya Ringspot Virus-Watermelon strain). The hybrids were obtained using a partial diallel cross design (4 ? 4). The lines of parental group I were 1 = ABX-037G-77-03-05-01-01-bulk, 2 = ABX-037G-77-03-05-03-10-bulk, 3 = ABX-037G-77-03-05-01-04-bulk and 4 = ABX-037G-77-03-05-05-01-...

  6. Effects of cooking on the cell walls (dietary fiber) of 'Scarlet Warren' winter squash ( Cucurbita maxima ) studied by polysaccharide linkage analysis and solid-state (13)C NMR.

    Science.gov (United States)

    Ratnayake, R M Sunil; Sims, Ian M; Newman, Roger H; Melton, Laurence D

    2011-07-13

    Cell wall polysaccharides of 'Scarlet Warren' winter squash ( Cucurbita maxima ) were investigated before and after thermal processing. Linkage analysis of polysaccharides was done by gas chromatography coupled to mass spectrometry (GC-MS). The linkage analysis showed the cell wall polysaccharide compositions of raw and cooked squash were similar. The total pectic polysaccharides (galacturonan, rhamnogalacturonan, arabinan, and arabinogalactan) contents of the cell walls of both raw and cooked squash were 39 mol %. The amounts of pectic polysaccharides and xyloglucan in the cell walls of squash showed little alteration on heating. The cellulose content of the raw and cooked cell walls was relatively high at 47 mol %, whereas the xyloglucan content was low at 4 mol %. Solid-state (13)C nuclear magnetic resonance (NMR) spectroscopy techniques were used to examine the molecular motion of the polysaccharides in the cell walls. The mobility of highly flexible galactan depends on the water content of the sample, but no difference was seen between raw and cooked samples. Likewise, the mobility of semimobile pectic polysaccharides was apparently unaltered by cooking. No change was detected in the rigid cellulose microfibrils on cooking.

  7. A duplex real-time RT-PCR system with an internal control offers sensitive and reliable broad spectrum detection of Squash mosaic virus variants

    Science.gov (United States)

    Squash mosaic virus (SqMV) is a seed-borne virus, belonging to the genus Commovirus in the subfamily Comoviridae of family Secoviridae. SqMV has a bipartite single-stranded ribonucleic acid (RNA) genome (RNA1 and RNA2) encapsidated separately with two capsid proteins. Two serotypes (genotypes) of ...

  8. Genetic relationships in Cucurbita pepo (pumpkin, squash, gourd) as viewed with high frequency oligonucleotide–targeting active gene (HFO–TAG) markers

    Science.gov (United States)

    Cucurbita pepo is a highly diverse, economically important member of the Cucurbitaceae. C. pepo encompasses hundreds of cultivars of pumpkins, squash, and gourds. Although C. pepo has been scrutinized with various types of DNA markers, the relationships among the cultivar-groups of C. pepo subsp. p...

  9. Variabilidade genética em populações de pitangueira oriundas de autopolinização e polinização livre, acessada por AFLP Genetic variability in surinam cherry populations originated from self-pollination and cross pollination, estimated by AFLP

    Directory of Open Access Journals (Sweden)

    Rodrigo Cezar Franzon

    2010-03-01

    Full Text Available Foram utilizados marcadores AFLP para a avaliação de populações de plantas de pitangueira (Eugenia uniflora oriundas de autopolinização e de polinização livre, com o objetivo de verificar a variabilidade existente entre e dentro dessas populações, visando a fornecer mais informações que ajudem no entendimento do modo de reprodução dessa espécie. O material vegetal utilizado foi oriundo de duas seleções de pitangueira ("Pit 15" e "Pit 52", mantidas na Embrapa Clima Temperado. De cada seleção, foram obtidas duas populações F1, por meio de autopolinização e de polinização livre, totalizando quatro populações. Foram analisados 18 indivíduos de cada população e as duas plantas-mãe, totalizando 74 indivíduos. Foram utilizadas três combinações de primers AFLP e calculada a similaridade genética entre plantas pelo coeficiente de Jaccard. Uma estimativa da variabilidade genética entre e dentro das populações foi estimada pela AMOVA. As três combinações de primers AFLP utilizadas amplificaram um total de 178 locos AFLP, dos quais 114 (64,0% foram polimórficos entre todos os indivíduos. Não houve separação clara entre populações descendentes da mesma planta-mãe. Foi observado maior polimorfismo de marcadores AFLP em populações de polinização livre. A proporção da variabilidade genética total entre populações foi significativa, embora tenha sido menor do que aquela observada dentro das populações. A reprodução da pitangueira é decorrente tanto da autofertilização quanto da polinização cruzada, sendo necessário, no entanto, novos estudos para determinar qual a estratégia de reprodução mais eficiente.AFLP molecular markers were used aiming to study the genetic variability within and between Surinam cherry (Eugenia uniflora populations, originated from self-pollination and open pollination of two selections (Pit 15 and Pit 52 of the Embrapa Clima Temperado collection. The objective was to

  10. Evaluation of different pulverisation methods for RNA extraction in squash fruit: lyophilisation, cryogenic mill and mortar grinding.

    Science.gov (United States)

    Román, Belén; González-Verdejo, Clara I; Peña, Francisco; Nadal, Salvador; Gómez, Pedro

    2012-01-01

    Quality and integrity of RNA are critical for transcription studies in plant molecular biology. In squash fruit and other high water content crops, the grinding of tissue with mortar and pestle in liquid nitrogen fails to produce a homogeneous and fine powered sample desirable to ensure a good penetration of the extraction reagent. To develop an improved pulverisation method to facilitate the homogenisation process of squash fruit tissue prior to RNA extraction without reducing quality and yield of the extracted RNA. Three methods of pulverisation, each followed by the same extraction protocol, were compared. The first approach consisted of the lyophilisation of the sample in order to remove the excess of water before grinding, the second one used a cryogenic mill and the control one a mortar grinding of frozen tissue. The quality of the isolated RNA was tested by carrying out a quantitative real time downstream amplification. In the three situations considered, mean values for A(260) /A(280) indicated minimal interference by proteins and RNA quality indicator (RQI) values were considered appropriate for quantitative real-time polymerase chain reaction (qRT-PCR) amplification. Successful qRT-PCR amplifications were obtained with cDNA isolated with the three protocols. Both apparatus can improve and facilitate the grinding step in the RNA extraction process in zucchini, resulting in isolated RNA of high quality and integrity as revealed by qRT-PCR downstream application. This is apparently the first time that a cryogenic mill has been used to prepare fruit samples for RNA extraction, thereby improving the sampling strategy because the fine powder obtained represents a homogeneous mix of the organ tissue. Copyright © 2012 John Wiley & Sons, Ltd.

  11. The Potential Influence of Bumble Bee Visitation on Foraging Behaviors and Assemblages of Honey Bees on Squash Flowers in Highland Agricultural Ecosystems.

    Science.gov (United States)

    Xie, Zhenghua; Pan, Dongdong; Teichroew, Jonathan; An, Jiandong

    2016-01-01

    Bee species interactions can benefit plant pollination through synergistic effects and complementary effects, or can be of detriment to plant pollination through competition effects by reducing visitation by effective pollinators. Since specific bee interactions influence the foraging performance of bees on flowers, they also act as drivers to regulate the assemblage of flower visitors. We selected squash (Cucurbita pepo L.) and its pollinators as a model system to study the foraging response of honey bees to the occurrence of bumble bees at two types of sites surrounded by a high amount of natural habitats (≥ 58% of land cover) and a low amount of natural habitats (≤ 12% of land cover) in a highland agricultural ecosystem in China. At the individual level, we measured the elapsed time from the departure of prior pollinator(s) to the arrival of another pollinator, the selection of honey bees for flowers occupied by bumble bees, and the length of time used by honey bees to explore floral resources at the two types of sites. At the community level, we explored the effect of bumble bee visitation on the distribution patterns of honey bees on squash flowers. Conclusively, bumble bee visitation caused an increase in elapsed time before flowers were visited again by a honey bee, a behavioral avoidance by a newly-arriving honey bee to select flowers occupied by bumble bees, and a shortened length of time the honey bee takes to examine and collect floral resources. The number of overall bumble bees on squash flowers was the most important factor explaining the difference in the distribution patterns of honey bees at the community level. Furthermore, decline in the number of overall bumble bees on the squash flowers resulted in an increase in the number of overall honey bees. Therefore, our study suggests that bee interactions provide an opportunity to enhance the resilience of ecosystem pollination services against the decline in pollinator diversity.

  12. The Potential Influence of Bumble Bee Visitation on Foraging Behaviors and Assemblages of Honey Bees on Squash Flowers in Highland Agricultural Ecosystems.

    Directory of Open Access Journals (Sweden)

    Zhenghua Xie

    Full Text Available Bee species interactions can benefit plant pollination through synergistic effects and complementary effects, or can be of detriment to plant pollination through competition effects by reducing visitation by effective pollinators. Since specific bee interactions influence the foraging performance of bees on flowers, they also act as drivers to regulate the assemblage of flower visitors. We selected squash (Cucurbita pepo L. and its pollinators as a model system to study the foraging response of honey bees to the occurrence of bumble bees at two types of sites surrounded by a high amount of natural habitats (≥ 58% of land cover and a low amount of natural habitats (≤ 12% of land cover in a highland agricultural ecosystem in China. At the individual level, we measured the elapsed time from the departure of prior pollinator(s to the arrival of another pollinator, the selection of honey bees for flowers occupied by bumble bees, and the length of time used by honey bees to explore floral resources at the two types of sites. At the community level, we explored the effect of bumble bee visitation on the distribution patterns of honey bees on squash flowers. Conclusively, bumble bee visitation caused an increase in elapsed time before flowers were visited again by a honey bee, a behavioral avoidance by a newly-arriving honey bee to select flowers occupied by bumble bees, and a shortened length of time the honey bee takes to examine and collect floral resources. The number of overall bumble bees on squash flowers was the most important factor explaining the difference in the distribution patterns of honey bees at the community level. Furthermore, decline in the number of overall bumble bees on the squash flowers resulted in an increase in the number of overall honey bees. Therefore, our study suggests that bee interactions provide an opportunity to enhance the resilience of ecosystem pollination services against the decline in pollinator diversity.

  13. T cell lymphoblastic lymphoma/leukemia within an adrenocorticotropic hormone and thyroid stimulating hormone positive pituitary adenoma: A cytohistological correlation emphasizing importance of intra-operative squash smear.

    Science.gov (United States)

    Gupta, Rakesh K; Saran, Ravindra K; Srivastava, Arvind K; Jagetia, Anita; Garg, Lalit; Sharma, Mehar C

    2017-08-01

    We present a rare case of primary pituitary T cell lymphoma/leukemia (T-LBL) in association with adrenocorticotropic hormone (ACTH) and thyroid stimulating hormone (TSH) expressing pituitary adenoma in a 55-year-old woman highlighting the importance of intra-operative squash smears examination. The patient presented with complaints of headache, diminution of vision and recent onset altered sensorium. MRI revealed a mass lesion in the sellar-suprasellar region with non-visualization of pituitary gland separately, extending to involve adjacent structures diagnosed as invasive pituitary macroadenoma. Intra-operative tissue was sent for squash smear examination. The cytology showed a tumor comprising of sheets of immature lymphoid cells intermixed with clusters of pituitary acinar cells with many mitoses and tingible body macrophages. A diagnosis of presence of immature lymphoid cells within the pituitary was offered and differentials of infiltration by lymphoma cells from systemic disease versus primary central nervous lymphoma-like lymphoma arising in the pituitary adenoma were considered. Later paraffin section examination and immunohistochemistry corroborated with the squash findings and a final diagnosis of primary pituitary T cell lymphoma/leukemia in association with ACTH and TSH expressing pituitary adenoma was made. To date, only six cases of primary pituitary T cell lymphomas, including three T-LBL cases, have been reported. This is the seventh case and first one additionally describing cytohistological correlation and importance of intra-operative cytology. © 2017 Japanese Society of Neuropathology.

  14. FERMENTATION BY Lactobacillus paracasei OF GALACTOOLIGOSACCHARIDES AND LOW-MOLECULAR-WEIGHT CARBOHYDRATES EXTRACTED FROM SQUASH (Curcubita maxima AND LUPIN (Lupinus albus SEEDS

    Directory of Open Access Journals (Sweden)

    María I. Palacio

    2014-02-01

    Full Text Available The in vitro prebiotic activity of galactooligosaccharides (GOS and low-molecular-weight carbohydrates (LMWC extracted from lupin and squash seeds on the growth of Lactobacillus paracasei BGP1 was studied. To this end, the change in cell density after 24 h of L. paracasei growth on 1% (w/v glucose, 1% (w/v raffinose, 1% (w/v commercial inulin GR, 1% (w/v lupin extract, and 1% (w/v squash extract relative to the change in cell density of a mixture of enteric strains under the same culture conditions were evaluated. Additionally, the principal components of GOS and LMWC in the extracts were identified using Thin Layer Chromatography. The highest prebiotic activity score was for L. paracasei grown on squash extract (0.55±0.03, followed by lupin extract (0.49±0.02, inulin (0.38±0.05 and raffinose (0.37±0.05. These results will contribute to selecting plant species as potential sources of prebiotic ingredients for the development of functional foods.

  15. Inheritance of rol-genes from Agrobacterium rhizogenes through two generations in Kalanchoë

    DEFF Research Database (Denmark)

    Lütken, Henrik Vlk; Wallström, Saba Victoria; Jensen, Erik Bjørn

    2012-01-01

    observed in the T1 generation was inherited to the offspring. F1 lines were produced by crossing the commercial Kalanchoë cultivar ‘Sarah’ with a selected T1 line. Subsequently, F2 populations were produced by self-pollination of individual selected lines. The rol-genes were inherited to the progeny...... and the presence of rol-genes was confirmed in all F1 and many F2 plant lines exhibiting dwarfism. Screening of F1 and F2 plants showed that the rol-genes were inherited together. Besides decreased plant height, several F1 and F2 lines containing rol-genes exhibited changes in plant diameter, number of branches...

  16. Involvement of ethylene biosynthesis and signalling in fruit set and early fruit development in zucchini squash (Cucurbita pepo L.).

    Science.gov (United States)

    Martínez, Cecilia; Manzano, Susana; Megías, Zoraida; Garrido, Dolores; Picó, Belén; Jamilena, Manuel

    2013-09-22

    We have identified a kind of parthenocarpy in zucchini squash which is associated with an incomplete andromonoecy, i.e. a partial conversion of female into bisexual flowers. Given that andromonoecy in this and other cucurbit species is caused by a reduction of ethylene production in the female flower, the associated parthenocarpic development of the fruit suggested the involvement of ethylene in fruit set and early fruit development. We have compared the production of ethylene as well as the expression of 13 ethylene biosynthesis and signalling genes in pollinated and unpollinated ovaries/fruits of two cultivars, one of which is parthenocarpic (Cavili), while the other is non-parthenocarpic (Tosca). In the latter, unpollinated ovaries show an induction of ethylene biosynthesis and ethylene signal transduction pathway genes three days after anthesis, which is concomitant with the initiation of fruit abortion and senescence. Fruit set and early fruit development in pollinated flowers of both cultivars and unpollinated flowers of Cavili is coupled with low ethylene biosynthesis and signalling, which would also explain the partial andromonoecy in the parthenocarpic genotype. The reduction of ethylene production in the ovary cosegregates with parthenocarpy and partial andromonoecy in the selfing progeny of Cavili. Moreover, the induction of ethylene in anthesis (by ethephon treatments) reduced the percentage of bisexual parthenocarpic flowers in Cavili, while the inhibition of ethylene biosynthesis or response (by AVG and STS treatments) induces not only andromonoecy but also the parthenocarpic development of the fruit in both cultivars. Results demonstrate that a reduction of ethylene production or signalling in the zucchini flower is able to induce fruit set and early fruit development, and therefore that ethylene is actively involved in fruit set and early fruit development. Auxin and TIBA treatments, inducing fruit set and early fruit development in this species

  17. Use of visible and near-infrared spectroscopy for predicting antioxidant compounds in summer squash (Cucurbita pepo ssp pepo).

    Science.gov (United States)

    Blanco-Díaz, María Teresa; Del Río-Celestino, Mercedes; Martínez-Valdivieso, Damián; Font, Rafael

    2014-12-01

    The food industry and plant breeding programmes require fast, clean and low-cost screening techniques for nutritional compounds determination in food matrices. This is the first report on the study of the potential of near-infrared spectroscopy (NIRS) for the prediction of antioxidant compounds in summer squash tissues collected since 2009-2012. Modified partial least-squares (MPLS) regression was used to correlate spectral information and the different antioxidant compounds in the samples. The coefficients of determination in the external validation (r(2)ev) obtained were for ascorbic acid (0.77 and 0.86), chlorophyll a (0.79 and 0.66), chlorophyll b (0.86 and 0.79) and total phenolic compounds (0.65 and 0.68) in exocarp and mesocarp tissues, respectively, supporting that NIRS is able to predict in a rapid way these components for screening purposes. Major wavelengths influencing the calibration equations showed that chromophores as well as fibre components of the fruits highly participated in developing the NIR equations. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. The responses of antioxidant system in bitter melon, sponge gourd, and winter squash under flooding and chilling stresses

    Science.gov (United States)

    Do, Tuong Ha; Nguyen, Hoang Chinh; Lin, Kuan-Hung

    2018-04-01

    The objective of this paper was to review the responses of antioxidant system and physiological parameters of bitter melon (BM), sponge gourd (SG), and winter squash (WS) under waterlogged and low temperature conditions. The BM and SG plants were subjected to 0-72 h flooding treatments, and BM and WS plants were exposed to chilling at 12/7 °C (day/night) for 0-72 h. Different genotypes responded differently to environmental stress according to their various antioxidant system and physiological parameters. Increased ascorbate peroxidase (APX) and superoxide dismutase (SOD) activities provided SG and WS plants with increased waterlogging and chilling stress tolerance, respectively, compared to BM plants. The APX gene from SG and the SOD gene from WS were then cloned, and the regulation of APX and SOD gene expressions under flooding and chilling stress, respectively, were also measured. Increased expression of APX and SOD genes was accompanied by the increased activity of the enzyme involved in detoxifying reactive oxygen species (ROS) in response to those stresses. Both APX and SOD activities can be used for selecting BM lines with the best tolerances to water logging and chilling stresses.

  19. Activity of β-Galactosidase and Polygalacturonase in Zucchini Squash (Cucurbita pepo L. Stored at Low Temperatures

    Directory of Open Access Journals (Sweden)

    René Renato Balandrán-Quintana

    2007-01-01

    Full Text Available When fruits are exposed to chilling temperatures, enzymatic systems are affected and normal cell metabolism is altered; cell wall enzymes are the least studied in this respect. Our objective is to determine the effect of storage temperature and/or kind of tissue on the activity of the enzymes polygalacturonase (PG and β-galactosidase (β-gal in zucchini squash (Cucurbita pepo L. subjected to 2.5 and/or 12 °C for 16 days. Exocarp and endocarp samples were analyzed every 4 days for PG and β-gal activities. The highest β-gal activity was found in the exocarp at 12 °C; in both tissues β-gal decreased with time at 2.5 °C, but increased at 12 °C. PG activity was higher in the endocarp (highest activity at 2.5 °C than in the exocarp (highest activity at 12 °C. It was concluded that PG activity in the exocarp constitutes an adequate system for studying the relationship between chilling injury and cell wall biological activity.

  20. Edge Principal Components and Squash Clustering: Using the Special Structure of Phylogenetic Placement Data for Sample Comparison

    Science.gov (United States)

    Matsen IV, Frederick A.; Evans, Steven N.

    2013-01-01

    Principal components analysis (PCA) and hierarchical clustering are two of the most heavily used techniques for analyzing the differences between nucleic acid sequence samples taken from a given environment. They have led to many insights regarding the structure of microbial communities. We have developed two new complementary methods that leverage how this microbial community data sits on a phylogenetic tree. Edge principal components analysis enables the detection of important differences between samples that contain closely related taxa. Each principal component axis is a collection of signed weights on the edges of the phylogenetic tree, and these weights are easily visualized by a suitable thickening and coloring of the edges. Squash clustering outputs a (rooted) clustering tree in which each internal node corresponds to an appropriate “average” of the original samples at the leaves below the node. Moreover, the length of an edge is a suitably defined distance between the averaged samples associated with the two incident nodes, rather than the less interpretable average of distances produced by UPGMA, the most widely used hierarchical clustering method in this context. We present these methods and illustrate their use with data from the human microbiome. PMID:23505415

  1. Effect of squash seed meal (Cucurbita moschata on broiler performance, sensory meat quality, and blood lipid profile

    Directory of Open Access Journals (Sweden)

    YM Aguilar

    2011-12-01

    Full Text Available In this experiment, 240 Cobb-500® broilers reared from1 to 49 days, and distributed according to a completely experimental randomized design with four treatments of four replicates each in order to evaluate the effect of the dietary inclusion of 0, 33, 66 or 100 g/kg of squash seed meal (SSM (Cucurbita moschata on the performance, carcass yield, serum lipid profile and sensory meat quality of broilers. Significant differences (p<0.05 were detected in performance, carcass weight, weight and breast yield, and leg weight. The best results were obtained with 33 and 66 g/kg as compared to the control diet and 100 g SSM /kg. Abdominal fat decreased with the inclusion of 66 and 100 g SSM / kg, but the sensory quality of breast and thighs was not affected by the inclusion of SSM. The serum levels of total cholesterol, very low density (VLDL and low density (LDL lipoproteins, triglycerides, glucose and atherogenic index decreased with the inclusion of 100 g/kg of SSM, except for high density lipoproteins (HDL, which increased. The inclusion of 0, 33, 66 and 100 g/kg of SSM in broiler diets, partially replacing soybean meal and vegetable oil, improved live performance and edible portions yield. In addition, abdominal fat and serum levels of harmful lipids were reduced, whereas serum levels of beneficial lipids increased. There was no effect on meat sensory quality.

  2. Radionuclide concentrations in pinto beans, sweet corn, and zucchini squash grown in Los Alamos Canyon at Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Fresquez, P.R.; Mullen, M.A.; Naranjo, L. Jr.; Armstrong, D.R.

    1997-05-01

    Pinto beans, sweet corn, and zucchini squash (Cucurbita pepo var. black beauty) were grown in a randomized complete-block field/pot experiment at a site that contained the highest observed levels of surface gross gamma radioactivity within Los Alamos Canyon (LAC) at Los Alamos National Laboratory. Soils as well as washed edible and nonedible crop tissues were analyzed for various radionuclides and heavy metals . Most radionuclides, with the exception of 3 H and tot U, in soil from LAC were detected in significantly higher concentrations (p -1 . This dose was below the International Commission on Radiological Protection permissible dose limit (PDL) of 100 mrem y -1 from all pathways; however, the addition of other internal and external exposure route factors may increase the overall dose over the PDL. Also, the risk of an excess cancer fatality, based on 74 mrem y -1 , was 3.7 x 10 -5 (37 in a million), which is above the Environmental Protection Agency's (acceptable) guideline of one in a million. 31 refs., 15 tabs

  3. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

    Science.gov (United States)

    Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

    2013-09-01

    Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

  4. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth M. Castro

    2013-09-01

    Full Text Available Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1 was obtained from a chayote (S. edule leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV and Pepper golden mosaic virus (PepGMV were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV infecting chayote in the Western Hemisphere.

  5. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash

    Science.gov (United States)

    Holdsworth, William L.; LaPlant, Kyle E.; Bell, Duane C.; Jahn, Molly M.; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection. PMID:27936008

  6. Combining ability of summer-squash lines with different degrees of parthenocarpy and PRSV-W resistance.

    Science.gov (United States)

    Nogueira, Douglas Willian; Maluf, Wilson Roberto; Dos Reis Figueira, Antonia; Maciel, Gabriel Mascarenhas; Gomes, Luiz Antonio Augusto; Benavente, Cesar Augusto Ticona

    2011-10-01

    The aim was to assess heterosis in a set of 16 summer-squash hybrids, and evaluate the combining capacity of the respective parental lines, which differed as to the degree of parthenocarpy and resistance to PRSV-W (Papaya Ringspot Virus-Watermelon strain). The hybrids were obtained using a partial diallel cross design (4 × 4). The lines of parental group I were 1 = ABX-037G-77-03-05-01-01-bulk, 2 = ABX-037G-77-03-05-03-10-bulk, 3 = ABX-037G-77-03-05-01-04-bulk and 4 = ABX-037G-77-03-05-05-01-bulk, and of group II, 1' = ABX-037G-77-03-05-04-08-bulk, 2' = ABX-037G-77-03-05-02-11-bulk, 3' = Clarice and 4' = Caserta. The 16 hybrids and eight parental lines were evaluated for PRSV-W resistance, parthenocarpic expression and yield in randomized complete-block designs, with three replications. Parthenocarpy and the resistance to PRSV-W were rated by means of a scale from 1 to 5, where 1 = non-parthenocarpic or high resistance to PRSV-W, and 5 = parthenocarpic or high susceptibility to PRSV-W. Both additive and non-additive gene effects were important in the expression of parthenocarpy and resistance to PRSV-W. Whereas estimates of heterosis in parthenocarpy usually tended towards a higher degree, resistance to PRSV-W was towards higher susceptibility. At least one F(1) hybrid was identified with a satisfactory degree of parthenocarpy, resistance to PRSV-W and high fruit-yield.

  7. Winter squash (Cucurbita moschata Duch fruit as a source of biologically active components after its thermal treatment

    Directory of Open Access Journals (Sweden)

    Andrea Mendelova

    2017-01-01

    Full Text Available To one of the most valuable pumpkin fruit belongs winter squash (Cucurbita moschata Duch. The aim of this work was to assess the quality of C. moschata fruit and to assess the dynamics of compositional changes after the heat treatment of the pulp. We used six varieties Liscia, Orange, Hannah, UG 201 F1, Waltham, Serpentine. In the samples were analyzed carbohydrate content (glucose, fructose and sucrose, total polyphenols, total carotenoids and antioxidant activity. The fresh pulp and pulp after the heat treatment were observed. Content of carbohydrates was determined by FTIR infrared spectroscopy. Content of total carotenoids, polyphenols and antioxidant activity was determined by spectrophotometry. As the dominant sugar was found to be sucrose. The lowest content of all carbohydrates was found in the variety Serpentine. Fructose content ranged from 7.59 to 12.32 g.100 g-1 dry matter, glucose content from 7.23 to 9.79 g.100 g-1 dry matter and sucrose content 38.67 to 55.94 g.100 g-1 dry matter. After processing there was found a decrease in the sucrose and the slight increase in glucose and fructose content. Total carotenoid content in fruits ranged from 39.01 to 97.67 g mg.100 g-1 dry matter, the content of total polyphenols from 443.98 to 565.44 mg GAE.100 g-1 dry matter and antioxidant activity from 680.18 to 851.87 mg AA.100 g-1 dry matter. After the heat treatment, there was found some decrease in total carotenoids, polyphenols and antioxidant activity as well.

  8. Combining ability of summer-squash lines with different degrees of parthenocarpy and PRSV-W resistance

    Directory of Open Access Journals (Sweden)

    Douglas Willian Nogueira

    2011-01-01

    Full Text Available The aim was to assess heterosis in a set of 16 summer-squash hybrids, and evaluate the combining capacity of the respective parental lines, which differed as to the degree of parthenocarpy and resistance to PRSV-W (Papaya Ringspot Virus-Watermelon strain. The hybrids were obtained using a partial diallel cross design (4 x 4. The lines of parental group I were 1 = ABX-037G-77-03-05-01-01-bulk, 2 = ABX-037G-77-03-05-03-10-bulk, 3 = ABX-037G77-03-05-01-04-bulk and 4 = ABX-037G-77-03-05-05-01-bulk, and of group II, 1' = ABX-037G-77-03-05-04-08-bulk, 2' = ABX-037G-77-03-05-02-11-bulk, 3' = Clarice and 4' = Caserta. The 16 hybrids and eight parental lines were evaluated for PRSV-W resistance, parthenocarpic expression and yield in randomized complete-block designs, with three replications. Parthenocarpy and the resistance to PRSV-W were rated by means of a scale from 1 to 5, where 1 = non-parthenocarpic or high resistance to PRSV-W, and 5 = parthenocarpic or high susceptibility to PRSV-W. Both additive and non-additive gene effects were important in the expression of parthenocarpy and resistance to PRSV-W. Whereas estimates of heterosis in parthenocarpy usually tended towards a higher degree, resistance to PRSV-W was towards higher susceptibility. At least one F1 hybrid was identified with a satisfactory degree of parthenocarpy, resistance to PRSV-W and high fruit-yield.

  9. Cultivar-Based Introgression Mapping Reveals Wild Species-Derived Pm-0, the Major Powdery Mildew Resistance Locus in Squash.

    Science.gov (United States)

    Holdsworth, William L; LaPlant, Kyle E; Bell, Duane C; Jahn, Molly M; Mazourek, Michael

    2016-01-01

    Powdery mildew is a major fungal disease on squash and pumpkin (Cucurbita spp.) in the US and throughout the world. Genetic resistance to the disease is not known to occur naturally within Cucurbita pepo and only infrequently in Cucurbita moschata, but has been achieved in both species through the introgression of a major resistance gene from the wild species Cucurbita okeechobeensis subsp. martinezii. At present, this gene, Pm-0, is used extensively in breeding, and is found in nearly all powdery mildew-resistant C. pepo and C. moschata commercial cultivars. In this study, we mapped C. okeechobeensis subsp. martinezii-derived single nucleotide polymorphism (SNP) alleles in a set of taxonomically and morphologically diverse and resistant C. pepo and C. moschata cultivars bred at Cornell University that, by common possession of Pm-0, form a shared-trait introgression panel. High marker density was achieved using genotyping-by-sequencing, which yielded over 50,000 de novo SNP markers in each of the three Cucurbita species genotyped. A single 516.4 kb wild-derived introgression was present in all of the resistant cultivars and absent in a diverse set of heirlooms that predated the Pm-0 introgression. The contribution of this interval to powdery mildew resistance was confirmed by association mapping in a C. pepo cultivar panel that included the Cornell lines, heirlooms, and 68 additional C. pepo cultivars and with an independent F2 population derived from C. okeechobeensis subsp. martinezii x C. moschata. The interval was refined to a final candidate interval of 76.4 kb and CAPS markers were developed inside this interval to facilitate marker-assisted selection.

  10. Faba Greens, Globe Artichoke’s Offshoots, Crenate Broomrape and Summer Squash Greens: Unconventional Vegetables of Puglia (Southern Italy With Good Quality Traits

    Directory of Open Access Journals (Sweden)

    Massimiliano Renna

    2018-03-01

    Full Text Available Globe artichoke (Cynara cardunculus L. subsp. [L.] scolymus Hayek, summer squash (Cucurbita pepo L. and faba bean (Vicia faba L. are widely cultivated for their immature inflorescences, fruits and seeds, respectively. Nevertheless, in some areas of Puglia (Southern Italy, other organs of these species are traditionally used as vegetables, instead of being considered as by-products. Offshoots (so-called cardoni or carducci of globe artichoke, produced during the vegetative growing cycle and removed by common cultural procedures, are used like to the cultivated cardoons (C. cardunculus L. var. altilis DC. The stems, petioles, flowers and smaller leaves of summer squash are used as greens (so-called cime di zucchini, like other leafy vegetables such as chicory (Cichorium intybus L. and Swiss chard (Beta vulgaris L.. Also the plant apex of faba bean, about 5–10 cm long, obtained from the green pruning, are used as greens (so-called cime di fava like spinach leaves. Moreover, crenate broomrape (Orobanche crenata Forssk., a root parasite plant that produces devastating effects on many crops (mostly legumes, is used like asparagus (Asparagus officinalis L. to prepare several traditional dishes. In this study ethnobotanical surveys and quality assessment of these unconventional vegetables were performed. For their content of fiber, offshoots of globe artichokes can be considered a useful food to bowel. Summer squash greens could be recommended as a vegetable to use especially in the case of hypoglycemic diets considering both content and composition of their carbohydrates. For their low content of nitrate, faba greens could be recommended as a substitute of nitrate-rich leafy vegetables. Crenate broomrape shows a high antioxidant activity and may be considered as a very nutritious agri-food product. Overall, the results of the present study indicate that offshoots of globe artichoke, summer squash greens, faba greens and crenate broomrape have good

  11. Effect of different levels of water consumptive use of squash under drip irrigation system on salt distribution, yield and water use efficiency

    International Nuclear Information System (INIS)

    Abd El-Moniem, M.; El-Gendy, R.W.; Gadalla, A.M.; Hamdy, A.; Zeedan, A.

    2006-01-01

    This study aims to trace the distribution of salts and fertilizers through drip irrigation system and the response of squash (yield and water use efficiency) to irrigation treatments, i.e. T1 (100 % ETc), T2 (75 % ETc) and T3 (50 % ETc). This study was carried out in Inshas sandy soil at the farm of Soil and Water Research Department, Nuclear Research Centre, Atomic Energy Authority, Egypt. Soil samples were taken from three sites (0, 12.5 and 25 cm distance from the emitters between drippers and laterals lines) for evaluating the salt content (horizontal and vertical directions within the soil depths). The obtained data pointed out that salt accumulation was noticed at the surface layer and was affected by the direction of soil water movement (horizontal and vertical motion). The highest salt concentrations were in 75 % and 50 % ETc treatments between emitters and laterals. As for the three sites, salt concentration behaved in the sequence: 25 >12.5 > 0 cm sites. For squash yield, the first treatment produced high yield without significant differences between the second treatment so, 75 % ETc treatment was considered the best one for saving water

  12. Towards a better understanding of the overall health impact of the game of squash: automatic and high-resolution motion analysis from a single camera view

    Directory of Open Access Journals (Sweden)

    Brumann Christopher

    2017-09-01

    Full Text Available In this paper, we present a method for locating and tracking players in the game of squash using Gaussian mixture model background subtraction and agglomerative contour clustering from a calibrated single camera view. Furthermore, we describe a method for player re-identification after near total occlusion, based on stored color- and region-descriptors. For camera calibration, no additional pattern is needed, as the squash court itself can serve as a 3D calibration object. In order to exclude non-rally situations from motion analysis, we further classify each video frame into game phases using a multilayer perceptron. By considering a player’s position as well as the current game phase we are able to visualize player-individual motion patterns expressed as court coverage using pseudo colored heat-maps. In total, we analyzed two matches (six games, 1:28h of high quality commercial videos used in sports broadcasting and compute high resolution (1cm per pixel heat-maps. 130184 manually labeled frames (game phases and player identification show an identification correctness of 79.28±8.99% (mean±std. Game phase classification is correct in 60.87±7.62% and the heat-map visualization correctness is 72.47±7.27%.

  13. Yield potential and fruit quality of scallop squash (Cucurbita pepo L. var. patissonina Greb. f. radiata Nois. cultivars grown for processing

    Directory of Open Access Journals (Sweden)

    Eugeniusz Kołota

    2015-10-01

    Full Text Available Scallop squash fruits may be harvested at different stages of development. Small size fruits, intended both for the fresh market and the food industry, have the highest biological value. This study was conducted to determine the yield potential of scallop squash cultivars (‘Polo F1’, ‘Disco’, ‘Gagat’, ‘Okra’, ‘Sunny Delight F1’ grown on mulched (black polyethylene foil or black agrotextile or unmulched soil, and harvested when fruits reached a diameter of 3–6 cm. Based on 3-year average data, the highest marketable and early yield was produced by ‘Sunny Delight F1’. This cultivar is also appreciated by consumers for its yellow colored skin of fruits. Another advantage of this cultivar was its high nutritional value expressed by the highest content of dry matter, vitamin C, polyphenols and minerals (K, P, Ca, Mg, with limited tendency to nitrate accumulation. Among the other cultivars tested, ‘Okra’ showed high yield potential, ‘Gagat’ was a rich source of carotenoids, and ‘Disco’ – polyphenols. Black polyethylene foil and black agrotextile appeared to be equally effective mulching materials. The benefit from the application of mulch was a significant increase in yield without any change in the chemical composition of the fruit.

  14. Effect of application timing and method on efficacy and phytotoxicity of 1,3-D, chloropicrin and metam-sodium combinations in squash plasticulture.

    Science.gov (United States)

    Desaeger, Johan A; Seebold, Kenneth W; Csinos, Alex S

    2008-03-01

    Metam-sodium, 1,3-dichloropropene (1,3-D) and chloropicrin are widely used soil fumigants. Combined application of metam-sodium and 1,3-D + chloropicrin is intended to improve efficacy and broaden spectrum of control, but little is known about the effect on crop safety. This study aimed to evaluate the effects of application timing of fumigant combinations on soilborne pest and disease control (nematodes, soil fungi and weeds) and growth of squash. Two separate tests with chisel-injected and drip-applied fumigant combinations and plant-back times ranging from 1 to 4 weeks were conducted in Tifton, GA, USA, in spring and fall 2002. Fumigant combinations using 1,3-D, chloropicrin and metam-sodium were as effective as methyl bromide in controlling Meloidogyne incognita (Kofoid & White) Chitwood, Pythium irregulare Buis., Rhizoctonia solani Kühn and Cyperus esculentus L. Chisel-applied combinations were more effective in terms of root-knot nematode control than drip-applied combinations. Root-knot nematode reduced squash yields by up to 60%. Phytotoxicity problems and lower yields were observed during spring, especially following 1,3-D + chloropicrin and when plant-back periods were shorter. The main problem with fumigant alternatives to methyl bromide may not be reduced efficacy but, in particular for 1,3-D products, loss of flexibility in terms of longer plant-back periods. (c) 2008 Society of Chemical Industry.

  15. Genome-wide identification and comparative analysis of grafting-responsive mRNA in watermelon grafted onto bottle gourd and squash rootstocks by high-throughput sequencing.

    Science.gov (United States)

    Liu, Na; Yang, Jinghua; Fu, Xinxing; Zhang, Li; Tang, Kai; Guy, Kateta Malangisha; Hu, Zhongyuan; Guo, Shaogui; Xu, Yong; Zhang, Mingfang

    2016-04-01

    Grafting is an important agricultural technique widely used to improve plant growth, yield, and adaptation to either biotic or abiotic stresses. However, the molecular mechanisms underlying grafting-induced physiological processes remain unclear. Watermelon (Citrullus lanatus L.) is an important horticultural crop worldwide. Grafting technique is commonly used in watermelon production for improving its tolerance to stresses, especially to the soil-borne fusarium wilt disease. In the present study, we used high-throughput sequencing to perform a genome-wide transcript analysis of scions from watermelon grafted onto bottle gourd and squash rootstocks. Our transcriptome and digital gene expression (DGE) profiling data provided insights into the molecular aspects of gene regulation in grafted watermelon. Compared with self-grafted watermelon, there were 787 and 3485 genes differentially expressed in watermelon grafted onto bottle gourd and squash rootstocks, respectively. These genes were associated with primary and secondary metabolism, hormone signaling, transcription factors, transporters, and response to stimuli. Grafting led to changes in expression of these genes, suggesting that they may play important roles in mediating the physiological processes of grafted seedlings. The potential roles of the grafting-responsive mRNAs in diverse biological and metabolic processes were discussed. Obviously, the data obtained in this study provide an excellent resource for unraveling the mechanisms of candidate genes function in diverse biological processes and in environmental adaptation in a graft system.

  16. Influência do tipo de corte na qualidade de abobrinha 'Menina Brasileira' minimamente processada Influence of cut type on quality of cv. 'Menina Brasileira' summer squash fresh-cut

    Directory of Open Access Journals (Sweden)

    Brígida M Vilas Boas

    2006-06-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito do tipo de corte na manutenção da qualidade de abobrinhas 'Menina Brasileira' minimamente processadas armazenadas sob refrigeração. As abobrinhas foram fatiadas ou raladas, sendo sanificadas com solução de hipoclorito de sódio 50 mg L-1 por 10 minutos. Estas foram acondicionadas em bandejas de polipropileno envoltas com filme de PVC (0,020 mm de espessura, e armazenadas em câmara fria (6ºC e 95% UR por 12 dias. As seguintes variáveis foram avaliadas: perda de massa, pH, sólidos solúveis (SS, valores L*, C* e hº, aparência e cor. O experimento foi conduzido em delineamento inteiramente casualizado em esquema fatorial (2x5, sendo dois tipos de corte (fatiada e ralada e cinco tempos de armazenamento (0, 3, 6, 9 e 12 dias. A perda de massa foi pequena, atingindo valores máximos de 1,5% para a abobrinha ralada. Os valores de pH foram menores a partir do 6º dia nas abobrinhas raladas quando comparadas às fatiadas. Após o 3º dia de armazenamento, as abobrinhas raladas apresentaram menores valores de SS em relação às abobrinhas fatiadas. Maiores valores L* foram encontrados nas abobrinhas fatiadas, observando-se um acréscimo ao longo do armazenamento. Abobrinha fatiada apresentou menores perdas de coloração, baseado nos valores h° e C* e melhor aceitabilidade quando avaliada sensorialmente em relação à ralada, com decréscimos nas notas com o armazenamento. O tipo de corte influencia a vida de prateleira de abobrinha minimamente processada sendo que as formas fatiada e ralada mantêm a aparência e as características físico-químicas até o 12º dia de armazenamento.The goal of this work was to evaluate the effect of the type of cut the on maintenance quality of fresh-cut 'Menina Brasileira' summer squash stored under refrigeration. Summer squashes were sliced or grated and sanitized with sodium hypochloride solution at 50 mg L-1 for 10 minutes. They were placed in

  17. Seleção para aumento de produtividade e qualidade de frutos em abobrinha 'Piramoita' comparando dois métodos de melhoramento Selection for fruit yield and quality in 'Piramoita' summer squash comparing two breeding methods

    Directory of Open Access Journals (Sweden)

    Antonio Ismael Inácio Cardoso

    2007-01-01

    improved populations after one (SR-1, two (SR-2 and three (SR-3 cycles. In the single seed descent (SSD, plants were selfed for five generations untill obtention and evaluation of S5 progenies. The nine best progenies were selected to obtain nine endogamous progenies (SSD-1 to SSD-9 and they were, also, inter-crossed to obtain a improved population by SSD (P-SSD. All obtained populations (SR-1, SR-2, SR-3, P-SSD, SSD-1 to SSD-9 and the original one (cv. Piramoita, resulting 14 treatments, were evaluated in a randomized block design, with six replications and five plants per plot. The following characteristics were evaluated: number and weight of fruits per plant, total and commercial, mean fruit weight and rate of commercial fruits. Improvements were obtained with increased commercial fruit yield along the recurrent selection cycles, and SR-3 population was superior to 'Piramoita' regarding fruit number per plant. It was obtained a SSD progeny better than the original population and as productive as SR-3 population. SSD method is a good alternative for summer squash breeding, allowing evaluation and selection of progenies, only when the progenies are practically homozygous rather than each year.

  18. Italian horticultural and culinary records of summer squash (Cucurbita pepo, Cucurbitaceae) and emergence of the zucchini in 19th-century Milan.

    Science.gov (United States)

    Lust, Teresa A; Paris, Harry S

    2016-07-01

    Summer squash, the young fruits of Cucurbita pepo, are a common, high-value fruit vegetable. Of the summer squash, the zucchini, C. pepo subsp. pepo Zucchini Group, is by far the most cosmopolitan. The zucchini is easily distinguished from other summer squash by its uniformly cylindrical shape and intense colour. The zucchini is a relatively new cultivar-group of C. pepo, the earliest known evidence for its existence having been a description in a book on horticulture published in Milan in 1901. For this study, Italian-language books on agriculture and cookery dating from the 16th to 19th centuries have been collected and searched in an effort to follow the horticultural development and culinary use of young Cucurbita fruits in Italy. The results indicate that Cucurbita fruits, both young and mature, entered Italian kitchens by the mid-16th century. A half-century later, round and elongate young fruits of C. pepo were addressed as separate cookery items and the latter had largely replaced the centuries-old culinary use of young, elongate bottle gourds, Lagenaria siceraria Allusion to a particular, extant cultivar of the longest fruited C. pepo, the Cocozelle Group, dates to 1811 and derives from the environs of Naples. The Italian diminutive word zucchini arose by the beginning of the 19th century in Tuscany and referred to small, mature, desiccated bottle gourds used as containers to store tobacco. By the 1840s, the Tuscan word zucchini was appropriated to young, primarily elongate fruits of C. pepo The Zucchini Group traces its origins to the environs of Milan, perhaps as early as 1850. The word zucchini and the horticultural product zucchini arose contemporaneously but independently. The results confirm that the Zucchini Group is the youngest of the four cultivar-groups of C. pepo subsp. pepo but it emerged approximately a half-century earlier than previously known. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

  19. O teste de frio sem solo em sementes de abóbora The modified cold germination test in squash seeds

    Directory of Open Access Journals (Sweden)

    Derblai Casaroli

    2006-12-01

    Full Text Available Este trabalho teve como objetivo determinar o período de exposição à baixa temperatura no teste de frio sem solo, para avaliação de diferentes potenciais fisiológicos em lotes de sementes de abóbora. Foram avaliados seis lotes de sementes de abóbora cultivar "Menina Brasileira" (Cucurbita moschata Duch. produzidas na safra 2003/2004. As sementes foram submetidas a diferentes períodos (três, cinco, sete e nove dias de exposição à baixa temperatura para condução do teste de frio sem solo, a uma temperatura constante de 10°C. Utilizou-se o delineamento inteiramente casualizado, em que os tratamentos constituíram um fatorial 6x4 (seis lotes e quatro períodos de exposição, com quatro repetições de 50 sementes. As médias foram comparadas pelo teste de Tukey em nível de 5% de probabilidade de erro. Realizou-se também o teste de correlação simples de Pearson .Os resultados permitiram concluir que o período de três dias de exposição à baixa temperatura foi o mais indicado para a condução do teste de frio sem solo em sementes de abóbora.This research was aimed at determining the exposition period at low temperature in the modified cold germination test, to evaluate physiological potential of squash seed lots. Six seed lots of squash, variety Menina Brasileira (Cucurbita moschata Duch., produced in 2003/2004, were submitted at different exposition times for the development of the cold test. The modified cold gernation test was carried out at 10°C of constant temperature, during exposition time of three, five, seven and nine days. A completely randomized desing was used to the cold test, 0 constituting a factorial 6x4, corresponding to the six seed lots and four exposition time (3, 5, 7, and 9 days, with four repetitions. The averages were compared by the Tukey test, at 5% of probability. The correlation test of Person (r was used too. For the modified cold germination test, the period of three days was the most

  20. Investigating differences in the root to shoot transfer and xylem sap solubility of organic compounds between zucchini, squash and soybean using a pressure chamber method.

    Science.gov (United States)

    Garvin, Naho; Doucette, William J; White, Jason C

    2015-07-01

    A pressure chamber method was used to examine differences in the root to shoot transfer and xylem sap solubility of caffeine (log Kow=-0.07), triclocarban (log Kow=3.5-4.2) and endosulfan (log Kow=3.8-4.8) for zucchini (cucurbita pepo ssp pepo), squash (cucurbita pepo ssp ovifera), and soybean (glycine max L.). Transpiration stream concentration factors (TSCF) for caffeine (TSCF=0.8) were statistically equivalent for all plant species. However, for the more hydrophobic endosulfan and triclocarban, the TSCF values for zucchini (TSCF=0.6 and 0.4, respectively) were 3 and 10 times greater than the soybean and squash (TSCF=0.2 and 0.05, respectively). The difference in TSCF values was examined by comparing the measured solubilities of caffeine, endosulfan and triclocarban in deionized water to those in soybean and zucchini xylem saps using a modified shake flask method. The measured solubility of organic contaminants in xylem sap has not previously been reported. Caffeine solubilities in the xylem saps of soybean and zucchini were statistically equal to deionized water (21500mgL(-1)) while endosulfan and triclocarban solubilities in the zucchini xylem sap were significantly greater (0.43 and 0.21mgL(-1), respectively) than that of the soybean xylem sap (0.31 and 0.11mgL(-1), respectively) and deionized water (0.34 and 0.11mgL(-1), respectively). This suggests that the enhanced root to shoot transfer of hydrophobic organics reported for zucchini is partly due to increased solubility in the xylem sap. Further xylem sap characterization is needed to determine the mechanism of solubility enhancement. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. THE EFFECT OF ETHREL ON THE DURATION OF FLOWERING OF MALE FLOWERS SQUASH PLANTS WITH DIFFERENT GENETIC EXPRESSIVENESS OF FLOWER GENDER IN THE KRASNODAR REGION CONDITION

    Directory of Open Access Journals (Sweden)

    R. A. Gish

    2016-01-01

    Full Text Available Depending on the genotype of monoecious plants Cucurbitaceae family may have different gender expressions: predominantly female, mixed and predominantlymale type of flowering. However, the degree of sexual differentiation can be changedunder the influence of abiotic and endogenous factors. Among the chemicals that affect the level of female flowering in pumpkin crops, preparations based on 2-chloroethylphosphonic acid (Ethephon or Etrelle are the most promising for hybrid seed production. Study of plant response of squash Cucurbita pepo var. giromontina with varying sex expressions on the treatments with Etrelle revealed common conformities and specificities of preparation action in the condition of Krasnodar region. It is shown the use of treatment once is not effective even if the high concentration range, 500-1100 mg/L, was taken. On gender switch was effectively influenced successive plant treatments with Etrelle at stages of 3-5 true leaves in a wide concentration range from 250 to 700 mg /L., where the restraining was that the start of male flower blossoming was 14-25 days after female flower blossoming. K69 line with predominantly female flowering was more responsive to the variation of concentration and frequency of treatments whereas the line K49 with male flowering was less responsive to the frequency of treatments. It is shown that in the range of effective concentrations, Etrelle may have phytotoxic effects on the growth and development of squash plants at the time of restraining flowering of male flowers. It is important to  ake that into account when choosing a regime of preparation treatments for chemical castration of maternal forms in hybrid seed production of this crop.

  2. Comparative analysis of three different of extraction protocols of total nucleic acids of squash (Cucurbita moschata) for the diagnosis from geminivirus

    International Nuclear Information System (INIS)

    Hernandez Jimenez, Eduardo

    2008-01-01

    The geminivirus constitute an important group of plant pathogens, characterized by an unusual morphology of the viral particle and its DNA. They have a paired icosahedral cover and a small circular genome of DNA simple band that is replicated, by DNA double band, in the nucleus of the infected cell of the plant. Many researchers have focused on the development and optimization of protocols for obtaining DNA or RNA of interest, because of rapid advances in molecular biology during the second half of the XX century and the beginning of XXI century, and to that the extraction and purification of nucleic acids is the first step mainly of the procedures in this area. The objective is to compare, by means of molecular techniques, the DNA purification in squash from different ways of storage and extraction protocols of total nucleic acids of the plant, in order to improve the quality and amount of genetic matters whereupon the detection and characterization of geminivirus are realised. Three methods were compared: i. Dellaporta and collaborators (1983), ii.- Doyle and Doyle (1990) and iii.- Jose and Usha (2000). The operation of the three methods scaled downward (15 milligrams of leaf tissue) and two ways of storage were evaluated: 1.- tubes with silica gel (SG, a desiccant) and 2.- frozen to -70 degrees Celsius. The method of Jose and Usha (2000) presented technical difficulties that not permitted to scale downward, for which it should work with the purification from a gram of foliar tissue. The integrity of the total DNA was verified superior in the material stored to -70 degrees celsius for all the methods, by means of electrophoresis in gels of agarose, besides that the protocol of Dellaporta et al. (1983) tends to enrich the RNA. The readings were similar for the methods of Dellaporta et al. (1983) and Doyle and Doyle (1993), this was evidenced upon quantifying the total DNA and that is extracted at least a 30% more of DNA from material in the desiccant with respect

  3. Sugar Composition and Molecular Weight Distribution of Cell Wall Polysaccharides in Outer and Inner Tissues from Segments of Dark Grown Squash (Cucurbita maxima Duch.) Hypocotyls.

    Science.gov (United States)

    Wakabayashi, K; Sakurai, N; Kuraishi, S

    1990-07-01

    The elongation growth of stem segments is determined by the outer cell layers (epidermis and collenchyma). We measured the sugar composition and molecular weight distribution of pectin and hemicellulose fractions obtained from inner and outer tissues of squash (Cucurbita maxima Duch.) hypocotyls. In addition, we studied the changes in these parameters after a 9 hour period of incubation of the segments. The results show that outer tissues have higher molecular weight pectin and hemicellulose compared to inner tissues (2-3 times higher). Incubation results in a 13 to 25% decrease in the amount of pectin and hemicellulose in inner tissues and an increase of 11 to 32% in the outer tissues. This increase in the outer tissues is accompanied by a decrease in the molecular weight of some of the components. These results clearly show that cell wall metabolism during elongation growth differs markedly in inner and outer tissues, and that future studies on the effect of auxin need to take these differences into account.

  4. Differential Effect of Auxin on Molecular Weight Distributions of Xyloglucans in Cell Walls of Outer and Inner Tissues from Segments of Dark Grown Squash (Cucurbita maxima Duch.) Hypocotyls.

    Science.gov (United States)

    Wakabayashi, K; Sakurai, N; Kuraishi, S

    1991-04-01

    Effects of indole-3-acetic acid (IAA) on the mechanical properties of cell walls and structures of cell wall polysaccharides in outer and inner tissues of segments of dark grown squash (Cucurbita maxima Duch.) hypocotyls were investigated. IAA induced the elongation of unpeeled, intact segments, but had no effect on the elongation of peeled segments. IAA induced the cell wall loosening in outer tissues as studied by the stress-relaxation analysis but not in inner tissues. IAA-induced changes in the net sugar content of cell wall fractions in outer and inner tissues were very small. Extracted hemicellulosic xyloglucans derived from outer tissues had a molecular weight about two times as large as in inner tissues, and the molecular weight of xyloglucans in both outer and inner tissues decreased during incubation. IAA substantially accelerated the depolymerization of xyloglucans in outer tissues, while it prevented that in inner tissues. These results suggest that IAA-induced growth in intact segments is due to the cell wall loosening in outer tissues, and that IAA-accelerated depolymerization of hemicellulosic xyloglucans in outer tissues is involved in the cell wall loosening processes.

  5. Sugar Composition and Molecular Weight Distribution of Cell Wall Polysaccharides in Outer and Inner Tissues from Segments of Dark Grown Squash (Cucurbita maxima Duch.) Hypocotyls 1

    Science.gov (United States)

    Wakabayashi, Kazuyuki; Sakurai, Naoki; Kuraishi, Susumu

    1990-01-01

    The elongation growth of stem segments is determined by the outer cell layers (epidermis and collenchyma). We measured the sugar composition and molecular weight distribution of pectin and hemicellulose fractions obtained from inner and outer tissues of squash (Cucurbita maxima Duch.) hypocotyls. In addition, we studied the changes in these parameters after a 9 hour period of incubation of the segments. The results show that outer tissues have higher molecular weight pectin and hemicellulose compared to inner tissues (2-3 times higher). Incubation results in a 13 to 25% decrease in the amount of pectin and hemicellulose in inner tissues and an increase of 11 to 32% in the outer tissues. This increase in the outer tissues is accompanied by a decrease in the molecular weight of some of the components. These results clearly show that cell wall metabolism during elongation growth differs markedly in inner and outer tissues, and that future studies on the effect of auxin need to take these differences into account. PMID:16667612

  6. ADUBAÇÃO MINERAL E ORGÂNICA DA ABÓBORA HÍBRIDA: CRESCIMENTO MINERAL AND ORGANIC FERTILIZER OF THE HYBRID SQUASH: GROWTH

    Directory of Open Access Journals (Sweden)

    Antônio Américo Cardoso

    2007-09-01

    Full Text Available

    Com finalidade de avaliar a resposta da abóbora híbrida cv. Tetsukabuto à adubação orgânica e mineral, foram realizados sete experimentos em Ponte Nova, Minas Gerais, em solo podzólico vermelho-amarelo câmbico fase terraço. Cada experimento constituiu uma época de amostragem, que foi iniciada aos 21 dias e encerrada aos 105 dias após a semeadura, com intervalos regulares de 14 dias. Nestes experimentos foram testados cinco tratamentos de adubação mais um tratamento controle (sem adubação. Nos tratamentos de adubação, definidos por meio de um corte em diagonal de um fatorial completo, foram aplicadas as doses de 0; 3; 6; 9 e 12 t/ha (base seca de composto orgânico de resíduo de suínos e bagaço de cana, juntamente com 0,772; 0,579; 0,386; 0,193 e 0 t/ha de adubo mineral NPK 4-14-8, respectivamente, em quatro repetições, no delineamento de blocos ao acaso. A substituição de parte da adubação mineral pela orgânica aumentou o número de nós da rama principal, o comprimento total da ramificação e os pesos das matérias secas da parte aérea, da parte reprodutiva e do fruto. A maior porcentagem de matéria seca no fruto e o menor crescimento vegetativo, aos 105 dias após a semeadura, foram obtidos quando toda a adubação mineral foi substituída pela orgânica.

    PALAVRAS-CHAVE: Moranga híbrida; Cucurbita maxima x C. moschata; crescimento.

    In order to evaluate the response of hybrid squash cv. Tetsukabuto to mineral (NPK and organic compost, seven experiments were carried out in Ponte Nova, State of Minas Gerais, Brazil, on a yellow-red cambic podsoil. Each experiment constituted one sampling date, which began at the 21st  day and ended at the 105th day after sowing, with 14 days intervals. In these experiments five

  7. Molecular and functional characterization of CpACS27A gene reveals its involvement in monoecy instability and other associated traits in squash (Cucurbita pepo L.).

    Science.gov (United States)

    Martínez, Cecilia; Manzano, Susana; Megías, Zoraida; Barrera, Alejandro; Boualem, Adnane; Garrido, Dolores; Bendahmane, Abdelhafid; Jamilena, Manuel

    2014-06-01

    A number of Cucurbita pepo genotypes showing instable monoecy or partial andromonoecy, i.e. an incomplete conversion of female into bisexual flowers, have been detected. Given that in melon and cucumber andromonoecy is the result of reduction of ethylene production in female floral buds, caused by mutations in the ethylene biosynthesis genes CmACS7 and CsACS2; we have cloned and characterized two related C. pepo genes, CpACS27A and CpACS27B. The molecular structure of CpACS27A and its specific expression in the carpels of female flowers during earlier stages of flower development suggests that this gene is the Cucurbita ortholog of CmACS7 and CsACS2. CpACS27B is likely to be a paralogous pseudogene since it has not been found to be expressed in any of the analyzed tissues. CpACS27A was sequenced in Bolognese (Bog) and Vegetable Spaghetti (Veg), two monoecious inbred lines whose F2 was segregating for partial andromonoecy. The Bog allele of CpACS27A carried a missense mutation that resulted in a substitution of the conserved serine residue in position 176 by an alanine. Segregation analysis indicated that this mutant variant is necessary but not sufficient to confer the andromonoecious phenotype in squash. In concordance with its involvement in stamen arrest, a reduction in CpACS27A expression has been found in bisexual flower buds at earlier stages of development. This reduction in CpACS27A expression was concomitant with a downregulation of other ethylene biosynthesis and signaling genes during earlier and later stages of ovary development. The role of CpACS27A is discussed regarding the regulation of ethylene biosynthesis and signaling genes in the control of andromonoecy-associated traits, such as the delayed maturation of corolla and stigma as well as the parthenocarpic development of the fruit.

  8. Alien DNA introgression and wheat DNA rearrangements in a stable wheat line derived from the early generation of distant hybridization.

    Science.gov (United States)

    Zhang, Lianquan; Liu, Dengcai; Yan, Zehong; Zheng, Youliang

    2005-10-01

    Polyploidy has been found to be common in plants. Bread or common wheat (Triticum aestivum L., 2n=42) is a good example of allopolyploid made up of three diploid genomes A, B and D. In recent years, by the study of mimicking the origination of common wheat, it was found that changes of DNA sequence and gene expression occurred at the early stages of artificial allohexaploid between tetraploid wheat and Aegilops tauschii, which was probably favorable to genetic diploidization of new synthetic hexaploid wheat. Common wheat 99L2 is a new line stable in genetic, which was derived from the early self-pollinated generation of wide hybrids between common wheat and rye. In this study, it was found that at least two rye DNA segments had been introgressed into 99L2. This result suggested that a mechanism of alien DNA introgression may exist, which was different from the traditional mechanism of chromosome pairing and DNA recombination between wheat and alien species. Meanwhile, during the introgression process of alien rye DNA segments, the changes in DNA sequences of wheat itself occurred.

  9. Transgenic expression of an unedited mitochondrial orfB gene product from wild abortive (WA) cytoplasm of rice (Oryza sativa L.) generates male sterility in fertile rice lines.

    Science.gov (United States)

    Chakraborty, Anirban; Mitra, Joy; Bhattacharyya, Jagannath; Pradhan, Subrata; Sikdar, Narattam; Das, Srirupa; Chakraborty, Saikat; Kumar, Sachin; Lakhanpaul, Suman; Sen, Soumitra K

    2015-06-01

    Over-expression of the unedited mitochondrial orfB gene product generates male sterility in fertile indica rice lines in a dose-dependent manner. Cytoplasmic male sterility (CMS) and nuclear-controlled fertility restoration are widespread developmental features in plant reproductive systems. In self-pollinated crop plants, these processes often provide useful tools to exploit hybrid vigour. The wild abortive CMS has been employed in the majority of the "three-line" hybrid rice production since 1970s. In the present study, we provide experimental evidence for a positive functional relationship between the 1.1-kb unedited orfB gene transcript, and its translated product in the mitochondria with male sterility. The generation of the 1.1-kb unedited orfB gene transcripts increased during flowering, resulting in low ATP synthase activity in sterile plants. Following insertion of the unedited orfB gene into the genome of male-fertile plants, the plants became male sterile in a dose-dependent manner with concomitant reduction of ATPase activity of F1F0-ATP synthase (complex V). Fertility of the transgenic lines and normal activity of ATP synthase were restored by down-regulation of the unedited orfB gene expression through RNAi-mediated silencing. The genetic elements deciphered in this study could further be tested for their use in hybrid rice development.

  10. Dinâmica de crescimento da abobrinha italiana em duas estações de cultivo = Growth dynamic of summer squash in two crop seasons.

    Directory of Open Access Journals (Sweden)

    André Samuel Strassburger

    2011-04-01

    Full Text Available O objetivo deste trabalho foi quantificar os índices de crescimento, a produção e a distribuição de matéria seca da cultura da abobrinha italiana cultivada em substrato de casca de arroz in natura com solução nutritiva recirculante, em duas épocas de cultivo: primavera-verão de 2005 e verão-outono de 2006, caracterizadas, respectivamente, como períodos de alta e baixa disponibilidades de radiação solar. Cada tratamento correspondeu a uma época de amostragem, sendo a produção de matéria seca quantificada aos 0, 18, 32, 46 e 68 dias após o transplante (DAT no cultivo de primavera-verão, e aos 0, 15, 29, 43 e 55 DAT no cultivo de verão-outono.A produção de matéria seca foi maior quando a disponibilidade de radiação solar foi mais elevada. Nessa situação (alta disponibilidade de radiação solar, os frutos caracterizaram-se como os maiores drenos da cultura, não ocorrendo o mesmo em condições de baixa disponibilidade de radiação solar. As taxas de crescimento (da cultura, dos frutos, dos órgãos vegetativos aéreos e relativa também foram mais elevadas quando a radiação solar disponível foi mais elevada. A razão de área foliar e a área foliar específica apresentaram dinâmicas semelhantes à taxa de crescimento relativo, decrescendo com o decorrer do período de cultivo.The objective of this work was to quantify the growth rates, dry matter production and distribution of summer squash grown in raw rice husk medium with recirculating nutrient solution, in two crop seasons:spring-summer 2005 and summer-autumn 2006, which are periods characterized by high and low solar radiation availability, respectively. Each treatment corresponded to a sampling date and dry matter production was evaluated at 18, 32, 46 and 68 days after setting (DAS in springsummer, and 15, 29, 43 and 55 DAS in the summer-autumn crop season. Dry matter production was highest in high solar radiation availability conditions. In those

  11. Produtividade de híbridos de abobrinha italiana cultivados sob diferentes coberturas de solo Yield of italian hibrid squash on different soil coverings

    Directory of Open Access Journals (Sweden)

    JR Olinik

    2011-03-01

    different types of materials for soil covering and its effect on fruits with virus symptoms and on the yield of two hybrids of squash. The experimental design was randomized blocks, with four replications. The treatments followed a split-plot cheme, evaluating six soil coverings (black, silver and white polyethylene, black polypropylene, rice husk and bare soil and two hybrids [(Novita Plus (cv. type Caserta and Samira (cv. type Libanese]. The technique of plastic soil covering, independently of the material used, was superior to bare soil. Among the materials the treatments using silver polyethylene promoted the highest yield and the lowest percentage of fruits with viruses in comparison to the other soil coverings. Among the hybrids, Novita Plus was superior to Samira in relation to the characteristics of fruit set, number of fruits per plants and yield, besides presenting 12% less fruits with virus symptoms in relation to Samira. For 'Novita Plus', the occurrence of virus symptoms began only at the eighth harvest on the treatments using silver and white polyethylene and rice husk. For 'Samira' the symptoms started at the second harvest on plants submitted to bare soil or black polypropylene and at fourth harvest on the other treatments.

  12. Effect of self-pollination monitored by microsatellite markers on maize kernel weight

    Directory of Open Access Journals (Sweden)

    Marcio Balestre

    2007-01-01

    Full Text Available The objective of this study was to evaluate the effect of fertilization by autopollen on maize kernel weight. Fivesingle cross hybrids (30F90. A2555, DKB333B, 2223, and 2324 were planted and hybrid leaf samples taken for DNAextraction. The crosses 2223XDKB333B; 2223XA2555; 2324XDKB333B and 2324XP30F90 were performed. Ten kernels ofeach ear of each cross were separated, sown in a greenhouse and the DNA of the respective seedlings was extracted, to identifythe kernel origin. The results obtained here demonstrated that allopollen increased the mean kernel weight by 16.5mg (gainof 4.65%. The proportion of sampled allopollen to self pollen was statistically equal, according to the c2 test, demonstratingthat there were no significant differences between the proportion of fertilized and sampled allopollen and autopollen in the ear.It was concluded that compared to autopollen, allopollen increases the mean weight of fertilized grain.

  13. Lack of floral nectar reduces self-pollination in a fly-pollinated orchid

    Czech Academy of Sciences Publication Activity Database

    Jersáková, Jana; Johnson, S.D.

    2006-01-01

    Roč. 147, - (2006), s. 60-68 ISSN 0029-8549 Institutional research plan: CEZ:AV0Z60870520 Keywords : geitonogamy * inbreeding depression * pollen dispersal Subject RIV: EF - Botanics Impact factor: 3.333, year: 2006

  14. Genetic Analysis for Some of Morphological Traits in Bread Wheat under Drought Stress Condition Using Generations Mean Analysis

    Directory of Open Access Journals (Sweden)

    Jamileh Abedi

    2015-06-01

    Full Text Available Perception of genes action controlling of quantitative traits is very important in genetic breeding methods the plant populations. to study and estimate the parameters of genetic and appointment the best genetically model for justification the genetic changing some of traits the bread wheat under drought stress condition, parents (P1 & P2 and F3, F4, F5 generations together the four control cultivars (Kharchia, Gaspard, Moghan and Mahuti were evaluated by generation mean analysis using a agoment design including six blocks. Generation mean analysis was performed for all traits with Mather and Jinks model using joint scaling test. Three parameter model [m d h] provided the best fit for all traits expect harvest index, main spike grain weight, number of grain per plant, Total spike weight of plant with significant at 5% and 1% levels . Though additive and dominance effect both had interfered in controlling often the traits but with attention to difference effects and variety component was determined that dominance is more impressive than additive effect for traits of number of tiller, main spike weight, grain yield and grain number of main spike. Therefore will benefit using of these traits in the collection and to improve these traits hybridization would be much efficient than the selection strategies. In this study additive Ч additive epistasis effect only observed for traits of Total spike weight of plant, number of grain per plant, main spike grain weight and harvest index and other traits hadn’t any epistasis effect that it was demonstration lack of existence the genes reciprocal effect in the inheritance studied traits. Therefore we can suggest that the selection strategies perform in terminal generations and additive Ч additive epistasis effect would be confirmed in selection under self-pollination condition.

  15. Crescimento e acúmulo de nutrientes pela abóbora híbrida tipo Tetsukabuto Growth and accumulation of nutrients in hybrid squash Tetsukabuto

    Directory of Open Access Journals (Sweden)

    Sanzio Mollica Vidigal

    2007-09-01

    Full Text Available Um experimento foi conduzido em Jaíba (MG para avaliar o crescimento e o acúmulo de nutrientes pela abóbora híbrida, cv. Suprema. As amostragens de plantas foram realizadas aos 28; 42; 56; 70; 84 e 98 dias após a semeadura (DAS para determinação da matéria seca das folhas, caule, flor, fruto e raiz. A planta teve lento crescimento até 56 DAS e a partir daí o crescimento intensificou-se até o final do ciclo. A produção total de matéria seca máxima ocorreu aos 89 DAS, atingindo 1.657,92 g planta-1. Os frutos acumularam mais matéria seca que outros órgãos da planta. A taxa de crescimento absoluto da planta e dos frutos foram 124,25 e 172,75 g planta-1 dia-1, aos 74 e 79 dias, respectivamente. A absorção de nutrientes seguiu o padrão da curva de acúmulo de matéria seca pelas plantas. O acúmulo de nutrientes foi reduzido nos primeiros 42 DAS, intensificando-se a partir daí, acumulando continuamente até o final do ciclo para N, S, Mg e os micronutrientes. O K foi o nutriente mais absorvido pela planta, seguido do N e Ca. A ordem de macronutrientes acumulados foi K>N>Ca>P>Mg>S e de micronutrientes foi Fe>Mn>Zn>Cu. Na colheita, aos 98 DAS, 69% da matéria seca alocou-se nos frutos, 19% nas folhas, 8% no caule, e o restante nas flores e raízes. Os nutrientes N, K, S e Cu acumularam-se preferencialmente nos frutos, enquanto o P, Ca, Mg, Zn, Fe e Mn na parte vegetativa. Os frutos exportaram 51,0 kg ha-1 de N; 12,4 kg ha-1 de P; 61,4 kg ha-1 de K; 3,6 kg ha-1 de S; 8,8 kg ha-1 de Ca e 3,5 kg ha-1 de Mg, e 11,4 g ha-1 de Cu; 61,6 g ha-1 de Zn; 126,6 g ha-1 de Fe e 44,3 g ha-1 de Mn.An experiment was carried out at Jaíba, Northern Minas Gerais State, to evaluate the growth and accumulation of nutrients in hybrid squash cv. Suprema. The samplings of plants were taken at 28; 42; 56; 70; 84, and 98 days after the sowing (DAS for dry matter determination of leaves, stem, flower, fruit and root. The plants grew slowly up the 56 DAS

  16. Efeito de injúrias mecânicas na qualidade de abobrinhas armazenadas em condição ambiente Effect of mechanical injuries on the quality of squash stored at room temperature

    Directory of Open Access Journals (Sweden)

    Maria Fernanda Berlingieri Durigan

    2007-06-01

    Full Text Available Foram avaliados os efeitos de diferentes injúrias mecânicas na qualidade de abobrinhas verdes cv. caipira, em três tipos de lesões: por impacto, compressão e corte. No impacto os frutos foram soltos em queda livre de uma altura de 1,60 m duas vezes (uma batida de cada lado do fruto, a compressão foi feito pela pressão de um peso de 58,8 N por 1 hora e o corte (6 cm de comprimento e 2 mm de profundidade, em triplicata em 2 lados dos frutos efetuado com uma faca apropriada. Após esses tratamentos, os frutos injuriados e os do controle (intactos foram armazenados em condições de ambiente (25°C, 65% UR. As avaliações foram feitas a cada 3 dias, determinando-se atividade respiratória, aparência, perda de massa, pH, teores de sólidos solúveis, acidez titulável, ácido ascórbico, amido e carboidratos solúveis. Durante o período de armazenamento, de 15 dias, as lesões mostraram-se prejudiciais à qualidade, afetando distintamente os parâmetros químicos, a aparência, e diminuindo os dias de possível comercialização dos frutos, em especial naqueles submetidos ao corte e ao impacto. Estas injúrias também ocasionaram maior atividade respiratória dos frutos. A perda de massa fresca foi agravada quando os frutos foram submetidos ao corte. A injúria por impacto e por corte foram as mais prejudiciais para a qualidade das abobrinhas 'Caipira'.The effects of different mechanical injuries were evaluated on green squash cv. Caipira, such as impact, compression and cut. The impact injury was done by dropping the fruit from a height of 1.60 m on a hard and plain surface. Compression was made by pressing a weight of 58.8 N on the squash fruit for 1 hour and the cut was done by using a knife to make wounds (2 mm deep and 6 cm length three times in both sides of the fruits. Injuried and intact fruits were stored at room temperature (25ºC, 65% RH. Evaluations were done every three days, measuring the respiratory activity, appearance, loss

  17. 'Brasileirinha': cultivar de abóbora (Cucurbita moschata de frutos bicolores com valor ornamental e aptidão para consumo verde 'Brasileirinha': an ornamental bicolor squash (Cucurbita moschata cultivar for immature fruit consumption

    Directory of Open Access Journals (Sweden)

    Leonardo S Boiteux

    2007-03-01

    Full Text Available 'Brasileirinha' é uma cultivar de abóbora (Cucurbita moschata com frutos bicolores que foi desenvolvida com o objetivo de disponibilizar um produto diferenciado devido ao aspecto ornamental e a composição nutricional de seus frutos. Esta cultivar foi selecionada na geração F7, sendo obtida via cruzamentos convencionais entre um acesso de frutos bicolores, provavelmente devido à presença de um alelo do gene B, e a cultivar Mocinha (com frutos imaturos de cor verde uniforme. A característica peculiar da cultivar Brasileirinha é a produção de frutos com casca apresentando uma marcante coloração bicolor (coloração amarela na região proximal e verde na posição distal dos frutos. A polpa apresenta coloração amarela-esverdeada em frutos colhidos imaturos e, à medida que o fruto amadurece, intensifica-se uma coloração alaranjada. Beta-caroteno e luteína são os principais carotenóides presentes em frutos para consumo verde. Em frutos em completo estádio de maturação (polpa laranja intensa verifica-se a acumulação de beta-caroteno e alfa-caroteno (precursores da vitamina A em torno de 243 mg g-1. A cultivar Brasileirinha tem apresentado boa resistência de campo a diferentes raças de oídio (Podosphaera xanthii. Esta cultivar é preferencialmente recomendada para consumo como abobrinha verde (no estádio de fruto imaturo e para fins ornamentais (frutos em todos os estádios. Uma opção é o uso de frutos jovens em conservas. A cultivar Brasileirinha é recomendada para plantio em todas as tradicionais regiões produtoras do país. O sistema de produção para esta cultivar tem sido o mesmo adotado para outros tipos de abóboras.'Brasileirinha' is a squash (Cucurbita moschata cultivar developed by Embrapa Vegetable Crops, with a appealing ornamental appearance and carotenoid composition of its fruits might provide raw material for the development of value-added products targeting new market niches. This cultivar is an F7

  18. Differential Effect of Auxin on Molecular Weight Distributions of Xyloglucans in Cell Walls of Outer and Inner Tissues from Segments of Dark Grown Squash (Cucurbita maxima Duch.) Hypocotyls 1

    Science.gov (United States)

    Wakabayashi, Kazuyuki; Sakurai, Naoki; Kuraishi, Susumu

    1991-01-01

    Effects of indole-3-acetic acid (IAA) on the mechanical properties of cell walls and structures of cell wall polysaccharides in outer and inner tissues of segments of dark grown squash (Cucurbita maxima Duch.) hypocotyls were investigated. IAA induced the elongation of unpeeled, intact segments, but had no effect on the elongation of peeled segments. IAA induced the cell wall loosening in outer tissues as studied by the stress-relaxation analysis but not in inner tissues. IAA-induced changes in the net sugar content of cell wall fractions in outer and inner tissues were very small. Extracted hemicellulosic xyloglucans derived from outer tissues had a molecular weight about two times as large as in inner tissues, and the molecular weight of xyloglucans in both outer and inner tissues decreased during incubation. IAA substantially accelerated the depolymerization of xyloglucans in outer tissues, while it prevented that in inner tissues. These results suggest that IAA-induced growth in intact segments is due to the cell wall loosening in outer tissues, and that IAA-accelerated depolymerization of hemicellulosic xyloglucans in outer tissues is involved in the cell wall loosening processes. PMID:16668092

  19. Efecto de la osmodeshidratación y secado en la retención de carotenos en fruto de zapallo Effect of the osmo dehydration and drying on carotenoids retention of squash fruit

    Directory of Open Access Journals (Sweden)

    Sanín Ortiz G.

    2008-12-01

    Full Text Available El fruto de zapallo aporta provitamina A en forma de a-caroteno, b-caroteno y luteína que se pueden degradar al deshidratarlo para estabilizar la materia seca. El objetivo de la investigación fue analizar la retención de carotenos en respuesta al proceso de acondicionado por osmodeshidratación (DO con melaza pura y secado con aire caliente (AC sin exposición al sol Vs. secado a exposición parcial al sol (S. El mejor rendimiento de materia seca estable correspondió a AC con protección de eritorbato de sodio (ES y sin él en solución al 5% con 8.5 y 14 horas de permanencia en el proceso y rendimiento másico entre 99.45% y 98.5% respectivamente, que correspondió a los siguientes modelos de pérdida de sólido húmedo:Y = 454.66935e -0.2648339x r=0.965 y Y = 463.07976e-0.16167667x (r=0.978 respectivamente. El caroteno total en fruto fresco osciló entre 1114.9 y 1365.8 mg. g-1, y 222.2, 60.2 y 158.5 de a-caroteno, b-caroteno y luteína respectivamente El proceso de acondicionado de fruto de zapallo hasta materia seca estable con 12% de humedad, requiere secado con aire caliente (55°C durante nueve horas con flujo de aire de 10 m.s-1 en ausencia de brillo solar, para retener hasta 45% de carotenos totales y lograr materia prima idónea hasta con 66.8, 33.5 y 44.7 mg. g-1 de a-caroteno, b-caroteno y luteína respectivamente.The squash fruit provides provitamin A in form of alpha-carotene, beta-carotene and lutein that can be degraded when dehydrated to stabilize dry matter. The objective of the research was to analyze the carotene retention in response to the osmo dehydration conditioning process (OD with pure molasses and hot air drying (HA without sun exposure vs. partial sun exposure (S. The best stable dry matter yield corresponded to HA with and without sodium eritorbate protection (SE in 5% solution with 8.5 and 14 hours of permanence in the process and mass yield between 99.45% and 98.5% respectively, that corresponded to the

  20. Generating Units

    Data.gov (United States)

    Department of Homeland Security — Generating Units are any combination of physically connected generators, reactors, boilers, combustion turbines, and other prime movers operated together to produce...

  1. Generational diversity.

    Science.gov (United States)

    Kramer, Linda W

    2010-01-01

    Generational diversity has proven challenges for nurse leaders, and generational values may influence ideas about work and career planning. This article discusses generational gaps, influencing factors and support, and the various generational groups present in today's workplace as well as the consequences of need addressing these issues. The article ends with a discussion of possible solutions.

  2. The Implicit Function as Squashing Time Model: A Novel Parallel Nonlinear EEG Analysis Technique Distinguishing Mild Cognitive Impairment and Alzheimer's Disease Subjects with High Degree of Accuracy

    Directory of Open Access Journals (Sweden)

    Massimo Buscema

    2007-01-01

    (2007, this protocol includes a new type of artificial organism, named TWIST. The working hypothesis was that compared to the results presented by the workgroup (2007; the new artificial organism TWIST could produce a better classification between AD and MCI. Material and methods. Resting eyes-closed EEG data were recorded in 180 AD patients and in 115 MCI subjects. The data inputs for the classification, instead of being the EEG data, were the weights of the connections within a nonlinear autoassociative ANN trained to generate the recorded data. The most relevant features were selected and coincidently the datasets were split in the two halves for the final binary classification (training and testing performed by a supervised ANN. Results. The best results distinguishing between AD and MCI were equal to 94.10% and they are considerable better than the ones reported in our previous study (∼92% (2007. Conclusion. The results confirm the working hypothesis that a correct automatic classification of MCI and AD subjects can be obtained by extracting spatial information content of the resting EEG voltage by ANNs and represent the basis for research aimed at integrating spatial and temporal information content of the EEG.

  3. Isotope generator

    International Nuclear Information System (INIS)

    1979-01-01

    The patent describes an isotope generator incorporating the possibility of stopping elution before the elution vessel is completely full. Sterile ventilation of the whole system can then occur, including of both generator reservoir and elution vessel. A sterile, and therefore pharmaceutically acceptable, elution fluid is thus obtained and the interior of the generator is not polluted with non-sterile air. (T.P.)

  4. Instant Generation

    Science.gov (United States)

    Loveland, Elaina

    2017-01-01

    Generation Z students (born between 1995-2010) have replaced millennials on college campuses. Generation Z students are entrepreneurial, desire practical skills with their education, and are concerned about the cost of college. This article presents what need to be known about this new generation of students.

  5. Optimising generators

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, E.J.; Garcia, A.O.; Graffigna, F.M.; Verdu, C.A. (IMPSA (Argentina). Generators Div.)

    1994-11-01

    A new computer tool, the ARGEN program, has been developed for dimensioning large hydroelectric generators. This results in better designs, and reduces calculation time for engineers. ARGEN performs dimensional tailoring of salient pole synchronous machines in generators, synchronous condensers, and generator-motors. The operation and uses of ARGEN are explained and its advantages are listed in this article. (UK)

  6. Temperatura no desenvolvimento e na reprodução de cochonilhas criadas sobre abóboras Temperature in the development and reproduction of scales reared on squash

    Directory of Open Access Journals (Sweden)

    Lília de Lima Andrade

    2008-12-01

    Full Text Available O desenvolvimento de insetos é dependente da temperatura. Nesta pesquisa, foi verificada a influência da temperatura no desenvolvimento e na reprodução de Chrysomphalus aonidum (L. em câmaras climatizadas com UR do ar 70±10%, fotofase de 12h e temperaturas constantes de 17, 19, 21, 23, 25 e 27 ± 1°C, tendo como substrato abóboras "cabotiá" (Curcubita maxima x Curcubita moschata var. Tetsukabuto. Foi observada a influência da temperatura nos parâmetros biológicos da cochonilha, sendo que temperaturas entre 23 e 27°C foram as mais adequadas ao inseto, propiciando menor duração do período ninfal e maior produção diária de ninfas por fêmea. Temperaturas entre 17 e 19°C provocam maior duração na fase ninfal, maior longevidade das fêmeas e menor produção diária de ninfas por fêmea.The development of the insects is dependent on the temperature. In this research, it was verified the influence of the temperature in the development and reproduction of the Chrysomphalus aonidum under climate controlled conditions (RH 70±10%, photophase of 12h, and seven constant temperatures of 17, 19, 21, 23, 25, and 27 ± 1°C; on "cabotiá" squash (Curcubita maxima x Curcubita moschata var. Tetsukabuto substrate. The temperature had influence in the biological parameters of the scale. The temperatures between 23 and 27°C were the most adequate to the scale, causing smaller duration of the nymphal period, and higher daily production of nymphs per female. At the temperatures between 17 and 19°C, the scale presented higher duration in the nymphal phase, and longevity of the females and smaller daily production of nymphs per female.

  7. Wind Generators

    Science.gov (United States)

    1989-01-01

    When Enerpro, Inc. president, Frank J. Bourbeau, attempted to file a patent on a system for synchronizing a wind generator to the electric utility grid, he discovered Marshall Space Flight Center's Frank Nola's power factor controller. Bourbeau advanced the technology and received a NASA license and a patent for his Auto Synchronous Controller (ASC). The ASC reduces generator "inrush current," which occurs when large generators are abruptly brought on line. It controls voltage so the generator is smoothly connected to the utility grid when it reaches its synchronous speed, protecting the components from inrush current damage. Generator efficiency is also increased in light winds by applying lower than rated voltage. Wind energy is utilized to drive turbines to generate electricity for utility companies.

  8. ADUBAÇÃO MINERAL E ORGÂNICA DA ABÓBORA HÍBRIDA: ESTADO NUTRICIONAL E PRODUÇÃO MINERAL AND ORGANIC FERTILIZER OF THE HYBRID SQUASH: NUTRITIONAL STATE AND PRODUCTION

    Directory of Open Access Journals (Sweden)

    Francisco Affonso Ferreira

    2007-09-01

    nutrientes; nível crítico; Cucurbita maxima x C. Moschata.

    In order to evaluate the response of hybrid squash cv. Tetsukabuto to organic compost and mineral fertilizer (NPK, seven experiments were carried out on a cambic yellow-red Podzol soil under field conditions at Ponte Nova, Minas Gerais State. Each experiment constituted one sampling date, that begun at the 21st day and ended at the 105th day after planting, with 14 days intervals. In these experiments five fertilizing treatments were tested plus a control (no treatment. In the fertilizing treatments, defined by a diagonal section of a complete factorial, rates of 0, 3, 6, 9 and 12 t/ha (dry basis of organic compound, associated were applied with rates of 0.772, 0.579, 0.386, 0.193 and 0 t/ha of NPK (4-14-8, respectively, with four replications in a randomized blocks design. The NPK and organic compost association increased the plant leaf number, the main branch length and the fruit yield. The maximum yield and maximum economical efficiency, 13.596 and 13.368 t/ha, were obtained with the rates 6.402 t/ha of organic compost and 0.360 t/ha of NPK and with 5.247 t/ha of compost and 0.434 t/ha of NPK, respectively. At the 49th day after sowing, the concentrations of N, P, K, S, Ca and Mg, in the leaf blade dry matter, associated with the maximum economic return, were: 38.8; 5.2; 27.5; 2.5; 21.3 and 3.8 g/kg, respectively. These data, at the 63rd day after sowing, were: 43.8; 4.7; 24.4; 2.5; 18.3 and 5.3 g/kg, respectively. At 105th after sowing, the estimated contents of N, P, K, S, Ca and Mg in the aerial part and expressed in g/plant were 27.8; 4.7; 26.7; 1.8; 10.1 and 4.8, respectively.

    KEY-WORDS: Hybrid squash; organic compost; nutrient content; mineral fertilizer.

  9. Produção e qualidade da moranga híbrida em resposta a doses de nitrogênio Yield and quality of hybrid squash (pumpkin in response to nitrogen doses

    Directory of Open Access Journals (Sweden)

    Marinalva W Pedrosa

    2012-06-01

    Full Text Available Foram avaliados os efeitos de doses de N na produção e qualidade da moranga hibrida cv. Tetsukabuto (Takaima F1 em experimento na EPAMIG Centro Oeste, Prudente de Morais (MG, de 25/08 a 03/12/2008. Foram avaliadas cinco doses de nitrogênio (0; 37,5; 75; 150; 300 kg ha-1, na forma de uréia, divididas em quatro aplicações (30% no plantio, 20% aos 20 dias, 30% aos 40 dias e 20% aos 60 dias após a emergência, num delineamento experimental de blocos casualizados com quatro repetições. As doses de N influenciaram significativamente as características avaliadas. O número de frutos aumentou de 2.498 ao ponto de máximo de 6.794 frutos ha-1 com a aplicação de 219 kg ha-1 de N. O diâmetro e a espessura da polpa do fruto aumentaram de 14,97 e 2,33 cm, até atingirem os pontos máximos de 17,74 e 2,80 cm nas doses de 171 e 128 kg ha-1 de N, respectivamente. O teor de sólidos solúveis na polpa de frutos de moranga híbrida aumentou com o aumento das doses de N observando-se com a aplicação de 300 kg ha-1 de N teor de 8ºBrix. A produtividade de frutos foi também influenciada pelas doses de N estimando-se como valor máximo 11,55 t ha-1 de frutos com a aplicação de 300 kg ha-1 de N. A dose estimada de N relativa à máxima eficiência econômica foi obtida com a aplicação de 262 kg ha-1, considerando os preços de R$ 2,41 kg-1 de N e de R$ 560,00 t-1 de moranga.An experiment was carried out at EPAMIG Centro Oeste, Prudente de Morais, Minas Gerais state, Brazil, from August 25 to December 2, 2008, to evaluate the effects of N rates on production and quality of hybrid squash cv. Tetsukabuto (Takaima F1. The treatments were five N rates (0, 37.5, 75, 150, 300 kg ha-1, as urea, split in four applications (30% at planting date, 20% at 20 days, 30% at 40 days and 20% at 60 days after emergence in a randomized complete block design, with four replications. The N rates significantly affected the characteristics evaluated. The number of fruits

  10. Generative Semantics.

    Science.gov (United States)

    King, Margaret

    The first section of this paper deals with the attempts within the framework of transformational grammar to make semantics a systematic part of linguistic description, and outlines the characteristics of the generative semantics position. The second section takes a critical look at generative semantics in its later manifestations, and makes a case…

  11. Generative Semantics

    Science.gov (United States)

    Bagha, Karim Nazari

    2011-01-01

    Generative semantics is (or perhaps was) a research program within linguistics, initiated by the work of George Lakoff, John R. Ross, Paul Postal and later McCawley. The approach developed out of transformational generative grammar in the mid 1960s, but stood largely in opposition to work by Noam Chomsky and his students. The nature and genesis of…

  12. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2008-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  13. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2010-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  14. Pulse Generator

    Science.gov (United States)

    Greer, Lawrence (Inventor)

    2017-01-01

    An apparatus and a computer-implemented method for generating pulses synchronized to a rising edge of a tachometer signal from rotating machinery are disclosed. For example, in one embodiment, a pulse state machine may be configured to generate a plurality of pulses, and a period state machine may be configured to determine a period for each of the plurality of pulses.

  15. Sound generator

    NARCIS (Netherlands)

    Berkhoff, Arthur P.

    2007-01-01

    A sound generator, particularly a loudspeaker, configured to emit sound, comprising a rigid element (2) enclosing a plurality of air compartments (3), wherein the rigid element (2) has a back side (B) comprising apertures (4), and a front side (F) that is closed, wherein the generator is provided

  16. Steam generator

    International Nuclear Information System (INIS)

    Fenet, J.-C.

    1980-01-01

    Steam generator particularly intended for use in the coolant system of a pressurized water reactor for vaporizing a secondary liquid, generally water, by the primary cooling liquid of the reactor and comprising special arrangements for drying the steam before it leaves the generator [fr

  17. Energy generation

    CSIR Research Space (South Africa)

    Osburn, L

    2009-02-01

    Full Text Available Current perceptions conjure images of photovoltaic panels and wind turbines when green building or sustainable development is discussed. How energy is used and how it is generated are core components of both green building and sustainable...

  18. Gravitational solitons and the squashed 7-sphere

    International Nuclear Information System (INIS)

    Bizon, P; Chmaj, T; Gibbons, G W; Pope, C N

    2007-01-01

    We discuss some aspects of higher-dimensional gravitational solitons and kinks, including in particular their stability. We illustrate our discussion with the examples of (non-BPS) higher-dimensional Taub-NUT solutions as the spatial metrics in (6 + 1) and (8 + 1) dimensions. We find them to be stable against small but non-infinitesimal disturbances, but unstable against large ones, which can lead to black-hole formation. In (8 + 1) dimensions we find a continuous non-BPS family of asymptotically-conical solitons connecting a previously-known kink metric with the supersymmetric A 8 solution which has Spin(7) holonomy. All the solitonic spacetimes we consider are topologically, but not geometrically, trivial. In an appendix we use the techniques developed in the paper to establish the linear stability of five-dimensional Myers-Perry black holes with equal angular momenta against cohomogeneity-2 perturbations

  19. Cucurbits [Cucumber, melon, pumpkin and squash

    Science.gov (United States)

    The focus of this chapter is on the edible members of the Cucurbitaceae family. The three important food-grade cucurbit genera Citrullus, Cucumis, and Cucurbita include the species Citrullus lanatus watermelons), Cucumis melo (cantaloupes and other sweet melons), Cucumis sativa (cucumbers and pick...

  20. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.; Wollongong Univ.; Tomiyoshi, K.; Sekine, T.

    1997-01-01

    The present status and future directions of research and development on radionuclide generator technology are reported. The recent interest to develop double-neutron capture reactions for production of in vivo generators; neutron rich nuclides for radio-immunotherapeutic pharmaceuticals: and advances with ultra-short lived generators is highlighted. Emphasis is focused on: production of the parent radionuclide; the selection and the evaluation of support materials and eluents with respect to the resultant radiochemical yield of the daughter, and the breakthrough of the radionuclide parent: and, the uses of radionuclide generators in radiopharmaceutical chemistry, biomedical and industrial applications. The 62 Zn → 62 Cu, 66 Ni → 66 Cu, 103m Rh → 103 Rh, 188 W → 188 Re and the 225 Ac → 221 Fr → 213 Bi generators are predicted to be emphasized for future development. Coverage of the 99 Mo → 99m Tc generator was excluded, as it the subject of another review. The literature search ended June, 1996. (orig.)

  1. Good maintenance of exercise-induced bone gain with decreased training of female tennis and squash players: a prospective 5-year follow-up study of young and old starters and controls.

    Science.gov (United States)

    Kontulainen, S; Kannus, P; Haapasalo, H; Sievänen, H; Pasanen, M; Heinonen, A; Oja, P; Vuori, I

    2001-02-01

    This prospective 5-year follow-up study of 64 adult female racquet sports players and 27 controls assessed the changes in the playing-to-nonplaying arm bone mineral content (BMC) differences to answer three questions: (1) Are training-induced bone gains lost with decreased training? (2) Is the bone response to decreased training different if the playing career has been started before or at puberty rather than after it? (3) Are the possible bone changes related to the changes in training? The players were divided into two groups according to the starting age of their tennis or squash playing. The mean starting age was 10.5 years (SD, 2.2) among the players who had started training before or at menarche (young starters; n = 36) while 26.4 years (SD, 8.0) among those players who had begun training a minimum of 1 year after menarche (old starters; n = 28). At baseline of the 5-year follow-up, the mean age of the young starters was 21.6 years (SD, 7.6) and that of old starters was 39.4 years (SD, 10.5). During the follow-up, the young starters had reduced the average training frequency from 4.7 times a week (2.7) to 1.4 times a week (1.3) and the old starters from 4.0 times a week (1.4) to 2.0 times a week (1.4), respectively. The 5-year follow-up revealed that despite reduced training the exercise-induced bone gain was well maintained in both groups of players regardless of their clearly different starting age of activity and different amount of exercise-induced bone gain. The gain was still 1.3-2.2 times greater in favor of the young starters (at the follow-up, the dominant-to-nondominant arm BMC difference was 22% [8.4] in the humeral shaft of the young starters versus 10% [3.8] in the old starters, and 3.5% [2.4] in controls). In the players, changes in training were only weakly related to changes in the side-to-side BMC difference (r(s) = 0.05-0.34, all NS), and this was true even among the players who had stopped training completely a minimum 1 year before the

  2. Ethephon on the growth of squash plants in protected environment / Aplicação de ethephon em plantas de abobrinha (Curcubita pepo var. melopepo cultivadas em casa de vegetação

    Directory of Open Access Journals (Sweden)

    Rumy Goto

    2000-04-01

    Full Text Available The aim of this work was to study the effect of Ethephon on the growth of squash plants, under conditions of protected environment. The application of Ethephon at 200 and 400 mgt1, was carried out in two stages of development, 2nd and 4th true leaf. The growth of the plants was evaluated with the following parameters of the growth analysis: Leaf Area Ratio (g.g1 - LAR; Specific Leaf Area (cm2.g1 - SLA; Leaf Mass Ratio (9-91 - LMR; Relative Growth Rate (g.g-1 .day1 - RGR and Net Assimilation Rate (g.cm2.day1 - NAR. The LAR increased from the first to the second collect to decreased soon after that, being that the Ethephon 400 mg.L1 applied in the stage of 4th true leaf presented difference to the 57 DAS (days after seeding. The SLA curves are increasing in the beginning of the development, presenting reduction through the long of the cycle. How much the LMR all the treatments had presented similar behaviour, not evidencing effect of Ethephon application. Ethephon 200 mg.L1 applied in the stage of 4th true leaf presented constant values of RGR. All the treatments had presented at least two peaks of NAR values and except for control, showed decreasing results in the last interval.O trabalho objetivou estudar o efeito do ethephon sobre o crescimento de plantas de abobrinha sob condições de ambiente protegido. As aplicações de ethephon a 200 e 400 mg.L foram realizadas nos estádios de 2ã e 4a folha verdadeira, sendo a primeira aos 22 DAS (dias após a semeadura e a segunda aos 30 DAS. O crescimento das plantas foi avaliado através dos seguintes parâmetros: razão de área foliar (cm2.g1 - RAF; área foliar específica (cm2.g1 - AFE; razão de massa foliar (g.g1 - RMF; taxa de crescimento relativo (g.g-1 .dia-1 - TCR e taxa assimilatória líquida (g.cm-2.dia-1 - TAL. A RAF aumentou da 1ã para a 2a coleta para diminuir logo em seguida, sendo que o tratamento com ethephon 400 mg.L-1, aplicado no estádio de 4a folha verdadeira, apresentou

  3. Realizing three generations of the Standard Model fermions in the type IIB matrix model

    International Nuclear Information System (INIS)

    Aoki, Hajime; Nishimura, Jun; Tsuchiya, Asato

    2014-01-01

    We discuss how the Standard Model particles appear from the type IIB matrix model, which is considered to be a nonperturbative formulation of superstring theory. In particular, we are concerned with a constructive definition of the theory, in which we start with finite-N matrices and take the large-N limit afterwards. In that case, it was pointed out recently that realizing chiral fermions in the model is more difficult than it had been thought from formal arguments at N=∞ and that introduction of a matrix version of the warp factor is necessary. Based on this new insight, we show that two generations of the Standard Model fermions can be realized by considering a rather generic configuration of fuzzy S"2 and fuzzy S"2×S"2 in the extra dimensions. We also show that three generations can be obtained by squashing one of the S"2’s that appear in the configuration. Chiral fermions appear at the intersections of the fuzzy manifolds with nontrivial Yukawa couplings to the Higgs field, which can be calculated from the overlap of their wave functions.

  4. THE GENERATIVE REPRODUCTIVE CHARACTERISTICS OF RED DRAGON FRUIT (Hylocereus.polyrhizus (Web. Britton & Rose, CACTACEAE

    Directory of Open Access Journals (Sweden)

    Eniek Kriswiyanti

    2013-04-01

    Full Text Available This study aimed to investigate the generative reproductive characteristics of red dragon fruit (Hylocereus polyrhizus (Web. Britton & Rose, that is the characteristics and the development of male and female reproductive system and the embryo. The flowering morphology was observed through the gametogenesis process and the process of embryogenesis was observed using the methods of squash, cytolysis, and embedding of flower before anthesis, during and after anthesis. The results showed that the flower funnelled form with many calyxes, stamens and crowns. The pollen was circular, sulcus, trilate, reticulate, and spheroid. The development of microgametophyte was at the 2nd stages with three nucleuses and the pistil developed after anthesis.  Anthesis was taken place at night time, fertilization and pollen developed before anthesis and has not germinating. A single pistil, the head of pistil with many branches, the style longer than the stamen, open type.  Seeds anathrophus, endosperm and embryo with the globular shaped, developed 5 days after anthesis, the embryo torpedo likes and the differentiation of primer tissues seen in the seeds 7 days after anthesis, and arilus generated from development of megasporangium. Keywords: embedding, self incompatibility, sferoidal, anatrophus, arillus.

  5. Radionuclide generators

    International Nuclear Information System (INIS)

    Lambrecht, R.M.

    1983-01-01

    The status of radionuclide generators for chemical research and applications related to the life sciences and biomedical research are reviewed. Emphasis is placed upon convenient, efficient and rapid separation of short-lived daughter radionuclides in a chemical form suitable for use without further chemical manipulation. The focus is on the production of the parent, the radiochemistry associated with processing the parent and daughter, the selection and the characteristic separation methods, and yields. Quality control considerations are briefly noted. The scope of this review includes selected references to applications of radionuclide generators in radiopharmaceutical chemistry, and the life sciences, particularly in diagnostic and therapeutic medicine. The 99 Mo-sup(99m)Tc generator was excluded. 202 references are cited. (orig.)

  6. Generation Next

    Science.gov (United States)

    Hawkins, B. Denise

    2010-01-01

    There is a shortage of accounting professors with Ph.D.s who can prepare the next generation. To help reverse the faculty deficit, the American Institute of Certified Public Accountants (CPAs) has created the new Accounting Doctoral Scholars program by pooling more than $17 million and soliciting commitments from more than 70 of the nation's…

  7. Generative Contexts

    Science.gov (United States)

    Lyles, Dan Allen

    Educational research has identified how science, technology, engineering, and mathematics (STEM) practice and education have underperforming metrics in racial and gender diversity, despite decades of intervention. These disparities are part of the construction of a culture of science that is alienating to these populations. Recent studies in a social science framework described as "Generative Justice" have suggested that the context of social and scientific practice might be modified to bring about more just and equitable relations among the disenfranchised by circulating the value they and their non-human allies create back to them in unalienated forms. What is not known are the underlying principles of social and material space that makes a system more or less generative. I employ an autoethnographic method at four sites: a high school science class; a farm committed to "Black and Brown liberation"; a summer program geared towards youth environmental mapping; and a summer workshop for Harlem middle school students. My findings suggest that by identifying instances where material affinity, participatory voice, and creative solidarity are mutually reinforcing, it is possible to create educational contexts that generate unalienated value, and circulate it back to the producers themselves. This cycle of generation may help explain how to create systems of justice that strengthen and grow themselves through successive iterations. The problem of lack of diversity in STEM may be addressed not merely by recruiting the best and the brightest from underrepresented populations, but by changing the context of STEM education to provide tools for its own systematic restructuring.

  8. Steam generators

    International Nuclear Information System (INIS)

    Hayden, R.L.J.

    1979-01-01

    Steam generators for nuclear reactors are designed so that deposition of solids on the surface of the inlet side of the tubesheet or the inlet header with the consequent danger of corrosion and eventual tube failure is obviated or substantially reduced. (U.K.)

  9. British Association of Plastic Surgeons Program from another generation.

    Science.gov (United States)

    Freshwater, M Felix

    2010-05-01

    To Compare the Association's Summer Programs of 1971 and 2008. I attended the 1971 meeting of BAPS that was held in London and kept the program. I compared the content of that meeting with the 2008 Provisional Program. A blow-up of that 1971 program will be the highlight of the poster. The 1971 meeting's registration fee was 10 pounds for me as an overseas non-member registering at the desk compared to the current fee of 500 pounds. The meeting was three day long, but only one day was devoted to papers. The first and third days of the meeting were devoted to watching live cranio-facial surgery performed by Tessier at the Hospital for Sick Children. To make the length of these televised sessions more tolerable, a cash bar was available and lunch including beer and squash were served from noon until 4 pm followed by tea from 4 pm to 6 pm Dinner Jackets were required for the 1971 Association dinner compared with dark lounge suits in 2008. In contrast to 2008, the 1971 scientific program consisted of only 13 papers of which all but five were written by single authors. Seven of the papers were published in the British Journal of Plastic Surgery. There were no cosmetic and no breast papers. There were no poster sessions. There were no panel discussions. There were no exhibits. The 1971 meeting was truly from another generation in both its form and content. Copyright (c) 2009 British Association of Plastic, Reconstructive and Aesthetic Surgeons. Published by Elsevier Ltd. All rights reserved.

  10. Thermoelectric generator

    International Nuclear Information System (INIS)

    Purdy, D.L.

    1978-01-01

    The main components of a thermoelectric generator are housed in an evacuated cylindrical vessel. In the middle of it there is the radioactive heat source, e.g. 90 Sr or 238 Pu, enclosed by a gamma radiation shield. This one is surrounded by a heat-insulating screen from getter material or indicidual sheets of titanium. In the bottom of the screen there are arranged several thermocouples on a circle. The thermocouples themselves are contained within casings sealed gas-tight and filled with an inert gas, e.g. argon. By separating the internal space of the generator vessel from the thermocouple casings, made of e.g. n- respectively p-doped lead telluride cylinders, for both the optimal gas state may be obtained. (DG) [de

  11. Cluster generator

    Science.gov (United States)

    Donchev, Todor I [Urbana, IL; Petrov, Ivan G [Champaign, IL

    2011-05-31

    Described herein is an apparatus and a method for producing atom clusters based on a gas discharge within a hollow cathode. The hollow cathode includes one or more walls. The one or more walls define a sputtering chamber within the hollow cathode and include a material to be sputtered. A hollow anode is positioned at an end of the sputtering chamber, and atom clusters are formed when a gas discharge is generated between the hollow anode and the hollow cathode.

  12. Photon generator

    Science.gov (United States)

    Srinivasan-Rao, Triveni

    2002-01-01

    A photon generator includes an electron gun for emitting an electron beam, a laser for emitting a laser beam, and an interaction ring wherein the laser beam repetitively collides with the electron beam for emitting a high energy photon beam therefrom in the exemplary form of x-rays. The interaction ring is a closed loop, sized and configured for circulating the electron beam with a period substantially equal to the period of the laser beam pulses for effecting repetitive collisions.

  13. Event generators

    International Nuclear Information System (INIS)

    Durand, D.; Gulminelli, F.; Lopez, O.; Vient, E.

    1998-01-01

    The results concerning the heavy ion collision simulations at Fermi energies by means of phenomenological models obtained in the last two years ar presented. The event generators are essentially following the phase of elaboration of analysis methods of data obtained by INDRA or NAUTILUS 4 π multidetectors. To identify and correctly quantify a phenomenon or a physical quantity it is necessary to verify by simulation the feasibility and validity of the analysis and also to estimate the bias introduced by the experimental filter. Many studies have shown this, for instance: the determination of the collision reaction plan for flow studies, determination of kinematical characteristics of the quasi-projectiles, and the excitation energy measurement stored in the hot nuclei. To Eugene, the currently utilised generator, several improvements were added: introduction of space-time correlations between the different products emitted in the decay of excited nuclei by calculating the trajectories of the particles in the final phase of the reaction; taking into account in the decay cascade of the discrete levels of the lighter fragments; the possibility of the schematically description of the explosion of the nucleus by simultaneous emission of multi-fragments. Thus, by comparing the calculations with the data relative to heavy systems studied with the NAUTILUS assembly it was possible to extract the time scales in the nuclear fragmentation. The utilisation of these event generators was extended to the analysis of INDRA data concerning the determination of the vaporization threshold in the collisions Ar + Ni and also the research of the expansion effects in the collisions Xe + Sn at 50 MeV/u

  14. Growth and yield of summer squash: effect of the ionic concentration of nutrient solutionCrescimento e produtividade da abobrinha italiana: efeito da concentração iônica da solução nutritiva

    Directory of Open Access Journals (Sweden)

    Tiago Zanatta Aumonde

    2011-07-01

    Full Text Available With the objective of evaluating the effect of different ionic concentrations of the nutrient solution on growth of summer squash cultivated in raw rice husk substrate with leaching recirculation, two experiments were conducted in two crop-seasons: spring-summer of 2005 and summer-autumn of 2006, in Pelotas, RS. Four ionic concentrations of the nutrient solution (based on electrical conductivity - EC were studied: 1.3; 1.7; 2.1 and 4.2 dS m-1. Crop growth was determinated by accumulated dry mass production and partitioning among the different above-ground plant organs (leafs, stem and fruits at the end of the crop-seasons. Fruit yield was also evaluated. The obtained results indicate that ionic concentrations equal or lower than 1.7 dS m-1 were limiting for proper growth and yield of the crop. The effect of high ionic concentration of the nutrient solution (above 2.1 dS m-1 on dry mass production and partitioning varied according to the crop-season. The lower solar radiation availability of the summer-autumn crop season minimized the effects of the different concentrations of nutrient solution on dry mass production and partitioning to the fruits, as well as on the yield. The fruits comprised from 28 to 52% of the total above-ground dry mass production. Fruits represented the largest sink of assimilates of the plant only at 2.1 dS m-1 ionic concentration of the nutrient solution and in crescent solar radiation availability condition (spring-summer. According the mathematics models, the electrical conductivity that maximizes dry mass production and yield is approximately 3.0 dS m-1 for both crop-seasons.Com o objetivo de avaliar o efeito de diferentes concentrações iônicas da solução nutritiva sobre o crescimento e a produtividade da abobrinha italiana cultivada em substrato de casca de arroz in natura com recirculação dos lixiviados, foram realizados dois experimentos em duas épocas de cultivo: primavera-verão de 2005 e verão-outono de

  15. GENERATIVE LEADERSHIP

    Directory of Open Access Journals (Sweden)

    Janina León

    2010-07-01

    Full Text Available This article presents the results of a research project that studied leadership from the standpoint of the personal conceptions that influence the behavior of local government leaders, as well as those conceptions desired to generate the social transformation processes required in communities. Qualitative methodology was used. Categories of analysis were created based on Pearson’s (1992 model of psychological archetypes. A relevant finding was the limited advance shown by interviewees regarding self-knowledge and a fragmented vision between the observer and the observee, which hinders their ability to take on the challenges that current reality demands from them.

  16. Power generation

    International Nuclear Information System (INIS)

    Nunez, Anibal D.

    2001-01-01

    In the second half of twentieth century, nuclear power became an industrial reality. Now the operating 433 power plants, the 37 plants under construction, near 9000 years/reactor with only one serious accident with emission of radioactive material to the environment (Chernobyl) show the maturity of this technology. Today nuclear power contribute a 17% to the global generation and an increase of 75 % of the demand of electricity is estimated for 2020 while this demand is expected to triplicate by 2050. How this requirement can be satisfied? All the indicators seems to demonstrate that nuclear power will be the solution because of the shortage of other sources, the increase of the prices of the non renewable fuels and the scarce contribution of the renewable ones. In addition, the climatic changes produced by the greenhouse effect make even more attractive nuclear power. The situation of Argentina is analyzed and compared with other countries. The convenience of an increase of nuclear power contribution to the total national generation seems clear and the conclusion of the construction of the Atucha II nuclear power plant is recommended

  17. Produção de moranga e pepino em solo com incorporação de cama aviária e casca de pinus Production of squash and cucumber in soil amended with poultry manure and pine bark

    Directory of Open Access Journals (Sweden)

    Luiz Eduardo B. Blum

    2003-12-01

    Full Text Available A cama aviária e a casca de pinus (Pinus taeda são subprodutos de empresas avícolas e florestais que podem ser utilizados na melhoria da fertilidade e das propriedades físicas e químicas do solo. As morangas 'Tetsukabuto' (Cucurbita maxima x C. moschata e 'Exposição' (Cucurbita maxima e o pepino 'Caipira' (Cucumis sativus estão entre as cucurbitáceas mais cultivadas em Santa Catarina. Avaliou-se os efeitos de doses (0 a 50 g.kg-1 de solo de cama aviária (2,82% N; 2,53% P; 1,2% K; 2,5% Ca; 0,5% Mg e da casca de pinus (0,30% N; 0,10% P; 0,12% K; 0,21% Ca; 0,03% Mg, incorporadas ao solo, no desenvolvimento de plantas e na produção de moranga e pepino. Os experimentos foram delineados em blocos ao acaso, desenvolvidos em casa de vegetação e no campo, e, dependendo do experimento, possuíam tratamentos variando de quatro a cinco, e, repetições de quatro a oito. Em casa de vegetação, doses de cama aviária de até 30 g kg-1 de solo (correspondendo a ~3 kg m-2 aumentaram as plantas emergentes (~15% a 50% e a massa da matéria fresca (~90% a 200% de plantas de moranga 'Exposição' e de pepino 'Caipira'. O pH e os conteúdos de Ca, K, Mg, Mn, N, P e Zn do solo aumentaram com o incremento das doses de cama aviária. O incremento nas doses de casca de pinus diminuiu (~27% os níveis de nitrogênio mineral do solo. Nos experimentos de campo, a incorporação de cama aviária e casca de pinus aumentou a emergência (~15% de plântulas de pepino. A produção de frutos de moranga 'Tetsukabuto' e de pepino 'Caipira' aumentou (~120% nos tratamentos com cama aviária, na dose de 30 g kg-1 (correspondendo a ~ 3 kg m-2.Poultry manure and pine bark (Pinus taeda are by-products readily available in the State of Santa Catarina, Brazil. These by-products can be used as soil amendments to improve soil fertility and soil physical and chemical properties. Inter-specific hybrid squash cv. 'Tetsukabuto' (Cucurbita maxima x C. moschata, squash cv. 'Exposi

  18. Plasma generator

    International Nuclear Information System (INIS)

    Omichi, Takeo; Yamanaka, Toshiyuki.

    1976-01-01

    Object: To recycle a coolant in a sealed hollow portion formed interiorly of a plasma limiter itself to thereby to cause direct contact between the coolant and the plasma limiter and increase of contact area therebetween to cool the plasma limiter. Structure: The heat resulting from plasma generated during operation and applied to the body of the plasma limiter is transmitted to the coolant, which recycles through an inlet and outlet pipe, an inlet and outlet nozzle and a hollow portion to hold the plasma limiter at a level less than a predetermined temperature. On the other hand, the heater wire is, at the time of emergency operation, energized to heat the plasma limiter, but this heat is transmitted to the limiter body to increase the temperature thereof. However, the coolant recycling the hollow portion comes into direct contact with the limiter body, and since the plasma limiter surround the hollow portion, the heat amount transmitted from the limiter body to the coolant increases to sufficiently cool the plasma limiter. (Yoshihara, H.)

  19. Avaliação de extratos vegetais no controle de mosca-branca, Bemisia tabaci biótipo B em abóbora Evaluation of plant extracts in the control of whitefly Bemisia tabaci biotype B in squash

    Directory of Open Access Journals (Sweden)

    Bruno Marcus Freire Vieira Lima

    2013-09-01

    Full Text Available A abóbora (Cucurbita moschata Duch. é uma cultura de importância para a agricultura familiar da região Nordeste do Brasil. No entanto, a ocorrência do prateamento das folhas da aboboreira ocasionado pela mosca-branca, Bemisia tabaci biótipo B limita sua produção, causando prejuízos aos agricultores. O objetivo deste trabalho foi avaliar a eficiência de extratos vegetais sobre o nível populacional de ninfas de mosca-branca em abóbora cv. Jacarezinho. O experimento foi instalado em campo experimental, em blocos casualizados, constituído de seis tratamentos e três repetições. As aplicações dos extratos vegetais foram feitas com intervalo de sete dias, fazendo-se uso de substâncias extraídas das seguintes plantas: canudo (Ipomoea carnea subsp. fistulosa, mamona (Ricinus communis L., tinguí (Mascagnia rigida Griseb, cardo-santo (Argemone mexicana L., e o óleo comercial Natuneem®. Todos os extratos vegetais obtiveram eficiência no controle de ninfas B. tabaci, sendo o R. communis (75,49%, M. rigida (73,99%, I. carnea (72,24%, óleo de nim (70,4% e A. mexicana (69,16%.The squash (Cucurbita moschata Duch. is an important crop for family farmers in the northeast of Brazil. However, the occurrence of leaf silvering caused by the whitefly, Bemisia tabaci biotype B, limits production, causing losses to farmers. The aim of this study was to evaluate the efficiency of plant extracts on the population levels of whitefly nymphs on the squash cv. Jacarezinho. The experiment was conducted at an experimental field, in a randomized block design consisting of six treatments and three replications. Applications of plant extracts were made at an interval of seven days, making use of substances extracted from the following plants: Ipomoea carnea subsp. Fistulosa, castor bean (Ricinus communis L., Tingui (Mascagnia rigida Griseb, cardo-santo (Argemone mexicana L., and the commercial oil product Natuneem ®. All of the plant extracts were

  20. Electrical generator

    International Nuclear Information System (INIS)

    Purdy, D.L.

    1976-01-01

    A nuclear heart pacer having a heat-to-electricity converter including a solid-state thermoelectric unit embedded in rubber which is compressed to impress hydrostatic precompression on the unit is described. The converter and the radioactive heat source are enclosed in a container which includes the electrical circuit components for producing and controlling the pulses; the converter and components being embedded in rubber. The portions of the rubber in the converter and in the container through which heat flows between the radioactive primary source and the hot junction and between the cold junction and the wall of the container are of thermally conducting silicone rubber. The 238 Pu primary radioactive source material is encapsuled in a refractory casing of WC-222 (T-222) which in turn is encapsuled in a corrosion-resistant casing of platinum rhodium, a diffusion barrier separating the WC-222 and the Pt--Rh casings. The Pt--Rh casing is in a closed basket of tantalum. The tantalum protects the Pt--Rh from reacting with other materials during cremation of the host, if any. The casings and basket suppress the transmission of hard x rays generated by the alpha particles from the 238 Pu. The outside casing of the pacer is typically of titanium but its surface is covered by an electrically insulating coating, typically epoxy resin, except over a relatively limited area for effective electrical grounding to the body of the host. It is contemplated that the pacer will be inserted in the host with the exposed titanium engaging a non-muscular region of the body

  1. Magnet Free Generators - 3rd Generation Wind Turbine Generators

    DEFF Research Database (Denmark)

    Jensen, Bogi Bech; Mijatovic, Nenad; Henriksen, Matthew Lee

    2013-01-01

    This paper presents an introduction to superconducting wind turbine generators, which are often referred to as 3rd generation wind turbine generators. Advantages and challenges of superconducting generators are presented with particular focus on possible weight and efficiency improvements. A comp...

  2. Trip generation characteristics of special generators

    Science.gov (United States)

    2010-03-01

    Special generators are introduced in the sequential four-step modeling procedure to represent certain types of facilities whose trip generation characteristics are not fully captured by the standard trip generation module. They are also used in the t...

  3. Ability of Aphis gossypii and Myzus persicae to Transmit Cucumber mosaic virus in Single and Mixed Infection with Two Potyviruses to Zucchini Squash Eficiência dos afídeos Aphis gossypii e Myzus persicae na transmissão do Cucumber mosaic virus em infecção simples e mista com dois Potyvirus para abobrinha de moita

    Directory of Open Access Journals (Sweden)

    Zayame Vegette Pinto

    2008-06-01

    Full Text Available The main objective of this work was to investigate the ability of Aphis gossypii and Myzus persicae to transmit Cucumber mosaic virus (CMV singly and mixed with two potyviruses (Papaya ringspot virus - type W, PRSV-W and Zucchini yellow mosaic virus, ZYMV, to zucchini squash plants (Cucurbita pepo. The results showed that the potyviruses in general were more efficiently transmitted by both species of aphids as compared to CMV. The transmission of PRSV-W, ZYMV and CMV separately was more efficient than in mixture.O objetivo desse trabalho foi estudar a eficiência de Aphis gossypii e Myzus persicae na transmissão do vírus do mosaico do pepino (Cucumber mosaic virus, CMV, isoladamente e em mistura com duas espécies de potyvirus (Vírus do mosaico do mamoeiro = Papaya ringspot virus - type W, PRSV-W e Vírus do mosaico amarelo da abobrinha = Zucchini yellow mosaic virus, ZYMV, para planta-testes de abobrinha de moita (Cucurbita pepo. Os dois potyvirus em geral foram transmitidos com mais eficiência pelas duas espécies de afídeos do que o CMV. A transmissão do PRSV-W, ZYMV e CMV, separadamente, foi mais eficiente do que em mistura.

  4. Self generation, small generation, and embedded generation issues

    International Nuclear Information System (INIS)

    2001-01-01

    The New Brunswick Market Design Committee for electric power restructuring has been directed to examine issues regarding cogeneration and small-scale, on-site generation and how they will fit within the framework of the bilateral contract market. The Committee will also have to deal with issues of generation embedded in a distribution system. The Committee has defined cogeneration as the simultaneous production of electricity and useful thermal energy. Self-generation has been defined as small-scale power generation by an end-user, while embedded generation has been defined as a generation facility that is located within a distribution utility but is not directly connected to the transmission system. The Committee has postponed its decision on whether embedded generation will be eligible to participate under the bilateral contract market for electricity. This report discusses general issues such as the physical support of generation, market support of generation, transition issues and policy issues. It also discusses generation support issues such as operating reserves, transmission tariff issues, and distribution tariffs. Market support issues such as transmission access for generation sales were also considered, along with market access for generation sales, and net metering for behind the meter generation. 7 refs., 1 tab

  5. Leading Generation Y

    National Research Council Canada - National Science Library

    Newman, Jill M

    2008-01-01

    .... Whether referred to as the Millennial Generation, Generation Y or the Next Generation, the Army needs to consider the gap between Boomers, Generation X and the Soldiers that fill our junior ranks...

  6. Frutificação e crescimento de frutos em abóbora híbrida 'Tetsukabuto' tratada com alfa-naftalenoacetato de sódio Fruit set and fruit growth of 'Tetsukabuto' squash treated with the sodium salt of alfa-naphthaleneacetic acid

    Directory of Open Access Journals (Sweden)

    Cassandro V.T. do Amarante

    2000-11-01

    Full Text Available A abertura de flores femininas na abóbora híbrida 'Tetsukabuto' concentra-se num período de três a quatro semanas. Este curto período de florescimento indica que uma polinização deficiente pode ocasionar grande comprometimento da produção de frutos. Este trabalho foi conduzido com o objetivo de avaliar o efeito de concentrações do fitorregulador alfa-naftalenoacetato de sódio (ANA-Na, pulverizado em flores abertas femininas, na frutificação e crescimento de frutos da abóbora 'Tetsukabuto'. O experimento foi conduzido em Lages, SC, na safra 1992/1993, seguindo o delineamento em blocos casualizados, com três repetições. A parcela foi constituída de cinco covas de 'Tetsukabuto' e uma da polinizadora Cucurbita maxima, em espaçamento de 3 x 1 m, com duas plantas/cova. Os tratamentos utilizados foram testemunha (polinização natural e 150, 300, 450, 600 e 750 mg·L-1 de ANA-Na. Nos tratamentos com ANA-Na, evitou-se a polinização natural isolando-se as flores com sacos de papel. Avaliou-se percentagem de frutificação, peso, comprimento e diâmetro dos frutos e peso, espessura, rendimento e sólidos totais da polpa. Apenas a dose de 750 mg·L-1 do hormônio reduziu a percentagem de frutificação. Os frutos obtidos por tratamento com ANA-Na apresentaram crescimento similar ao dos frutos obtidos por polinização.Anthesis of female flowers of 'Tetsukabuto' squash occurs within three to four weeks. A deficient pollination during this short flowering period may reduce the yield. The sodium salt of alfa-naphthaleneacetic acid (Na-NAA can be used to improve fruit set when pollination is deficient. This work was conducted to investigate the effects of different concentrations of Na-NAA, sprayed in open female flowers on fruit set and fruit growth of 'Tetsukabuto' squash. The experiment was carried out in 1992-93, in South Brazil, in a randomized block design with three replicates. The plots had a proportion of five plants of

  7. Distributed generation induction and permanent magnet generators

    CERN Document Server

    Lai, L

    2007-01-01

    Distributed power generation is a technology that could help to enable efficient, renewable energy production both in the developed and developing world. It includes all use of small electric power generators, whether located on the utility system, at the site of a utility customer, or at an isolated site not connected to the power grid. Induction generators (IGs) are the cheapest and most commonly used technology, compatible with renewable energy resources. Permanent magnet (PM) generators have traditionally been avoided due to high fabrication costs; however, compared with IGs they are more reliable and productive. Distributed Generation thoroughly examines the principles, possibilities and limitations of creating energy with both IGs and PM generators. It takes an electrical engineering approach in the analysis and testing of these generators, and includes diagrams and extensive case study examples o better demonstrate how the integration of energy sources can be accomplished. The book also provides the ...

  8. Random pulse generator

    International Nuclear Information System (INIS)

    Guo Ya'nan; Jin Dapeng; Zhao Dixin; Liu Zhen'an; Qiao Qiao; Chinese Academy of Sciences, Beijing

    2007-01-01

    Due to the randomness of radioactive decay and nuclear reaction, the signals from detectors are random in time. But normal pulse generator generates periodical pulses. To measure the performances of nuclear electronic devices under random inputs, a random generator is necessary. Types of random pulse generator are reviewed, 2 digital random pulse generators are introduced. (authors)

  9. Power Generation for River and Tidal Generators

    Energy Technology Data Exchange (ETDEWEB)

    Muljadi, Eduard [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wright, Alan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Gevorgian, Vahan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Donegan, James [Ocean Renewable Power Company (ORPC), Portland, ME (United States); Marnagh, Cian [Ocean Renewable Power Company (ORPC), Portland, ME (United States); McEntee, Jarlath [Ocean Renewable Power Company (ORPC), Portland, ME (United States)

    2016-06-01

    Renewable energy sources are the second largest contributor to global electricity production, after fossil fuels. The integration of renewable energy continued to grow in 2014 against a backdrop of increasing global energy consumption and a dramatic decline in oil prices during the second half of the year. As renewable generation has become less expensive during recent decades, and it becomes more accepted by the global population, the focus on renewable generation has expanded from primarily wind and solar to include new types with promising future applications, such as hydropower generation, including river and tidal generation. Today, hydropower is considered one of the most important renewable energy sources. In river and tidal generation, the input resource flow is slower but also steadier than it is in wind or solar generation, yet the level of water turbulent flow may vary from one place to another. This report focuses on hydrokinetic power conversion.

  10. Magnetohydrodynamic (MHD) power generation

    International Nuclear Information System (INIS)

    Chandra, Avinash

    1980-01-01

    The concept of MHD power generation, principles of operation of the MHD generator, its design, types, MHD generator cycles, technological problems to be overcome, the current state of the art in USA and USSR are described. Progress of India's experimental 5 Mw water-gas fired open cycle MHD power generator project is reported in brief. (M.G.B.)

  11. Talkin' 'bout My Generation

    Science.gov (United States)

    Rickes, Persis C.

    2010-01-01

    The monikers are many: (1) "Generation Y"; (2) "Echo Boomers"; (3) "GenMe"; (4) the "Net Generation"; (5) "RenGen"; and (6) "Generation Next". One name that appears to be gaining currency is "Millennials," perhaps as a way to better differentiate the current generation from its…

  12. Work Values across Generations

    Science.gov (United States)

    Hansen, Jo-Ida C.; Leuty, Melanie E.

    2012-01-01

    Mainstream publication discussions of differences in generational cohorts in the workplace suggest that individuals of more recent generations, such as Generation X and Y, have different work values than do individuals of the Silent and Baby Boom generations. Although extant research suggests that age may influence work values, few of the…

  13. Minding the Generation Gap

    Science.gov (United States)

    Field, John

    2011-01-01

    Generational conflict is back. After years of relative silence, and mutual ignorance, the young and old are once more at war. With youth unemployment high on the political agenda, the fortunes of the "jobless generation" are being contrasted with those of the "golden generation" of baby boomers, but is one generation really…

  14. M6: A diploid potato inbred line for use in breeding and genetics research

    Science.gov (United States)

    M6 is a vigorous, homozygous breeding line derived by self-pollinating the diploid wild potato relative Solanum chacoense for seven generations. While most wild Solanum species are self-incompatible, this clone is homozygous for the dominant self-incompatibility inhibitor gene Sli. It is homozygous ...

  15. THE EFFECTS OF SELF-POLLINATION AND MATERNAL RESOURCES ON REPRODUCTION AND OFFSPRING PERFORMANCE IN THE WILD LUPINE, LUPINUS PERENNIS (FABACEAE). (R826596)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  16. Gamma ray generator

    Science.gov (United States)

    Firestone, Richard B; Reijonen, Jani

    2014-05-27

    An embodiment of a gamma ray generator includes a neutron generator and a moderator. The moderator is coupled to the neutron generator. The moderator includes a neutron capture material. In operation, the neutron generator produces neutrons and the neutron capture material captures at least some of the neutrons to produces gamma rays. An application of the gamma ray generator is as a source of gamma rays for calibration of gamma ray detectors.

  17. HTGR steam generator development

    International Nuclear Information System (INIS)

    Schuetzenduebel, W.G.; Hunt, P.S.; Weber, M.

    1976-01-01

    More than 40 gas-cooled reactor plants have produced in excess of 400 reactor years of operating experience which have proved a reasonably high rate of gas-cooled reactor steam generator availability. The steam generators used in these reactors include single U-tube and straight-tube steam generators as well as meander type and helically wound or involute tube steam generators. It appears that modern reactors are being equipped with helically wound steam generators of the once-through type as the end product of steam generator evolution in gas-cooled reactor plants. This paper provides a general overview of gas-cooled reactor steam generator evolution and operating experience and shows how design criteria and constraints, research and development, and experience data are factored into the design/development of modern helically wound tube steam generators for the present generation of gas-cooled reactors

  18. Cylindrical neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo [Hercules, CA

    2008-04-22

    A cylindrical neutron generator is formed with a coaxial RF-driven plasma ion source and target. A deuterium (or deuterium and tritium) plasma is produced by RF excitation in a cylindrical plasma ion generator using an RF antenna. A cylindrical neutron generating target is coaxial with the ion generator, separated by plasma and extraction electrodes which contain many slots. The plasma generator emanates ions radially over 360.degree. and the cylindrical target is thus irradiated by ions over its entire circumference. The plasma generator and target may be as long as desired. The plasma generator may be in the center and the neutron target on the outside, or the plasma generator may be on the outside and the target on the inside. In a nested configuration, several concentric targets and plasma generating regions are nested to increase the neutron flux.

  19. Second harmonic generation and sum frequency generation

    International Nuclear Information System (INIS)

    Pellin, M.J.; Biwer, B.M.; Schauer, M.W.; Frye, J.M.; Gruen, D.M.

    1990-01-01

    Second harmonic generation and sum frequency generation are increasingly being used as in situ surface probes. These techniques are coherent and inherently surface sensitive by the nature of the mediums response to intense laser light. Here we will review these two techniques using aqueous corrosion as an example problem. Aqueous corrosion of technologically important materials such as Fe, Ni and Cr proceeds from a reduced metal surface with layer by layer growth of oxide films mitigated by compositional changes in the chemical makeup of the growing film. Passivation of the metal surface is achieved after growth of only a few tens of atomic layers of metal oxide. Surface Second Harmonic Generation and a related nonlinear laser technique, Sum Frequency Generation have demonstrated an ability to probe the surface composition of growing films even in the presence of aqueous solutions. 96 refs., 4 figs

  20. Refrigeration generation using expander-generator units

    Science.gov (United States)

    Klimenko, A. V.; Agababov, V. S.; Koryagin, A. V.; Baidakova, Yu. O.

    2016-05-01

    The problems of using the expander-generator unit (EGU) to generate refrigeration, along with electricity were considered. It is shown that, on the level of the temperatures of refrigeration flows using the EGU, one can provide the refrigeration supply of the different consumers: ventilation and air conditioning plants and industrial refrigerators and freezers. The analysis of influence of process parameters on the cooling power of the EGU, which depends on the parameters of the gas expansion process in the expander and temperatures of cooled environment, was carried out. The schematic diagram of refrigeration generation plant based on EGU is presented. The features and advantages of EGU to generate refrigeration compared with thermotransformer of steam compressive and absorption types were shown, namely: there is no need to use the energy generated by burning fuel to operate the EGU; beneficial use of the heat delivered to gas from the flow being cooled in equipment operating on gas; energy production along with refrigeration generation, which makes it possible to create, using EGU, the trigeneration plants without using the energy power equipment. It is shown that the level of the temperatures of refrigeration flows, which can be obtained by using the EGU on existing technological decompression stations of the transported gas, allows providing the refrigeration supply of various consumers. The information that the refrigeration capacity of an expander-generator unit not only depends on the parameters of the process of expansion of gas flowing in the expander (flow rate, temperatures and pressures at the inlet and outlet) but it is also determined by the temperature needed for a consumer and the initial temperature of the flow of the refrigeration-carrier being cooled. The conclusion was made that the expander-generator units can be used to create trigeneration plants both at major power plants and at small energy.

  1. Quantum random number generator

    Science.gov (United States)

    Pooser, Raphael C.

    2016-05-10

    A quantum random number generator (QRNG) and a photon generator for a QRNG are provided. The photon generator may be operated in a spontaneous mode below a lasing threshold to emit photons. Photons emitted from the photon generator may have at least one random characteristic, which may be monitored by the QRNG to generate a random number. In one embodiment, the photon generator may include a photon emitter and an amplifier coupled to the photon emitter. The amplifier may enable the photon generator to be used in the QRNG without introducing significant bias in the random number and may enable multiplexing of multiple random numbers. The amplifier may also desensitize the photon generator to fluctuations in power supplied thereto while operating in the spontaneous mode. In one embodiment, the photon emitter and amplifier may be a tapered diode amplifier.

  2. Steam generator tube extraction

    International Nuclear Information System (INIS)

    Delorme, H.

    1985-05-01

    To enable tube examination on steam generators in service, Framatome has now developed a process for removing sections of steam generator tubes. Tube sections can be removed without being damaged for treating the tube section expanded in the tube sheet

  3. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Goslee, D.E.; Bustard, T.S.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile

  4. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Goslee, D.E.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The disclosed generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile

  5. Uniform random number generators

    Science.gov (United States)

    Farr, W. R.

    1971-01-01

    Methods are presented for the generation of random numbers with uniform and normal distributions. Subprogram listings of Fortran generators for the Univac 1108, SDS 930, and CDC 3200 digital computers are also included. The generators are of the mixed multiplicative type, and the mathematical method employed is that of Marsaglia and Bray.

  6. Generational Pension Plan Designs

    NARCIS (Netherlands)

    Huang, Xiaohong; Mahieu, Ronald

    2010-01-01

    We propose a generational plan for the occupational pension provision in which people from the same generation are pooled in a generational fund. Each fund can set its own policies independently. This plan provides the benefits of differentiation missing in the prevailing collective plan and the

  7. Consolidated nuclear steam generator

    International Nuclear Information System (INIS)

    Jabsen, F.S.; Schluderberg, D.C.; Paulson, A.E.

    1978-01-01

    An improved system of providing power has a unique generating means for nuclear reactors with a number of steam generators in the form of replaceable modular units of the expendable type to attain the optimum in effective and efficient vaporization of fluid during the generating power. The system is most adaptable to undrground power plants and marine usage

  8. Logarithmic-function generator

    Science.gov (United States)

    Caron, P. R.

    1975-01-01

    Solid-state logarithmic-function generator is compact and provides improved accuracy. Generator includes a stable multivibrator feeding into RC circuit. Resulting exponentially decaying voltage is compared with input signal. Generator output is proportional to time required for exponential voltage to decay from preset reference level to level of input signal.

  9. Generation and Context Memory

    Science.gov (United States)

    Mulligan, Neil W.; Lozito, Jeffrey P.; Rosner, Zachary A.

    2006-01-01

    Generation enhances memory for occurrence but may not enhance other aspects of memory. The present study further delineates the negative generation effect in context memory reported in N. W. Mulligan (2004). First, the negative generation effect occurred for perceptual attributes of the target item (its color and font) but not for extratarget…

  10. Radio-isotope generator

    International Nuclear Information System (INIS)

    Benjamins, H.M.

    1983-01-01

    A device is claimed for interrupting an elution process in a radioisotope generator before an elution vial is entirely filled. The generator is simultaneously exposed to sterile air both in the direction of the generator column and of the elution vial

  11. Motor/generator

    Science.gov (United States)

    Hickam, Christopher Dale [Glasford, IL

    2008-05-13

    A motor/generator is provided for connecting between a transmission input shaft and an output shaft of a prime mover. The motor/generator may include a motor/generator housing, a stator mounted to the motor/generator housing, a rotor mounted at least partially within the motor/generator housing and rotatable about a rotor rotation axis, and a transmission-shaft coupler drivingly coupled to the rotor. The transmission-shaft coupler may include a clamp, which may include a base attached to the rotor and a plurality of adjustable jaws.

  12. Generator for radionuclide

    International Nuclear Information System (INIS)

    Weisner, P.S.; Forrest, T.R.F.

    1985-01-01

    This invention provides a radionuclide generator of the kind in which a parent radionuclide, adsorbed on a column of particulate material, generates a daughter radionuclide which is periodically removed from the column. This invention is particularly concerned with technetium generators using single collection vials. The generator comprises a column, a first reservoir for the eluent, a second reservoir to contain the volume of eluent required for a single elution, and means connecting the first reservoir to the second reservoir and the second reservoir to the column. Such a generator is particularly suitable for operation by vacuum elution

  13. Solar thermoelectric generator

    Science.gov (United States)

    Toberer, Eric S.; Baranowski, Lauryn L.; Warren, Emily L.

    2016-05-03

    Solar thermoelectric generators (STEGs) are solid state heat engines that generate electricity from concentrated sunlight. A novel detailed balance model for STEGs is provided and applied to both state-of-the-art and idealized materials. STEGs can produce electricity by using sunlight to heat one side of a thermoelectric generator. While concentrated sunlight can be used to achieve extremely high temperatures (and thus improved generator efficiency), the solar absorber also emits a significant amount of black body radiation. This emitted light is the dominant loss mechanism in these generators. In this invention, we propose a solution to this problem that eliminates virtually all of the emitted black body radiation. This enables solar thermoelectric generators to operate at higher efficiency and achieve said efficient with lower levels of optical concentration. The solution is suitable for both single and dual axis solar thermoelectric generators.

  14. Designing the next generation (fifth generation computers)

    International Nuclear Information System (INIS)

    Wallich, P.

    1983-01-01

    A description is given of the designs necessary to develop fifth generation computers. An analysis is offered of problems and developments in parallelism, VLSI, artificial intelligence, knowledge engineering and natural language processing. Software developments are outlined including logic programming, object-oriented programming and exploratory programming. Computer architecture is detailed including concurrent computer architecture

  15. Generational Accounting in Iran

    Directory of Open Access Journals (Sweden)

    Mahdi Salehi

    2013-09-01

    Full Text Available The aim of this paper is to study of the generation accounts for Iranian’s generation. We applied the method of Auerbach, Gokhale and Kotlihoff (1991 on the period 1967-2008 in Iran. Our calculation shows with compare to industrial countries, fiscal burden for Iranian’s population is very chip and that depend on fiscal system in Iran. Except the recent years the rate of tax in Iran has been very low. The generation account for the old people (40 olds is 2117 $ but the future generation (t+1 is 36985 $. The share of male and female, during the years, in this burden is similar. Fiscal burden for Iranian’s generation is low but this population should support other burden that calls inflation. Because when the government do not receive the tax income, a low generation account transfer to price general level.

  16. Distributed generation hits market

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    The pace at which vendors are developing and marketing gas turbines and reciprocating engines for small-scale applications may signal the widespread growth of distributed generation. Loosely defined to refer to applications in which power generation equipment is located close to end users who have near-term power capacity needs, distributed generation encompasses a broad range of technologies and load requirements. Disagreement is inevitable, but many industry observers associate distributed generation with applications anywhere from 25 kW to 25 MW. Ten years ago, distributed generation users only represented about 2% of the world market. Today, that figure has increased to about 4 or 5%, and probably could settle in the 20% range within a 3-to-5-year period, according to Michael Jones, San Diego, Calif.-based Solar Turbines Inc. power generation marketing manager. The US Energy Information Administration predicts about 175 GW of generation capacity will be added domestically by 2010. If 20% comes from smaller plants, distributed generation could account for about 35 GW. Even with more competition, it's highly unlikely distributed generation will totally replace current market structures and central stations. Distributed generation may be best suited for making market inroads when and where central systems need upgrading, and should prove its worth when the system can't handle peak demands. Typical applications include small reciprocating engine generators at remote customer sites or larger gas turbines to boost the grid. Additional market opportunities include standby capacity, peak shaving, power quality, cogeneration and capacity rental for immediate demand requirements. Integration of distributed generation systems--using gas-fueled engines, gas-fired combustion engines and fuel cells--can upgrade power quality for customers and reduce operating costs for electric utilities

  17. Third generation nuclear plants

    Science.gov (United States)

    Barré, Bertrand

    2012-05-01

    After the Chernobyl accident, a new generation of Light Water Reactors has been designed and is being built. Third generation nuclear plants are equipped with dedicated systems to insure that if the worst accident were to occur, i.e. total core meltdown, no matter how low the probability of such occurrence, radioactive releases in the environment would be minimal. This article describes the EPR, representative of this "Generation III" and a few of its competitors on the world market.

  18. Modular Stirling Radioisotope Generator

    Science.gov (United States)

    Schmitz, Paul C.; Mason, Lee S.; Schifer, Nicholas A.

    2016-01-01

    High-efficiency radioisotope power generators will play an important role in future NASA space exploration missions. Stirling Radioisotope Generators (SRGs) have been identified as a candidate generator technology capable of providing mission designers with an efficient, high-specific-power electrical generator. SRGs high conversion efficiency has the potential to extend the limited Pu-238 supply when compared with current Radioisotope Thermoelectric Generators (RTGs). Due to budgetary constraints, the Advanced Stirling Radioisotope Generator (ASRG) was canceled in the fall of 2013. Over the past year a joint study by NASA and the Department of Energy (DOE) called the Nuclear Power Assessment Study (NPAS) recommended that Stirling technologies continue to be explored. During the mission studies of the NPAS, spare SRGs were sometimes required to meet mission power system reliability requirements. This led to an additional mass penalty and increased isotope consumption levied on certain SRG-based missions. In an attempt to remove the spare power system, a new generator architecture is considered, which could increase the reliability of a Stirling generator and provide a more fault-tolerant power system. This new generator called the Modular Stirling Radioisotope Generator (MSRG) employs multiple parallel Stirling convertor/controller strings, all of which share the heat from the General Purpose Heat Source (GPHS) modules. For this design, generators utilizing one to eight GPHS modules were analyzed, which provided about 50 to 450 W of direct current (DC) to the spacecraft, respectively. Four Stirling convertors are arranged around each GPHS module resulting in from 4 to 32 Stirling/controller strings. The convertors are balanced either individually or in pairs, and are radiatively coupled to the GPHS modules. Heat is rejected through the housing/radiator, which is similar in construction to the ASRG. Mass and power analysis for these systems indicate that specific

  19. TFTR generator load assessment

    International Nuclear Information System (INIS)

    Heck, F.M.

    1975-10-01

    Typical experimental load demands on the TFTR generators are illustrated based on the electrical characteristics of the field coils, the coil leads, the main bus work, the various auxiliary bus work, the rectifiers, and transformers. The generator MW capacities are shown to be adequate for the proposed experimental operations with allowances made for variations in the final designs. The generator MVA capacities are shown to be adequate provided portions of the TF and EF rectifiers are freewheeled at selected times

  20. Solar fuels generator

    Science.gov (United States)

    Lewis, Nathan S.; Spurgeon, Joshua M.

    2016-10-25

    The solar fuels generator includes an ionically conductive separator between a gaseous first phase and a second phase. A photoanode uses one or more components of the first phase to generate cations during operation of the solar fuels generator. A cation conduit is positioned provides a pathway along which the cations travel from the photoanode to the separator. The separator conducts the cations. A second solid cation conduit conducts the cations from the separator to a photocathode.

  1. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Hittman, F.; Bustard, T.S.

    1976-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile. 2 claims, 4 drawing figures

  2. Microwatt thermoelectric generator

    International Nuclear Information System (INIS)

    Barr, H.N.

    1978-01-01

    A microwatt thermoelectric generator suitable for implanting in the body is described. The disclosed generator utilizes a nuclear energy source. Provision is made for temporary electrical connection to the generator for testing purposes, and for ensuring that the heat generated by the nuclear source does not bypass the pile. Also disclosed is a getter which is resistant to shrinkage during sintering, and a foil configuration for controlling the radiation of heat from the nuclear source to the hot plate of the pile. 4 claims, 4 figures

  3. SMUG: Scientific Music Generator

    DEFF Research Database (Denmark)

    Scirea, Marco; A B Barros, Gabriella; Togelius, Julian

    2015-01-01

    Music is based on the real world. Composers use their day-to-day lives as inspiration to create rhythm and lyrics. Procedural music generators are capable of creating good quality pieces, and while some already use the world as inspiration, there is still much to be explored in this. We describe...... a system to generate lyrics and melodies from real-world data, in particular from academic papers. Through this we want to create a playful experience and establish a novel way of generating content (textual and musical) that could be applied to other domains, in particular to games. For melody generation...

  4. NEGATIVE GATE GENERATOR

    Science.gov (United States)

    Jones, C.S.; Eaton, T.E.

    1958-02-01

    This patent relates to pulse generating circuits and more particularly to rectangular pulse generators. The pulse generator of the present invention incorporates thyratrons as switching elements to discharge a first capacitor through a load resistor to initiate and provide the body of a Pulse, and subsequently dlscharge a second capacitor to impress the potential of its charge, with opposite potential polarity across the load resistor to terminate the pulse. Accurate rectangular pulses in the millimicrosecond range are produced across a low impedance by this generator.

  5. Third generation coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2014-01-01

    Third generation coaching unfolds a new universe for coaching and coaching psychology in the framework of current social research, new learning theories and discourses about personal leadership. Third generation coaching views coaching in a societal perspective. Coaching has become important...... transformation. Coaching thus facilitates new reflections and perspectives, as well as empowerment and support for self-Bildung processes. Third generation coaching focuses on the coach and the coachee in their narrative collaborative partnership. Unlike first generation coaching, where the goal is to help...

  6. Gearless wind power generator

    Energy Technology Data Exchange (ETDEWEB)

    Soederlund, L.; Ridanpaeae, P.; Vihriaelae, H.; Peraelae, R. [Tampere Univ. of Technology (Finland). Lab. of Electricity and Magnetism

    1998-12-31

    During the wind power generator project a design algorithm for a gearless permanent magnet generator with an axially orientated magnetic flux was developed and a 10 kW model machine was constructed. Utilising the test results a variable wind speed system of 100 kW was designed that incorporates a permanent magnet generator, a frequency converter and a fuzzy controller. This system produces about 5-15% more energy than existing types and stresses to the blades are minimised. The type of generator designed in the project represents in general a gearless solution for slow-speed electrical drives. (orig.)

  7. EPRI steam generator programs

    International Nuclear Information System (INIS)

    Martel, L.J.; Passell, T.O.; Bryant, P.E.C.; Rentler, R.M.

    1977-01-01

    The paper describes the current overall EPRI steam generator program plan and some of the ongoing projects. Because of the recent occurrence of a corrosion phenomenon called ''denting,'' which has affected a number of operating utilities, an expanded program plan is being developed which addresses the broad and urgent needs required to achieve improved steam generator reliability. The goal of improved steam generator reliability will require advances in various technologies and also a management philosophy that encourages conscientious efforts to apply the improved technologies to the design, procurement, and operation of plant systems and components that affect the full life reliability of steam generators

  8. Commanding Generation Y: How Generation X Military Leaders Can Better Utilize Generational Tendencies

    Science.gov (United States)

    2013-03-21

    generation ( Baby Boomers ). Although the profession of arms is a time-honored tradition steeped in discipline...senior leadership generational tendencies. Command; Leadership; Generation ; Baby Boomer ; Generation X; Generation Y Unclass Unclass Unclass UU 32 USMC...enable commanders to better lead Generation Y within the U.S. military. Discussion: Baby Boomers , Generation X, and Generation Y are

  9. Pulsed Corona Discharge Generated By Marx Generator

    Science.gov (United States)

    Sretenovic, G. B.; Obradovic, B. M.; Kovacevic, V. V.; Kuraica, M. M.; Puric J.

    2010-07-01

    The pulsed plasma has a significant role in new environmental protection technologies. As a part of a pulsed corona system for pollution control applications, Marx type repetitive pulse generator was constructed and tested in arrangement with wire-plate corona reactor. We performed electrical measurements, and obtained voltage and current signals, and also power and energy delivered per pulse. Ozone formation by streamer plasma in air was chosen to monitor chemical activity of the pulsed corona discharge.

  10. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    Science.gov (United States)

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  11. Performance analysis of the Malaysian elite youth squash players ...

    African Journals Online (AJOL)

    The straight and cross court drives were the most frequent strokes used by both genders, with more on the backhand side. The drop shot and straight drives contributed to most winners for the men and women respectively. Most winners were produced by the players when they occupied the middle areas of the court.

  12. Tennis-Badminton-Squash, June 1976-June 1978. NAGWS Guide.

    Science.gov (United States)

    Van Oteghen, Sharon L., Ed.; And Others

    The National Association for Girls and Women in Sport (NAGWS) publishes ten biennial and two annual guides for 22 sports. Guides contain information on NAGWS or NAGWS-approved playing rules, officials' ratings in most sports, articles on coaching techniques and organization, regulations governing AIAW National Championships in applicable sports,…

  13. Crescimento e estado nutricional de abóbora híbrida em função de adubação orgânica e mineral Nutritional state of hybrid squash as a function of organic compost and mineral fertilizer

    Directory of Open Access Journals (Sweden)

    Natan F. Silva

    1999-11-01

    Full Text Available Foi conduzido um ensaio em estufa com cobertura plástica, em Viçosa, MG, com finalidade de avaliar a resposta da abóbora híbrida, cv. Tetsukabuto, a cinco doses (0, 25, 50, 100 e 150 g.dm-3 de composto orgânico produzido com resíduos de suínos e bagaço de cana em três níveis (0, 1 e 2 de adubação mineral (AM. No nível 1 da adubação mineral foram adicionados, em mg.dm-3 de substrato, os elementos: 150 de P; 50 de N; 75 de K; 20 de S; 58,5 de Ca; 14 de Mg; 0,5 de B; 0,5 de Cu; 1 de Zn e 0,1 de Mo. No nível 2 adicionou-se o dobro das doses dos nutrientes aplicadas no nível 1. O experimento foi em fatorial 5 x 3, e os tratamentos distribuídos em blocos ao acaso com quatro repetições. Cada parcela foi constituída por um vaso contendo 10 dm³ de substrato, com uma planta cada. Após 36 dias da semeadura, o composto orgânico e o adubo mineral propiciaram aumentos da área foliar, da matéria seca da parte aérea das plantas e aumentos dos teores de P, K e S e redução dos teores de N, Mg, e Ca na matéria seca do limbo foliar.An experiment was carried out in a plastic greenhouse, in Viçosa, Minas Gerais, Brazil, to evaluate the response of hybrid squash cv. Tetsukabuto to five rates (0, 25, 50, 100, and 150 g/dm³ of organic compost combined with three levels (0, 1 and 2 of mineral fertilizer. At level 1 of mineral fertilizer the following nutrients were added in mg per dm³ of substrate: 150 of P; 50 of N; 75 of K; 20 of S; 58.5 of Ca; 14 of Mg; 0.5 of B; 0.5 of Cu; 1 of Zn and 0.1 of Mo. At level 2, a double of the quantities applied at level 1 were added. The experiment was laid out as a 5 x 3 factorial arrangement, and the treatments randomly distributed in blocks, with four repetitions. Each sample comprised a pot containing 10 dm³ of substrate and a single plant. Thirty six days after planting the organic compost and mineral fertilizer resulted in increases in leaf area, dry weight of aerial parts, and P, K and S content

  14. NMR studies of internal dynamics of serine proteinase protein inhibitors: Binding region mobilities of intact and reactive-site hydrolyzed Cucurbita maxima trypsin inhibitor (CMTI)-III of the squash family and comparison with those of counterparts of CMTI-V of the potato I family.

    Science.gov (United States)

    Liu, J; Gong, Y; Prakash, O; Wen, L; Lee, I; Huang, J K; Krishnamoorthi, R

    1998-01-01

    Serine proteinase protein inhibitors follow the standard mechanism of inhibition (Laskowski M Jr, Kato I, 1980, Annu Rev Biochem 49:593-626), whereby an enzyme-catalyzed equilibrium between intact (I) and reactive-site hydrolyzed inhibitor (I*) is reached. The hydrolysis constant, Khyd, is defined as [I*]/[I]. Here, we explore the role of internal dynamics in the resynthesis of the scissile bond by comparing the internal mobility data of intact and cleaved inhibitors belonging to two different families. The inhibitors studied are recombinant Cucurbita maxima trypsin inhibitor III (rCMTI-III; Mr 3 kDa) of the squash family and rCMTI-V (Mr approximately 7 kDa) of the potato I family. These two inhibitors have different binding loop-scaffold interactions and different Khyd values--2.4 (CMTI-III) and 9 (CMTI-V)--at 25 degrees C. The reactive-site peptide bond (P1-P1') is that between Arg5 and Ile6 in CMTI-III, and that between Lys44 and Asp45 in CMTI-V. The order parameters (S2) of backbone NHs of uniformly 15N-labeled rCMTI-III and rCMTI-III* were determined from measurements of 15N spin-lattice and spin-spin relaxation rates, and [1H]-15N steady-state heteronuclear Overhauser effects, using the model-free formalism, and compared with the data reported previously for rCMTI-V and rCMTI-V*. The backbones of rCMTI-III [(S2) = 0.71] and rCMTI-III* [(S2) = 0.63] are more flexible than those of rCMTI-V [(S2) = 0.83] and rCMTI-V* [(S2) = 0.85]. The binding loop residues, P4-P1, in the two proteins show the following average order parameters: 0.57 (rCMTI-III) and 0.44 (rCMTI-III*); 0.70 (rCMTI-V) and 0.40 (rCMTI-V*). The P1'-P4' residues, on the other hand, are associated with (S2) values of 0.56 (rCMTI-III) and 0.47 (rCMTI-III*); and 0.73 (rCMTI-V) and 0.83 (rCMTI-V*). The newly formed C-terminal (Pn residues) gains a smaller magnitude of flexibility in rCMTI-III* due to the Cys3-Cys20 crosslink. In contrast, the newly formed N-terminal (Pn' residues) becomes more flexible

  15. Wroclaw neutrino event generator

    International Nuclear Information System (INIS)

    Nowak, J A

    2006-01-01

    A neutrino event generator developed by the Wroclaw Neutrino Group is described. The physical models included in the generator are discussed and illustrated with the results of simulations. The considered processes are quasi-elastic scattering and pion production modelled by combining the Δ resonance excitation and deep inelastic scattering

  16. When Generations Collide

    Science.gov (United States)

    Fogg, Piper

    2008-01-01

    When four generations converge in the academic workplace, it can create serious culture clashes. It is happening across college campuses--in offices as diverse as admissions, student affairs, legal affairs, and technology. It is especially striking in the faculty ranks, where generational challenges have extra significance amid recruiting efforts,…

  17. Photovoltaic Bias Generator

    Science.gov (United States)

    2018-02-01

    Department of the Army position unless so designated by other authorized documents. Citation of manufacturer’s or trade names does not constitute an... Interior view of the photovoltaic bias generator showing wrapped-wire side of circuit board...3 Fig. 4 Interior view of the photovoltaic bias generator showing component side of circuit board

  18. Third Generation Coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2016-01-01

    , Gruppen oder Teams neue Orientierung auf einer tieferen Sinnebene ermöglicht. Im Gegensatz zum Coaching der ersten Generation, bei dem das Erreichen bestimmter, festgeschriebener Ziele im Vordergrund steht, und im Gegensatz zum Coaching der zweiten Generation, in dem wünschenswerte zukünftige...

  19. Hospitality services generate revenue.

    Science.gov (United States)

    Bizouati, S

    1993-01-01

    An increasing number of hospitals are undertaking external revenue-generating activities to supplement their shrinking budgets. Written at the request of Leadership, this article outlines an example of a successful catering service -- a money-generating business that more Canadian hospitals could profitably consider.

  20. Aerodynamically shaped vortex generators

    DEFF Research Database (Denmark)

    Hansen, Martin Otto Laver; Velte, Clara Marika; Øye, Stig

    2016-01-01

    An aerodynamically shaped vortex generator has been proposed, manufactured and tested in a wind tunnel. The effect on the overall performance when applied on a thick airfoil is an increased lift to drag ratio compared with standard vortex generators. Copyright © 2015 John Wiley & Sons, Ltd....

  1. Understanding portable generators

    Energy Technology Data Exchange (ETDEWEB)

    Hills, A.; Hawkins, B. [Guelph Univ., ON (Canada); Clarke, S. [Ontario Ministry of Agriculture, Food and Rural Affairs, Toronto, ON (Canada)

    2000-06-01

    This factsheet is intended to help consumers select a small portable generator for emergency electrical needs. Interest in standby generators has been heightened ever since the prolonged power outage in Eastern Ontario and Southwestern Quebec during the 1998 ice storm and the concern over Y2K related outages. Farmers, in particular, have been reassessing their need for emergency electrical power supply. This document presents some of the factors that should be considered when purchasing and operating a portable generator in the 3 to 12 kW size. It provides a detailed review of power quality and describes the use of tractor-driven power-take-off generators of 15 kW and larger. Several manufacturers make portable generators in many sizes with a whole range of features. This document includes a table depicting generator Feature/Benefit analysis to help consumers understand the differences between features and benefits. A second table provides a check list for generator feature/benefits. Specific details for the operations of various generators are available from manufacturers, distributors and electrical contractors. 2 tabs., 1 fig.

  2. Generative Processes: Thick Drawing

    Science.gov (United States)

    Wallick, Karl

    2012-01-01

    This article presents techniques and theories of generative drawing as a means for developing complex content in architecture design studios. Appending the word "generative" to drawing adds specificity to the most common representation tool and clarifies that such drawings are not singularly about communication or documentation but are…

  3. Generation Y Perspectives

    Science.gov (United States)

    Skytland, Nicholas; Painting, Kristen; Barrera, Aaron; Fitzpatrick, Garret

    2008-01-01

    This viewgraph presentation reviews the perception of NASA and the importance of engaging those people born between 1977 and 2000, also known as Generation Y. It examines some of the differences in attitudes and experiences, and how it reflects on how they view NASA. It also discusses use of the internet in connecting to the people from that generation.

  4. Neutron generator control system

    International Nuclear Information System (INIS)

    Peelman, H.E.; Bridges, J.R.

    1981-01-01

    A method is described of controlling the neutron output of a neutron generator tube used in neutron well logging. The system operates by monitoring the target beam current and comparing a function of this current with a reference voltage level to develop a control signal used in a series regulator to control the replenisher current of the neutron generator tube. (U.K.)

  5. Generation IV national program

    International Nuclear Information System (INIS)

    Preville, M.; Sadhankar, R.; Brady, D.

    2007-01-01

    This paper outlines the Generation IV National Program. This program involves evolutionary and innovative design with significantly higher efficiencies (∼50% compared to present ∼30%) - sustainable, economical, safe, reliable and proliferation resistant - for future energy security. The Generation IV Forum (GIF) effectively leverages the resources of the participants to meet these goals. Ten countries signed the GIF Charter in 2001

  6. Solar Fuel Generator

    Science.gov (United States)

    Lewis, Nathan S. (Inventor); West, William C. (Inventor)

    2017-01-01

    The disclosure provides conductive membranes for water splitting and solar fuel generation. The membranes comprise an embedded semiconductive/photoactive material and an oxygen or hydrogen evolution catalyst. Also provided are chassis and cassettes containing the membranes for use in fuel generation.

  7. The Next Great Generation?

    Science.gov (United States)

    Brownstein, Andrew

    2000-01-01

    Discusses ideas from a new book, "Millennials Rising: The Next Great Generation," (by Neil Howe and William Strauss) suggesting that youth culture is on the cusp of a radical shift with the generation beginning with this year's college freshmen who are typically team oriented, optimistic, and poised for greatness on a global scale. Includes a…

  8. OMG: Open molecule generator

    NARCIS (Netherlands)

    Peironcely, J.E.; Rojas-Chertó, M.; Fichera, D.; Reijmers, T.; Coulier, L.; Faulon, J.-L.; Hankemeier, T.

    2012-01-01

    Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG), which for a given elemental composition produces all non-isomorphic chemical

  9. Experience and Its Generation

    Science.gov (United States)

    Youqing, Chen

    2006-01-01

    Experience is an activity that arouses emotions and generates meanings based on vivid sensation and profound comprehension. It is emotional, meaningful, and personal, playing a key role in the course of forming and developing one's qualities. The psychological process of experience generation consists of such links as sensing things, arousing…

  10. Experience and Its Generation

    Institute of Scientific and Technical Information of China (English)

    Chen Youqing

    2006-01-01

    Experience iS an activity that arouses emotions and generates meanings based on vivid sensation and profound compreh ension.It iS emotional,meaningful,and personal,playing a key role in the course of forming and developing one'S qualities.The psychological process of experience generation consists of such links as sensing things,arousing emotions,promoting comprehension and association,generating insights and meanings,and deepening emotional responses.Undergoing things personally by means of direct sensation,taking part in activities,and living life are the most important preconditions of experience generation.Emotional influence,situational edification,and arts edification ale extemal factors that induce experience generation.

  11. Impacts on power generation

    International Nuclear Information System (INIS)

    Myers, J.; Sidebotton, P.

    1998-01-01

    The future impact of the arrival of natural gas in the Maritime provinces on electricity generation in the region was discussed. Currently, electrical generation sources in Nova Scotia include hydro generation (9 per cent), coal generation (80 per cent), heavy fuel oil generation (8 per cent), and light oil, wood chips and purchased power (3 per cent). It is expected that with the introduction of natural gas electric utilities will take advantage of new gas combustion turbines which have high efficiency rates. An overview of Westcoast Power's operations across Canada was also presented. The Company has three projects in the Maritimes - the Courtney Bay project in New Brunswick, the Bayside Power project, the Irving Paper project - in addition to the McMahon cogeneration plant in Taylor, B.C. figs

  12. Quantum random number generator

    Science.gov (United States)

    Soubusta, Jan; Haderka, Ondrej; Hendrych, Martin

    2001-03-01

    Since reflection or transmission of a quantum particle on a beamsplitter is inherently random quantum process, a device built on this principle does not suffer from drawbacks of neither pseudo-random computer generators or classical noise sources. Nevertheless, a number of physical conditions necessary for high quality random numbers generation must be satisfied. Luckily, in quantum optics realization they can be well controlled. We present an easy random number generator based on the division of weak light pulses on a beamsplitter. The randomness of the generated bit stream is supported by passing the data through series of 15 statistical test. The device generates at a rate of 109.7 kbit/s.

  13. Procedure generation and verification

    International Nuclear Information System (INIS)

    Sheely, W.F.

    1986-01-01

    The Department of Energy has used Artificial Intelligence of ''AI'' concepts to develop two powerful new computer-based techniques to enhance safety in nuclear applications. The Procedure Generation System, and the Procedure Verification System, can be adapted to other commercial applications, such as a manufacturing plant. The Procedure Generation System can create a procedure to deal with the off-normal condition. The operator can then take correct actions on the system in minimal time. The Verification System evaluates the logic of the Procedure Generator's conclusions. This evaluation uses logic techniques totally independent of the Procedure Generator. The rapid, accurate generation and verification of corrective procedures can greatly reduce the human error, possible in a complex (stressful/high stress) situation

  14. EGG: Empirical Galaxy Generator

    Science.gov (United States)

    Schreiber, C.; Elbaz, D.; Pannella, M.; Merlin, E.; Castellano, M.; Fontana, A.; Bourne, N.; Boutsia, K.; Cullen, F.; Dunlop, J.; Ferguson, H. C.; Michałowski, M. J.; Okumura, K.; Santini, P.; Shu, X. W.; Wang, T.; White, C.

    2018-04-01

    The Empirical Galaxy Generator (EGG) generates fake galaxy catalogs and images with realistic positions, morphologies and fluxes from the far-ultraviolet to the far-infrared. The catalogs are generated by egg-gencat and stored in binary FITS tables (column oriented). Another program, egg-2skymaker, is used to convert the generated catalog into ASCII tables suitable for ingestion by SkyMaker (ascl:1010.066) to produce realistic high resolution images (e.g., Hubble-like), while egg-gennoise and egg-genmap can be used to generate the low resolution images (e.g., Herschel-like). These tools can be used to test source extraction codes, or to evaluate the reliability of any map-based science (stacking, dropout identification, etc.).

  15. TFTR Motor Generator

    International Nuclear Information System (INIS)

    Murray, J.G.; Bronner, G.; Horton, M.

    1977-01-01

    A general description is given of 475 MVA pulsed motor generators for TFTR at Princeton Plasma Physics Laboratory. Two identical generators operating in parallel are capable of supplying 950 MVA for an equivalent square pulse of 6.77 seconds and 4,500 MJ at 0.7 power factor to provide the energy for the pulsed electrical coils and heating system for TFTR. The description includes the operational features of the 15,000 HP wound rotor motors driving each generator with its starting equipment and cycloconverter for controlling speed, power factor, and regulating line voltage during load pulsing where the generator speed changes from 87.5 to 60 Hz frequency variation to provide the 4,500 MJ or energy. The special design characteristics such as fatigue stress calculations for 10 6 cycles of operation, forcing factor on exciter to provide regulation, and low generator impedance are reviewed

  16. Steam generator life management

    International Nuclear Information System (INIS)

    Tapping, R.L.; Nickerson, J.; Spekkens, P.; Maruska, C.

    1998-01-01

    Steam generators are a critical component of a nuclear power reactor, and can contribute significantly to station unavailability, as has been amply demonstrated in Pressurized Water Reactors (PWRs). CANDU steam generators are not immune to steam generator degradation, and the variety of CANDU steam generator designs and tube materials has led to some unexpected challenges. However, aggressive remedial actions, and careful proactive maintenance activities, have led to a decrease in steam generator-related station unavailability of Canadian CANDUs. AECL and the CANDU utilities have defined programs that will enable existing or new steam generators to operate effectively for 40 years. Research and development work covers corrosion and mechanical degradation of tube bundles and internals, chemistry, thermal hydraulics, fouling, inspection and cleaning, as well as provision for specially tool development for specific problem solving. A major driving force is development of CANDU-specific fitness-for-service guidelines, including appropriate inspection and monitoring technology to measure steam generator condition. Longer-range work focuses on development of intelligent on-line monitoring for the feedwater system and steam generator. New designs have reduced risk of corrosion and fouling, are more easily inspected and cleaned, and are less susceptible to mechanical damage. The Canadian CANDU utilities have developed programs for remedial actions to combat degradation of performance (Gentilly-2, Point Lepreau, Bruce A/B, Pickering A/B), and have developed strategic plans to ensure that good future operation is ensured. This report shows how recent advances in cleaning technology are integrated into a life management strategy, discusses downcomer flow measurement as a means of monitoring steam generator condition, and describes recent advances in hideout return as a life management tool. The research and development program, as well as operating experience, has identified

  17. Compact neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo; Lou, Tak Pui

    2005-03-22

    A compact neutron generator has at its outer circumference a toroidal shaped plasma chamber in which a tritium (or other) plasma is generated. A RF antenna is wrapped around the plasma chamber. A plurality of tritium ion beamlets are extracted through spaced extraction apertures of a plasma electrode on the inner surface of the toroidal plasma chamber and directed inwardly toward the center of neutron generator. The beamlets pass through spaced acceleration and focusing electrodes to a neutron generating target at the center of neutron generator. The target is typically made of titanium tubing. Water is flowed through the tubing for cooling. The beam can be pulsed rapidly to achieve ultrashort neutron bursts. The target may be moved rapidly up and down so that the average power deposited on the surface of the target may be kept at a reasonable level. The neutron generator can produce fast neutrons from a T-T reaction which can be used for luggage and cargo interrogation applications. A luggage or cargo inspection system has a pulsed T-T neutron generator or source at the center, surrounded by associated gamma detectors and other components for identifying explosives or other contraband.

  18. OMG: Open Molecule Generator.

    Science.gov (United States)

    Peironcely, Julio E; Rojas-Chertó, Miguel; Fichera, Davide; Reijmers, Theo; Coulier, Leon; Faulon, Jean-Loup; Hankemeier, Thomas

    2012-09-17

    Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG), which for a given elemental composition produces all non-isomorphic chemical structures that match that elemental composition. Furthermore, this structure generator can accept as additional input one or multiple non-overlapping prescribed substructures to drastically reduce the number of possible chemical structures. Being open source allows for customization and future extension of its functionality. OMG relies on a modified version of the Canonical Augmentation Path, which grows intermediate chemical structures by adding bonds and checks that at each step only unique molecules are produced. In order to benchmark the tool, we generated chemical structures for the elemental formulas and substructures of different metabolites and compared the results with a commercially available structure generator. The results obtained, i.e. the number of molecules generated, were identical for elemental compositions having only C, O and H. For elemental compositions containing C, O, H, N, P and S, OMG produces all the chemically valid molecules while the other generator produces more, yet chemically impossible, molecules. The chemical completeness of the OMG results comes at the expense of being slower than the commercial generator. In addition to being open source, OMG clearly showed the added value of constraining the solution space by using multiple prescribed substructures as input. We expect this structure generator to be useful in many fields, but to be especially of great importance for metabolomics, where identifying unknown metabolites is still a major bottleneck.

  19. OMG: Open Molecule Generator

    Directory of Open Access Journals (Sweden)

    Peironcely Julio E

    2012-09-01

    Full Text Available Abstract Computer Assisted Structure Elucidation has been used for decades to discover the chemical structure of unknown compounds. In this work we introduce the first open source structure generator, Open Molecule Generator (OMG, which for a given elemental composition produces all non-isomorphic chemical structures that match that elemental composition. Furthermore, this structure generator can accept as additional input one or multiple non-overlapping prescribed substructures to drastically reduce the number of possible chemical structures. Being open source allows for customization and future extension of its functionality. OMG relies on a modified version of the Canonical Augmentation Path, which grows intermediate chemical structures by adding bonds and checks that at each step only unique molecules are produced. In order to benchmark the tool, we generated chemical structures for the elemental formulas and substructures of different metabolites and compared the results with a commercially available structure generator. The results obtained, i.e. the number of molecules generated, were identical for elemental compositions having only C, O and H. For elemental compositions containing C, O, H, N, P and S, OMG produces all the chemically valid molecules while the other generator produces more, yet chemically impossible, molecules. The chemical completeness of the OMG results comes at the expense of being slower than the commercial generator. In addition to being open source, OMG clearly showed the added value of constraining the solution space by using multiple prescribed substructures as input. We expect this structure generator to be useful in many fields, but to be especially of great importance for metabolomics, where identifying unknown metabolites is still a major bottleneck.

  20. Superconducting current generators

    International Nuclear Information System (INIS)

    Genevey, P.

    1970-01-01

    After a brief summary of the principle of energy storage and liberation with superconducting coils,two current generators are described that create currents in the range 600 to 1400 A, used for two storage experiments of 25 kJ and 50 kJ respectively. The two current generators are: a) a flux pump and b) a superconducting transformer. Both could be developed into more powerful units. The study shows the advantage of the transformer over the flux pump in order to create large currents. The efficiencies of the two generators are 95 per cent and 40 to 60 per cent respectively. (author) [fr

  1. Random number generation

    International Nuclear Information System (INIS)

    Coveyou, R.R.

    1974-01-01

    The subject of random number generation is currently controversial. Differing opinions on this subject seem to stem from implicit or explicit differences in philosophy; in particular, from differing ideas concerning the role of probability in the real world of physical processes, electronic computers, and Monte Carlo calculations. An attempt is made here to reconcile these views. The role of stochastic ideas in mathematical models is discussed. In illustration of these ideas, a mathematical model of the use of random number generators in Monte Carlo calculations is constructed. This model is used to set up criteria for the comparison and evaluation of random number generators. (U.S.)

  2. PULSE SYNTHESIZING GENERATOR

    Science.gov (United States)

    Kerns, Q.A.

    1963-08-01

    >An electronlc circuit for synthesizing electrical current pulses having very fast rise times includes several sinewave generators tuned to progressively higher harmonic frequencies with signal amplitudes and phases selectable according to the Fourier series of the waveform that is to be synthesized. Phase control is provided by periodically triggering the generators at precisely controlled times. The outputs of the generators are combined in a coaxial transmission line. Any frequency-dependent delays that occur in the transmission line can be readily compensated for so that the desired signal wave shape is obtained at the output of the line. (AEC)

  3. Coal-fired generation

    CERN Document Server

    Breeze, Paul

    2015-01-01

    Coal-Fired Generation is a concise, up-to-date and readable guide providing an introduction to this traditional power generation technology. It includes detailed descriptions of coal fired generation systems, demystifies the coal fired technology functions in practice as well as exploring the economic and environmental risk factors. Engineers, managers, policymakers and those involved in planning and delivering energy resources will find this reference a valuable guide, to help establish a reliable power supply address social and economic objectives. Focuses on the evolution of the traditio

  4. Graph Generator Survey

    Energy Technology Data Exchange (ETDEWEB)

    Lothian, Joshua [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Powers, Sarah S. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sullivan, Blair D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Baker, Matthew B. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Schrock, Jonathan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Poole, Stephen W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2013-10-01

    The benchmarking effort within the Extreme Scale Systems Center at Oak Ridge National Laboratory seeks to provide High Performance Computing benchmarks and test suites of interest to the DoD sponsor. The work described in this report is a part of the effort focusing on graph generation. A previously developed benchmark, SystemBurn, allowed the emulation of different application behavior profiles within a single framework. To complement this effort, similar capabilities are desired for graph-centric problems. This report examines existing synthetic graph generator implementations in preparation for further study on the properties of their generated synthetic graphs.

  5. Power generation technologies

    CERN Document Server

    Breeze, Paul

    2014-01-01

    The new edition of Power Generation Technologies is a concise and readable guide that provides an introduction to the full spectrum of currently available power generation options, from traditional fossil fuels and the better established alternatives such as wind and solar power, to emerging renewables such as biomass and geothermal energy. Technology solutions such as combined heat and power and distributed generation are also explored. However, this book is more than just an account of the technologies - for each method the author explores the economic and environmental costs and risk factor

  6. Harmonic arbitrary waveform generator

    Science.gov (United States)

    Roberts, Brock Franklin

    2017-11-28

    High frequency arbitrary waveforms have applications in radar, communications, medical imaging, therapy, electronic warfare, and charged particle acceleration and control. State of the art arbitrary waveform generators are limited in the frequency they can operate by the speed of the Digital to Analog converters that directly create their arbitrary waveforms. The architecture of the Harmonic Arbitrary Waveform Generator allows the phase and amplitude of the high frequency content of waveforms to be controlled without taxing the Digital to Analog converters that control them. The Harmonic Arbitrary Waveform Generator converts a high frequency input, into a precision, adjustable, high frequency arbitrary waveform.

  7. Nanosecond neutron generator

    International Nuclear Information System (INIS)

    Lobov, S.I.; Pavlovskaya, N.G.; Pukhov, S.P.

    1991-01-01

    High-voltage nanosecond neutron generator for obtaining neutrons in D-T reaction is described. Yield of 6x10 6 neutron/pulse was generated in a sealed gas-filled diode with a target on the cathode by accelerating pulse voltage of approximately 0.5 MV and length at half-height of 0.5 ns and deuterium pressure of 6x10 -2 Torr. Ways of increasing neutron yield and possibilities of creating generators of nanosecond neutron pulses with great service life are considered

  8. PC Scene Generation

    Science.gov (United States)

    Buford, James A., Jr.; Cosby, David; Bunfield, Dennis H.; Mayhall, Anthony J.; Trimble, Darian E.

    2007-04-01

    AMRDEC has successfully tested hardware and software for Real-Time Scene Generation for IR and SAL Sensors on COTS PC based hardware and video cards. AMRDEC personnel worked with nVidia and Concurrent Computer Corporation to develop a Scene Generation system capable of frame rates of at least 120Hz while frame locked to an external source (such as a missile seeker) with no dropped frames. Latency measurements and image validation were performed using COTS and in-house developed hardware and software. Software for the Scene Generation system was developed using OpenSceneGraph.

  9. Philosophy of power generation

    International Nuclear Information System (INIS)

    Amein, H.; Joyia, Y.; Qureshi, M.N.; Asif, M.

    1995-01-01

    In view of the huge power demand in future, the capital investment requirements for the development of power projects to meet the future energy requirements are so alarming that public sector alone cannot manage to raise funds and participation of the private sector in power generation development has become imperative. This paper discusses a power generation philosophy based on preference to the exploitation of indigenous resources and participation of private sector. In order to have diversification in generation resources, due consideration has been given to the development of nuclear power and even non-conventional but promising technologies of solar, wind, biomass and geothermal etc. (author)

  10. French steam generator

    International Nuclear Information System (INIS)

    Remond, A.

    1986-01-01

    After recalling the potential damage mode of tubes of steam generator, the author recalls the safety criteria used in France. The improvements and the process of damage prejudice and reparation for tubular bundle are presented [fr

  11. Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    2016-01-01

    Deep generative models parameterized by neural networks have recently achieved state-of-the-art performance in unsupervised and semi-supervised learning. We extend deep generative models with auxiliary variables which improves the variational approximation. The auxiliary variables leave...... the generative model unchanged but make the variational distribution more expressive. Inspired by the structure of the auxiliary variable we also propose a model with two stochastic layers and skip connections. Our findings suggest that more expressive and properly specified deep generative models converge...... faster with better results. We show state-of-the-art performance within semi-supervised learning on MNIST (0.96%), SVHN (16.61%) and NORB (9.40%) datasets....

  12. Airburst-Generated Tsunamis

    Science.gov (United States)

    Berger, Marsha; Goodman, Jonathan

    2018-04-01

    This paper examines the questions of whether smaller asteroids that burst in the air over water can generate tsunamis that could pose a threat to distant locations. Such airburst-generated tsunamis are qualitatively different than the more frequently studied earthquake-generated tsunamis, and differ as well from tsunamis generated by asteroids that strike the ocean. Numerical simulations are presented using the shallow water equations in several settings, demonstrating very little tsunami threat from this scenario. A model problem with an explicit solution that demonstrates and explains the same phenomena found in the computations is analyzed. We discuss the question of whether compressibility and dispersion are important effects that should be included, and show results from a more sophisticated model problem using the linearized Euler equations that begins to addresses this.

  13. The nuclear power generation

    International Nuclear Information System (INIS)

    Serres, R.

    1999-01-01

    The French nuclear generating industry is highly competitive. The installations have an average age of fifteen years and are half way through their expected life. Nuclear power accounts for 70% of the profits of the French generating company, EDF. Nuclear generation has a minimal effect on the atmosphere and France has a level of CO 2 emissions, thought to be the main cause of the greenhouse effect, half that of Europe as a whole. The air in France is purer than in neighbouring countries, mainly because 75% of all electrical power is generated in nuclear plants and 15% in hydroelectric stations. The operations and maintenance of French nuclear power plants in the service and distribution companies out of a total of 100 000 employees in all, 90 % of whom are based in mainland France. (authors)

  14. Rhodium-103m generator

    International Nuclear Information System (INIS)

    Mamadaliev, N.; Levin, V.I.; Malinin, A.B.

    1978-01-01

    103 Pd separated from metal rhodium irradiated with deuterons has been used without a carrier for sup( 03m)Rh generator The generator of sup(103m)Rh is a column 6mm in diameter filled with an anionite in Cl - form (Dowex-2,8,200-400 mesh) with an adsorbed parent isotope of 103 Pd. As a result of its decay, a 103 Rh daughter isotope is accumulated, which can be washed out from the generator from time to time with a corresponding solution. To prepare the generator, 0.5g of the resin with an adsorbed 103 Pd is charged into the column containing 1g of the same resin. Washing out with 2N HCl yields more than 90% of sup(103m)Rh with a radionuclide purity of more than 99.99%

  15. Rechargeable radioactive isotope generator

    International Nuclear Information System (INIS)

    Thornton, A.K.; Cerone, F.E.

    1978-01-01

    The description is given of a rechargeable radioactive isotope generator having the following features: a box containing a transport shield, a shielded generator including elements for the absorption and holding of the parent isotope, an eluant tank, a first pipe causing this tank to communicate with the transport shield, a second pipe causing this transport shield to communicate with the shielded generator and a third pipe placing the shielded generator in communication with the outside of the unit. It also includes a shelf across the external front part of the unit a part of which is shielded by external components, a shielded elution flask in which the eluate is poured and a filter set at a point between the flask and the third pipe [fr

  16. Standard Firebrand Generator

    Data.gov (United States)

    Federal Laboratory Consortium — This apparatus, developed at EL, has been constructed to generate a controlled and repeatable size and mass distribution of glowing firebrands. The purpose of NIST...

  17. Generators for Miranda

    Energy Technology Data Exchange (ETDEWEB)

    Angiolini, G.; Borgna, H.; Garcia, A.; Fernandez, M.; Piriz, H.; Verdu, C. [IMPSA Hydrogenerators (Argentina)

    2000-10-01

    The three generators at the Miranda hydroelectric power plant on the Araguari river northwest of Belo Horizonte in the state of Minas Gerais began operation in 1998. All the electromechanical equipment for the project was supplied by IMPSA. The generators, which are driven by Francis turbines, are vertical shaft, three-phase, salient-pole synchronous machines with an output of 137 MVA. The generators successfully completed a series of studies and trials before commercial operation began and Companhia Energetica de Minas Gerais (CEMIG) is considering increasing the operation power to 150 MVA. The specification and design of the electrical aspects, stator winding, rotor, bearings, shaft line, generator cooling system, excitation system and monitoring systems are described. Electromagnetic requirements and acceptance testing results are given in two summary tables.

  18. Financing Distributed Generation

    Energy Technology Data Exchange (ETDEWEB)

    Walker, A.

    2001-06-29

    This paper introduces the engineer who is undertaking distributed generation projects to a wide range of financing options. Distributed generation systems (such as internal combustion engines, small gas turbines, fuel cells and photovoltaics) all require an initial investment, which is recovered over time through revenues or savings. An understanding of the cost of capital and financing structures helps the engineer develop realistic expectations and not be offended by the common requirements of financing organizations. This paper discusses several mechanisms for financing distributed generation projects: appropriations; debt (commercial bank loan); mortgage; home equity loan; limited partnership; vendor financing; general obligation bond; revenue bond; lease; Energy Savings Performance Contract; utility programs; chauffage (end-use purchase); and grants. The paper also discusses financial strategies for businesses focusing on distributed generation: venture capital; informal investors (''business angels''); bank and debt financing; and the stock market.

  19. Steam generator water lancing

    International Nuclear Information System (INIS)

    Kamler, F.; Schneider, W.

    1992-01-01

    The tubesheet and tube support plate deposits in CANDU steam generators are notable for their hardness. Also notable is the wide variety of steam generator access situations. Because of the sludge hardness and the difficulty of the access, traditional water lancing processes which directed jets from the central tube free lane or from the periphery of the bundle have proven unsuitable. This has led to the need for some very unique inter tube water lancing devices which could direct powerful water jets directly onto the deposits. This type of process was applied to the upper broached plates of the Bruce A steam generators, which had become severely blocked. It has since been applied to various other steam generator situations. This paper describes the flexlance equipment development, qualification, and performance in the various CANDU applications. 4 refs., 2 tabs., 7 figs

  20. Financing Distributed Generation

    International Nuclear Information System (INIS)

    Walker, A.

    2001-01-01

    This paper introduces the engineer who is undertaking distributed generation projects to a wide range of financing options. Distributed generation systems (such as internal combustion engines, small gas turbines, fuel cells and photovoltaics) all require an initial investment, which is recovered over time through revenues or savings. An understanding of the cost of capital and financing structures helps the engineer develop realistic expectations and not be offended by the common requirements of financing organizations. This paper discusses several mechanisms for financing distributed generation projects: appropriations; debt (commercial bank loan); mortgage; home equity loan; limited partnership; vendor financing; general obligation bond; revenue bond; lease; Energy Savings Performance Contract; utility programs; chauffage (end-use purchase); and grants. The paper also discusses financial strategies for businesses focusing on distributed generation: venture capital; informal investors (''business angels''); bank and debt financing; and the stock market

  1. Voltage regulator for generator

    Energy Technology Data Exchange (ETDEWEB)

    Naoi, K

    1989-01-17

    It is an object of this invention to provide a voltage regulator for a generator charging a battery, wherein even if the ambient temperature at the voltage regulator rises abnormally high, possible thermal breakage of the semiconductor elements constituting the voltage regulator can be avoided. A feature of this invention is that the semiconductor elements can be protected from thermal breakage, even at an abnormal ambient temperature rise at the voltage regulator for the battery charging generator, by controlling a maximum conduction ratio of a power transistor in the voltage regulator in accordance with the temperature at the voltage regulator. This is achieved through a switching device connected in series to the field coil of the generator and adapted to be controlled in accordance with an output voltage of the generator and the ambient temperature at the voltage regulator. 6 figs.

  2. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M.K.; Wind, L.; Canter, B.; Moeller, T.

    2001-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 1999 and 2000. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (CLS)

  3. Wind electric power generation

    International Nuclear Information System (INIS)

    Koch, M. K.; Wind, L.; Canter, B.; Moeller, T.

    2002-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of the private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 2000 and 2001. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. (SM)

  4. Automated lattice data generation

    Directory of Open Access Journals (Sweden)

    Ayyar Venkitesh

    2018-01-01

    Full Text Available The process of generating ensembles of gauge configurations (and measuring various observables over them can be tedious and error-prone when done “by hand”. In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.

  5. The Aeolian Asynchronous Generator

    Directory of Open Access Journals (Sweden)

    Ionel Dragomirescu

    2008-10-01

    Full Text Available The production of the electric energy with lower costs could be realized with the help of the aeolian electric central. In these centrals we can use the squirrel cage asynchronous generators, because these machines are the most safety in function and easy exploited. This work show the function analyzing of the asynchronous generator having on involving torque depending on the square wind speed, the air-density and on the construction of the wing spiral.

  6. Automated lattice data generation

    Science.gov (United States)

    Ayyar, Venkitesh; Hackett, Daniel C.; Jay, William I.; Neil, Ethan T.

    2018-03-01

    The process of generating ensembles of gauge configurations (and measuring various observables over them) can be tedious and error-prone when done "by hand". In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.

  7. Quad precision delay generator

    International Nuclear Information System (INIS)

    Krishnan, Shanti; Gopalakrishnan, K.R.; Marballi, K.R.

    1997-01-01

    A Quad Precision Delay Generator delays a digital edge by a programmed amount of time, varying from nanoseconds to microseconds. The output of this generator has an amplitude of the order of tens of volts and rise time of the order of nanoseconds. This was specifically designed and developed to meet the stringent requirements of the plasma focus experiments. Plasma focus is a laboratory device for producing and studying nuclear fusion reactions in hot deuterium plasma. 3 figs

  8. Steam generator tube failures

    International Nuclear Information System (INIS)

    MacDonald, P.E.; Shah, V.N.; Ward, L.W.; Ellison, P.G.

    1996-04-01

    A review and summary of the available information on steam generator tubing failures and the impact of these failures on plant safety is presented. The following topics are covered: pressurized water reactor (PWR), Canadian deuterium uranium (CANDU) reactor, and Russian water moderated, water cooled energy reactor (VVER) steam generator degradation, PWR steam generator tube ruptures, the thermal-hydraulic response of a PWR plant with a faulted steam generator, the risk significance of steam generator tube rupture accidents, tubing inspection requirements and fitness-for-service criteria in various countries, and defect detection reliability and sizing accuracy. A significant number of steam generator tubes are defective and are removed from service or repaired each year. This wide spread damage has been caused by many diverse degradation mechanisms, some of which are difficult to detect and predict. In addition, spontaneous tube ruptures have occurred at the rate of about one every 2 years over the last 20 years, and incipient tube ruptures (tube failures usually identified with leak detection monitors just before rupture) have been occurring at the rate of about one per year. These ruptures have caused complex plant transients which have not always been easy for the reactor operators to control. Our analysis shows that if more than 15 tubes rupture during a main steam line break, the system response could lead to core melting. Although spontaneous and induced steam generator tube ruptures are small contributors to the total core damage frequency calculated in probabilistic risk assessments, they are risk significant because the radionuclides are likely to bypass the reactor containment building. The frequency of steam generator tube ruptures can be significantly reduced through appropriate and timely inspections and repairs or removal from service

  9. Dust devil generation

    International Nuclear Information System (INIS)

    G Onishchenko, O; A Pokhotelov, O; Horton, W; Stenflo, L

    2014-01-01

    The equations describing axi-symmetric nonlinear internal gravity waves in an unstable atmosphere are derived. A hydrodynamic model of a dust devil generation mechanism in such an atmosphere is investigated. It is shown that in an unstably stratified atmosphere the convective plumes with poloidal motion can grow exponentially. Furthermore, it is demonstrated that these convective plumes in an atmosphere with weak large scale toroidal motion are unstable with respect to three-dimensional dust devil generation. (papers)

  10. Wave Generation Theory

    DEFF Research Database (Denmark)

    Frigaard, Peter; Høgedal, Michael; Christensen, Morten

    The intention of this manual is to provide some formulas and techniques which can be used for generating waves in hydraulic laboratories. Both long crested waves (2-D waves) and short crested waves (3-D waves) are considered.......The intention of this manual is to provide some formulas and techniques which can be used for generating waves in hydraulic laboratories. Both long crested waves (2-D waves) and short crested waves (3-D waves) are considered....

  11. Next generation initiation techniques

    Science.gov (United States)

    Warner, Tom; Derber, John; Zupanski, Milija; Cohn, Steve; Verlinde, Hans

    1993-01-01

    Four-dimensional data assimilation strategies can generally be classified as either current or next generation, depending upon whether they are used operationally or not. Current-generation data-assimilation techniques are those that are presently used routinely in operational-forecasting or research applications. They can be classified into the following categories: intermittent assimilation, Newtonian relaxation, and physical initialization. It should be noted that these techniques are the subject of continued research, and their improvement will parallel the development of next generation techniques described by the other speakers. Next generation assimilation techniques are those that are under development but are not yet used operationally. Most of these procedures are derived from control theory or variational methods and primarily represent continuous assimilation approaches, in which the data and model dynamics are 'fitted' to each other in an optimal way. Another 'next generation' category is the initialization of convective-scale models. Intermittent assimilation systems use an objective analysis to combine all observations within a time window that is centered on the analysis time. Continuous first-generation assimilation systems are usually based on the Newtonian-relaxation or 'nudging' techniques. Physical initialization procedures generally involve the use of standard or nonstandard data to force some physical process in the model during an assimilation period. Under the topic of next-generation assimilation techniques, variational approaches are currently being actively developed. Variational approaches seek to minimize a cost or penalty function which measures a model's fit to observations, background fields and other imposed constraints. Alternatively, the Kalman filter technique, which is also under investigation as a data assimilation procedure for numerical weather prediction, can yield acceptable initial conditions for mesoscale models. The

  12. Magnetohydrodynamic generation method

    International Nuclear Information System (INIS)

    Masai, Tadahisa; Ishibashi, Eiichi; Kojima, Akihiro.

    1967-01-01

    The present invention relates to a magneto-hydrodynamic generation method which increases the conductivity of active gas and the generated energy. In the conventional method of open-cycle magnetohydrodynamic generation, the working fluid does not possess a favorable electric conductivity since the collision cross section is large when the combustion is carried out in a condition of excess oxygen. Furthermore, combustion under a condition of oxygen shortage is uncapable of completely converting the generated energy. The air preheater or boiler is not sufficient to collect the waste gas resulting in damage and other economic disadvantages. In the present invention, the combustion gas caused by excess fuel in the combuster is supplied to the generator as the working gas, to which air or fully oxidized air is added to be reheated. While incomplete gas used for heat collection is not adequate, the unburned damage may be eliminated by combusting again and increasing the gas temperature and heat collection rate. Furthermore, a diffuser is mounted at the rear side of the generator to decrease the gas combustion rate. Thus, even when directly absorbing the preheated fully oxidized air or the ordinary air, the boiler is free from damage caused by combustion delay or impulsive force. (M. Ishida)

  13. Next generation PWR

    International Nuclear Information System (INIS)

    Tanaka, Toshihiko; Fukuda, Toshihiko; Usui, Shuji

    2001-01-01

    Development of LWR for power generation in Japan has been intended to upgrade its reliability, safety, operability, maintenance and economy as well as to increase its capacity in order, since nuclear power generation for commercial use was begun on 1970, to steadily increase its generation power. And, in Japan, ABWR (advanced BWR) of the most promising LWR in the world, was already used actually and APWR (advanced PWR) with the largest output in the world is also at a step of its actual use. And, development of the APWR in Japan was begun on 1980s, and is at a step of plan on construction of its first machine at early of this century. However, by large change of social affairs, economy of nuclear power generation is extremely required, to be positioned at an APWR improved development reactor promoted by collaboration of five PWR generation companies and the Mitsubishi Electric Co., Ltd. Therefore, on its development, investigation on effect of change in social affairs on nuclear power stations was at first carried out, to establish a design requirement for the next generation PWR. Here were described on outline, reactor core design, safety concept, and safety evaluation of APWR+ and development of an innovative PWR. (G.K.)

  14. The Gel Generator option

    International Nuclear Information System (INIS)

    Boyd, R.E.

    1999-01-01

    The development of a national policy for guaranteeing an ample supply of 99m Tc to nuclear medicine, involves issues which go beyond the means by which radioactivation is achieved. Indeed, in such an exercise the pragmatic dictates of business and the sensitivities of politics must also be taken into account. Furthermore where a preference towards the nuclear reactor or the potential of cyclotrons is being questioned, the debate is incomplete if the only options that are considered are the fission-based 99 Mo generator versus the direct cyclotron production of 99m Tc. There is a third option (also neutron γ-based), an alternative to the fission 99 Mo generator, which ought not be overlooked. The application of low specific activity (n,γ) 99 Mo to a new type of generator, the Gel Generator, has been the focus of much research, particularly in Australia and more recently in China. After the initial concept had been established in the laboratory, the Australian researchers then undertook a comprehensive program of tests on the Gel Generator to assess its potential, either in the clinical laboratory or the centralised radiopharmacy, for supplying 99m Tc suitable for nuclear medicine. The outcome of this program was a clear indication that the Gel Generator innovation had the capability to provide both technical and economic advantages to the nuclear medicine industry. These advantages are described. Since that time the Gel Generator has been selected for routine use in China where it now satisfies more than 30% of the 99m Tc demand. (author)

  15. Generation IV reactors: economics

    International Nuclear Information System (INIS)

    Dupraz, B.; Bertel, E.

    2003-01-01

    The operating nuclear reactors were built over a short period: no more than 10 years and today their average age rounds 18 years. EDF (French electricity company) plans to renew its reactor park over a far longer period : 30 years from 2020 to 2050. According to EDF this objective implies 3 constraints: 1) a service life of 50 to 60 years for a significant part of the present operating reactors, 2) to be ready to built a generation 3+ unit in 2020 which infers the third constraint: 3) to launch the construction of an EPR (European pressurized reactor) prototype as soon as possible in order to have it operating in 2010. In this scheme, generation 4 reactor will benefit the feedback experience of generation 3 and will take over in 2030. Economic analysis is an important tool that has been used by the generation 4 international forum to select the likely future reactor systems. This analysis is based on 4 independent criteria: the basic construction cost, the construction time, the operation and maintenance costs and the fuel cycle cost. This analysis leads to the evaluation of the global cost of electricity generation and of the total investment required for each of the reactor system. The former defines the economic competitiveness in a de-regulated energy market while the latter is linked to the financial risk taken by the investor. It appears, within the limits of the assumptions and models used, that generation 4 reactors will be characterized by a better competitiveness and an equivalent financial risk when compared with the previous generation. (A.C.)

  16. Fourth Generation Reactor Concepts

    International Nuclear Information System (INIS)

    Furtek, A.

    2008-01-01

    Concerns over energy resources availability, climate changes and energy supply security suggest an important role for nuclear energy in future energy supplies. So far nuclear energy evolved through three generations and is still evolving into new generation that is now being extensively studied. Nuclear Power Plants are producing 16% of the world's electricity. Today the world is moving towards hydrogen economy. Nuclear technologies can provide energy to dissociate water into oxygen and hydrogen and to production of synthetic fuel from coal gasification. The introduction of breeder reactors would turn nuclear energy from depletable energy supply into an unlimited supply. From the early beginnings of nuclear energy in the 1940s to the present, three generations of nuclear power reactors have been developed: First generation reactors: introduced during the period 1950-1970. Second generation: includes commercial power reactors built during 1970-1990 (PWR, BWR, Candu, Russian RBMK and VVER). Third generation: started being deployed in the 1990s and is composed of Advanced LWR (ALWR), Advanced BWR (ABWR) and Passive AP600 to be deployed in 2010-2030. Future advances of the nuclear technology designs can broaden opportunities for use of nuclear energy. The fourth generation reactors are expected to be deployed by 2030 in time to replace ageing reactors built in the 1970s and 1980s. The new reactors are to be designed with a view of the following objectives: economic competitiveness, enhanced safety, minimal radioactive waste production, proliferation resistance. The Generation IV International Forum (GIF) was established in January 2000 to investigate innovative nuclear energy system concepts. GIF members include Argentina, Brazil, Canada, Euratom, France Japan, South Africa, South Korea, Switzerland, United Kingdom and United States with the IAEA and OECD's NEA as permanent observers. China and Russia are expected to join the GIF initiative. The following six systems

  17. New Generator Technology

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Roy S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-02-17

    New generator technology project is driven by the need to be able to remotely deploy generator technology where it is needed, when it is needed. Both the military and aid programs that provide assistance after disasters could use the ability to deploy energy generation that fits the needs of the situation. Currently, pre-specified generators are deployed, sometime more than half way around the world to provide electricity. Through our Phase-I to Phase III DARPA grant, we will provide a mechanism where a 3d print station and raw materials could be shipped to a deployment site and remotely deployed personnel. These remote personnel can collaborate with engineers at a home location where 3d print plans can be optimized for the remote purpose. The plans can then be sent electronically to the remote location for printing, much like NASA sent the plans for a socket wrench to the International Space Station for printing in . If multiple generators need to be deployed at different remote locations, within miles of each other the printer rig can be moved to print the generators where they are needed. 3d printing is growing in the field of manufacturing. 3d printing has matured to the point where many types of materials are now available for many types of manufacturing. Both magnetic and electrically conductive material materials have recently been developed which can now lead to 3d printing of engines and generators. Our project will provide a successful printer rig that can be remotely deployed, to print a generator design in the field as well as provide a process for deploying the printed generator as well. This Systems Engineering Management Plan(SEMP) will provide the planning required for a Phase I DARPA grant that may also include goals for Phase II and Phase II grants. The SEMP provides a proposed project schedule, references, system engineering processes, specialty engineering system deployment and product support sections. Each section will state how our company

  18. Next-generation phylogenomics

    Directory of Open Access Journals (Sweden)

    Chan Cheong Xin

    2013-01-01

    Full Text Available Abstract Thanks to advances in next-generation technologies, genome sequences are now being generated at breadth (e.g. across environments and depth (thousands of closely related strains, individuals or samples unimaginable only a few years ago. Phylogenomics – the study of evolutionary relationships based on comparative analysis of genome-scale data – has so far been developed as industrial-scale molecular phylogenetics, proceeding in the two classical steps: multiple alignment of homologous sequences, followed by inference of a tree (or multiple trees. However, the algorithms typically employed for these steps scale poorly with number of sequences, such that for an increasing number of problems, high-quality phylogenomic analysis is (or soon will be computationally infeasible. Moreover, next-generation data are often incomplete and error-prone, and analysis may be further complicated by genome rearrangement, gene fusion and deletion, lateral genetic transfer, and transcript variation. Here we argue that next-generation data require next-generation phylogenomics, including so-called alignment-free approaches. Reviewers Reviewed by Mr Alexander Panchin (nominated by Dr Mikhail Gelfand, Dr Eugene Koonin and Prof Peter Gogarten. For the full reviews, please go to the Reviewers’ comments section.

  19. Magnetohydrodynamic power generation

    International Nuclear Information System (INIS)

    Sheindlin, A.E.; Jackson, W.D.; Brzozowski, W.S.; Rietjens, L.H.Th.

    1979-01-01

    The paper describes research and development in the field of magnetohydrodynamic power generation technology, based on discussions held in the Joint IAEA/UNESCO International Liaison Group on MHD electrical power generation. Research and development programmes on open cycle, closed cycle plasma and liquid-metal MHD are described. Open cycle MHD has now entered the engineering development stage. The paper reviews the results of cycle analyses and economic and environmental evaluations: substantial agreement has been reached on the expected overall performance and necessary component specifications. The achievement in the Soviet Union on the U-25 MHD pilot plant in obtaining full rated electrical power of 20.4 MW is described, as well as long duration testing of the integrated operation of MHD components. Work in the United States on coal-fired MHD generators has shown that, with slagging of the walls, a run time of about one hundred hours at the current density and electric field of a commercial MHD generator has been achieved. Progress obtained in closed cycle plasma and liquid metal MHD is reviewed. Electrical power densities of up to 140 MWe/m 3 and an enthalpy extraction as high as 24 per cent have been achieved in noble gas MHD generator experiments. (Auth.)

  20. MHD Generating system

    Science.gov (United States)

    Petrick, Michael; Pierson, Edward S.; Schreiner, Felix

    1980-01-01

    According to the present invention, coal combustion gas is the primary working fluid and copper or a copper alloy is the electrodynamic fluid in the MHD generator, thereby eliminating the heat exchangers between the combustor and the liquid-metal MHD working fluids, allowing the use of a conventional coalfired steam bottoming plant, and making the plant simpler, more efficient and cheaper. In operation, the gas and liquid are combined in a mixer and the resulting two-phase mixture enters the MHD generator. The MHD generator acts as a turbine and electric generator in one unit wherein the gas expands, drives the liquid across the magnetic field and thus generates electrical power. The gas and liquid are separated, and the available energy in the gas is recovered before the gas is exhausted to the atmosphere. Where the combustion gas contains sulfur, oxygen is bubbled through a side loop to remove sulfur therefrom as a concentrated stream of sulfur dioxide. The combustor is operated substoichiometrically to control the oxide level in the copper.

  1. Power generating device

    Energy Technology Data Exchange (ETDEWEB)

    Onodera, Toshihiro

    1989-05-02

    The existing power generating device consisting of static components only lacks effective measures to utilize solar energy and maintain power generation, hence it is inevitable to make the device much larger and more complicated in order to utilize it as the primary power source for artificial satellites. In view of the above, in order to offer a power generating device useful for the primary power source for satellites which is simple and can keep power generation by solar energy, this invention proposes a power generating device composed of the following elements: (1) a rectangular parallelopiped No. II superconductor plate; (2) a measure to apply a magnetic field to one face of the above superconductor plate; (3) a measure to provide a temperature difference within the range between the starting temperature and the critical temperature of superconductivity to a pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure; (4) a measure to provide an electrode on each of the other pair of faces meeting at right angles with the face to which the magnetic field was applied by the above measure and form a closed circuit by connecting the each electrode above to each of a pair of electrodes of the load respectively; and (5) a switching measure which is installed in the closed circuit prepared by the above measure and shuts off the closed circuit when the direction of the electric current running the above closed circuit is reversed. 6 figs.

  2. The Atlin Hydro Project : generation for generations

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, S. [Atlin Tlingit Development Corp., Atlin, BC (Canada)

    2010-07-01

    This presentation documented the step-by-step process by which the Atlin Hydro Project was developed. The Taku River Tlingit First Nation undertook the Atlin project as part of its vision for responsible resource management, sustainable economic development, and cultural revival. The Atlin Community Energy Plan involved an assessment of electricity demand, a 20-year demand projection, energy efficiency recommendations, and an assessment of power supply options such as wind towers, connection to the Yukon power grid, and hydro. The potential impact on fisheries, hydrology, wildlife habitat, roads and bridges, navigable waters and forests, existing rights, and First Nation archaeology were assessed, along with other factors such as hazards and flood control. A hydrology assessment of the Surprise-Pine Drainage Basin was undertaken, and stream-flow measurements were taken near the intake location on Pine Creek. The project comprises a discharge control structure and a fish ladder; an intake and weir on Pine Creek; a penstock pipeline from intake to powerhouse; a powerhouse with a 2.1 MW Pelton turbine generator and a switch yard; and a power line from the powerhouse to the interconnection with the existing grid. The impacts on fisheries, wildlife, and human movement are expected to be minimal. 28 figs., 3 tabs.

  3. Third Generation Coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2016-01-01

    German abstract: Auf der Grundlage aktueller Sozialforschung, neuer Lerntheorien und Diskurse der Personalführung entfaltet sich ein neues Verständnis von Coaching und Coaching-Psychologie. In der dritten Generation wird Coaching aus gesellschaftlicher Perspektive betrachtet. Wenn sich die...... Gesellschaft verändert, muss sich auch Coaching als spezifische Form der Interaktion weiterentwickeln: Die Mission des Third Generation Coaching ist die Entwicklung von Nachhaltigkeit in der Anwendung, indem sich der Dialog stärker auf Werte und Sinn-Schaffen ausrichtet, weg vom einengenden Zielfokus hin zur...... Betonung von Aspirationen, Leidenschaften und Werten. In diesem Sinne trägt Third Generation Coaching zur Entfaltung und Weiterentwicklung persönlicher Identität bei – ein entscheidender Faktor für die menschliche Entwicklung in unserer Zeit. Auf der Basis kollaborativer Zusammenarbeit dieses Ansatzes...

  4. Protocol Implementation Generator

    DEFF Research Database (Denmark)

    Carvalho Quaresma, Jose Nuno; Probst, Christian W.

    2010-01-01

    Users expect communication systems to guarantee, amongst others, privacy and integrity of their data. These can be ensured by using well-established protocols; the best protocol, however, is useless if not all parties involved in a communication have a correct implementation of the protocol and a...... Generator framework based on the LySatool and a translator from the LySa language into C or Java....... necessary tools. In this paper, we present the Protocol Implementation Generator (PiG), a framework that can be used to add protocol generation to protocol negotiation, or to easily share and implement new protocols throughout a network. PiG enables the sharing, verification, and translation...

  5. The Compton generator revisited

    Science.gov (United States)

    Siboni, S.

    2014-09-01

    The Compton generator, introduced in 1913 by the US physicist A H Compton as a relatively simple device to detect the Earth's rotation with respect to the distant stars, is analyzed and discussed in a general perspective. The paper introduces a generalized definition of the generator, emphasizing the special features of the original apparatus, and provides a suggestive interpretation of the way the device works. To this end, an intriguing electromagnetic analogy is developed, which turns out to be particularly useful in simplifying the calculations. Besides the more extensive description of the Compton generator in itself, the combined use of concepts and methods coming from different fields of physics, such as particle dynamics in moving references frames, continuum mechanics and electromagnetism, may be of interest to both teachers and graduate students.

  6. Liquid metal steam generator

    International Nuclear Information System (INIS)

    Wolowodiuk, W.

    1975-01-01

    A liquid metal heated steam generator is described which in the event of a tube failure quickly exhausts out of the steam generator the products of the reaction between the water and the liquid metal. The steam is generated in a plurality of bayonet tubes which are heated by liquid metal flowing over them between an inner cylinder and an outer cylinder. The inner cylinder extends above the level of liquid metal but below the main tube sheet. A central pipe extends down into the inner cylinder with a centrifugal separator between it and the inner cylinder at its lower end and an involute deflector plate above the separator so that the products of a reaction between the liquid metal and the water will be deflected downwardly by the deflector plate and through the separator so that the liquid metal will flow outwardly and away from the central pipe through which the steam and gaseous reaction products are exhausted. (U.S.)

  7. Grid generation methods

    CERN Document Server

    Liseikin, Vladimir D

    2010-01-01

    This book is an introduction to structured and unstructured grid methods in scientific computing, addressing graduate students, scientists as well as practitioners. Basic local and integral grid quality measures are formulated and new approaches to mesh generation are reviewed. In addition to the content of the successful first edition, a more detailed and practice oriented description of monitor metrics in Beltrami and diffusion equations is given for generating adaptive numerical grids. Also, new techniques developed by the author are presented, in particular a technique based on the inverted form of Beltrami’s partial differential equations with respect to control metrics. This technique allows the generation of adaptive grids for a wide variety of computational physics problems, including grid clustering to given function values and gradients, grid alignment with given vector fields, and combinations thereof. Applications of geometric methods to the analysis of numerical grid behavior as well as grid ge...

  8. The generation problem

    International Nuclear Information System (INIS)

    Ecker, G.

    1983-01-01

    Evidence for the generation structure of quarks and leptons is reviewed. The two main aspects of the generation problem are emphasized. The concept and possible problems of horizontal symmetries are discussed. Two different mechanisms for horizontal symmetries are considered leading to a generalized permutation symmetry in SU(2)sub(L) x u(1) in one case. The second mechanism uses the discrete unbroken subgroup of an axial U(1) with hypercolour anomalies in composite models. A concrete realization in the rishon model is investigated. The two different approaches produce almost identical quark mass matrices for three generations. In addition to a correct prediction for the Cabibbo angle the models yield a very small Kobayashi-Maskawa mixing angle Theta 3 and thus provide for a natural explanation of the smallness of CP violation. (Author)

  9. Automated drawing generation system

    International Nuclear Information System (INIS)

    Yoshinaga, Toshiaki; Kawahata, Junichi; Yoshida, Naoto; Ono, Satoru

    1991-01-01

    Since automated CAD drawing generation systems still require human intervention, improvements were focussed on an interactive processing section (data input and correcting operation) which necessitates a vast amount of work. As a result, human intervention was eliminated, the original objective of a computerized system. This is the first step taken towards complete automation. The effects of development and commercialization of the system are as described below. (1) The interactive processing time required for generating drawings was improved. It was determined that introduction of the CAD system has reduced the time required for generating drawings. (2) The difference in skills between workers preparing drawings has been eliminated and the quality of drawings has been made uniform. (3) The extent of knowledge and experience demanded of workers has been reduced. (author)

  10. Grid generation methods

    CERN Document Server

    Liseikin, Vladimir D

    2017-01-01

    This new edition provides a description of current developments relating to grid methods, grid codes, and their applications to actual problems. Grid generation methods are indispensable for the numerical solution of differential equations. Adaptive grid-mapping techniques, in particular, are the main focus and represent a promising tool to deal with systems with singularities. This 3rd edition includes three new chapters on numerical implementations (10), control of grid properties (11), and applications to mechanical, fluid, and plasma related problems (13). Also the other chapters have been updated including new topics, such as curvatures of discrete surfaces (3). Concise descriptions of hybrid mesh generation, drag and sweeping methods, parallel algorithms for mesh generation have been included too. This new edition addresses a broad range of readers: students, researchers, and practitioners in applied mathematics, mechanics, engineering, physics and other areas of applications.

  11. Generating ethnographic research questions

    DEFF Research Database (Denmark)

    Friberg, Torbjörn

    2015-01-01

    ? By drawing on the conceptual history of anthropology, the aim of this article is to generate ethnographic-oriented research questions concerned with higher education. The first part of the article provides an ethnographic background, while the second part focuses on Paul Willis's reasoning on ethnographic......As part of recent complex transformations, it seems that higher educational organisations are being forced to reorganise, standardise and streamline in order to survive in the new political and economic context. How are ethnographers in general going to approach these contemporary phenomena...... imagination, as a prerequisite for generating alternative research questions. The third part makes explicit anthropologist Maurice Godelier's theoretical imagination, carving out some specific theoretical parts which may be used in the generating process. The conclusion then suggests a number of questions...

  12. House of Generations

    DEFF Research Database (Denmark)

    Geert Jensen, Birgitte

    2017-01-01

    only the benefits of living close to the family. The Aarhus Municipality project "House of Generations" is a vision for creating a framework for relationships across all generations, for meaningful encounters and for rewarding neighbourliness. Three of Aarhus Municipality's magistrate departments...... participate in the project: Health and Care, Children and Youth, and Social Conditions and Employment. A public housing association that provides student dorms also participates in the project. The physical framework will be a building with a total area of approx. 25,000 m², located at Pier 4, at Aarhus......' harbour areas. The building will be a multi-generational house comprising a mixture of flexible public housing units for students, the elderly and residents who require care (elderly disabled people and people with acquired brain injuries). The building will be connected with common areas located in close...

  13. Spherical neutron generator

    Science.gov (United States)

    Leung, Ka-Ngo

    2006-11-21

    A spherical neutron generator is formed with a small spherical target and a spherical shell RF-driven plasma ion source surrounding the target. A deuterium (or deuterium and tritium) ion plasma is produced by RF excitation in the plasma ion source using an RF antenna. The plasma generation region is a spherical shell between an outer chamber and an inner extraction electrode. A spherical neutron generating target is at the center of the chamber and is biased negatively with respect to the extraction electrode which contains many holes. Ions passing through the holes in the extraction electrode are focused onto the target which produces neutrons by D-D or D-T reactions.

  14. Review of Micro Magnetic Generator

    OpenAIRE

    Lin DU; Gengchen SHI; Jingjing ZHAO

    2014-01-01

    This paper discusses the research progress of micro magnetic generator systems. Micro magnetic generator systems convert energy from the environment to electric energy with advantages as high reliability, high power density, long life time and can be applied to extreme environment. This paper summarizes methods for improving generator performance of micro magnetic generator, including rotational magnetic generator, vibrational magnetic generator and hybrid magnetic generator, analyzes and com...

  15. Programmable pulse generator

    International Nuclear Information System (INIS)

    Xue Zhihua; Lou Binqiao; Duan Xiaohui

    2002-01-01

    The author introduces the design of programmable pulse generator that is based on a micro-controller and controlled by RS232 interface of personal computer. The whole system has good stability. The pulse generator can produce TTL pulse and analog pulse. The pulse frequency can be selected by EPLD. The voltage amplitude and pulse width of analog pulse can be adjusted by analog switches and digitally-controlled potentiometers. The software development tools of computer is National Instruments LabView5.1. The front panel of this virtual instrumentation is intuitive and easy-to-use. Parameters can be selected and changed conveniently by knob and slide

  16. Hacking the next generation

    CERN Document Server

    Dhanjani, Nitesh; Hardin, Brett

    2009-01-01

    With the advent of rich Internet applications, the explosion of social media, and the increased use of powerful cloud computing infrastructures, a new generation of attackers has added cunning new techniques to its arsenal. For anyone involved in defending an application or a network of systems, Hacking: The Next Generation is one of the few books to identify a variety of emerging attack vectors. You'll not only find valuable information on new hacks that attempt to exploit technical flaws, you'll also learn how attackers take advantage of individuals via social networking sites, and abuse

  17. Seismic wave generator

    International Nuclear Information System (INIS)

    Devaure, Bernard.

    1982-01-01

    This invention concerns a device for simulating earth tremors. This device includes a seismic wave generator formed of a cylinder, one end of which is closed by one of the walls of a cell containing a soil, the other end being closed by a wall on which are fixed pyrotechnic devices generating shock waves inside the cylinder. These waves are transmitted from the cylinder to the cell through openings made in the cell wall. This device also includes a mechanical device acting as low-pass filter, located inside the cylinder and close to the cell wall [fr

  18. Intracavity vortex beam generation

    Science.gov (United States)

    Naidoo, Darryl; Aït-Ameur, Kamel; Forbes, Andrew

    2011-10-01

    In this paper we explore vortex beams and in particular the generation of single LG0l modes and superpositions thereof. Vortex beams carry orbital angular momentum (OAM) and this intrinsic property makes them prevalent in transferring this OAM to matter and to be used in quantum information processing. We explore an extra-cavity and intra-cavity approach in LG0l mode generation respectively. The outputs of a Porro-prism resonator are represented by "petals" and we show that through a full modal decomposition, the "petal" fields are a superposition of two LG0l modes.

  19. Electricity Generation Baseline Report

    Energy Technology Data Exchange (ETDEWEB)

    Logan, Jeffrey [National Renewable Energy Lab. (NREL), Golden, CO (United States); Marcy, Cara [National Renewable Energy Lab. (NREL), Golden, CO (United States); McCall, James [National Renewable Energy Lab. (NREL), Golden, CO (United States); Flores-Espino, Francisco [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bloom, Aaron [National Renewable Energy Lab. (NREL), Golden, CO (United States); Aabakken, Jorn [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cole, Wesley [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jenkin, Thomas [National Renewable Energy Lab. (NREL), Golden, CO (United States); Porro, Gian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Liu, Chang [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ganda, Francesco [Argonne National Lab. (ANL), Argonne, IL (United States); Boardman, Richard [Idaho National Lab. (INL), Idaho Falls, ID (United States); Tarka, Thomas [National Energy Technology Lab. (NETL), Albany, OR (United States); Brewer, John [National Energy Technology Lab. (NETL), Albany, OR (United States); Schultz, Travis [National Energy Technology Lab. (NETL), Albany, OR (United States)

    2017-01-01

    This report was developed by a team of national laboratory analysts over the period October 2015 to May 2016 and is part of a series of studies that provide background material to inform development of the second installment of the Quadrennial Energy Review (QER 1.2). The report focuses specifically on U.S. power sector generation. The report limits itself to the generation sector and does not address in detail parallel issues in electricity end use, transmission and distribution, markets and policy design, and other important segments. The report lists 15 key findings about energy system needs of the future.

  20. Electric power generator

    International Nuclear Information System (INIS)

    Carney, H.C.

    1977-01-01

    An electric power generator of the type employing a nuclear heat source and a thermoelectric converter is described wherein a transparent thermal insulating medium is provided inside an encapsulating enclosure to thermally insulate the heat source and thermoelectric generator. The heat source, the thermoelectric converter, and the enclosure are provided with facing surfaces which are heat-reflective to a substantial degree to inhibit radiation of heat through the medium of the encapsulating enclosure. Multiple reflective foils may be spaced within the medium as necessary to inhibit natural convection of heat and/or further inhibit radiation

  1. Wind electric power generation

    International Nuclear Information System (INIS)

    Groening, B.; Koch, M.; Canter, B.; Moeller, T.

    1995-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of private wind turbines. For each wind turbine the name of the site and of the type of turbine is given, and the power generation data are given for the month in question together with the total production in 1988 and 1989. Also the data of operation start are given. On the map of Denmark the sites of the wind turbines are marked. The statistics for December 1994 comprise 2328 wind turbines

  2. Radioactive material generator

    International Nuclear Information System (INIS)

    Czaplinski, T.V.; Bolter, B.J.; Heyer, R.E.; Bruno, G.A.

    1975-01-01

    A radioactive material generator includes radioactive material in a column, which column is connected to inlet and outlet conduits, the generator being embedded in a lead casing. The inlet and outlet conduits extend through the casing and are topped by pierceable closure caps. A fitting, containing means to connect an eluent supply and an eluate container, is adapted to pierce the closure caps. The lead casing and the fitting are compatibly contoured such that they will fit only if properly aligned with respect to each other

  3. The generation game

    OpenAIRE

    Chatrakul Na Ayudhya, Uracha

    2015-01-01

    Purpose – Explores the limited value of concepts such as Baby-Boomer, Generation X and Generation Y and advances the view that life course is more valuable.\\ud \\ud Design/methodology/approach – Examines how young adults in Britain, born between 1975 and 1982, conceptualized the notion of work-life balance as they were about to leave university and enter full-time paid employment. \\ud \\ud Findings – Reveals that the notion of individual choice strongly underpins young adults’ conceptualization...

  4. ColloInputGenerator

    DEFF Research Database (Denmark)

    2013-01-01

    This is a very simple program to help you put together input files for use in Gries' (2007) R-based collostruction analysis program. It basically puts together a text file with a frequency list of lexemes in the construction and inserts a column where you can add the corpus frequencies. It requires...... it as input for basic collexeme collostructional analysis (Stefanowitsch & Gries 2003) in Gries' (2007) program. ColloInputGenerator is, in its current state, based on programming commands introduced in Gries (2009). Projected updates: Generation of complete work-ready frequency lists....

  5. Generator for ionizing radiation

    International Nuclear Information System (INIS)

    Romanovskij, V.F.; Panasjuk, V.S.; Stepanov, B.M.; Ovtscharov, A.M.; Akimov, J.A.

    1979-01-01

    The X-ray, electron, or neutron generator contains a radiation source with an accelerating tube, whose shell encloses a resonance transformer, a subdivided tube insulator and a high-tension electrode for the accelerating tube. The accelerating tube can be evacuated. The high-tension winding of the resonance transformer lies within the tube insulator of the accelerating tube and the evacuated space between resonance transformer and tube insulator. The generator may be applied in medicine, in geophysical research or for activation analysis of materials. (DG) 891 HP/DG 892 BRE [de

  6. Hera presentation generator (Poster)

    NARCIS (Netherlands)

    Frasincar, F.; Houben, G.J.P.M.; Barna, P.; Ellis, A.; Hagino, T.

    2005-01-01

    Semantic Web Information Systems (SWIS) are Web Information Systems that use Semantic Web technologies. Hera is a model-driven design methodology for SWIS. In Hera, models are represented in RDFS and model instances in RDF. The Hera Presentation Generator (HPG) is an integrated development

  7. Tredje generations coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    2012-01-01

    ”Tredje generations coaching” udfolder et nyt univers for coaching og coachingpsykologi gennem en bearbejdelse af aktuel samfundsforskning, nye læringsteorier og diskurser om det personlige lederskab. ”Tredje generations coaching” er funderet på en samfundsmæssig forståelse af coaching. Coaching er...... blevet så betydningsfuld, fordi samfundet opleves som uoverskueligt og hyperkomplekst. Viden skal nu udformes og anvendes i specifikke kontekster og situationer, og både i privatliv og i det offentlige rum skal vi lære at forhandle os til rette. Coaching kan hjælpe os til at skabe ny viden og mestre...... sociale forhandlinger. Coaching er dermed en slags fødselshjælp til nye refleksioner og perspektiver, en hjælp til selvhjælp og en støtte til ens egen selvdannelsesproces. ”Tredje generations coaching” fremhæver coach og coachee i deres narrativ-samskabende partnerskab. Til forskel fra første generations...

  8. CONFIGURATION GENERATOR MODEL

    International Nuclear Information System (INIS)

    Alsaed, A.

    2004-01-01

    ''The Disposal Criticality Analysis Methodology Topical Report'' prescribes an approach to the methodology for performing postclosure criticality analyses within the monitored geologic repository at Yucca Mountain, Nevada. An essential component of the methodology is the ''Configuration Generator Model for In-Package Criticality'' that provides a tool to evaluate the probabilities of degraded configurations achieving a critical state. The configuration generator model is a risk-informed, performance-based process for evaluating the criticality potential of degraded configurations in the monitored geologic repository. The method uses event tree methods to define configuration classes derived from criticality scenarios and to identify configuration class characteristics (parameters, ranges, etc.). The probabilities of achieving the various configuration classes are derived in part from probability density functions for degradation parameters. The NRC has issued ''Safety Evaluation Report for Disposal Criticality Analysis Methodology Topical Report, Revision 0''. That report contained 28 open items that required resolution through additional documentation. Of the 28 open items, numbers 5, 6, 9, 10, 18, and 19 were concerned with a previously proposed software approach to the configuration generator methodology and, in particular, the k eff regression analysis associated with the methodology. However, the use of a k eff regression analysis is not part of the current configuration generator methodology and, thus, the referenced open items are no longer considered applicable and will not be further addressed

  9. Nuclear power generation

    International Nuclear Information System (INIS)

    Hirao, Katumi; Sato, Akira; Kaimori, Kimihiro; Kumano, Tetsuji

    2001-01-01

    Nuclear power generation for commercial use in Japan has passed 35 years since beginning of operation in the Tokai Nuclear Power Station in 1966, and has 51 machines of reactor and about 44.92 MW of total output of equipment scale in the 21st century. However, an environment around nuclear energy becomes severer at present, and then so many subjects to be overcome are remained such as increased unreliability of the public on nuclear energy at a chance of critical accident of the JCO uranium processing facility, delay of pull-thermal plan, requirement for power generation cost down against liberalization of electric power, highly aging countermeasure of power plant begun its operation as its Genesis, and so on. Under such conditions, in order that nuclear power generation in Japan survives as one of basic electric source in future, it is necessary not only to pursue safety and reliability of the plant reliable to the public, but also to intend to upgrade its operation and maintenance by positively adopting good examples on operational management method on abroad and to endeavor further upgrading of application ratio of equipments and reduction of generation cost. Here were outlined on operation conditions of nuclear power stations in Japan, and introduced on upgrading of their operational management and maintenance management. (G.K.)

  10. Large hydropower generating units

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-01

    This document presents the Brazilian experience with the design, fabrication, construction, commissioning and operation of large scale and generation capacity unities. The experience had been acquired with the implementation of Itumbiara, Paulo Afonso IV, Tucurui, Itaipu and Xingo power plants, which are among the largest world unities.

  11. Generating a scalar logic

    DEFF Research Database (Denmark)

    Ramsgaard Thomsen, Mette; Tamke, Martin

    2011-01-01

    This paper presents the design project "it's a SMALL world", an exhibition design developed for the Danish Design Centre in 2009. The project investigates the making of a generative design environment by which multiple design parameters as from program, site or the subsequent digital fabrication ...

  12. Dynamical generation of flavour

    Indian Academy of Sciences (India)

    Introduction of family symmetry and generation of flavour structure by Yukawa couplings arising as vacuum expectation values (VEVs) of 'spurion' fields offers an attractive alternative prospect for understanding flavour structure [1]. Model builders have considered various. Pramana – J. Phys., Vol. 86, No. 2, February 2016.

  13. Next Generation Inverter

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Zilai [General Motors LLC, Detroit, MI (United States); Gough, Charles [General Motors LLC, Detroit, MI (United States)

    2016-04-22

    The goal of this Cooperative Agreement was the development of a Next Generation Inverter for General Motors’ electrified vehicles, including battery electric vehicles, range extended electric vehicles, plug-in hybrid electric vehicles and hybrid electric vehicles. The inverter is a critical electronics component that converts battery power (DC) to and from the electric power for the motor (AC).

  14. Risks of power generation

    International Nuclear Information System (INIS)

    Mostert, P.

    1981-01-01

    A comparison is made between the various ways of power generation in the Netherlands and the hazards attached to them. Tables are presented of fuels used, the quantities used per annum and in the course of the last 20 years, accidents and pollution types and percentages, as well as the toxicity and waste disposal risks. (Auth.)

  15. Next generation of accelerators

    International Nuclear Information System (INIS)

    Richter, B.

    1979-01-01

    Existing high-energy accelerators are reviewed, along with those under construction or being designed. Finally, some of the physics issues which go into setting machine parameters, and some of the features of the design of next generation electron and proton machines are discussed

  16. Leading Generation Y

    Science.gov (United States)

    Coley, David C.

    2009-01-01

    School administrators are facing the perfect storm: a growing number of baby boomers retiring each year, an absence of experienced teachers to take their place, and high turnover among young teachers. The need to hire and retain a new generation of teachers is one of the biggest challenges facing school administrators. To fill these vacancies,…

  17. Loser Generated Content

    DEFF Research Database (Denmark)

    Petersen, Søren Mørk

    2008-01-01

    In this article [ 1 ] some of the critical aspects of Web 2.0 are mapped in relation to labor and the production of user generated content. For many years the Internet was considered an apt technology for subversion of capitalism by the Italian post–Marxists. What we have witnessed, however...

  18. Dynalight Next Generation

    DEFF Research Database (Denmark)

    Jørgensen, Bo Nørregaard; Ottosen, Carl-Otto; Dam-Hansen, Carsten

    2016-01-01

    The project aims to develop the next generation of energy cost-efficient artificial lighting control that enables greenhouse growers to adapt their use of artificial lighting dynamically to fluctuations in the price of electricity. This is a necessity as fluctuations in the price of electricity c...

  19. Next Generation Social Networks

    DEFF Research Database (Denmark)

    Sørensen, Lene Tolstrup; Skouby, Knud Erik

    2008-01-01

    different online networks for communities of people who share interests or individuals who presents themselves through user produced content is what makes up the social networking of today. The purpose of this paper is to discuss perceived user requirements to the next generation social networks. The paper...

  20. Point Lepreau generating station

    International Nuclear Information System (INIS)

    Ganong, G.H.D.; Strang, A.E.; Gunter, G.E.; Thompson, T.S.

    Point Lepreau-1 reactor is a 600 MWe generating station expected to be in service by October 1979. New Brunswick is suffering a 'catch up' phenomenon in load growth and needs to decrease dependence on foreign oil. The site is on salt water and extensive study has gone into corrosion control. Project management, financing and scheduling have unique aspects. (E.C.B.)

  1. Aircraft Oxygen Generation

    Science.gov (United States)

    2012-02-01

    An Oxygen Enriched Air System for the AV-8A Harrier (NADC-81198-60).” 70 Horch , T., et. al. “The F-16 Onboard Oxygen Generating System: Performance...Only and Safety Privileged). Horch , T., Miller, R., Bomar, J., Tedor, J., Holden, R., Ikels, K., & Lozano, P. (1983). The F-16 Onboard Oxygen

  2. Variable speed generators

    CERN Document Server

    Boldea, Ion

    2005-01-01

    With the deregulation of electrical energy production and distribution, says Boldea (Polytechnical Institute, Timisoara, Romania) producers are looking for ways to tailor their electricity for different markets. Variable-speed electric generators are serving that purpose, up to the 400 megavolt ampere unit size, in Japan since 1996 and Germany sinc

  3. Image scaling curve generation

    NARCIS (Netherlands)

    2012-01-01

    The present invention relates to a method of generating an image scaling curve, where local saliency is detected in a received image. The detected local saliency is then accumulated in the first direction. A final scaling curve is derived from the detected local saliency and the image is then

  4. Image scaling curve generation.

    NARCIS (Netherlands)

    2011-01-01

    The present invention relates to a method of generating an image scaling curve, where local saliency is detected in a received image. The detected local saliency is then accumulated in the first direction. A final scaling curve is derived from the detected local saliency and the image is then

  5. MEMS Solar Generators

    OpenAIRE

    Grbovic, Dragoslav; Osswald, Sebastian

    2011-01-01

    Approved for public release; distribution is unlimited Using MEMS bimaterial structures to build highly efficient solar energy generators. This is a novel approach that utilizes developments in the area of bimaterial sensors and applies them in the field of solar energy harvesting.

  6. Pulsed neutron generator

    International Nuclear Information System (INIS)

    Bespalov, D.F.; Bykovskii, Yu.A.; Vergun, I.I.; Kozlovskii, K.I.; Kozyrev, Yu.P.; Leonov, R.K.; Simagin, B.I.; Tsybin, A.S.; Shikanov, A.Ie.

    1986-03-01

    The paper describes a new device for generating pulsed neutron fields, utilized in nuclear geophysics for carrying out pulsed neutron logging and activation analysis under field conditions. The invention employs a sealed-off neutron tube with a laser ion source which increases neutron yield to the level of 10 neutrons per second or higher. 2 refs., 1 fig

  7. Steam generators and furnaces

    Energy Technology Data Exchange (ETDEWEB)

    Swoboda, E

    1978-04-01

    The documents published in 1977 in the field of steam generators for conventional thermal power plants are classified according to the following subjects: power industry and number of power plants, planning and operation, design and construction, furnaces, environmental effects, dirt accumulation and corrosion, conservation and scouring, control and automation, fundamental research, and materials.

  8. Future generations in democracy

    DEFF Research Database (Denmark)

    Jensen, Karsten Klint

    2015-01-01

    of future generations. The analysis reveals that they tend to overlook the democratic costs of such representation (violation of political equality, risk of distortion of the deliberation and undermining of autonomy), while they seem to ignore the alternative of giving consideration to the interests...

  9. Energy generation device

    International Nuclear Information System (INIS)

    Araki, Takashi; Tatsumi, Masami; Tada, Koji.

    1990-01-01

    In a reaction estimated as nuclear fusion, a portion near of electrode is heated locally to a high temperature by the heat of the reaction generated on the electrode, by which the electrode is melted or heavy water is boiled. Then, Continuous reaction is difficult and not practical. In view of the above, a cathode made of deuterium absorbing materials is put into heavy water and electric current is supplied, to continuously take place the reaction and an anode is disposed in a cylindrical cathode to cause reaction of energy generation therein in order to continuously take out the generated energy to the outside safely. Further, heavy water is circulated inside the cylindrical cathode to externally take out heavy water the temperature of which is elevated by the generated energy, and fresh heavy water is supplied to the inside of the cylindrical cathode. Thus, heavy water does not boil on the electrode, temperature elevation can be suppressed and melting of the electrode itself can be prevented. (N.H.)

  10. Mentorship: A Generational Perspective

    Science.gov (United States)

    Shadle, Eric

    2016-01-01

    Three major generations are represented in today's workforce: Baby Boomers, Gen X, and Millennials. Each of these groups has a wide range of definitions, but here they are defined according to their most common definitions: Baby boomers include those born in the decade following the end of World War II and are between the ages of 50 and 70 years.…

  11. High Voltage Seismic Generator

    Science.gov (United States)

    Bogacz, Adrian; Pala, Damian; Knafel, Marcin

    2015-04-01

    This contribution describes the preliminary result of annual cooperation of three student research groups from AGH UST in Krakow, Poland. The aim of this cooperation was to develop and construct a high voltage seismic wave generator. Constructed device uses a high-energy electrical discharge to generate seismic wave in ground. This type of device can be applied in several different methods of seismic measurement, but because of its limited power it is mainly dedicated for engineering geophysics. The source operates on a basic physical principles. The energy is stored in capacitor bank, which is charged by two stage low to high voltage converter. Stored energy is then released in very short time through high voltage thyristor in spark gap. The whole appliance is powered from li-ion battery and controlled by ATmega microcontroller. It is possible to construct larger and more powerful device. In this contribution the structure of device with technical specifications is resented. As a part of the investigation the prototype was built and series of experiments conducted. System parameter was measured, on this basis specification of elements for the final device were chosen. First stage of the project was successful. It was possible to efficiently generate seismic waves with constructed device. Then the field test was conducted. Spark gap wasplaced in shallowborehole(0.5 m) filled with salt water. Geophones were placed on the ground in straight line. The comparison of signal registered with hammer source and sparker source was made. The results of the test measurements are presented and discussed. Analysis of the collected data shows that characteristic of generated seismic signal is very promising, thus confirms possibility of practical application of the new high voltage generator. The biggest advantage of presented device after signal characteristics is its size which is 0.5 x 0.25 x 0.2 m and weight approximately 7 kg. This features with small li-ion battery makes

  12. GASIFICATION FOR DISTRIBUTED GENERATION

    Energy Technology Data Exchange (ETDEWEB)

    Ronald C. Timpe; Michael D. Mann; Darren D. Schmidt

    2000-05-01

    A recent emphasis in gasification technology development has been directed toward reduced-scale gasifier systems for distributed generation at remote sites. The domestic distributed power generation market over the next decade is expected to be 5-6 gigawatts per year. The global increase is expected at 20 gigawatts over the next decade. The economics of gasification for distributed power generation are significantly improved when fuel transport is minimized. Until recently, gasification technology has been synonymous with coal conversion. Presently, however, interest centers on providing clean-burning fuel to remote sites that are not necessarily near coal supplies but have sufficient alternative carbonaceous material to feed a small gasifier. Gasifiers up to 50 MW are of current interest, with emphasis on those of 5-MW generating capacity. Internal combustion engines offer a more robust system for utilizing the fuel gas, while fuel cells and microturbines offer higher electric conversion efficiencies. The initial focus of this multiyear effort was on internal combustion engines and microturbines as more realistic near-term options for distributed generation. In this project, we studied emerging gasification technologies that can provide gas from regionally available feedstock as fuel to power generators under 30 MW in a distributed generation setting. Larger-scale gasification, primarily coal-fed, has been used commercially for more than 50 years to produce clean synthesis gas for the refining, chemical, and power industries. Commercial-scale gasification activities are under way at 113 sites in 22 countries in North and South America, Europe, Asia, Africa, and Australia, according to the Gasification Technologies Council. Gasification studies were carried out on alfalfa, black liquor (a high-sodium waste from the pulp industry), cow manure, and willow on the laboratory scale and on alfalfa, black liquor, and willow on the bench scale. Initial parametric tests

  13. Pulsed current generator

    International Nuclear Information System (INIS)

    Semenov, V.D.; Furman, Eh.G.

    1974-01-01

    The paper describes a current pulse generator with an auxiliary network consisting of a choke and diode in series designed to enlarge the range of pulse frequency control. One output of the network is connected to an adjustable valve cathode and via antoher auxiliary condenser to the point where the cathode of the main key unit is joined to the start of the magnetizing coil. A second output is connected to the anode of another adjustable valve and via another auxiliary condenser to the point where the anode of the other main key unit is joined to the end of the magnetizing coil. The generator can be used to excite the electromagnets of charged particle accelerators or in devices designed to produce magnetic fields. (author)

  14. Why three generations?

    Directory of Open Access Journals (Sweden)

    Masahiro Ibe

    2016-07-01

    Full Text Available We discuss an anthropic explanation of why there exist three generations of fermions. If one assumes that the right-handed neutrino sector is responsible for both the matter–antimatter asymmetry and the dark matter, then anthropic selection favors three or more families of fermions. For successful leptogenesis, at least two right-handed neutrinos are needed, while the third right-handed neutrino is invoked to play the role of dark matter. The number of the right-handed neutrinos is tied to the number of generations by the anomaly constraints of the U(1B−L gauge symmetry. Combining anthropic arguments with observational constraints, we obtain predictions for the X-ray observations, as well as for neutrinoless double-beta decay.

  15. Second harmonic generation imaging

    CERN Document Server

    2013-01-01

    Second-harmonic generation (SHG) microscopy has shown great promise for imaging live cells and tissues, with applications in basic science, medical research, and tissue engineering. Second Harmonic Generation Imaging offers a complete guide to this optical modality, from basic principles, instrumentation, methods, and image analysis to biomedical applications. The book features contributions by experts in second-harmonic imaging, including many pioneering researchers in the field. Written for researchers at all levels, it takes an in-depth look at the current state of the art and possibilities of SHG microscopy. Organized into three sections, the book: Provides an introduction to the physics of the process, step-by-step instructions on how to build an SHG microscope, and comparisons with related imaging techniques Gives an overview of the capabilities of SHG microscopy for imaging tissues and cells—including cell membranes, muscle, collagen in tissues, and microtubules in live cells—by summarizing experi...

  16. Choice probability generating functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel; Bierlaire, Michel

    2010-01-01

    This paper establishes that every random utility discrete choice model (RUM) has a representation that can be characterized by a choice-probability generating function (CPGF) with specific properties, and that every function with these specific properties is consistent with a RUM. The choice...... probabilities from the RUM are obtained from the gradient of the CPGF. Mixtures of RUM are characterized by logarithmic mixtures of their associated CPGF. The paper relates CPGF to multivariate extreme value distributions, and reviews and extends methods for constructing generating functions for applications....... The choice probabilities of any ARUM may be approximated by a cross-nested logit model. The results for ARUM are extended to competing risk survival models....

  17. High energy neutron generator

    International Nuclear Information System (INIS)

    Barjon, R.; Breynat, G.

    1987-01-01

    This patent describes a generator of fast neutrons only slightly contaminated by neutrons of energy less than 15 MeV, comprising a source of charged particles of energy equal to at least 15 MeV, a target made of lithium deuteride, and means for cooling the target. The target comprises at least two elements placed in series in the path of the charged particles and separated from each other, the thickness of each of the elements being selected as a function of the average energy of the charged particles emitted from the source and the energy of the fast neutrons to be generated such that neutrons of energy equal to at least 15 MeV are emitted in the forward direction in response to the bombardment of the target from behind by the charged particles. The target cooling means comprises means for circulating between and around the elements a gas which does not chemically react with lithium deuteride

  18. The intense neutron generator

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, W B

    1966-07-01

    The presentation discusses both the economic and research contexts that would be served by producing neutrons in gram quantities at high intensities by electrical means without uranium-235. The revenue from producing radioisotopes is attractive. The array of techniques introduced by the multipurpose 65 megawatt Intense Neutron Generator project includes liquid metal cooling, superconducting magnets for beam bending and focussing, super-conductors for low-loss high-power radiofrequency systems, efficient devices for producing radiofrequency power, plasma physics developments for producing and accelerating hydrogen, ions at high intensity that are still far out from established practice, a multimegawatt high voltage D.C. generating machine that could have several applications. The research fields served relate principally to materials science through neutron-phonon and other quantum interactions as well as through neutron diffraction. Nuclear physics is served through {mu}-, {pi}- and K-meson production. Isotope production enters many fields of applied research. (author)

  19. Electric power generation

    International Nuclear Information System (INIS)

    Pinske, J.D.

    1981-01-01

    Apart from discussing some principles of power industry the present text deals with the different ways of electric power generation. Both the conventional methods of energy conversion in heating and water power stations and the facilities for utilizing regenerative energy sources (sun, wind, ground heat, tidal power) are considered. The script represents the essentials of the lecture of the same name which is offered to the students of the special subject 'electric power engineering' at the Fachhochschule Hamburg. It does not require any special preliminary knowledge except for the general principles of electrical engineering. It is addressing students of electrical engineering who have passed their preliminary examination at technical colleges and universities. Moreover, it shall also be of use for engineers who want to obtain a quick survey of the structure and the operating characteristics of the extremely different technical methods of power generation. (orig.) [de

  20. Inflow Turbulence Generation Methods

    Science.gov (United States)

    Wu, Xiaohua

    2017-01-01

    Research activities on inflow turbulence generation methods have been vigorous over the past quarter century, accompanying advances in eddy-resolving computations of spatially developing turbulent flows with direct numerical simulation, large-eddy simulation (LES), and hybrid Reynolds-averaged Navier-Stokes-LES. The weak recycling method, rooted in scaling arguments on the canonical incompressible boundary layer, has been applied to supersonic boundary layer, rough surface boundary layer, and microscale urban canopy LES coupled with mesoscale numerical weather forecasting. Synthetic methods, originating from analytical approximation to homogeneous isotropic turbulence, have branched out into several robust methods, including the synthetic random Fourier method, synthetic digital filtering method, synthetic coherent eddy method, and synthetic volume forcing method. This article reviews major progress in inflow turbulence generation methods with an emphasis on fundamental ideas, key milestones, representative applications, and critical issues. Directions for future research in the field are also highlighted.

  1. Thermoacoustic magnetohydrodynamic electrical generator

    International Nuclear Information System (INIS)

    Wheatley, J.C.; Swift, G.W.; Migliori, A.

    1986-01-01

    A thermoacoustic magnetohydrodynamic electrical generator is described comprising a magnet having a magnetic field, an elongate hollow housing containing an electrically conductive liquid and a thermoacoustic structure positioned in the liquid, heat exchange means thermally connected to the thermoacoustic structure for inducing the liquid to oscillate at an acoustic resonant frequency within the housing. The housing is positioned in the magnetic field and oriented such that the direction of the magnetic field and the direction of oscillatory motion of the liquid are substantially orthogonal to one another, first and second electrical conductor means connected to the liquid on opposite sides of the housing along an axis which is substantially orthogonal to both the direction of the magnetic field and the direction of oscillatory motion of the liquid, an alternating current output signal is generated in the conductor means at a frequency corresponding to the frequency of the oscillatory motion of the liquid

  2. Short pulse neutron generator

    Science.gov (United States)

    Elizondo-Decanini, Juan M.

    2016-08-02

    Short pulse neutron generators are described herein. In a general embodiment, the short pulse neutron generator includes a Blumlein structure. The Blumlein structure includes a first conductive plate, a second conductive plate, a third conductive plate, at least one of an inductor or a resistor, a switch, and a dielectric material. The first conductive plate is positioned relative to the second conductive plate such that a gap separates these plates. A vacuum chamber is positioned in the gap, and an ion source is positioned to emit ions in the vacuum chamber. The third conductive plate is electrically grounded, and the switch is operable to electrically connect and disconnect the second conductive plate and the third conductive plate. The at least one of the resistor or the inductor is coupled to the first conductive plate and the second conductive plate.

  3. JET flywheel generators

    International Nuclear Information System (INIS)

    Huart, M.; Sonnerup, L.

    1986-01-01

    Two large vertical shaft flywheel generators each provides the JET device with peak power up to 400 MW and energy up to 2600 MJ per pulse to induce and confine the multi-mega-ampere plasma current. The integrated rotor flywheel consists of a 650 tonne/10 m diameter rim carrying the poles of the machine. The energy is stored kinetically during a 9 min interval of acceleration from half-speed to full-speed and then released during a 20 s long deceleration. A design life of 100 000 cycles at full energy rating was specified. The mechanical design and construction of the generators is reviewed. Particular attention is paid to the assessment of the stresses and fatigue life of the rotor system, its dynamic behaviour (rim movement, critical speed and balancing) and on the performance in operation of the large thrust bearing. (author)

  4. Parallel Polarization State Generation.

    Science.gov (United States)

    She, Alan; Capasso, Federico

    2016-05-17

    The control of polarization, an essential property of light, is of wide scientific and technological interest. The general problem of generating arbitrary time-varying states of polarization (SOP) has always been mathematically formulated by a series of linear transformations, i.e. a product of matrices, imposing a serial architecture. Here we show a parallel architecture described by a sum of matrices. The theory is experimentally demonstrated by modulating spatially-separated polarization components of a laser using a digital micromirror device that are subsequently beam combined. This method greatly expands the parameter space for engineering devices that control polarization. Consequently, performance characteristics, such as speed, stability, and spectral range, are entirely dictated by the technologies of optical intensity modulation, including absorption, reflection, emission, and scattering. This opens up important prospects for polarization state generation (PSG) with unique performance characteristics with applications in spectroscopic ellipsometry, spectropolarimetry, communications, imaging, and security.

  5. Vertical steam generator

    International Nuclear Information System (INIS)

    Cuda, F.; Kondr, M.; Kresta, M.; Kusak, V.; Manek, O.; Turon, S.

    1982-01-01

    A vertical steam generator for nuclear power plants and dual purpose power plants consists of a cylindrical vessel in which are placed heating tubes in the form upside-down U. The heating tubes lead to the jacket of the cylindrical collector placed in the lower part of the steam generator perpendicularly to its vertical axis. The cylindrical collector is divided by a longitudinal partition into the inlet and outlet primary water sections of the heating tubes. One ends of the heating tube leads to the jacket of the collector for primary water feeding and the second ends of the heating tubes into the jacket of the collector which feeds and offtakes primary water from the heating tubes. (B.S.)

  6. Power generation statistics

    International Nuclear Information System (INIS)

    Kangas, H.

    2001-01-01

    The frost in February increased the power demand in Finland significantly. The total power consumption in Finland during January-February 2001 was about 4% higher than a year before. In January 2001 the average temperature in Finland was only about - 4 deg C, which is nearly 2 degrees higher than in 2000 and about 6 degrees higher than long term average. Power demand in January was slightly less than 7.9 TWh, being about 0.5% less than in 2000. The power consumption in Finland during the past 12 months exceeded 79.3 TWh, which is less than 2% higher than during the previous 12 months. In February 2001 the average temperature was - 10 deg C, which was about 5 degrees lower than in February 2000. Because of this the power consumption in February 2001 increased by 5%. Power consumption in February was 7.5 TWh. The maximum hourly output of power plants in Finland was 13310 MW. Power consumption of Finnish households in February 2001 was about 10% higher than in February 2000, and in industry the increase was nearly zero. The utilization rate in forest industry in February 2001 decreased from the value of February 2000 by 5%, being only about 89%. The power consumption of the past 12 months (Feb. 2000 - Feb. 2001) was 79.6 TWh. Generation of hydroelectric power in Finland during January - February 2001 was 10% higher than a year before. The generation of hydroelectric power in Jan. - Feb. 2001 was nearly 2.7 TWh, corresponding to 17% of the power demand in Finland. The output of hydroelectric power in Finland during the past 12 months was 14.7 TWh. The increase from the previous 12 months was 17% corresponding to over 18% of the power demand in Finland. Wind power generation in Jan. - Feb. 2001 was exceeded slightly 10 GWh, while in 2000 the corresponding output was 20 GWh. The degree of utilization of Finnish nuclear power plants in Jan. - Feb. 2001 was high. The output of these plants was 3.8 TWh, being about 1% less than in Jan. - Feb. 2000. The main cause for the

  7. Next generation vaccines.

    Science.gov (United States)

    Riedmann, Eva M

    2011-07-01

    In February this year, about 100 delegates gathered for three days in Vienna (Austria) for the Next Generation Vaccines conference. The meeting held in the Vienna Hilton Hotel from 23rd-25th February 2011 had a strong focus on biotech and industry. The conference organizer Jacob Fleming managed to put together a versatile program ranging from the future generation of vaccines to manufacturing, vaccine distribution and delivery, to regulatory and public health issues. Carefully selected top industry experts presented first-hand experience and shared solutions for overcoming the latest challenges in the field of vaccinology. The program also included several case study presentations on novel vaccine candidates in different stages of development. An interactive pre-conference workshop as well as interactive panel discussions during the meeting allowed all delegates to gain new knowledge and become involved in lively discussions on timely, interesting and sometimes controversial topics related to vaccines.

  8. The intense neutron generator

    International Nuclear Information System (INIS)

    Lewis, W.B.

    1966-01-01

    The presentation discusses both the economic and research contexts that would be served by producing neutrons in gram quantities at high intensities by electrical means without uranium-235. The revenue from producing radioisotopes is attractive. The array of techniques introduced by the multipurpose 65 megawatt Intense Neutron Generator project includes liquid metal cooling, superconducting magnets for beam bending and focussing, super-conductors for low-loss high-power radiofrequency systems, efficient devices for producing radiofrequency power, plasma physics developments for producing and accelerating hydrogen, ions at high intensity that are still far out from established practice, a multimegawatt high voltage D.C. generating machine that could have several applications. The research fields served relate principally to materials science through neutron-phonon and other quantum interactions as well as through neutron diffraction. Nuclear physics is served through μ-, π- and K-meson production. Isotope production enters many fields of applied research. (author)

  9. Electrochemical energy generation

    International Nuclear Information System (INIS)

    Kreysa, G.; Juettner, K.

    1993-01-01

    The proceedings encompass 40 conference papers belonging to the following subject areas: Baseline and review papers; electrochemical fuel cells; batteries: Primary and secondary cells; electrochemical, regenerative systems for energy conversion; electrochemical hydrogen generation; electrochemistry for nuclear power plant; electrochemistry for spent nuclear fuel reprocessing; energy efficiency in electrochemical processes. There is an annex listing the authors and titles of the poster session, and compacts of the posters can be obtained from the office of the Gesellschaft Deutscher Chemiker, Abteilung Tagungen. (MM) [de

  10. Second generation registry framework.

    Science.gov (United States)

    Bellgard, Matthew I; Render, Lee; Radochonski, Maciej; Hunter, Adam

    2014-01-01

    Information management systems are essential to capture data be it for public health and human disease, sustainable agriculture, or plant and animal biosecurity. In public health, the term patient registry is often used to describe information management systems that are used to record and track phenotypic data of patients. Appropriate design, implementation and deployment of patient registries enables rapid decision making and ongoing data mining ultimately leading to improved patient outcomes. A major bottleneck encountered is the static nature of these registries. That is, software developers are required to work with stakeholders to determine requirements, design the system, implement the required data fields and functionality for each patient registry. Additionally, software developer time is required for ongoing maintenance and customisation. It is desirable to deploy a sophisticated registry framework that can allow scientists and registry curators possessing standard computing skills to dynamically construct a complete patient registry from scratch and customise it for their specific needs with little or no need to engage a software developer at any stage. This paper introduces our second generation open source registry framework which builds on our previous rare disease registry framework (RDRF). This second generation RDRF is a new approach as it empowers registry administrators to construct one or more patient registries without software developer effort. New data elements for a diverse range of phenotypic and genotypic measurements can be defined at any time. Defined data elements can then be utilised in any of the created registries. Fine grained, multi-level user and workgroup access can be applied to each data element to ensure appropriate access and data privacy. We introduce the concept of derived data elements to assist the data element standards communities on how they might be best categorised. We introduce the second generation RDRF that

  11. Wind power generation

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    The monthly statistics of wind electric power generation in Denmark are compiled from information given by the owners of private wind turbines. The data are arranged according to the size of the turbines. For each wind turbine the name of the site and type of turbine is given as well as the production during the last 3 months in 1998, and the total production in 1997 and 1998. Data on the operation is given

  12. Wind power. [electricity generation

    Science.gov (United States)

    Savino, J. M.

    1975-01-01

    A historical background on windmill use, the nature of wind, wind conversion system technology and requirements, the economics of wind power and comparisons with alternative systems, data needs, technology development needs, and an implementation plan for wind energy are presented. Considerable progress took place during the 1950's. Most of the modern windmills feature a wind turbine electricity generator located directly at the top of their rotor towers.

  13. Generation of monoenergetic positrons

    International Nuclear Information System (INIS)

    Hulett, L.D. Jr.; Dale, J.M.; Miller, P.D. Jr.; Moak, C.D.; Pendyala, S.; Triftshaeuser, W.; Howell, R.H.; Alvarez, R.A.

    1983-01-01

    Many experiments have been performed in the generation and application of monoenergetic positron beams using annealed tungsten moderators and fast sources of 58 Co, 22 Na, 11 C, and LINAC bremstrahlung. This paper will compare the degrees of success from our various approaches. Moderators made from both single crystal and polycrystal tungsten have been tried. Efforts to grow thin films of tungsten to be used as transmission moderators and brightness enhancement devices are in progress

  14. Equilibrium and generators

    International Nuclear Information System (INIS)

    Balter, H.S.

    1994-01-01

    This work studies the behaviour of radionuclides when it produce a desintegration activity,decay and the isotopes stable creation. It gives definitions about the equilibrium between activity of parent and activity of the daughter, radioactive decay,isotope stable and transient equilibrium and maxim activity time. Some considerations had been given to generators that permit a disgregation of two radioisotopes in equilibrium and its good performance. Tabs

  15. "Asset Ownership Across Generations"

    OpenAIRE

    Ngina S. Chiteji; Frank P. Stafford

    2000-01-01

    This paper examines cross-generational connections in asset ownership. It begins by presenting a theoretical framework that develops the distinction between the intergenerational transfer of knowledge about financial assets and the direct transfer of dollars from parents to children. Its analysis of data from the Panel Study of Income Dynamics (PSID) reveals intergenerational correlations in asset ownership, and we find evidence to suggest that parental asset ownership or family-based exposur...

  16. Choice Probability Generating Functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel L; Bierlaire, Michel

    This paper considers discrete choice, with choice probabilities coming from maximization of preferences from a random utility field perturbed by additive location shifters (ARUM). Any ARUM can be characterized by a choice-probability generating function (CPGF) whose gradient gives the choice...... probabilities, and every CPGF is consistent with an ARUM. We relate CPGF to multivariate extreme value distributions, and review and extend methods for constructing CPGF for applications....

  17. Mechanisms for generating froissaron

    International Nuclear Information System (INIS)

    Glushko, N.I.; Kobylinski, N.A.; Martynov, E.S.; Shelest, V.P.

    1982-01-01

    From a common point of view, we consider the mechanisms for generating froissaron which arise due to the quasieikonal approximation, the U-matrix approach and the method of continued unitarity. A realistic model for the input pomeron is suggested and the data on high-energy pp-scattering are described. Likeness and difference of asymptotic and preasymptotic regimes for three variants of froissaron are discussed

  18. 350 KVA motor generators

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Each logic circuit in the central computers consumes only a fraction of a watt: however, the final load constituted by many such circuits plus peripheral equipment is nearly half a million watts. Shown here are two 350 KVA motor generators used to convert 50 Hz mains to 60 Hz (US standard). Flywheels on the M.G. shafts remove power dropouts of up to 0.5 s.

  19. Micro watt thermocurrent generator

    International Nuclear Information System (INIS)

    Bustard, T.; Goslee, D.; Barr, H.

    1976-01-01

    This nuclear thermocurrent generator to feed a cardic pacemaker should have higher life expectancy and reliability than was previously achieved. For this purpose a gettering arrangement is connected to be heat conducting immediately adjacent to the nuclear fuel arrangement in an evacuated casing. The gettering arrangement can be operated to activate at as high a temperature as possible, from 121 0 C to preferably about 204 0 C, so that a high vacuum is maintained. The current generating thermal column works at a temperature difference of 55.6 0 C. As the cold end of the column is connected to the outer casing, and should be held to a mean body temperature of 37.8 0 C, the hot side of the thermal column may only be heated to 93.4 0 C. The temperature jump from 121 0 or 204 0 to 93.4 0 is produced by a thermal resistance inserted between the hot side of the thermal column and the fuel arrangement. It may consist of a spacer made of stainless steel or by a gap, while in this first arrangement the nuclear heat generator is situated between the gettering arrangement and the thermal column, another arrangement shows the gettering arrangement enclosed in the fuel arrangement and thermal column. Here the heat flows in one direction only, the required temperature gradient is produced by suitable construction of the heat contacts between the 3 elements. Detailed constructional and manufacturing data are given for both models. Plutonium oxide is welded into a double casing as heat generator, in example the casing is made of nickel alloy. 1/10 gram of plutonium supplies a thermal energy of 50m watts, which produces a thermal current of 300 to 400 micro watts at 0.3V. (RW) [de

  20. Four Generations in Phenomenology

    Energy Technology Data Exchange (ETDEWEB)

    Kribs, Graham D. [Department of Physics, University of Oregon, Eugene, OR 97403 (United States); Plehn, Tilman [SUPA, School of Physics, University of Edinburgh, Edinburgh EH9 3JZ, Scotland (HCP speaker) (United Kingdom); Spannowsky, Michael [ASC, Department fuer Physik, Ludwig-Maximilians-Universitaet Muenchen, 80333 Muenchen (Germany); Tait, Tim M.P. [HEP Division, Argonne National Laboratory, 9700 Cass Ave., Argonne, IL 60439 (United States)

    2008-03-15

    In four-generation models Higgs masses of 115-315 GeV are perfectly allowed by electroweak precision data. In this mass range we find dramatic effects on Higgs phenomenology at hadron colliders: production rates are enhanced, weak-boson-fusion channels are suppressed, angular distributions are modified, Higgs pairs can be observed, and Higgs decays to Majorana neutrinos can lead to exotic signals.

  1. Automated Test Case Generation

    CERN Multimedia

    CERN. Geneva

    2015-01-01

    I would like to present the concept of automated test case generation. I work on it as part of my PhD and I think it would be interesting also for other people. It is also the topic of a workshop paper that I am introducing in Paris. (abstract below) Please note that the talk itself would be more general and not about the specifics of my PhD, but about the broad field of Automated Test Case Generation. I would introduce the main approaches (combinatorial testing, symbolic execution, adaptive random testing) and their advantages and problems. (oracle problem, combinatorial explosion, ...) Abstract of the paper: Over the last decade code-based test case generation techniques such as combinatorial testing or dynamic symbolic execution have seen growing research popularity. Most algorithms and tool implementations are based on finding assignments for input parameter values in order to maximise the execution branch coverage. Only few of them consider dependencies from outside the Code Under Test’s scope such...

  2. Electricity generation cost

    International Nuclear Information System (INIS)

    Bald, M.

    1984-01-01

    Also questions of efficiency play a part in the energy discussion. In this context, the economic evaluation of different energy supply variants is of importance. Especially with regard to the generation of electric power there have been discussions again and again during the last years on the advantage of the one or the other kind of electric power generation. In the meantime, a large number of scientific studies has been published on this topic which mainly deal with comparisons of the costs of electric power generated by hard coal or nuclear energy, i.e. of those energy forms which still have the possibilities of expansion. The following part shows a way for the evaluation of efficiency comparisons which starts from simplified assumptions and which works with arithmetical aids, which don't leave the area of the fundamental operations. The general comprehensibility is paid for with cuts on ultimate analytical and arithmetical precision. It will, however, turn out that the results achieved by this method don't differ very much from those which have been won by scientific targets. (orig./UA) [de

  3. Linear wind generator

    International Nuclear Information System (INIS)

    Kozarov, A.; Petrov, O.; Antonov, J.; Sotirova, S.; Petrova, B.

    2006-01-01

    The purpose of the linear wind-power generator described in this article is to decrease the following disadvantages of the common wind-powered turbine: 1) large bending and twisting moments to the blades and the shaft, especially when strong winds and turbulence exist; 2) significant values of the natural oscillation period of the construction result in the possibility of occurrence of destroying resonance oscillations; 3) high velocity of the peripheral parts of the rotor creating a danger for birds; 4) difficulties, connected with the installation and the operation on the mountain ridges and passages where the wind energy potential is the largest. The working surfaces of the generator in questions driven by the wind are not connected with a joint shaft but each moves along a railway track with few oscillations. So the sizes of each component are small and their number can be rather large. The mechanical trajectory is not a circle but a closed outline in a vertical plain, which consists of two rectilinear sectors, one above the other, connected in their ends by semi-circumferences. The mechanical energy of each component turns into electrical on the principle of the linear electrical generator. A regulation is provided when the direction of the wind is perpendicular to the route. A possibility of effectiveness is shown through aiming of additional quantities of air to the movable components by static barriers

  4. The event generator SIMON

    International Nuclear Information System (INIS)

    Durand, D.; Lopez, O.; Nguyen, A.D.

    1997-01-01

    The utilization and development of SIMON generator work was conducted at LPC.This generator was conceived for simple and versatile simulations of different processes occurring in the nuclear collisions at Fermi Energies. At present it is utilized in a large number of French foreign laboratories. Particularly, certain analyses of INDRA data have been done by use of this generator: estimation of collective energy in the Xe + Sn and Gd + U central collisions; shape and space-time correlation analysis in fragment-fragment and particle-fragment output of the same system; calorimetric study of the Xe + Sn and Ar + Ni system; study of the vaporization for the Ar + Ni system. Recently a number of items were improved or modified, among which: the initial configuration was allowed to be non-spherical what permits the analysis of the semi-central collisions; a so-called pre-fragmentation emission may be included to estimate different time constants implied in the fragmentation process

  5. Steam generator life management

    International Nuclear Information System (INIS)

    King, P.; McGillivray, R.; Reinhardt, W.; Millman, J.; King, B.; Schneider, W.

    2003-01-01

    'Full-Text:' Steam Generator Life Management responsibility embodies doing whatever is necessary to maintain the steam generation equipment of a nuclear plant in effective, reliable service. All comes together in that most critical deliverable, namely the submission of the documentation which wins approval for return to service after an outage program. Life management must address all aspects of SG reliability over the life of the plant. Nevertheless, the life management activities leading up to return to service approval is where all of it converges. Steam Generator Life Management activities entail four types of work, all equally important in supporting the objective of successful operation. These activities are i) engineering functions; including identification of inspection and maintenance requirements, outage planning and scope definition plus engineering assessment, design and analysis as necessary to support equipment operation, ii) fitness of service work; including the expert evaluation of degradation mechanisms, disposition of defects for return to service or not, and the fitness for service analysis as required to justify ongoing operation with acceptable defects, iii) inspection work; including large scale eddy current inspection of tubing, the definition of defect size and character, code inspections of pressure vessel integrity and visual inspections for integrity and iv) maintenance work; including repairs, retrofits, cleaning and modifications, all as necessary to implement the measures defined during activities i) through iii). The paper discusses the approach and execution of the program for the achievement of the above objectives and particularly of items i) and ii). (author)

  6. Generation Z: Educating and Engaging the Next Generation of Students

    Science.gov (United States)

    Seemiller, Corey; Grace, Meghan

    2017-01-01

    In 1995, the Internet was born. So, too, was Generation Z. The oldest of this post-Millennial generation arrived to college in 2013, and more than four years later, Generation Z students fill the nation's classrooms, campus programs, and residence halls. In order to recruit, educate, and graduate this new generational cohort effectively, educators…

  7. Superconducting wind turbine generators

    International Nuclear Information System (INIS)

    Abrahamsen, A B; Seiler, E; Zirngibl, T; Andersen, N H; Mijatovic, N; Traeholt, C; Pedersen, N F; Oestergaard, J; Noergaard, P B

    2010-01-01

    We have examined the potential of 10 MW superconducting direct drive generators to enter the European offshore wind power market and estimated that the production of about 1200 superconducting turbines until 2030 would correspond to 10% of the EU offshore market. The expected properties of future offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However, the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10 MW is suggested to secure the accumulation of reliability experience. Finally, the quantities of high temperature superconducting tape needed for a 10 kW and an extreme high field 10 MW generator are found to be 7.5 km and 1500 km, respectively. A more realistic estimate is 200-300 km of tape per 10 MW generator and it is concluded that the present production capacity of coated conductors must be increased by a factor of 36 by 2020, resulting in a ten times lower price of the tape in order to reach a realistic price level for the superconducting drive train.

  8. Closing the generation gap

    International Nuclear Information System (INIS)

    Silverstein, E.

    1997-09-01

    The author has explained how the naive obstructions to unifying vacua with different net generation numbers can be overcome, and she gave a class of examples of chirality-changing phase transitions in four dimensions. The phenomenon exhibited here presumably occurs quite generally; it would be very interesting to understand whether in fact one can connect all vacua with N ≤ 1 supersymmetry at low energies. For this an F-theory analysis could be quite instructive, once that approach is developed more fully for four-folds. Perhaps the next in principle question to ask along these lines is whether there could be any physical process which changes the number of supersymmetries

  9. Improvements to vapor generators

    International Nuclear Information System (INIS)

    Keller, Arthur; Monroe, Neil.

    1976-01-01

    A supporting system is proposed for vapor generators of the 'supported' type. Said supporting system is intended to compensate the disparities of thermal expansion due to the differences in the vertical dimensions of the tubes in the walls of the combustion chamber and their collectors compared to that of the balloon tanks and the connecting tube clusters of vaporization, the first one being longer than the second ones. Said system makes it possible to build said combustion chamber higher than the balloon tanks and the tube clusters of vaporization. The capacity of steam production is thus enhanced [fr

  10. Nuclear power generating costs

    International Nuclear Information System (INIS)

    Srinivasan, M.R.; Kati, S.L.; Raman, R.; Nanjundeswaran, K.; Nadkarny, G.V.; Verma, R.S.; Mahadeva Rao, K.V.

    1983-01-01

    Indian experience pertaining to investment and generation costs of nuclear power stations is reviewed. The causes of investment cost increases are analysed and the increases are apportioned to escalation, design improvements and safety related adders. The paper brings out the fact that PHWR investment costs in India compare favourably with those experienced in developed countries in spite of the fact that the programme and the unit size are relatively much smaller in India. It brings out that in India at current prices a nuclear power station located over 800 km from coal reserves and operating at 75% capacity factor is competitive with thermal power at 60% capacity factor. (author)

  11. Next generation data harmonization

    Science.gov (United States)

    Armstrong, Chandler; Brown, Ryan M.; Chaves, Jillian; Czerniejewski, Adam; Del Vecchio, Justin; Perkins, Timothy K.; Rudnicki, Ron; Tauer, Greg

    2015-05-01

    Analysts are presented with a never ending stream of data sources. Often, subsets of data sources to solve problems are easily identified but the process to align data sets is time consuming. However, many semantic technologies do allow for fast harmonization of data to overcome these problems. These include ontologies that serve as alignment targets, visual tools and natural language processing that generate semantic graphs in terms of the ontologies, and analytics that leverage these graphs. This research reviews a developed prototype that employs all these approaches to perform analysis across disparate data sources documenting violent, extremist events.

  12. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1984-10-01

    A review of the performance of steam generator tubes in 116 water-cooled nuclear power reactors showed that tubes were plugged at 54 (46 percent) of the reactors. The number of tubes removed from service decreased from 4 692 (0.30 percent) in 1981 to 3 222 (0.20 percent) in 1982. The leading causes of tube failures were stress corrosion cracking from the primary side, stress corrosion cracking (or intergranular attack) from the secondary side and pitting corrosion. The lowest incidence of corrosion-induced defects from the secondary side occurred in reactors that have used only volatile treatment, with or without condensate demineralization

  13. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Tapping, R.L.; Stipan, L.

    1992-03-01

    A survey of steam generator operating experience for 1986 has been carried out for 184 pressurized water and pressurized heavy-water reactors, and 1 water-cooled, graphite-moderated reactor. Tubes were plugged at 75 of the reactors (40.5%). In 1986, 3737 tubes were plugged (0.14% of those in service) and 3148 tubes were repaired by sleeving. A small number of reactors accounted for the bulk of the plugged tubes, a phenomenon consistent with previous years. For 1986, the available tubesheet sludge data for 38 reactors has been compiled into tabular form, and sludge/deposit data will be incorporated into all future surveys

  14. Semiconductor thermoelectric generators

    CERN Document Server

    Fahrner, Wolfgang R

    2009-01-01

    It is well-known that fossil fuels are being rapidly depleted, and that atomic power is rejected by many people. As a consequence, there is a strong trend towards alternative sources such as wind, photovoltaics, solar heat and biomass. Strangely enough, quite another power source is generally neglected: namely, the thermoelectric generator (a device which converts heat, i.e. thermal energy, directly into electrical energy). The reason for this neglect is probably the low conversion efficiency, which is of the order of a few percent at most. However, there are two arguments in favor of the ther

  15. PLEXOS Input Data Generator

    Energy Technology Data Exchange (ETDEWEB)

    2017-02-01

    The PLEXOS Input Data Generator (PIDG) is a tool that enables PLEXOS users to better version their data, automate data processing, collaborate in developing inputs, and transfer data between different production cost modeling and other power systems analysis software. PIDG can process data that is in a generalized format from multiple input sources, including CSV files, PostgreSQL databases, and PSS/E .raw files and write it to an Excel file that can be imported into PLEXOS with only limited manual intervention.

  16. Choice probability generating functions

    DEFF Research Database (Denmark)

    Fosgerau, Mogens; McFadden, Daniel; Bierlaire, Michel

    2013-01-01

    This paper considers discrete choice, with choice probabilities coming from maximization of preferences from a random utility field perturbed by additive location shifters (ARUM). Any ARUM can be characterized by a choice-probability generating function (CPGF) whose gradient gives the choice...... probabilities, and every CPGF is consistent with an ARUM. We relate CPGF to multivariate extreme value distributions, and review and extend methods for constructing CPGF for applications. The choice probabilities of any ARUM may be approximated by a cross-nested logit model. The results for ARUM are extended...

  17. Radioisotope and radiopharmaceutical generators

    International Nuclear Information System (INIS)

    Barak, M.; Winchell, H.W.

    1975-01-01

    A chromatographic column for generating technetium-99m isotopes and technetium-99m labeled pharmaceuticals in a simple two-step process is described. Technetium-99m pertechnetate in a first step is isolated by adsorption upon an adsorbent packing. Then the technetium-99m in a second step is eluted from the packing, either with an immediately labeled biological compound to form a radiopharmaceutical, or by a controlled volume of eluant to produce a 99m-technetium-bearing eluate of a desired specific concentration. (Official Gazette)

  18. Computer generated holographic microtags

    International Nuclear Information System (INIS)

    Sweatt, W.C.

    1998-01-01

    A microlithographic tag comprising an array of individual computer generated holographic patches having feature sizes between 250 and 75 nanometers is disclosed. The tag is a composite hologram made up of the individual holographic patches and contains identifying information when read out with a laser of the proper wavelength and at the proper angles of probing and reading. The patches are fabricated in a steep angle Littrow readout geometry to maximize returns in the -1 diffracted order. The tags are useful as anti-counterfeiting markers because of the extreme difficulty in reproducing them. 5 figs

  19. Biomass Energy Generation Project

    Energy Technology Data Exchange (ETDEWEB)

    Olthoff, Edward [Cedar Falls Utilities, Cedar Falls, IA (United States)

    2017-05-15

    The Municipal Electric Utility of the City of Cedar Falls (dba Cedar Fals Utilities or CFU) received a congressionally directed grant funded through DOE-EERE to run three short (4 hour) duration test burns and one long (10 days) duration test burn to test the viability of renewable fuels in Streeter Station Boiler #6, a stoker coal fired electric generation unit. The long test burn was intended to test supply chain assumptions, optimize boiler combustion and assess the effects of a longer duration burn of biomass on the boiler.

  20. Steam generator arrangement

    International Nuclear Information System (INIS)

    Ssinegurski, E.

    1981-01-01

    A steam flow path arrangement for covering the walls of the rear gas pass of a steam generator is disclosed. The entire flow passes down the sidewalls with a minor portion then passing up through the rear wall to a superheater inlet header at an intermediate elevation. The major portion of the flow passes up the front wall and through hanger tubes to a roof header. From there the major portion passes across the roof and down the rear wall to the superheater inlet header at the intermediate elevation

  1. Generation of earthquake signals

    International Nuclear Information System (INIS)

    Kjell, G.

    1994-01-01

    Seismic verification can be performed either as a full scale test on a shaker table or as numerical calculations. In both cases it is necessary to have an earthquake acceleration time history. This report describes generation of such time histories by filtering white noise. Analogue and digital filtering methods are compared. Different methods of predicting the response spectrum of a white noise signal filtered by a band-pass filter are discussed. Prediction of both the average response level and the statistical variation around this level are considered. Examples with both the IEEE 301 standard response spectrum and a ground spectrum suggested for Swedish nuclear power stations are included in the report

  2. Isotopic Thermionic Generator

    International Nuclear Information System (INIS)

    Clemot, M.; Devin, B.; Durand, J.P.

    1967-01-01

    This report describes the general design of a thermionic direct conversion space generator. The power source used is a radioisotope. Two radioisotopes are considered: Pu 238 and Cm 244. The system is made up of a heat pipe concentrating the thermal flux from the isotope to the emitter, and of a second heat pipe evacuating the waste heat from the collector to the outer wall used as radiating panel. Calculations are given in the particular case of a 100 electrical watts output power. (authors) [fr

  3. Code Generation with Templates

    CERN Document Server

    Arnoldus, Jeroen; Serebrenik, A

    2012-01-01

    Templates are used to generate all kinds of text, including computer code. The last decade, the use of templates gained a lot of popularity due to the increase of dynamic web applications. Templates are a tool for programmers, and implementations of template engines are most times based on practical experience rather than based on a theoretical background. This book reveals the mathematical background of templates and shows interesting findings for improving the practical use of templates. First, a framework to determine the necessary computational power for the template metalanguage is presen

  4. Review of Micro Magnetic Generator

    Directory of Open Access Journals (Sweden)

    Lin DU

    2014-08-01

    Full Text Available This paper discusses the research progress of micro magnetic generator systems. Micro magnetic generator systems convert energy from the environment to electric energy with advantages as high reliability, high power density, long life time and can be applied to extreme environment. This paper summarizes methods for improving generator performance of micro magnetic generator, including rotational magnetic generator, vibrational magnetic generator and hybrid magnetic generator, analyzes and compares their design and performance, and concludes key technologies and ongoing challenges for further progress. The paper is instructive and meaningful to for research work of related field.

  5. Simple and Realistic Data Generation

    DEFF Research Database (Denmark)

    Pedersen, Kenneth Houkjær; Torp, Kristian; Wind, Rico

    2006-01-01

    This paper presents a generic, DBMS independent, and highly extensible relational data generation tool. The tool can efficiently generate realistic test data for OLTP, OLAP, and data streaming applications. The tool uses a graph model to direct the data generation. This model makes it very simple...... to generate data even for large database schemas with complex inter- and intra table relationships. The model also makes it possible to generate data with very accurate characteristics....

  6. Emotion-driven level generation

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.

    2016-01-01

    This chapter examines the relationship between emotions and level generation. Grounded in the experience-driven procedural content generation framework we focus on levels and introduce a taxonomy of approaches for emotion-driven level generation. We then review four characteristic level generators of our earlier work that exemplify each one of the approaches introduced. We conclude the chapter with our vision on the future of emotion-driven level generation.

  7. A molecular noise generator

    International Nuclear Information System (INIS)

    Lu Ting; Ferry, Michael; Hasty, Jeff; Weiss, Ron

    2008-01-01

    Recent studies have demonstrated that intracellular variations in the rate of gene expression are of fundamental importance to cellular function and development. While such 'noise' is often considered detrimental in the context of perturbing genetic systems, it can be beneficial in processes such as species diversification and facilitation of evolution. A major difficulty in exploring such effects is that the magnitude and spectral properties of the induced variations arise from some intrinsic cellular process that is difficult to manipulate. Here, we present two designs of a molecular noise generator that allow for the flexible modulation of the noise profile of a target gene. The first design uses a dual-signal mechanism that enables independent tuning of the mean and variability of an output protein. This is achieved through the combinatorial control of two signals that regulate transcription and translation separately. We then extend the design to allow for DNA copy-number regulation, which leads to a wider tuning spectrum for the output molecule. To gain a deeper understanding of the circuit's functionality in a realistic environment, we introduce variability in the input signals in order to ascertain the degree of noise induced by the control process itself. We conclude by illustrating potential applications of the noise generator, demonstrating how it could be used to ascertain the robust or fragile properties of a genetic circuit

  8. Next generation CANDU plants

    International Nuclear Information System (INIS)

    Hedges, K.R.; Yu, S.K.W.

    1998-01-01

    Future CANDU designs will continue to meet the emerging design and performance requirements expected by the operating utilities. The next generation CANDU products will integrate new technologies into both the product features as well as into the engineering and construction work processes associated with delivering the products. The timely incorporation of advanced design features is the approach adopted for the development of the next generation of CANDU. AECL's current products consist of 700MW Class CANDU 6 and 900 MW Class CANDU 9. Evolutionary improvements are continuing with our CANDU products to enhance their adaptability to meet customers ever increasing need for higher output. Our key product drivers are for improved safety, environmental protection and improved cost effectiveness. Towards these goals we have made excellent progress in Research and Development and our investments are continuing in areas such as fuel channels and passive safety. Our long term focus is utilizing the fuel cycle flexibility of CANDU reactors as part of the long term energy mix

  9. Next generation toroidal devices

    International Nuclear Information System (INIS)

    Yoshikawa, Shoichi

    1998-10-01

    A general survey of the possible approach for the next generation toroidal devices was made. Either surprisingly or obviously (depending on one's view), the technical constraints along with the scientific considerations lead to a fairly limited set of systems for the most favorable approach for the next generation devices. Specifically if the magnetic field strength of 5 T or above is to be created by superconducting coils, it imposes minimum in the aspect ratio for the tokamak which is slightly higher than contemplated now for ITER design. The similar technical constraints make the minimum linear size of a stellarator large. Scientifically, it is indicated that a tokamak of 1.5 times in the linear dimension should be able to produce economically, especially if a hybrid reactor is allowed. For the next stellarator, it is strongly suggested that some kind of helical axis is necessary both for the (almost) absolute confinement of high energy particles and high stability and equilibrium beta limits. The author still favors a heliac most. Although it may not have been clearly stated in the main text, the stability afforded by the shearless layer may be exploited fully in a stellarator. (author)

  10. Next generation toroidal devices

    Energy Technology Data Exchange (ETDEWEB)

    Yoshikawa, Shoichi [Princeton Plasma Physics Lab., Princeton Univ., NJ (United States)

    1998-10-01

    A general survey of the possible approach for the next generation toroidal devices was made. Either surprisingly or obviously (depending on one`s view), the technical constraints along with the scientific considerations lead to a fairly limited set of systems for the most favorable approach for the next generation devices. Specifically if the magnetic field strength of 5 T or above is to be created by superconducting coils, it imposes minimum in the aspect ratio for the tokamak which is slightly higher than contemplated now for ITER design. The similar technical constraints make the minimum linear size of a stellarator large. Scientifically, it is indicated that a tokamak of 1.5 times in the linear dimension should be able to produce economically, especially if a hybrid reactor is allowed. For the next stellarator, it is strongly suggested that some kind of helical axis is necessary both for the (almost) absolute confinement of high energy particles and high stability and equilibrium beta limits. The author still favors a heliac most. Although it may not have been clearly stated in the main text, the stability afforded by the shearless layer may be exploited fully in a stellarator. (author)

  11. Stretchable piezoelectric nanocomposite generator.

    Science.gov (United States)

    Park, Kwi-Il; Jeong, Chang Kyu; Kim, Na Kyung; Lee, Keon Jae

    2016-01-01

    Piezoelectric energy conversion that generate electric energy from ambient mechanical and vibrational movements is promising energy harvesting technology because it can use more accessible energy resources than other renewable natural energy. In particular, flexible and stretchable piezoelectric energy harvesters which can harvest the tiny biomechanical motions inside human body into electricity properly facilitate not only the self-powered energy system for flexible and wearable electronics but also sensitive piezoelectric sensors for motion detectors and in vivo diagnosis kits. Since the piezoelectric ZnO nanowires (NWs)-based energy harvesters (nanogenerators) were proposed in 2006, many researchers have attempted the nanogenerator by using the various fabrication process such as nanowire growth, electrospinning, and transfer techniques with piezoelectric materials including polyvinylidene fluoride (PVDF) polymer and perovskite ceramics. In 2012, the composite-based nanogenerators were developed using simple, low-cost, and scalable methods to overcome the significant issues with previously-reported energy harvester, such as insufficient output performance and size limitation. This review paper provides a brief overview of flexible and stretchable piezoelectric nanocomposite generator for realizing the self-powered energy system with development history, power performance, and applications.

  12. Future nuclear power generation

    International Nuclear Information System (INIS)

    Mosbah, D.S.; Nasreddine, M.

    2006-01-01

    The book includes an introduction then it speaks about the options to secure sources of energy, nuclear power option, nuclear plants to generate energy including light-water reactors (LWR), heavy-water reactors (HWR), advanced gas-cooled reactors (AGR), fast breeder reactors (FBR), development in the manufacture of reactors, fuel, uranium in the world, current status of nuclear power generation, economics of nuclear power, nuclear power and the environment and nuclear power in the Arab world. A conclusion at the end of the book suggests the increasing demand for energy in the industrialized countries and in a number of countries that enjoy special and economic growth such as China and India pushes the world to search for different energy sources to insure the urgent need for current and anticipated demand in the near and long-term future in light of pessimistic and optimistic outlook for energy in the future. This means that states do a scientific and objective analysis of the currently available data for the springboard to future plans to secure the energy required to support economy and welfare insurance.

  13. ULSGEN (Uplink Summary Generator)

    Science.gov (United States)

    Wang, Y.-F.; Schrock, M.; Reeve, T.; Nguyen, K.; Smith, B.

    2014-01-01

    Uplink is an important part of spacecraft operations. Ensuring the accuracy of uplink content is essential to mission success. Before commands are radiated to the spacecraft, the command and sequence must be reviewed and verified by various teams. In most cases, this process requires collecting the command data, reviewing the data during a command conference meeting, and providing physical signatures by designated members of various teams to signify approval of the data. If commands or sequences are disapproved for some reason, the whole process must be restarted. Recording data and decision history is important for traceability reasons. Given that many steps and people are involved in this process, an easily accessible software tool for managing the process is vital to reducing human error which could result in uplinking incorrect data to the spacecraft. An uplink summary generator called ULSGEN was developed to assist this uplink content approval process. ULSGEN generates a web-based summary of uplink file content and provides an online review process. Spacecraft operations personnel view this summary as a final check before actual radiation of the uplink data. .

  14. Steam generator materials

    International Nuclear Information System (INIS)

    Kim, Joung Soo; Han, J. H.; Kim, H. P.; Lim, Y. S.; Lee, D. H.; Suh, J. H.; Hwang, S. S.; Hur, D. H.; Kim, D. J.; Kim, Y. H.

    2002-05-01

    In order to keep the nuclear power plant(NPP)s safe and increase their operating efficiency, axial stress corrosion cracking(SCC)(IGA/IGSCC, PWSCC, PbSCC) test techniques were developed and SCC property data of the archive steam generator tubing materials having been used in nuclear power plants operating in Korea were produced. The data obtained in this study were data-based, which will be used to clarify the damage mechanisms, to operate the plants safely, and to increase the lifetime of the tubing. In addition, the basic technologies for the improvement of the SCC property of the tubing materials, for new SCC inhibition, for damaged tube repair, and for manufacturing processes of the tubing were developed. In the 1 phase of this long term research, basic SCC test data obtained from the archive steam generator tubing materials used in NPPs operating in Korea were established. These basic technologies developed in the 1 phase will be used in developing process optimization during the 2 phase in order to develop application technologies to the field nuclear power plants

  15. Teaching Millennials and Generation Z: Bridging the Generational Divide.

    Science.gov (United States)

    Shatto, Bobbi; Erwin, Kelly

    2017-02-01

    Most undergraduate students today are part of the millennial generation. However, the next wave of students-Generation Z-are just beginning to enter universities. Although these groups share many similarities, they each have unique characteristics that create challenges in the classroom. Incorporating technology, engaging students with adaptive learning activities, and understanding basic generational differences are ways to limit the effects of generational conflict while keeping both millennials and Generation Z students engaged in learning. It is important to understand basic differences and distinctions across generations for developing pedagogy that reaches these unique student populations.

  16. Manual for the ELL (2) - parser generator and tree generator generator

    OpenAIRE

    Heckmann, Reinhold

    1986-01-01

    Regular right part grammars extended by tree generator specifications are interpreted by a combined parser generator and tree generator that produces an ELL(2) parser. This parser is able to translate programs of the specified language into abstract syntax trees according to the tree specifications in the generator input.

  17. Tri-generation nation

    International Nuclear Information System (INIS)

    Pichon, Max

    2010-01-01

    Full text: Sydney and Melbourne councils are looking to outperform each other with ambitious greenhouse and energy efficiency initiatives. Sydney wants to cut CO_2 by 70 per cent by 2030, while Melbourne's 1200 Buildings retrofit project speaks for itself. One key technology both councils are tapping is trigeneration, which generates electricity, heating and cooling from local gas-fired power units. From a physics perspective, a combustion process cannot be more than 30 per cent efficient, so capturing and using the waste heat can lead to great savings. Sydney Lord Mayor Clover Moore said a third of the council's carbon reduction goal of 3.9Mt a year by 2030 will come from tri-gen. Melbourne is aiming to achieve zero net emissions by 2020, which means eliminating 5.8Mt of CO_2, a lot of it through tri-gen. It has already seen a surge among landlords. GPT, Stockland and Mirvac have all stuck tri-gen units in Sydney office developments, while newly carbon- neutral NAB has installed the technology on its data centre in Melbourne and expects to save 20,000 tonnes of CO_2 a year. But one expert, while welcoming the spike in popularity, says there are traps for the unwary. Johnson Controls' Peter Moser sees two core drivers for its uptake. “First is the prominence of GreenStar and NABERS. Many companies will move to tri-gen as they will want the extra points or stars,” he told WME. “Secondly, there is the continuous increase in the price of energy. At the same time there may be an [emissions trading scheme] or a carbon price introduced, and that puts pressure on the consumer. Combining those two scenarios will see more people adopt tri-gen because it will become more economically viable and the payback periods of tri-gen will come down considerably.” But he points to the importance of pre-planning when considering tri-gen, warning. “To put tri-gen into a building, let alone retrofit a whole city and make it work, you need highly complex teams working together

  18. Wind Generators and Market Power

    DEFF Research Database (Denmark)

    Misir, Nihat

    price thresholds are significantly higher when the monopolist at the peakload level owns both types of generators. Furthermore, when producing electricity with the peakload generator, the monopolist can avoid facing prices below marginal cost by owning a certain share of the wind generators.......Electricity production from wind generators holds significant importance in European Union’s 20% renewable energy target by 2020. In this paper, I show that ownership of wind generators affects market outcomes by using both a Cournot oligopoly model and a real options model. In the Cournot...... oligopoly model, ownership of the wind generators by owners of fossil-fueled (peakload) generators decreases total peakload production and increases the market price. These effects increase with total wind generation and aggregate wind generator ownership. In the real options model, start up and shut down...

  19. Generative Moire Structures

    Directory of Open Access Journals (Sweden)

    Adrian – Mihail Marian

    2006-01-01

    Full Text Available “GRAPHIC ON COMPUTER” – the work of the Czech Petar Milojevic, published in Titus Mocanu’s book “THE MODERN ART’S MORPHOLOGY”, in 1973, had great influence on me. I tried to discover the algorithm that generated this work. It was not so difficult to do and in a short time I was able to draw 12 such structures. In time, with interruptions, I have returned to this kind of works. In my personal exhibition “CYBERNETIC DESIGN” that took place at “M4-1-13-etopa” gallery of Pitesti, in March 1981, I have presented 8 such structures. To my joy, they had an impact on art lovers.

  20. Touchable Online Braille Generator

    Directory of Open Access Journals (Sweden)

    Wooseob Jeong

    2008-03-01

    Full Text Available A prototype of a touchable online Braille generator has been developed for the visually impaired or blind using force feedback technology, which has been used in video games for years. Without expensive devices, this prototype allows blind people to access information on the Web by touching output Braille displays with a force feedback mouse. The data collected from user studies conducted with blind participants has provided valuable information about the optimal conditions for the use of the prototype. The end product of this research will enable visually impaired people to enjoy information on the Web more freely.

  1. Second harmonic generation microscopy

    DEFF Research Database (Denmark)

    Brüggemann, Dagmar Adeline; Brewer, Jonathan R.; Risbo, Jens

    2010-01-01

    Myofibers and collagen show non-linear optical properties enabling imaging using second harmonic generation (SHG) microscopy. The technique is evaluated for use as a tool for real-time studies of thermally induced changes in thin samples of unfixed and unstained pork. The forward and the backward...... scattered SHG light reveal complementary features of the structures of myofibers and collagen fibers. Upon heating the myofibers show no structural changes before reaching a temperature of 53 °C. At this temperature the SHG signal becomes extinct. The extinction of the SHG at 53 °C coincides with a low......-temperature endotherm peak observable in the differential scanning calorimetry (DSC) thermograms. DSC analysis of epimysium, the connective tissue layer that enfold skeletal muscles, produces one large endotherm starting at 57 °C and peaking at 59.5 °C. SHG microscopy of collagen fibers reveals a variability of thermal...

  2. Generator for ionising radiation

    International Nuclear Information System (INIS)

    Romanovsky, V.F.; Panasjuk, V.S.; Stepanov, B.M.; Ovcharov, A.M.; Akimov, J.A.

    1979-01-01

    The generator for ionising radiation wherein a transmitter for ionising radiation contains a resonance transformer wherein the field coil is composed of a low voltage outside portion and a transformer coil, electrically connected with an electrically conducting housing of the resonance transformer, and an acclerating tube wherein the high voltage electrode is coupled with the high voltage end of the transformer coil of the resonance transformer and fixed to one of the ends of the tubular insulator of the accelerator tube, wherein the low voltage electrode is electrically connected with the housing of the resonance transformer and a source of charged particles is introduced into the evacuated inner space of the acceleration tube and electrically connected with one of the electrodes thereof, is described. (G.C.)

  3. Mood Dependent Music Generator

    DEFF Research Database (Denmark)

    Scirea, Marco

    2013-01-01

    Music is one of the most expressive media to show and manipulate emotions, but there have been few studies on how to generate music connected to emotions. Such studies have always been shunned upon by musicians affirming that a machine cannot create expressive music, as it's the composer......'s and player's experiences and emotions that get poured into the piece. At the same time another problem is that music is highly complicated (and subjective) and finding out which elements transmit certain emotions is not an easy task. This demo wants to show how the manipulation of a set of features can...... actually change the mood the music transmits, hopefully awakening an interest in this area of research....

  4. Light Beam Generation

    DEFF Research Database (Denmark)

    2007-01-01

    The invention relates to a method and a system for synthesizing a set of controllable light beams by provision of a system for synthesizing a set of light beams, comprising a spatially modulated light source for generation of electromagnetic radiation with a set of replicas of a predetermined......(x-xs, y-ys), a Fourier transforming lens for Fourier transforming the electromagnetic radiation, a first spatial light modulator for phase shifting the Fourier transformed electromagnetic radiation with the phase -F(u, v) of S*, S* is the complex conjugate of the Fourier transformed symbol s, a Fourier...... transforming lens for Inverse Fourier transforming the spatially modulated radiation, whereby a set of light beams are formed propagating through the inverse Fourier plane (x', y') at desired positions (x's, y's), and a controller for controlling the position of a replica of the symbol, s, for movement...

  5. Generation in Europe

    International Nuclear Information System (INIS)

    Aveline, Michelle; Mason, Laura.

    1994-01-01

    Information for this document has been collected from a range of primary sources which include annual reports, strategy statements and company information leaflets. The first part consists of profiles for each of the countries of Western Europe and selected countries in Eastern Europe. In each case an overview of the organization of the electricity industry is given and information where available on interconnections, new projects, ongoing work at existing plant, environmental issues and details of plant and closures. In the second part, details are given of some of the largest power generating companies in Europe listed in alphabetical order. The most up-to-date figures available have been used in all cases and the companies have been invited to comment on the text. (UK)

  6. Generation of electrical power

    International Nuclear Information System (INIS)

    Hursen, T.F.; Kolenik, S.A.; Purdy, D.L.

    1976-01-01

    A heat-to-electricity converter is disclosed which includes a radioactive heat source and a thermoelectric element of relatively short overall length capable of delivering a low voltage of the order of a few tenths of a volt. Such a thermoelectric element operates at a higher efficiency than longer higher-voltage elements; for example, elements producing 6 volts. In the generation of required power, the thermoelectric element drives a solid-state converter which is controlled by input current rather than input voltage and operates efficiently for a high signal-plus-noise to signal ratio of current. The solid-state converter has the voltage gain necessary to deliver the required voltage at the low input of the thermoelectric element

  7. Generator for radiological diagnostics

    Energy Technology Data Exchange (ETDEWEB)

    Seissl, J; Broenner, K; Krause, H

    1978-10-02

    A generator is described for X-ray diagnostics, with a high-voltage transformer with a primary coil connected or with the grid and a secondary coil feeding the X-ray tube and with a rectifier bridge situated in the primary circuit of the high-voltage transformer. The direct current branch of the rectifier bridge contains a filter capacitor and a thyristor which is opened and closed by means of a pulse duty factor determining the capacitor voltage and thus the voltage of the X-ray tube. An LC-tuned circuit is connected to the thyristor whose capacity is discharged to the conductive thyristor so that the thyristor is quenched via a free-wheel diode arranged in parallel to the thyristor. In this way, a high switching frequency of the thyristor and, consequently, a low ripple of the X-ray tube voltage is obtained.

  8. Peak power ratio generator

    Science.gov (United States)

    Moyer, R.D.

    A peak power ratio generator is described for measuring, in combination with a conventional power meter, the peak power level of extremely narrow pulses in the gigahertz radio frequency bands. The present invention in a preferred embodiment utilizes a tunnel diode and a back diode combination in a detector circuit as the only high speed elements. The high speed tunnel diode provides a bistable signal and serves as a memory device of the input pulses for the remaining, slower components. A hybrid digital and analog loop maintains the peak power level of a reference channel at a known amount. Thus, by measuring the average power levels of the reference signal and the source signal, the peak power level of the source signal can be determined.

  9. X-ray generator

    Energy Technology Data Exchange (ETDEWEB)

    Zucarias, A; Shepherd, J W

    1982-09-08

    An X-ray tube has a tubular envelope with a cathode for directing an electron beam onto a focal spot area of a spaced anode target to generate X-rays. The target is mounted for axial rotation on one end of a rotor disposed in an end portion of the envelope and encircled by a stator of an alternating current induction motor. An annular shield of high permeability magnetic material extends transversely between the electron beam and the stator of the induction motor for shunting stray or fringe electromagnetic fields established by the stator away from the electron beam to avoid consequent lateral deflections of the electron and corresponding lateral movements of the focal spot area.

  10. Superconducting wind turbine generators

    DEFF Research Database (Denmark)

    Abrahamsen, Asger Bech; Mijatovic, Nenad; Seiler, Eugen

    2010-01-01

    , the main challenge of the superconducting direct drive technology is to prove that the reliability is superior to the alternative drive trains based on gearboxes or permanent magnets. A strategy of successive testing of superconducting direct drive trains in real wind turbines of 10 kW, 100 kW, 1 MW and 10......We have examined the potential of 10 MW superconducting direct drive generators to enter the European offshore wind power market and estimated that the production of about 1200 superconducting turbines until 2030 would correspond to 10% of the EU offshore market. The expected properties of future...... offshore turbines of 8 and 10 MW have been determined from an up-scaling of an existing 5 MW turbine and the necessary properties of the superconducting drive train are discussed. We have found that the absence of the gear box is the main benefit and the reduced weight and size is secondary. However...

  11. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1982-04-01

    The performance of steam generator tubes in water-cooled nuclear power reactors has been reviewed for 1980. Tube defects occurred at 38% of the 97 reactors surveyed. This is a marginal improvement over 1979 when defects occurred at 41% of the reactors. The number of failed tubes was also lower, 0.14% of the tubes in service in 1980 compared with 0.20% of those in service in 1979. Analysis of the causes of these failures indicates that stress corrosion cracking was the leading failure mechanism. Reactors that used all-volatile treatment of secondary water, with or without full-flow condensate demineralization since start-up showed the lowest incidence of corrosion-related defects

  12. Reloadable radioactive generator system

    International Nuclear Information System (INIS)

    Colombetti, L.G.

    1977-01-01

    A generator system that can be reloaded with an elutable radioactive material, such as 99 molybdenum, a multiple number of times is described. The system basically comprises a column filled with alumina, a loading vial containing a predetermined amount of the elutable radioactive material, and a rinsing vial containing a sterile solution. The two vials are connected by a conduit so that when communication is achieved between the column and loading vial and an evacuated vial is placed in communication with the bottom of the column, the predetermined amount of the radioactive material in the loading vial will be transferred to the column. The procedure can be repeated as the elutable material in the column is dissipated

  13. Steam generator tube performance

    International Nuclear Information System (INIS)

    Tatone, O.S.; Pathania, R.S.

    1983-08-01

    A review of the performance of steam generator tubes in 110 water-cooled nuclear power reactors showed that tubes were plugged at 46 (42 percent) of the reactors. The number of tubes removed from service increased from 1900 (0.14 percent) in 1980 to 4692 (0.30 percent) in 1981. The leading causes of tube failures were stress corrosion cracking from the primary side, stress corrosion cracking (or intergranular attack) from the secondary side and pitting corrosion. The lowest incidence of corrosion-induced defects from the secondary side occurred in reactors that used all-volatile treatment since start-up. At one reactor a large number of degraded tubes were repaired by sleeving which is expected to become an important method of tube repair in the future

  14. Turbulence generation by waves

    Energy Technology Data Exchange (ETDEWEB)

    Kaftori, D.; Nan, X.S.; Banerjee, S. [Univ. of California, Santa Barbara, CA (United States)

    1995-12-31

    The interaction between two-dimensional mechanically generated waves, and a turbulent stream was investigated experimentally in a horizontal channel, using a 3-D LDA synchronized with a surface position measuring device and a micro-bubble tracers flow visualization with high speed video. Results show that although the wave induced orbital motion reached all the way to the wall, the characteristics of the turbulence wall structures and the turbulence intensity close to the wall were not altered. Nor was the streaky nature of the wall layer. On the other hand, the mean velocity profile became more uniform and the mean friction velocity was increased. Close to the free surface, the turbulence intensity was substantially increased as well. Even in predominantly laminar flows, the introduction of 2-D waves causes three dimensional turbulence. The turbulence enhancement is found to be proportional to the wave strength.

  15. Photovoltaic Solar Energy Generation

    CERN Document Server

    Lotsch, H.K.V; U.Hoffmann, Volker; Rhodes, William T; Asakura, Toshimitsu; Brenner, Karl-Heinz; Hänsch, Theodor W; Kamiya, Takeshi; Krausz, Ferenc; Monemar, Bo; Venghaus, Herbert; Weber, Horst; Weinfurter, Harald

    2005-01-01

    This comprehensive description and discussion of photovoltaics (PV) is presented at a level that makes it accessible to the interested academic. Starting with an historical overview, the text outlines the relevance of photovoltaics today and in the future. Then follows an introduction to the physical background of solar cells and the most important materials and technologies, with particular emphasis placed on future developments and prospects. The book goes beyond technology by also describing the path from the cell to the module to the system, proceeding to important applications, such as grid-connected and stand-alone systems. The composition and development of the markets and the role of PV in future energy systems are also considered. Finally, the discussion turns to the future structure of energy supplies, expected to comprise more distributed generation, and addresses synergies and competition from other carbon-free energy sources.

  16. Steam generators in PWR's

    International Nuclear Information System (INIS)

    Michel, R.

    1974-01-01

    The steam generator of the PWR operates according to the principle of natural circulation. It consists of a U-shaped tube bundle whose free ends are welded to a bottom plate. The tube bundle is surrounded by a cylinder jacket which has slots closely above the bottom or tube plate. The feed water mixed with boiling water enters the tube bundle through these slots. Because of its buoyancy, the steam-water mixture flows upwards. Below the tube plate there are chambers for distributing and collecting pressurized water separated by means of a partition wall. By omitting some tubes, a free alloy is created so that the tubes in the center get sufficient water, too. By asymmetrical arrangement of the partition wall it is further possible to limit the tube alloy only to the inlet side for pressurized water. The flow over the tube plate is thus improved on the inlet side. (DG) [de

  17. Next generation breeding.

    Science.gov (United States)

    Barabaschi, Delfina; Tondelli, Alessandro; Desiderio, Francesca; Volante, Andrea; Vaccino, Patrizia; Valè, Giampiero; Cattivelli, Luigi

    2016-01-01

    The genomic revolution of the past decade has greatly improved our understanding of the genetic make-up of living organisms. The sequencing of crop genomes has completely changed our vision and interpretation of genome organization and evolution. Re-sequencing allows the identification of an unlimited number of markers as well as the analysis of germplasm allelic diversity based on allele mining approaches. High throughput marker technologies coupled with advanced phenotyping platforms provide new opportunities for discovering marker-trait associations which can sustain genomic-assisted breeding. The availability of genome sequencing information is enabling genome editing (site-specific mutagenesis), to obtain gene sequences desired by breeders. This review illustrates how next generation sequencing-derived information can be used to tailor genomic tools for different breeders' needs to revolutionize crop improvement. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  18. Generation of radioisotopes

    International Nuclear Information System (INIS)

    Panek-Finda, H.

    1984-01-01

    A method of producing radioisotopes for radiopharmaceutical applications is claimed. A physiological solution is used to elute a radioactive daughter isotope from a fission-produced parent isotope adsorbed on an adsorbent. The eluate containing the daughter isotope is purified with a cation-exchange material. In separate claims: the parent isotope is molybdenum-99; aluminium oxide which contains fully or partly hydrated manganese dioxide is used as the adsorbent for the parent isotope; a resin is used as the cation-exchange material; a strongly acid cation-exchange resin which has been neutralized is used as a resin; and a strongly acid cation-exchange resin which has been converted into the Na + , K + or NH 4 + form is used as a resin; an isotope generator system is also claimed

  19. Superconducting Wind Turbine Generators

    Directory of Open Access Journals (Sweden)

    Yunying Pan

    2016-08-01

    Full Text Available Wind energy is well known as a renewable energy because its clean and less polluted characteristic, which is the foundation of development modern wind electricity. To find more efficient wind turbine is the focus of scientists around the world. Compared from conventional wind turbines, superconducting wind turbine generators have advantages at zero resistance, smaller size and lighter weight. Superconducting wind turbine will inevitably become the main trends in this area. This paper intends to introduce the basic concept and principle of superconductivity, and compare form traditional wind turbine to obtain superiority, then to summary three proposed machine concept.While superconductivity have difficulty  in modern technology and we also have proposed some challenges in achieving superconducting wind turbine finally.

  20. A Clustering Graph Generator

    Energy Technology Data Exchange (ETDEWEB)

    Winlaw, Manda [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); De Sterck, Hans [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sanders, Geoffrey [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-10-26

    In very simple terms a network can be de ned as a collection of points joined together by lines. Thus, networks can be used to represent connections between entities in a wide variety of elds including engi- neering, science, medicine, and sociology. Many large real-world networks share a surprising number of properties, leading to a strong interest in model development research and techniques for building synthetic networks have been developed, that capture these similarities and replicate real-world graphs. Modeling these real-world networks serves two purposes. First, building models that mimic the patterns and prop- erties of real networks helps to understand the implications of these patterns and helps determine which patterns are important. If we develop a generative process to synthesize real networks we can also examine which growth processes are plausible and which are not. Secondly, high-quality, large-scale network data is often not available, because of economic, legal, technological, or other obstacles [7]. Thus, there are many instances where the systems of interest cannot be represented by a single exemplar network. As one example, consider the eld of cybersecurity, where systems require testing across diverse threat scenarios and validation across diverse network structures. In these cases, where there is no single exemplar network, the systems must instead be modeled as a collection of networks in which the variation among them may be just as important as their common features. By developing processes to build synthetic models, so-called graph generators, we can build synthetic networks that capture both the essential features of a system and realistic variability. Then we can use such synthetic graphs to perform tasks such as simulations, analysis, and decision making. We can also use synthetic graphs to performance test graph analysis algorithms, including clustering algorithms and anomaly detection algorithms.

  1. A large capacity turbine generator for nuclear power generation

    International Nuclear Information System (INIS)

    Maeda, Susumu; Miki, Takahiro; Suzuki, Kazuichi

    2000-01-01

    In future large capacity nuclear power plant, capacity of a generator to be applied will be 1800 MVA of the largest class in the world. In response to this, the Mitsubishi Electric Co., Ltd. began to carry out element technology verification of a four-pole large capacity turbine generator mainly using upgrading technique of large capacity, since 1994 fiscal year. And, aiming at reliability verification of the 1800 MVA class generator, a model generator with same cross-section as that of an actual one was manufactured, to carry out some verifications on its electrified tests, and so on. Every performance evaluation result of tests on the model generator were good, and high reliability to design and manufacturing technique of the 1800 MVA class generator could be verified. In future, on the base of these technologies, further upgrading of reliability on the large capacity turbine generator for nuclear power generation is intended to be carried out. (G.K.)

  2. Steam-Generator Integrity Program/Steam-Generator Group Project

    International Nuclear Information System (INIS)

    1982-10-01

    The Steam Generator Integrity Program (SGIP) is a comprehensive effort addressing issues of nondestructive test (NDT) reliability, inservice inspection (ISI) requirements, and tube plugging criteria for PWR steam generators. In addition, the program has interactive research tasks relating primary side decontamination, secondary side cleaning, and proposed repair techniques to nondestructive inspectability and primary system integrity. The program has acquired a service degraded PWR steam generator for research purposes. This past year a research facility, the Steam Generator Examination Facility (SGEF), specifically designed for nondestructive and destructive examination tasks of the SGIP was completed. The Surry generator previously transported to the Hanford Reservation was then inserted into the SGEF. Nondestructive characterization of the generator from both primary and secondary sides has been initiated. Decontamination of the channelhead cold leg side was conducted. Radioactive field maps were established in the steam generator, at the generator surface and in the SGEF

  3. Cheaper power generation from surplus steam generating capacities

    International Nuclear Information System (INIS)

    Gupta, K.

    1996-01-01

    Prior to independence most industries had their own captive power generation. Steam was generated in own medium/low pressure boilers and passed through extraction condensing turbines for power generation. Extraction steam was used for process. With cheaper power made available in Nehru era by undertaking large hydro power schemes, captive power generation in industries was almost abandoned except in sugar and large paper factories, which were high consumers of steam. (author)

  4. A viable technology to generate third-generation biofuel

    DEFF Research Database (Denmark)

    Singh, Anoop; Olsen, Stig Irving; Nigam, Poonam Singh

    2011-01-01

    First generation biofuels are commercialized at large as the production technologies are well developed. However, to grow the raw materials, there is a great need to compromise with food security, which made first generation biofuels not so much promising. The second generation of biofuels does...

  5. Comparing Generative and Inter-generative Subjectivity in Post-Revolutionary Academic Generations in Iran

    Directory of Open Access Journals (Sweden)

    mehran Sohrabzadeh

    2010-01-01

    Full Text Available Comparative study of different post-revolutionary generation has been broadly applied by social scientists; among them some believe there is a gulf between generations, while some others endorsing some small differences among generations, emphasis that this variety is natural. Avoiding being loyal to any of these two views, the present study attempts to compare three different post-revolutionary academic generations using theory of “generative objects” which explores generations’ view about their behaviors, Beliefs, and historical monuments. Sampling was carried among 3 generations; firstly ones who were student in 60s and now are experienced faculties in the university, secondly ones who are recently employed as faculty members, and finally who are now students in universities. Results show that in all 3 generations there are essential in-generation similarities, while comparatively there are some differentiations in inter-generative analysis.

  6. Catalysis for alternative energy generation

    CERN Document Server

    2012-01-01

    Summarizes recent problems in using catalysts in alternative energy generation and proposes novel solutions  Reconsiders the role of catalysis in alternative energy generation  Contributors include catalysis and alternative energy experts from across the globe

  7. Canonical transformations and generating functionals

    NARCIS (Netherlands)

    Broer, L.J.F.; Kobussen, J.A.

    1972-01-01

    It is shown that canonical transformations for field variables in hamiltonian partial differential equations can be obtained from generating functionals in the same way as classical canonical transformations from generating functions. A simple proof of the relation between infinitesimal invariant

  8. Generators of Modern Wind Turbines

    DEFF Research Database (Denmark)

    Chen, Zhe

    2008-01-01

    In this paper, various types of wind generator configurations, including power electronic grid interfaces, drive trains, are described The performance in power systems is briefed. Then the optimization of generator system is presented. Some investigation results are presented and discussed....

  9. Steam generator sludge removal apparatus

    International Nuclear Information System (INIS)

    Schafer, B.W.; Werner, C.E.; Klahn, F.C.

    1992-01-01

    The present invention relates to equipment for cleaning steam generators and in particular to a high pressure fluid lance for cleaning sludge off the steam generator tubes away from an open tube lane. 6 figs

  10. Navy Advertising: Targeting Generation Z

    Science.gov (United States)

    2015-12-01

    NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA MBA PROFESSIONAL REPORT NAVY ADVERTISING : TARGETING GENERATION Z December......study recommends improvements for Navy advertising efficiency by examining characteristics of recruits defined as Generation Z. Data gathered from five

  11. Power generation and the environment

    International Nuclear Information System (INIS)

    Robert, L.E.J.; Liss, P.S.; Saunders, P.A.H.

    1990-01-01

    This book reviews environmental aspects of large-scale power generation. It includes historic background of present-generation patterns and a discussion of fossil fuel, nuclear energy, and renewable technologies

  12. Steam generators - problems and prognosis

    International Nuclear Information System (INIS)

    Tapping, R.L.

    1997-05-01

    Steam-generator problems, largely a consequence of corrosion and fouling, have resulted in increased inspection requirements and more regulatory attention to steam-generator integrity. In addition, utilities have had to develop steam-generator life-management strategies, including cleaning and replacement, to achieve design life. This paper summarizes the pertinent data to 1993/1994, and presents an overview of current steam-generator management practices. (author)

  13. Digital random-number generator

    Science.gov (United States)

    Brocker, D. H.

    1973-01-01

    For binary digit array of N bits, use N noise sources to feed N nonlinear operators; each flip-flop in digit array is set by nonlinear operator to reflect whether amplitude of generator which feeds it is above or below mean value of generated noise. Fixed-point uniform distribution random number generation method can also be used to generate random numbers with other than uniform distribution.

  14. Electromechanical x-ray generator

    Science.gov (United States)

    Watson, Scott A; Platts, David; Sorensen, Eric B

    2016-05-03

    An electro-mechanical x-ray generator configured to obtain high-energy operation with favorable energy-weight scaling. The electro-mechanical x-ray generator may include a pair of capacitor plates. The capacitor plates may be charged to a predefined voltage and may be separated to generate higher voltages on the order of hundreds of kV in the AK gap. The high voltage may be generated in a vacuum tube.

  15. Online branding to generation Z

    OpenAIRE

    Wirokarto, Dewi Alismah

    2013-01-01

    Mestrado em Marketing/ JEL Classification System: M31, I21, D71 Generation Z is the first generation growing up in a digitalized world, where Internet has become a primary need. Growing up with touch screens, smartphones and tablets impacts the development of this generation. They are born between mid 1990s and 2010. This research will attempt to demonstrate and support the assumption that Generation Z exhibits more Early adopters than the other adopter levels. Analyses...

  16. Self-assembling software generator

    Science.gov (United States)

    Bouchard, Ann M [Albuquerque, NM; Osbourn, Gordon C [Albuquerque, NM

    2011-11-25

    A technique to generate an executable task includes inspecting a task specification data structure to determine what software entities are to be generated to create the executable task, inspecting the task specification data structure to determine how the software entities will be linked after generating the software entities, inspecting the task specification data structure to determine logic to be executed by the software entities, and generating the software entities to create the executable task.

  17. Tredje generations coaching

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    , vi dagligt skal forholde os til. Forfatterens forestilling om coaching tager udgangspunkt i en analyse af vort samfund – et samfund, der er kendetegnet af diversificering, identitetsudfordringer, ophævelse af vidensmonopolet, livslang uddannelse, nødvendighed til selvrefleksion mm. Bogen skal har...... dermed et særligt profil. Den skal markere (og skubbe til) en ny trend i coaching, som afgrænser sig fra pop coaching og GROW model o.l.. Coaching kan aldrig være ”the quick fix”. Vores tid tillader det bage ikke. Disse samfundsmæssige forandringer er grundlaget for coachingens eksistens og udbredelse......, men de skal også være fundament for den måde vi bedriver coaching. Derfor plæderer bogens forfatter for en 3. generations coaching i en form, hvor coachen og fokuspersonen mindre er fokuseret på løsninger, men i højere grad optaget af at skabe et rum til (selv)refleksion gennem en samskabende praksis....

  18. Inspiring a generation

    CERN Multimedia

    2012-01-01

    The motto of the 2012 Olympic and Paralympic Games is ‘Inspire a generation’ so it was particularly pleasing to see science, the LHC and Higgs bosons featuring so strongly in the opening ceremony of the Paralympics last week.   It’s a sign of just how far our field has come that such a high-profile event featured particle physics so strongly, and we can certainly add our support to that motto. If the legacy of London 2012 is a generation inspired by science as well as sport, then the games will have more than fulfilled their mission. Particle physics has truly inspiring stories to tell, going well beyond Higgs and the LHC, and the entire community has played its part in bringing the excitement of frontier research in particle physics to a wide audience. Nevertheless, we cannot rest on our laurels: maintaining the kind of enthusiasm for science we witnessed at the Paralympic opening ceremony will require constant vigilance, and creative thinking about ways to rea...

  19. Next Generation Science Partnerships

    Science.gov (United States)

    Magnusson, J.

    2016-02-01

    I will provide an overview of the Next Generation Science Standards (NGSS) and demonstrate how scientists and educators can use these standards to strengthen and enhance their collaborations. The NGSS are rich in content and practice and provide all students with an internationally-benchmarked science education. Using these state-led standards to guide outreach efforts can help develop and sustain effective and mutually beneficial teacher-researcher partnerships. Aligning outreach with the three dimensions of the standards can help make research relevant for target audiences by intentionally addressing the science practices, cross-cutting concepts, and disciplinary core ideas of the K-12 science curriculum that drives instruction and assessment. Collaborations between researchers and educators that are based on this science framework are more sustainable because they address the needs of both scientists and educators. Educators are better able to utilize science content that aligns with their curriculum. Scientists who learn about the NGSS can better understand the frameworks under which educators work, which can lead to more extensive and focused outreach with teachers as partners. Based on this model, the International Ocean Discovery Program (IODP) develops its education materials in conjunction with scientists and educators to produce accurate, standards-aligned activities and curriculum-based interactions with researchers. I will highlight examples of IODP's current, successful teacher-researcher collaborations that are intentionally aligned with the NGSS.

  20. Dynamical Mass Generation.

    Science.gov (United States)

    Mendel Horwitz, Roberto Ruben

    1982-03-01

    In the framework of the Glashow-Weinberg-Salem model without elementary scalar particles, we show that masses for fermions and intermediate vector bosons can be generated dynamically. The mechanism is the formation of fermion-antifermion pseudoscalar bound states of zero total four momentum, which form a condensate in the physical vacuum. The force responsible for the binding is the short distance part of the net Coulomb force due to photon and Z exchange. Fermions and bosons acquire masses through their interaction with this condensate. The neutrinos remain massless because their righthanded components have no interactions. Also the charge -1/3 quarks remain massless because the repulsive force from the Z exchange dominates over the Coulomb force. To correct this, we propose two possible modifications to the theory. One is to cut off the Z exchange at very small distances, so that all fermions except the neutrinos acquire masses, which are then, purely electromagnetic in origin. The other is to introduce an additional gauge boson that couples to all quarks with a pure vector coupling. To make this vector boson unobservable at usual energies, at least two new fermions must couple to it. The vector boson squared masses receive additive contributions from all the fermion squared masses. The photon remains massless and the masses of the Z and W('(+OR -)) bosons are shown to be related through the Weinberg angle in the conventional way. Assuming only three families of fermions, we obtain estimates for the top quark mass.

  1. Gearless wind power generator

    Energy Technology Data Exchange (ETDEWEB)

    Soederlund, L.; Ridanpaeae, P.; Vihriaelae, H.; Peraelae, R. [Tampere Univ. of Technology (Finland). Lab. of Electricity and Magnetism

    1998-10-01

    In the project a 100 kW axial flux permanent magnet wind power generator has been designed. The toroidal stator with air gap winding is placed between two rotating discs with permanent magnets. The magnet material is NdBFe due to its excellent magnetic properties compared to other materials. This type of topology enables a very large number of poles compared to conventional machine of the same size. A large number of poles is required to achieve a low rotational speed and consequently a direct driven system. The stator winding is formed by rectangular coils. The end winding is very short leading to small resistive losses. On the other hand, the absence of iron teeth causes eddy current losses in the conductors. These can be restricted to an acceptable level by keeping the wire diameter and flux density small. This means that the number of phases should be large. Several independent three phase systems may be used. The toothless stator also means that the iron losses are small and there exists no cogging torque

  2. Super power generators

    International Nuclear Information System (INIS)

    Martin, T.H.; Johnson, D.L.; McDaniel, D.H.

    1977-01-01

    PROTO II, a super power generator, is presently undergoing testing at Sandia Laboratories. It has operated with an 80 ns, 50 ns, 35 ns, and 20 ns positive output pulse high voltage mode and achieved total current rates of rise of 4 x 10 14 A/s. The two sided disk accelerator concept using two diodes has achieved voltages of 1.5 MV and currents of 4.5 MA providing a power exceeding 6 TW in the electron beam and 8 TW in the transmission lines. A new test bed named MITE (Magnetically Insulated Transmission Experiment) was designed and is now being tested. The pulse forming lines are back to back short pulse Blumleins which use untriggered water switching. Output data showing a ten ns half width power pulse peaking above one terrawatt were obtained. MITE is a module being investigated for use in the Electron Beam Fusion Accelerator and will be used to test the effects of short pulses propagating down vacuum transmission lines

  3. Gas turbine electric generator

    International Nuclear Information System (INIS)

    Nemoto, Masaaki; Yuhara, Tetsuo.

    1993-01-01

    When troubles are caused to a boundary of a gas turbine electric generator, there is a danger that water as an operation medium for secondary circuits leaks to primary circuits, to stop a plant and the plant itself can not resume. Then in the present invention, helium gases are used as the operation medium not only for the primary circuits but also for the secondary circuits, to provide so-called a direct cycle gas turbine system. Further, the operation media of the primary and secondary circuits are recycled by a compressor driven by a primary circuit gas turbine, and the turbine/compressor is supported by helium gas bearings. Then, problems of leakage of oil and water from the bearings or the secondary circuits can be solved, further, the cooling device in the secondary circuit is constituted as a triple-walled tube structure by way of helium gas, to prevent direct leakage of coolants into the reactor core even if cracks are formed to pipes. (N.H.)

  4. Generation III+ Reactor Portfolio

    International Nuclear Information System (INIS)

    2010-03-01

    While the power generation needs of utilities are unique and diverse, they are all faced with the double challenge of meeting growing electricity needs while curbing CO 2 emissions. To answer these diverse needs and help tackle this challenge, AREVA has developed several reactor models which are briefly described in this document: The EPR TM Reactor: designed on the basis of the Konvoi (Germany) and N4 (France) reactors, the EPRTM reactor is an evolutionary model designed to achieve best-in-class safety and operational performance levels. The ATMEA1 TM reactor: jointly designed by Mitsubishi Heavy Industries and AREVA through ATMEA, their common company. This reactor design benefits from the competencies and expertise of the two mother companies, which have commissioned close to 130 reactor units. The KERENA TM reactor: Designed on the basis of the most recent German BWR reactors (Gundremmingen) the KERENA TM reactor relies on proven technology while also including innovative, yet thoroughly tested, features. The optimal combination of active and passive safety systems for a boiling water reactor achieves a very low probability of severe accident

  5. Generating cancelable fingerprint templates.

    Science.gov (United States)

    Ratha, Nalini K; Chikkerur, Sharat; Connell, Jonathan H; Bolle, Ruud M

    2007-04-01

    Biometrics-based authentication systems offer obvious usability advantages over traditional password and token-based authentication schemes. However, biometrics raises several privacy concerns. A biometric is permanently associated with a user and cannot be changed. Hence, if a biometric identifier is compromised, it is lost forever and possibly for every application where the biometric is used. Moreover, if the same biometric is used in multiple applications, a user can potentially be tracked from one application to the next by cross-matching biometric databases. In this paper, we demonstrate several methods to generate multiple cancelable identifiers from fingerprint images to overcome these problems. In essence, a user can be given as many biometric identifiers as needed by issuing a new transformation "key." The identifiers can be cancelled and replaced when compromised. We empirically compare the performance of several algorithms such as Cartesian, polar, and surface folding transformations of the minutiae positions. It is demonstrated through multiple experiments that we can achieve revocability and prevent cross-matching of biometric databases. It is also shown that the transforms are noninvertible by demonstrating that it is computationally as hard to recover the original biometric identifier from a transformed version as by randomly guessing. Based on these empirical results and a theoretical analysis we conclude that feature-level cancelable biometric construction is practicable in large biometric deployments.

  6. Digitally programmable signal generator

    International Nuclear Information System (INIS)

    Priatko, G.J.; Kaskey, J.A.

    1988-01-01

    A digitally programmable signal generator (DPSG) includes a first memory from which data is written into a second memory formed of n banks. Each bank includes four memories and a multiplexer, the banks being read once during each time frame, the read-out bits being multiplexed and fed out serially in synchronism with a plurality of clock pulses occuring during a time frame. The resulting serial bit streams may be fed in parallel to a digital-to-analog converter. The DPSG can be used in applications such as Atomic Vapor Laser Isotope Separation (AVLIS) to create an optimal match between the process laser's spectral profile and that of the vaporized material, optical telecommunications, non-optical telecommunication in the microwave and radio spectrum, radar, electronic countermeasures, high speed computer interconnects, local area networks, high definition video transport and the multiplexing of large quantities of slow digital memory into high speed data streams. This invention extends the operation of DPSGs into the GHz range. (author)

  7. Geothermal Power Generation Plant

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, Tonya [Oregon Inst. of Technology, Klamath Falls, OR (United States). Geo-Heat Center

    2013-12-01

    Oregon Institute of Technology (OIT) drilled a deep geothermal well on campus (to 5,300 feet deep) which produced 196°F resource as part of the 2008 OIT Congressionally Directed Project. OIT will construct a geothermal power plant (estimated at 1.75 MWe gross output). The plant would provide 50 to 75 percent of the electricity demand on campus. Technical support for construction and operations will be provided by OIT’s Geo-Heat Center. The power plant will be housed adjacent to the existing heat exchange building on the south east corner of campus near the existing geothermal production wells used for heating campus. Cooling water will be supplied from the nearby cold water wells to a cooling tower or air cooling may be used, depending upon the type of plant selected. Using the flow obtained from the deep well, not only can energy be generated from the power plant, but the “waste” water will also be used to supplement space heating on campus. A pipeline will be construction from the well to the heat exchanger building, and then a discharge line will be construction around the east and north side of campus for anticipated use of the “waste” water by facilities in an adjacent sustainable energy park. An injection well will need to be drilled to handle the flow, as the campus existing injection wells are limited in capacity.

  8. Next-Generation Pathology.

    Science.gov (United States)

    Caie, Peter D; Harrison, David J

    2016-01-01

    The field of pathology is rapidly transforming from a semiquantitative and empirical science toward a big data discipline. Large data sets from across multiple omics fields may now be extracted from a patient's tissue sample. Tissue is, however, complex, heterogeneous, and prone to artifact. A reductionist view of tissue and disease progression, which does not take this complexity into account, may lead to single biomarkers failing in clinical trials. The integration of standardized multi-omics big data and the retention of valuable information on spatial heterogeneity are imperative to model complex disease mechanisms. Mathematical modeling through systems pathology approaches is the ideal medium to distill the significant information from these large, multi-parametric, and hierarchical data sets. Systems pathology may also predict the dynamical response of disease progression or response to therapy regimens from a static tissue sample. Next-generation pathology will incorporate big data with systems medicine in order to personalize clinical practice for both prognostic and predictive patient care.

  9. Cracked gas generator

    Energy Technology Data Exchange (ETDEWEB)

    Abthoff, J; Schuster, H D; Gabler, R

    1976-11-17

    A small cracked-gas generator in a vehicle driven, in particular, by an air combustion engine has been proposed for the economic production of the gases necessary for low toxicity combustion from diesel fuel. This proceeds via catalytic crack-gasification and exploitation of residual heat from exhaust gases. This patent application foresees the insertion of one of the catalysts supporting the cracked-gas reaction in a container through which the reacting mixture for cracked-gas production flows in longitudinal direction. Further, air ducts are embedded in the catalyst through which exhaust gases and fresh air flow in counter direction to the cracked gas flow in the catalyst. The air vents are connected through heat conduction to the catalyst. A cracked gas constituting H/sub 2//CO/CO/sub 2//CH/sub 4/ and H/sub 2/O can be produced from the air-fuel mixture using appropriate catalysts. By the addition of 5 to 25% of cracked gas to the volume of air drawn in by the combustion engine, a more favourable combustion can be achieved compared to that obtained under normal combustion conditions.

  10. Two quantitative character selection following neutron and EMS treatment in malt barley. An applied micromutation experiment

    Energy Technology Data Exchange (ETDEWEB)

    Haensel, H; Simon, W; Ehrendorfer, K [Hochschule fuer Bodenkultur, Vienna (Austria)

    1975-01-01

    Mutation experiments in spring barley are described aimed at increasing the grain yield and ''classification'' (i.e. weight percent of caryopsis greater than 2.5 mm). The course of selection up to the M/sub 8/-generation obtained by self-pollination is given. A comparison is presented with materials obtained after neutron and ethyl methanesulfonate treatment. The possibilities are also discussed of using the methods of micromutation breeding for barley crop yield and its malt quality improvement.

  11. Engineering Education for Generation Z

    Science.gov (United States)

    Moore, Kevin; Jones, Carol; Frazier, Robert Scott

    2017-01-01

    Generation Z is gaining popularity as the name used to refer to those born beginning in the mid to late 1990s. This is the generation that follows the Millennials, and they are just starting to arrive on college campuses. Much attention has been paid to Millennials and their impact on society, and because of this Generation Z members are often…

  12. A new generation in computing

    International Nuclear Information System (INIS)

    Kahn, R.E.

    1983-01-01

    Fifth generation of computers is described. The three disciplines involved in bringing such a new generation to reality are: microelectronics; artificial intelligence and, computer systems and architecture. Applications in industry, offices, aerospace, education, health care and retailing are outlined. An analysis is given of research efforts in the US, Japan, U.K., and Europe. Fifth generation programming languages are detailed

  13. Laboratory generation of gravitational waves

    International Nuclear Information System (INIS)

    Pinto, I.M.; Rotoli, G.

    1988-01-01

    The authors have performed calculations on the basic type of gravitational wave electromagnetic laboratory generators. Their results show that laboratory generations of gravitational wave is at limit of state-of-the-art of present-day giant electromagnetic field generation

  14. Next Generation Summer School

    Science.gov (United States)

    Eugenia, Marcu

    2013-04-01

    On 21.06.2010 the "Next Generation" Summer School has opened the doors for its first students. They were introduced in the astronomy world by astronomical observations, astronomy and radio-astronomy lectures, laboratory projects meant to initiate them into modern radio astronomy and radio communications. The didactic programme was structure as fallowing: 1) Astronomical elements from the visible spectrum (lectures + practical projects) 2) Radio astronomy elements (lectures + practical projects) 3) Radio communication base (didactic- recreative games) The students and professors accommodation was at the Agroturistic Pension "Popasul Iancului" situated at 800m from the Marisel Observatory. First day (summer solstice day) began with a practical activity: determination of the meridian by measurements of the shadow (the direction of one vertical alignment, when it has the smallest length). The experiment is very instructive and interesting because combines notions of physics, spatial geometry and basic astronomy elements. Next day the activities took place in four stages: the students processed the experimental data obtained on first day (on sheets of millimetre paper they represented the length of the shadow alignments according the time), each team realised its own sun quadrant, point were given considering the design and functionality of these quadrant, the four teams had to mimic important constellations on carton boards with phosphorescent sticky stars and the students, accompanied by the professors took a hiking trip to the surroundings, marking the interest point coordinates, using a GPS to establish the geographical coronations and at the end of the day the students realised a small map of central Marisel area based on the GPS data. On the third day, the students were introduced to basic notions of radio astronomy, the principal categories of artificial Earth satellites: low orbit satellites (LEO), Medium orbit satellites (MEO) and geostationary satellites (GEO

  15. [Generation continuity and integration].

    Science.gov (United States)

    Zakhvatkin, Iu A

    2008-01-01

    Transformation of the cyclic morphoprocesses in Protista toward the terminal-cyclic morphoprocesses in Metazoa had lead to integration of the fomer's life circles into the latter's ontogenesis and began to supply the newly emerging ecosystems with the regular income of mortomasses. According to the palintomic hypothesis of A.A. Zakhvatkin, it was the egg that became a means of the metazoan generation continuity, and not the half set of organells acquired by descendants of a divided maternal cell in Protozoa. Origin of Metazoa and of their ontogenesis was accomplished by hypetrophic distomy and subsequent palintomic division of the protist parental cell, these processes being comparable to the ovogenesis and ovocyte division in the Metazoa. Division process in the most primitive metazoans, Leptolida and Calcarea, retained certains features of its palintomic nature that are clear in the Ctenophora, the latter though specific being most similar in this respect to the spongs and not to the Coelenterata whith whom they were united in the same phylum formerly. The ovogenesis perfection controlled by the maternal organism and leading to an increment of the nuclear-plasmic tension due to enrichment of egg with the yolk, promoted the embrionization of development and formation of the egg morphogenetic environment providing for the earlier formation processes without participation of the parental recombined genotypes. With all this, far earlier appearence of symmetry elements of definitive forms is embriogenesis along the ascending trend from the lower Metazoa to the most advanced insects. The unordered correspondence of the polarity axis of egg and the oral-aboral axis of blastula-like larva (1) is replaced by protaxony (2) in which these axes coincide, all formation processes reaching their perfection in the homoquadrant spiral division of annelids, which became a means of ovoplasma segregation. Afterward, a herequadrant division and plagioxony are developed in the course

  16. NEXT GENERATION TURBINE PROGRAM

    Energy Technology Data Exchange (ETDEWEB)

    William H. Day

    2002-05-03

    The Next Generation Turbine (NGT) Program's technological development focused on a study of the feasibility of turbine systems greater than 30 MW that offer improvement over the 1999 state-of-the-art systems. This program targeted goals of 50 percent turndown ratios, 15 percent reduction in generation cost/kW hour, improved service life, reduced emissions, 400 starts/year with 10 minutes to full load, and multiple fuel usage. Improvement in reliability, availability, and maintainability (RAM), while reducing operations, maintenance, and capital costs by 15 percent, was pursued. This program builds on the extensive low emissions stationary gas turbine work being carried out by Pratt & Whitney (P&W) for P&W Power Systems (PWPS), which is a company under the auspices of the United Technologies Corporation (UTC). This study was part of the overall Department of Energy (DOE) NGT Program that extends out to the year 2008. A follow-on plan for further full-scale component hardware testing is conceptualized for years 2002 through 2008 to insure a smooth and efficient transition to the marketplace for advanced turbine design and cycle technology. This program teamed the National Energy Technology Laboratory (NETL), P&W, United Technologies Research Center (UTRC), kraftWork Systems Inc., a subcontractor on-site at UTRC, and Multiphase Power and Processing Technologies (MPPT), an off-site subcontractor. Under the auspices of the NGT Program, a series of analyses were performed to identify the NGT engine system's ability to serve multiple uses. The majority were in conjunction with a coal-fired plant, or used coal as the system fuel. Identified also was the ability of the NGT system to serve as the basis of an advanced performance cycle: the humid air turbine (HAT) cycle. The HAT cycle is also used with coal gasification in an integrated cycle HAT (IGHAT). The NGT systems identified were: (1) Feedwater heating retrofit to an existing coal-fired steam plant, which

  17. Next Generation Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Cheraghi, S. Hossein [Western New England Univ., Springfield, MA (United States); Madden, Frank [FloDesign Wind Turbine Corp., Waltham, MA (United States)

    2012-09-01

    The goal of this collaborative effort between Western New England University's College of Engineering and FloDesign Wind Turbine (FDWT) Corporation to wok on a novel areodynamic concept that could potentially lead to the next generation of wind turbines. Analytical studies and early scale model tests of FDWT's Mixer/Ejector Wind Turbine (MEWT) concept, which exploits jet-age advanced fluid dynamics, indicate that the concept has the potential to significantly reduce the cost of electricity over conventional Horizontal Axis Wind Turbines while reducing land usage. This project involved the design, fabrication, and wind tunnel testing of components of MEWT to provide the research and engineering data necessary to validate the design iterations and optimize system performance. Based on these tests, a scale model prototype called Briza was designed, fabricated, installed and tested on a portable tower to investigate and improve the design system in real world conditions. The results of these scale prototype efforts were very promising and have contributed significantly to FDWT's ongoing development of a product scale wind turbine for deployment in multiple locations around the U.S. This research was mutually beneficial to Western New England University, FDWT, and the DOE by utilizing over 30 student interns and a number of faculty in all efforts. It brought real-world wind turbine experience into the classroom to further enhance the Green Engineering Program at WNEU. It also provided on-the-job training to many students, improving their future employment opportunities, while also providing valuable information to further advance FDWT's mixer-ejector wind turbine technology, creating opportunities for future project innovation and job creation.

  18. Next generation information systems

    Energy Technology Data Exchange (ETDEWEB)

    Limback, Nathan P [Los Alamos National Laboratory; Medina, Melanie A [Los Alamos National Laboratory; Silva, Michelle E [Los Alamos National Laboratory

    2010-01-01

    The Information Systems Analysis and Development (ISAD) Team of the Safeguards Systems Group at Los Alamos National Laboratory (LANL) has been developing web based information and knowledge management systems for sixteen years. Our vision is to rapidly and cost effectively provide knowledge management solutions in the form of interactive information systems that help customers organize, archive, post and retrieve nonproliferation and safeguards knowledge and information vital to their success. The team has developed several comprehensive information systems that assist users in the betterment and growth of their organizations and programs. Through our information systems, users are able to streamline operations, increase productivity, and share and access information from diverse geographic locations. The ISAD team is also producing interactive visual models. Interactive visual models provide many benefits to customers beyond the scope of traditional full-scale modeling. We have the ability to simulate a vision that a customer may propose, without the time constraints of traditional engineering modeling tools. Our interactive visual models can be used to access specialized training areas, controlled areas, and highly radioactive areas, as well as review site-specific training for complex facilities, and asset management. Like the information systems that the ISAD team develops, these models can be shared and accessed from any location with access to the internet. The purpose of this paper is to elaborate on the capabilities of information systems and interactive visual models as well as consider the possibility of combining the two capabilities to provide the next generation of infonnation systems. The collection, processing, and integration of data in new ways can contribute to the security of the nation by providing indicators and information for timely action to decrease the traditional and new nuclear threats. Modeling and simulation tied to comprehensive

  19. The different generation of nuclear reactors from Generation-1 to Generation-4

    International Nuclear Information System (INIS)

    Cognet, G.

    2010-01-01

    In this work author deals with the history of the development of nuclear reactors from Generation-1 to Generation-4. The fuel cycle and radioactive waste management as well as major accidents are presented, too.

  20. Generation 4 and the Nea

    International Nuclear Information System (INIS)

    Dujardin, T.

    2002-01-01

    In the previous edition of NEA News, W. D. Magwood of the US Department of Energy (DOE) outlined the future of nuclear energy in the context of the new US national energy policy. He cited the Generation IV initiative as a mechanism to implement a longer-term aspect of this policy. Although initiated in the US, the Generation IV initiative has quickly become an international effort and today ten countries are participating in the Generation IV International Forum (GIF). This article briefly reviews the context of Generation IV and describes NEA involvement in the Generation IV process. (author)