WorldWideScience

Sample records for self-immolative tumor-targeted isotope

  1. Self-immolation and the exchange of self and others

    DEFF Research Database (Denmark)

    Sobisch, Jan-Ulrich

    2012-01-01

    On the recent self-immolations as a form of Tibetan protest, the Dalai Lama's statement on it, and its relation to some doctrinal aspects such as karma and the bodhisattvas' ability to exchange of Self and other.......On the recent self-immolations as a form of Tibetan protest, the Dalai Lama's statement on it, and its relation to some doctrinal aspects such as karma and the bodhisattvas' ability to exchange of Self and other....

  2. A model to explain suicide by self-immolation among Iranian women: A grounded theory study.

    Science.gov (United States)

    Khankeh, Hamid Reza; Hosseini, Seyed Ali; Rezaie, Leeba; Shakeri, Jalal; Schwebel, David C

    2015-11-01

    Self-immolation is a common method of suicide among Iranian women. There are several contributing motives for attempting self-immolation, and exploration of the process of self-immolation incidents will help interventionists and clinicians develop prevention programs. A grounded theory study using face-to-face, recorded interviews was conducted with surviving self-immolated patients (n=14), their close relatives (n=5), and medical staff (n=8) in Kermanshah, Iran. Data were analyzed using constant comparison in open, axial, and selective coding stages. A conceptual model was developed to explain the relationships among the main categories extracted through the grounded theory study. Family conflicts emerged as the core category. Cultural context of self-immolated patients offered a contextual condition. Other important categories linked to the core category were mental health problems, distinct characteristics of the suicidal method, and self-immolation as a threat. The role of mental health problems as a causal condition was detected in different levels of the self-immolation process. Finally, adverse consequences of self-immolation emerged as having important impact. The conceptual model, derived through grounded theory study, can guide design of prevention programs. The pivotal role of family conflicts should be emphasized in mental health interventions. The impact of adverse consequences of self-immolation on further suicidal processes necessitates post-suicide prevention programs. Further research to design specific interventions is recommended. Copyright © 2015 Elsevier Ltd and ISBI. All rights reserved.

  3. Differences in Demographic and Psychological Variables in Suicide by Self-immolation and Poisoning

    Directory of Open Access Journals (Sweden)

    Azadeh Memarian

    2013-09-01

    Full Text Available Background: Self-immolation and intentional poisoning are two common methods for suicidal attempts in developing countries. Few studies have compared the characteristics of people who commit suicide by self-immolation or intentional poisoning. Hence, the aim of this study was to compare demographic, social, and psychological features between these two groups.Methods: In the present study, patients hospitalized after suicide by self-immolation in Shaheed Motahari Hospital, Tehran, were compared to patients hospitalized due to intentional poisoning in Loghman Hakim Hospital, Tehran, in 2011. Demographic and psychological data were collected by interviews and questionnaires and analyzed by SPSS software (version 16.Results: Overall, 50 patients with poisoning and 21 patients with self-immolation were enrolled in this cross-sectional study. The mean age of the patients in the poisoning group was significantly lower than the self-immolation group (P=0.007. The number of married people in the self-immolation group was significantly higher than the poisoning group (P=0.014. Substance abuse was also significantly higher (P=0.048 and educational level was significantly lower (P=0.023 in the self-immolation group. However, the prevalence of anxiety disorders (P=0.001 and adjustment disorders (P=0.007 was significantly higher in the poisoning group than the self-immolation group.Conclusion: The findings of this study suggest the presence of differences between individuals who commit suicide by self-immolation or by poisoning in terms of demographic and psychological factors. Identification of these differences can be important in planning suicide prevention measures and education.

  4. Differences in Demographic and Psychological Variables in Suicide by Self-immolation and Poisoning

    Directory of Open Access Journals (Sweden)

    Kamran Aghakhani

    2013-11-01

    Full Text Available Background: Self-immolation and intentional poisoning are two common methods for suicidal attempts in developing countries. Few studies have compared the characteristics of people who commit suicide by self-immolation or intentional poisoning. Hence, the aim of this study was to compare demographic, social, and psychological features between these two groups. Methods: In the present study, patients hospitalized after suicide by self-immolation in Shaheed Motahari Hospital, Tehran, were compared to patients hospitalized due to intentional poisoning in Loghman Hakim Hospital, Tehran, in 2011. Demographic and psychological data were collected by interviews and questionnaires and analyzed by SPSS software (version 16. Results: Overall, 50 patients with poisoning and 21 patients with self-immolation were enrolled in this cross-sectional study. The mean age of the patients in the poisoning group was significantly lower than the self-immolation group (P=0.007. The number of married people in the self-immolation group was significantly higher than the poisoning group (P=0.014. Substance abuse was also significantly higher (P=0.048 and educational level was significantly lower (P=0.023 in the self-immolation group. However, the prevalence of anxiety disorders (P=0.001 and adjustment disorders (P=0.007 was significantly higher in the poisoning group than the self-immolation group. Conclusion: The findings of this study suggest the presence of differences between individuals who commit suicide by self-immolation or by poisoning in terms of demographic and psychological factors. Identification of these differences can be important in planning suicide prevention measures and education.

  5. The survival rate of self-immolators in Kermanshah Province 2010- 2011

    Directory of Open Access Journals (Sweden)

    Farid Najafi

    2013-12-01

    Full Text Available Background: Self-immolation is one of the most violent methods of suicide, which is spreading in Iran. The highest rate of deaths due to committing suicide and self-immolation in Iran is observed in Kermanshah province. This research was conducted to study the survival rate and the factors that influence survival among the ones who commit self-immolation in Kermanshah province. Methods: In this study, all the cases who did not survive, as well as all the ones who were hospitalized due to self-immolation in Kermanshah province during 2010 and 2011 were examined. The Kaplan-Meier method was used to estimate the survival function, and in order to do the comparisons, Logrank test and Cox Regression were employed using Stata 12 software. Results: The results indicated that during 2010 and 2011, 343 individuals committed self-immolation in Kermanshah Province, while, 288 (84% were women. Also, it was found that 184 (53% did not survive, the mean and median of survival time in those who committed suicide deliberately, were 33±2.6 and 11±2 days respectively. Estimation of survival rate using Logrank test indicated that survival rate had a significant relationship with age, mental disorders, drug addiction, and TBSA (Total Body Surface Area, while it did not suggest a statistically significant relationship with gender, marital status and cause of injury. After multivariate analysis using Cox regression, only two variables of age and TBSA could remain in the model and the other variables were excluded from the model. Conclusion: The death toll due to self-immolation is very high and the mean and median of survival time among the people who committed self-immolation is very low. Therefore, it is recommended that remedial action be performed quickly without wasting time.

  6. Self-Immolation in Kermanshah City, Iran; a Serious Suicide Intention?

    Directory of Open Access Journals (Sweden)

    Shakeri J. MD,

    2016-09-01

    Full Text Available Abstract Aims: The reason of selecting self-immolation as a mean to commit suicide is unclear. This study was designed to compare 2 groups of people with and without intention to suicide that had self-immolated. Instrument & Methods: All 227 self-immolated patients who had been admitted to the burn unit of Imam Khomeini Hospital of Kermanshah City, Iran, during 2003 to 2004 participated in this cross-sectional study. All the samples and their families were interviewed and a psychiatrist completed DSM-IV symptom checklist. Data were analyzed by SPSS 11 using descriptive statistic methods, two-sample T and Chi-square tests. Findings: 126 of the patients (55.5% had suicidal intent and 97 (42.7% reported prior suicidal plan. The mortality rate of the suicidal intent patients was 61.1% and non-suicidal intent patients was 36.6%. Personality disorder was the only psychiatric problem that was significantly different between two groups of patients with and without intent of suicide. Conclusion: Self-immolation cannot be considered as a suicidal attempt in Kermanshah City, Iran.

  7. The trend of indexed papers in PubMed covering different aspects of self-immolation.

    Science.gov (United States)

    Rezaeian, Mohsen

    2014-01-01

    Self-immolation is a fatal and devastating method of committing suicide used around the world. The chief aim of the present article is to look at the trend of indexed papers in PubMed covering different aspects of self-immolation. PubMed search engine (http://www.ncbi.nlm.nih.gov) was searched by using six keywords i.e. "self-immolation", "self-inflicted burn", "self-burning", "self-incineration", "suicidal burns" and "suicide by burning". These keywords should appear either in the title or the abstract of the articles. The time frame was set as to retrieve papers expanding from early indexing time up to end of the year 2011. Based on the search strategy 132 papers were retrieved from these total numbers; 12 (9%) were categorized as review papers; 24 (18%) as case reports and the rest 96 (73%) were original studies. It seems that the number of papers increased during the years of investigations and the highest indexed papers i.e. 14 (10.6%) belonged to the year 2011. While most journals, published only one article the highest indexed papers i.e. 35 (26.5%) belonged to Burns. There was an increasing trend in the number of self-immolation articles indexed in PubMed since 1965. Three journals i.e. Burns, Journal of Burn Care and Rehabilitation and Journal of Forensic Sciences hosted for more than 37% of all those indexed articles. However, given the increasing trend of self-immolation still more studies are needed to shed light on the diverse aspects of this appalling human behavior.

  8. What factors play a role in preventing self-immolation?Results from a case-control study in Iran

    Directory of Open Access Journals (Sweden)

    Hosein Karim

    2015-07-01

    Full Text Available Abstract: Background: To investigate factors related to prevention of self-immolation in west of Iran. Methods: In a case-control study, 30 consecutive cases of deliberate self-inflicted burns admitted to the regional burn center (Imam Khomeini hospital in Kermanshah province, Iran were compared with controls selected from the community and matched by sex, age,district-county of residence, and rural vs urban living environment. The following characteristics relevant to preventing self immolation were collected from all cases and controls: main domestic fuel used in the household, awareness about complications of burn injuries, and use of counseling services. Results: Descriptive analyses revealed that kerosene was the main domestic fuel in the household for 83% of cases. Not surprisingly, the main means of self-immolation in 93% of the patients was kerosene, with other fuels such as petrol and domestic gas used in remaining cases. The majority of cases and controls were aware of the potential complications of burn injuries. Use of counseling services was more common in controls. Conclusions: All three aspects of preventing self-immolation – having kerosene and other fuels in the home, being aware of the complications of burn injuries, and using counseling services were present in both the cases and controls. This suggests a large portion of residents in rural Iran are potential self-immolation victims. Increasing preventive strategies may reduce risk of suicide by self-immolation.

  9. Living with burn scars caused by self-immolation among women in Iraqi Kurdistan: A qualitative study.

    Science.gov (United States)

    Mirlashari, Jila; Nasrabadi, Alireza Nikbakht; Amin, Pakestan Mohammad

    2017-03-01

    Patients with burns have to live with a variety of long-term physical and psychosocial consequences. Burns lead to prolonged hospital stay, disfiguring scars, disability, and even death. Since self-immolation is common in women of Iraqi Kurdistan, the present study sought to explore the experiences of women living with scars caused by self-immolation. This paper was part of a qualitative research study. A purposive sample of 18 female self-immolation survivors from Iraqi Kurdistan was selected, and 21 individual interviews were conducted and analyzed using conventional content analysis. Four categories emerged during the data analysis: (1) feelings of disbelief, regret, and anger caused by post-burn scars; (2) desperately seeking solutions; (3) grief due to disappointment and surrender to despair; and (4) rejection and isolation. In conclusion, individuals with scars and disfigurements sometimes adopted inappropriate measures to deal with the psychological problems caused by others' behaviors and wrong perceptions. Educational and support programs are hence indicated to promote awareness levels of self-immolation survivors, their families, and the whole society. Copyright © 2016 Elsevier Ltd and ISBI. All rights reserved.

  10. From Querulous to Suicidal: Self-immolation in Public Places as a Symbolic Response to the Feeling of Injustice.

    Science.gov (United States)

    Lévy, Benjamin T; Prudent, Cécile; Liétard, Florian; Evrard, Renaud

    2017-01-01

    Aim: This paper sheds light on the context that leads some querulous patients to self-immolate in front of, or into, public buildings (e.g., tribunals, city halls, and employment agencies). Method: The author defines paranoid querulousness. A psychoanalytic perspective, but also a judicial and a psychiatric point of view, over querulous claimants is presented. The links between political or social claims and self-immolation are studied. The expression of suicidal thoughts voiced by four querulous subjects is analyzed. Eight examples of self-immolation are presented. Results: The querulous subjects' self-aggressive behaviors seem to be caused by a loss of hope to obtain compensation for a prejudice they allegedly suffered. Querulous individuals tend to self-immolate in front of, or into, public buildings when no answer is given to their claims. These gestures may be both a consequence of some personal distress and triggered by a difficult social or professional context. Discussion: Five sets of assumptions derived from Freudian and Lacanian psychoanalytic theories are advanced. The status of the object over which the querulous claimants wish to assert their rights is clarified. The meaning of self-aggressive gestures is outlined by making reference to the concepts of instinct for mastery, symbolic other, chain of signifiers, masochism, pleasure principle, and reality principle. Conclusion: Prevention of self-immolation could involve that members of the legal professions, social workers, civil servants, and mental health professionals in contact with querulous subjects openly show their will to listen to these claimants' voice: self-aggressive gestures might be avoided by supporting the querulous person's hope to obtain compensation for the prejudice allegedly suffered.

  11. From Querulous to Suicidal: Self-immolation in Public Places as a Symbolic Response to the Feeling of Injustice

    Directory of Open Access Journals (Sweden)

    Benjamin T. Lévy

    2017-10-01

    Full Text Available Aim: This paper sheds light on the context that leads some querulous patients to self-immolate in front of, or into, public buildings (e.g., tribunals, city halls, and employment agencies.Method: The author defines paranoid querulousness. A psychoanalytic perspective, but also a judicial and a psychiatric point of view, over querulous claimants is presented. The links between political or social claims and self-immolation are studied. The expression of suicidal thoughts voiced by four querulous subjects is analyzed. Eight examples of self-immolation are presented.Results: The querulous subjects' self-aggressive behaviors seem to be caused by a loss of hope to obtain compensation for a prejudice they allegedly suffered. Querulous individuals tend to self-immolate in front of, or into, public buildings when no answer is given to their claims. These gestures may be both a consequence of some personal distress and triggered by a difficult social or professional context.Discussion: Five sets of assumptions derived from Freudian and Lacanian psychoanalytic theories are advanced. The status of the object over which the querulous claimants wish to assert their rights is clarified. The meaning of self-aggressive gestures is outlined by making reference to the concepts of instinct for mastery, symbolic other, chain of signifiers, masochism, pleasure principle, and reality principle.Conclusion: Prevention of self-immolation could involve that members of the legal professions, social workers, civil servants, and mental health professionals in contact with querulous subjects openly show their will to listen to these claimants' voice: self-aggressive gestures might be avoided by supporting the querulous person's hope to obtain compensation for the prejudice allegedly suffered.

  12. Oxidation Responsive Polymers with a Triggered Degradation via Arylboronate Self-Immolative Motifs on a Polyphosphazene Backbone.

    Science.gov (United States)

    Iturmendi, Aitziber; Monkowius, Uwe; Teasdale, Ian

    2017-02-21

    Oxidation responsive polymers with triggered degradation pathways have been prepared via attachment of self-immolative moieties onto a hydrolytically unstable polyphosphazene backbone. After controlled main-chain growth, postpolymerization functionalization allows the preparation of hydrolytically stable poly(organo)phosphazenes decorated with a phenylboronic ester caging group. In oxidative environments, triggered cleavage of the caging group is followed by self-immolation, exposing the unstable glycine-substituted polyphosphazene which subsequently undergoes to backbone degradation to low-molecular weight molecules. As well as giving mechanistic insights, detailed GPC and 1 H and 31 P NMR analysis reveal the polymers to be stable in aqueous solutions, but show a selective, fast degradation upon exposure to hydrogen peroxide containing solutions. Since the post-polymerization functionalization route allows simple access to polymer backbones with a broad range of molecular weights, the approach of using the inorganic backbone as a platform significantly expands the toolbox of polymers capable of stimuli-responsive degradation.

  13. Amplified release through the stimulus triggered degradation of self-immolative oligomers, dendrimers, and linear polymers.

    Science.gov (United States)

    Wong, Andrew D; DeWit, Matthew A; Gillies, Elizabeth R

    2012-08-01

    In recent years, numerous delivery systems based on polymers, dendrimers, and nano-scale assemblies have been developed to improve the properties of drug molecules. In general, for the drug molecules to be active, they must be released from these delivery systems, ideally in a selective manner at the therapeutic target. As the changes in physiological conditions are relatively subtle from one tissue to another and the concentrations of specific enzymes are often quite low, a release strategy involving the amplification of a biological signal is particularly attractive. This article describes the development of oligomers, dendrimers, and linear polymers based on self-immolative spacers. This new class of molecules is designed to undergo a cascade of intramolecular reactions in response to the cleavage of a trigger moiety, resulting in molecular fragmentation and the release of multiple reporter or drug molecules. Progress in the development of these materials as drug delivery vehicles and sensors will be highlighted. Copyright © 2011 Elsevier B.V. All rights reserved.

  14. A study of suicide and attempted suicide by self-immolation in an Irish psychiatric population: an increasing problem.

    LENUS (Irish Health Repository)

    O'Donoghue, J M

    2012-02-03

    In the Western World self-immolation is an uncommon but dramatic method of attempting suicide. In-patients who attempt suicide by fire-setting tend to be female with severe psychopathology. In a previous study from the South of Ireland, seven cases from a psychiatric and prison population were identified in a five year period from 1984 to 1989. This would represent an annual rate of 1.07 per cent of burns treated in the burns unit at Cork University Hospital. In this study 12 cases were identified for the years 1994 and 1995. This represents an increase of 3.5 per cent from 1.07 to 4.6 per cent of all burns treated at the same institution. Ten of these patients had a previous psychiatric history and eight of them were resident on a psychiatric ward when they committed the act. Seven of the patients were found to have a high degree of suicide intent of whom four died of their injuries, which gives a mortality rate for this group of 33 per cent. Effective prevention policies are necessary if this increasing problem is to be curtailed.

  15. Preparation and Characterization of a Small Library of Thermally-Labile End-Caps for Variable-Temperature Triggering of Self-Immolative Polymers.

    Science.gov (United States)

    Taimoory, S Maryamdokht; Sadraei, S Iraj; Fayoumi, Rose Anne; Nasri, Sarah; Revington, Matthew; Trant, John F

    2018-04-20

    The reaction between furans and maleimides has increasingly become a method of interest as its reversibility makes it a useful tool for applications ranging from self-healing materials, to self-immolative polymers, to hydrogels for cell culture and for the preparation of bone repair. However, most of these applications have relied on simple monosubstituted furans and simple maleimides and have not extensively evaluated the potential thermal variability inherent in the process that is achievable through simple substrate modification. A small library of cycloadducts suitable for the above applications was prepared, and the temperature dependence of the retro-Diels-Alder processes was determined through in situ 1 H NMR analyses complemented by computational calculations. The practical range of the reported systems ranges from 40 to >110 °C. The cycloreversion reactions are more complex than would be expected based on simple trends expected based on frontier molecular orbital analyses of the materials.

  16. Tumor-targeting peptides from combinatorial libraries*

    Science.gov (United States)

    Liu, Ruiwu; Li, Xiaocen; Xiao, Wenwu; Lam, Kit S.

    2018-01-01

    Cancer is one of the major and leading causes of death worldwide. Two of the greatest challenges infighting cancer are early detection and effective treatments with no or minimum side effects. Widespread use of targeted therapies and molecular imaging in clinics requires high affinity, tumor-specific agents as effective targeting vehicles to deliver therapeutics and imaging probes to the primary or metastatic tumor sites. Combinatorial libraries such as phage-display and one-bead one-compound (OBOC) peptide libraries are powerful approaches in discovering tumor-targeting peptides. This review gives an overview of different combinatorial library technologies that have been used for the discovery of tumor-targeting peptides. Examples of tumor-targeting peptides identified from each combinatorial library method will be discussed. Published tumor-targeting peptide ligands and their applications will also be summarized by the combinatorial library methods and their corresponding binding receptors. PMID:27210583

  17. Carbohydrate plasma expanders for passive tumor targeting

    DEFF Research Database (Denmark)

    Hoffmann, Stefan; Caysa, Henrike; Kuntsche, Judith

    2013-01-01

    The objective of this study was to investigate the suitability of carbohydrate plasma volume expanders as a novel polymer platform for tumor targeting. Many synthetic polymers have already been synthesized for targeted tumor therapy, but potential advantages of these carbohydrates include inexpen...... was characterized in human colon carcinoma xenograft bearing nude mice. A tumor specific accumulation of HES 450 was observed, which proves it’s potential as carrier for passive tumor targeting....

  18. Brain tumor-targeted drug delivery strategies

    Directory of Open Access Journals (Sweden)

    Xiaoli Wei

    2014-06-01

    Full Text Available Despite the application of aggressive surgery, radiotherapy and chemotherapy in clinics, brain tumors are still a difficult health challenge due to their fast development and poor prognosis. Brain tumor-targeted drug delivery systems, which increase drug accumulation in the tumor region and reduce toxicity in normal brain and peripheral tissue, are a promising new approach to brain tumor treatments. Since brain tumors exhibit many distinctive characteristics relative to tumors growing in peripheral tissues, potential targets based on continuously changing vascular characteristics and the microenvironment can be utilized to facilitate effective brain tumor-targeted drug delivery. In this review, we briefly describe the physiological characteristics of brain tumors, including blood–brain/brain tumor barriers, the tumor microenvironment, and tumor stem cells. We also review targeted delivery strategies and introduce a systematic targeted drug delivery strategy to overcome the challenges.

  19. High efficiency diffusion molecular retention tumor targeting.

    Directory of Open Access Journals (Sweden)

    Yanyan Guo

    Full Text Available Here we introduce diffusion molecular retention (DMR tumor targeting, a technique that employs PEG-fluorochrome shielded probes that, after a peritumoral (PT injection, undergo slow vascular uptake and extensive interstitial diffusion, with tumor retention only through integrin molecular recognition. To demonstrate DMR, RGD (integrin binding and RAD (control probes were synthesized bearing DOTA (for (111 In(3+, a NIR fluorochrome, and 5 kDa PEG that endows probes with a protein-like volume of 25 kDa and decreases non-specific interactions. With a GFP-BT-20 breast carcinoma model, tumor targeting by the DMR or i.v. methods was assessed by surface fluorescence, biodistribution of [(111In] RGD and [(111In] RAD probes, and whole animal SPECT. After a PT injection, both probes rapidly diffused through the normal and tumor interstitium, with retention of the RGD probe due to integrin interactions. With PT injection and the [(111In] RGD probe, SPECT indicated a highly tumor specific uptake at 24 h post injection, with 352%ID/g tumor obtained by DMR (vs 4.14%ID/g by i.v.. The high efficiency molecular targeting of DMR employed low probe doses (e.g. 25 ng as RGD peptide, which minimizes toxicity risks and facilitates clinical translation. DMR applications include the delivery of fluorochromes for intraoperative tumor margin delineation, the delivery of radioisotopes (e.g. toxic, short range alpha emitters for radiotherapy, or the delivery of photosensitizers to tumors accessible to light.

  20. Tumor targeting using liposomal antineoplastic drugs

    Directory of Open Access Journals (Sweden)

    Jörg Huwyler

    2008-03-01

    Full Text Available Jörg Huwyler1, Jürgen Drewe2, Stephan Krähenbühl21University of Applied Sciences Northwestern Switzerland, Institute of Pharma Technology, Muttenz, Switzerland; 2Department of Research and Division of Clinical Pharmacology, University Hospital Basel, Basel, SwitzerlandAbstract: During the last years, liposomes (microparticulate phospholipid vesicles have beenused with growing success as pharmaceutical carriers for antineoplastic drugs. Fields of application include lipid-based formulations to enhance the solubility of poorly soluble antitumordrugs, the use of pegylated liposomes for passive targeting of solid tumors as well as vector-conjugated liposomal carriers for active targeting of tumor tissue. Such formulation and drug targeting strategies enhance the effectiveness of anticancer chemotherapy and reduce at the same time the risk of toxic side-effects. The present article reviews the principles of different liposomal technologies and discusses current trends in this field of research.Keywords: tumor targeting, antineoplastic drugs, liposomes, pegylation, steric stabilization, immunoliposomes

  1. Glucosylated polyethylenimine as a tumor-targeting gene carrier.

    Science.gov (United States)

    Park, In-Kyu; Cook, Seung-Eun; Kim, You-Kyoung; Kim, Hyun-Woo; Cho, Myung-Haing; Jeong, Hwan-Jeong; Kim, Eun-Mi; Nah, Jae-Woon; Bom, Hee-Seung; Cho, Chong-Su

    2005-11-01

    Glucosylated polyethylenimine (GPEI) was synthesized as a tumor-targeting gene carrier through facilitative glucose metabolism by tumor glucose transporter. Particle sizes of GPEI/DNA complex increased in proportion to glucose content of GPEI, whereas surface charge of the complex was not dependent on glucosylation, partially due to inefficient shielding of the short hydrophilic group introduced. GPEI with higher glucosylation (36 mol-%) had no cytotoxic effect on cells even at polymer concentrations higher than 200 microg/mL. Compared to unglucosylated PEI, glucosylation induced less than one-order decrease of transfection efficiency. Transfection of GPEI/DNA complex into tumor cells possibly occurred through specific interaction between glucose-related cell receptors and glucose moiety of GPEI. Gamma imaging technique revealed GPEI/DNA complex was distributed in liver, spleen, and tumors.

  2. Tumor Targeting and Drug Delivery by Anthrax Toxin

    Directory of Open Access Journals (Sweden)

    Christopher Bachran

    2016-07-01

    Full Text Available Anthrax toxin is a potent tripartite protein toxin from Bacillus anthracis. It is one of the two virulence factors and causes the disease anthrax. The receptor-binding component of the toxin, protective antigen, needs to be cleaved by furin-like proteases to be activated and to deliver the enzymatic moieties lethal factor and edema factor to the cytosol of cells. Alteration of the protease cleavage site allows the activation of the toxin selectively in response to the presence of tumor-associated proteases. This initial idea of re-targeting anthrax toxin to tumor cells was further elaborated in recent years and resulted in the design of many modifications of anthrax toxin, which resulted in successful tumor therapy in animal models. These modifications include the combination of different toxin variants that require activation by two different tumor-associated proteases for increased specificity of toxin activation. The anthrax toxin system has proved to be a versatile system for drug delivery of several enzymatic moieties into cells. This highly efficient delivery system has recently been further modified by introducing ubiquitin as a cytosolic cleavage site into lethal factor fusion proteins. This review article describes the latest developments in this field of tumor targeting and drug delivery.

  3. Tumor Targeting and Drug Delivery by Anthrax Toxin.

    Science.gov (United States)

    Bachran, Christopher; Leppla, Stephen H

    2016-07-01

    Anthrax toxin is a potent tripartite protein toxin from Bacillus anthracis. It is one of the two virulence factors and causes the disease anthrax. The receptor-binding component of the toxin, protective antigen, needs to be cleaved by furin-like proteases to be activated and to deliver the enzymatic moieties lethal factor and edema factor to the cytosol of cells. Alteration of the protease cleavage site allows the activation of the toxin selectively in response to the presence of tumor-associated proteases. This initial idea of re-targeting anthrax toxin to tumor cells was further elaborated in recent years and resulted in the design of many modifications of anthrax toxin, which resulted in successful tumor therapy in animal models. These modifications include the combination of different toxin variants that require activation by two different tumor-associated proteases for increased specificity of toxin activation. The anthrax toxin system has proved to be a versatile system for drug delivery of several enzymatic moieties into cells. This highly efficient delivery system has recently been further modified by introducing ubiquitin as a cytosolic cleavage site into lethal factor fusion proteins. This review article describes the latest developments in this field of tumor targeting and drug delivery.

  4. Tumor target amplification: Implications for nano drug delivery systems.

    Science.gov (United States)

    Seidi, Khaled; Neubauer, Heidi A; Moriggl, Richard; Jahanban-Esfahlan, Rana; Javaheri, Tahereh

    2018-04-10

    Tumor cells overexpress surface markers which are absent from normal cells. These tumor-restricted antigenic signatures are a fundamental basis for distinguishing on-target from off-target cells for ligand-directed targeting of cancer cells. Unfortunately, tumor heterogeneity impedes the establishment of a solid expression pattern for a given target marker, leading to drastic changes in quality (availability) and quantity (number) of the target. Consequently, a subset of cancer cells remains untargeted during the course of treatment, which subsequently promotes drug-resistance and cancer relapse. Since target inefficiency is only problematic for cancer treatment and not for treatment of other pathological conditions such as viral/bacterial infections, target amplification or the generation of novel targets is key to providing eligible antigenic markers for effective targeted therapy. This review summarizes the limitations of current ligand-directed targeting strategies and provides a comprehensive overview of tumor target amplification strategies, including self-amplifying systems, dual targeting, artificial markers and peptide modification. We also discuss the therapeutic and diagnostic potential of these approaches, the underlying mechanism(s) and established methodologies, mostly in the context of different nanodelivery systems, to facilitate more effective ligand-directed cancer cell monitoring and targeting. Copyright © 2018 Elsevier B.V. All rights reserved.

  5. Advancing theranostics with tumor-targeting peptides for precision otolaryngology

    Directory of Open Access Journals (Sweden)

    Chadwick L. Wright

    2016-06-01

    Full Text Available Worldwide, about 600,000 head and neck squamous cell carcinoma (HNSCC are detected annually, many of which involve high risk human papilloma virus (HPV. Surgery is the primary and desired first treatment option. Following surgery, the existence of cancer cells at the surgical margin is strongly associated with eventual recurrence of cancer and a poor outcome. Despite improved surgical methods (robotics, microsurgery, endoscopic/laparoscopic, and external imaging, surgeons rely only on their vision and touch to locate tumors during surgery. Diagnostic imaging systems like computed tomography (CT, magnetic resonance imaging (MRI, single-photon emission computed tomography (SPECT and positron-emission tomography (PET are too large, slow and costly to use efficiently during most surgeries and, ultrasound imaging, while fast and portable, is not cancer specific. This purpose of this article is to review the fundamental technologies that will radically advance Precision Otolaryngology practices to the benefit of patients with HNSCC. In particular, this article will address the potential for tumor-targeting peptides to enable more precise diagnostic imaging while simultaneously advancing new therapeutic paradigms for next generation image-guided surgery, tumor-specific chemotherapeutic delivery and tumor-selective targeted radiotherapy (i.e., theranostic. Keywords: Squamous cell carcinoma, Peptide, Optical surgical navigation, Diagnostic imaging, Theranostic

  6. [The development of novel tumor targeting delivery strategy].

    Science.gov (United States)

    Gao, Hui-le; Jiang, Xin-guo

    2016-02-01

    Tumor is one of the most serious threats for human being. Although many anti-tumor drugs are approved for clinical use, the treatment outcome is still modest because of the poor tumor targeting efficiency and low accumulation in tumor. Therefore, it is important to deliver anti-tumor drug into tumor efficiently, elevate drug concentration in tumor tissues and reduce the drug distribution in normal tissues. And it has been one of the most attractive directions of pharmaceutical academy and industry. Many kinds of strategies, especially various nanoparticulated drug delivery systems, have been developed to address the critical points of complex tumor microenvironment, which are partially or mostly satisfied for tumor treatment. In this paper, we carefully reviewed the novel targeting delivery strategies developed in recent years. The most powerful method is passive targeting delivery based on the enhanced permeability and retention(EPR) effect, and most commercial nanomedicines are based on the EPR effect. However, the high permeability and retention require different particle sizes, thus several kinds of size-changeable nanoparticles are developed, such as size reducible particles and assemble particles, to satisfy the controversial requirement for particle size and enhance both tumor retention and penetration. Surface charge reversible nanoparticles also shows a high efficiency because the anionic charge in blood circulation and normal organs decrease the unintended internalization. The charge can change into positive in tumor microenvironment, facilitating drug uptake by tumor cells. Additionally, tumor microenvironment responsive drug release is important to decrease drug side effect, and many strategies are developed, such as p H sensitive release and enzyme sensitive release. Except the responsive nanoparticles, shaping tumor microenvironment could attenuate the barriers in drug delivery, for example, decreasing tumor collagen intensity and normalizing tumor

  7. Passive versus active tumor targeting using RGD- and NGR-modified polymeric nanomedicines

    NARCIS (Netherlands)

    Kunjachan, Sijumon; Pola, Robert; Gremse, Felix; Theek, Benjamin; Ehling, Josef; Moeckel, Diana; Hermanns-Sachweh, Benita; Pechar, Michal; Ulbrich, Karel; Hennink, Wim E.; Storm, Gert; Lederle, Wiltrud; Kiessling, Fabian; Lammers, Twan

    2014-01-01

    Enhanced permeability and retention (EPR) and the (over-) expression of angiogenesis-related surface receptors are key features of tumor blood vessels. As a consequence, EPR-mediated passive and Arg-Gly-Asp (RGD) and Asn-Gly-Arg (NGR) based active tumor targeting have received considerable attention

  8. In vivo imaging of passively tumor targeted polymer carrier and the enzymatically cleavable drug model

    Czech Academy of Sciences Publication Activity Database

    Pola, Robert; Heinrich, A. K.; Mueller, T.; Kostka, Libor; Mäder, K.; Pechar, Michal; Etrych, Tomáš

    2017-01-01

    Roč. 6, 4 (Suppl) (2017), s. 90 ISSN 2325-9604. [International Conference and Exhibition on Nanomedicine and Drug Delivery. 29.05.2017-31.05.2017, Osaka] R&D Projects: GA MZd(CZ) NV16-28594A Institutional support: RVO:61389013 Keywords : polymer drug carrier * tumor targeting * enzymatic release Subject RIV: FD - Oncology ; Hematology

  9. Novel tumor-targeting, self-assembling peptide nanofiber as a carrier for effective curcumin delivery

    Directory of Open Access Journals (Sweden)

    Liu J

    2013-12-01

    Full Text Available Jianfeng Liu, Jinjian Liu, Hongyan Xu, Yumin Zhang, Liping Chu, Qingfen Liu, Naling Song, Cuihong YangTianjin Key Laboratory of Molecular Nuclear Medicine, Institute of Radiation Medicine, Chinese Academy of Medical Science and Peking Union Medical College, People's Republic of ChinaAbstract: The poor aqueous solubility and low bioavailability of curcumin restrict its clinical application for cancer treatment. In this study, a novel tumor-targeting nanofiber carrier was developed to improve the solubility and tumor-targeting ability of curcumin using a self-assembled Nap-GFFYG-RGD peptide. The morphologies of the peptide nanofiber and the curcumin-encapsulated nanofiber were visualized by transmission electron microscopy. The tumor-targeting activity of the curcumin-encapsulated Nap-GFFYG-RGD peptide nanofiber (f-RGD-Cur was studied in vitro and in vivo, using Nap-GFFYG-RGE peptide nanofiber (f-RGE-Cur as the control. Curcumin was encapsulated into the peptide nanofiber, which had a diameter of approximately 10–20 nm. Curcumin showed sustained-release behavior from the nanofibers in vitro. f-RGD-Cur showed much higher cellular uptake in αvβ3 integrin-positive HepG2 liver carcinoma cells than did non-targeted f-RGE-Cur, thereby leading to significantly higher cytotoxicity. Ex vivo studies further demonstrated that curcumin could accumulate markedly in mouse tumors after administration of f-RGD-Cur via the tail vein. These results indicate that Nap-GFFYG-RGD peptide self-assembled nanofibers are a promising hydrophobic drug delivery system for targeted treatment of cancer.Keywords: nanofiber, tumor-targeting, self-assembling, curcumin, drug delivery

  10. Mesenchymal Stem Cell-Based Tumor-Targeted Gene Therapy in Gastrointestinal Cancer

    OpenAIRE

    Bao, Qi; Zhao, Yue; Niess, Hanno; Conrad, Claudius; Schwarz, Bettina; Jauch, Karl-Walter; Huss, Ralf; Nelson, Peter J.; Bruns, Christiane J.

    2012-01-01

    Mesenchymal stem (or stromal) cells (MSCs) are nonhematopoietic progenitor cells that can be obtained from bone marrow aspirates or adipose tissue, expanded and genetically modified in vitro, and then used for cancer therapeutic strategies in vivo. Here, we review available data regarding the application of MSC-based tumor-targeted therapy in gastrointestinal cancer, provide an overview of the general history of MSC-based gene therapy in cancer research, and discuss potential problems associa...

  11. In vivo tumor targeting of gold nanoparticles: effect of particle type and dosing strategy.

    Science.gov (United States)

    Puvanakrishnan, Priyaveena; Park, Jaesook; Chatterjee, Deyali; Krishnan, Sunil; Tunnell, James W

    2012-01-01

    Gold nanoparticles (GNPs) have gained significant interest as nanovectors for combined imaging and photothermal therapy of tumors. Delivered systemically, GNPs preferentially accumulate at the tumor site via the enhanced permeability and retention effect, and when irradiated with near infrared light, produce sufficient heat to treat tumor tissue. The efficacy of this process strongly depends on the targeting ability of the GNPs, which is a function of the particle's geometric properties (eg, size) and dosing strategy (eg, number and amount of injections). The purpose of this study was to investigate the effect of GNP type and dosing strategy on in vivo tumor targeting. Specifically, we investigated the in vivo tumor-targeting efficiency of pegylated gold nanoshells (GNSs) and gold nanorods (GNRs) for single and multiple dosing. We used Swiss nu/nu mice with a subcutaneous tumor xenograft model that received intravenous administration for a single and multiple doses of GNS and GNR. We performed neutron activation analysis to quantify the gold present in the tumor and liver. We performed histology to determine if there was acute toxicity as a result of multiple dosing. Neutron activation analysis results showed that the smaller GNRs accumulated in higher concentrations in the tumor compared to the larger GNSs. We observed a significant increase in GNS and GNR accumulation in the liver for higher doses. However, multiple doses increased targeting efficiency with minimal effect beyond three doses of GNPs. These results suggest a significant effect of particle type and multiple doses on increasing particle accumulation and on tumor targeting ability.

  12. Integrated nanotechnology platform for tumor-targeted multimodal imaging and therapeutic cargo release.

    Science.gov (United States)

    Hosoya, Hitomi; Dobroff, Andrey S; Driessen, Wouter H P; Cristini, Vittorio; Brinker, Lina M; Staquicini, Fernanda I; Cardó-Vila, Marina; D'Angelo, Sara; Ferrara, Fortunato; Proneth, Bettina; Lin, Yu-Shen; Dunphy, Darren R; Dogra, Prashant; Melancon, Marites P; Stafford, R Jason; Miyazono, Kohei; Gelovani, Juri G; Kataoka, Kazunori; Brinker, C Jeffrey; Sidman, Richard L; Arap, Wadih; Pasqualini, Renata

    2016-02-16

    A major challenge of targeted molecular imaging and drug delivery in cancer is establishing a functional combination of ligand-directed cargo with a triggered release system. Here we develop a hydrogel-based nanotechnology platform that integrates tumor targeting, photon-to-heat conversion, and triggered drug delivery within a single nanostructure to enable multimodal imaging and controlled release of therapeutic cargo. In proof-of-concept experiments, we show a broad range of ligand peptide-based applications with phage particles, heat-sensitive liposomes, or mesoporous silica nanoparticles that self-assemble into a hydrogel for tumor-targeted drug delivery. Because nanoparticles pack densely within the nanocarrier, their surface plasmon resonance shifts to near-infrared, thereby enabling a laser-mediated photothermal mechanism of cargo release. We demonstrate both noninvasive imaging and targeted drug delivery in preclinical mouse models of breast and prostate cancer. Finally, we applied mathematical modeling to predict and confirm tumor targeting and drug delivery. These results are meaningful steps toward the design and initial translation of an enabling nanotechnology platform with potential for broad clinical applications.

  13. Hyaluronic acid-functionalized single-walled carbon nanotubes as tumor-targeting MRI contrast agent

    Directory of Open Access Journals (Sweden)

    Hou L

    2015-07-01

    Full Text Available Lin Hou,* Huijuan Zhang,* Yating Wang, Lili Wang, Xiaomin Yang, Zhenzhong ZhangSchool of Pharmaceutical Sciences, Zhengzhou University, Zhengzhou, People’s Republic of China*These authors contributed equally to this workAbstract: A tumor-targeting carrier, hyaluronic acid (HA-functionalized single-walled carbon nanotubes (SWCNTs, was explored to deliver magnetic resonance imaging (MRI contrast agents (CAs targeting to the tumor cells specifically. In this system, HA surface modification for SWCNTs was simply accomplished by amidation process and could make this nanomaterial highly hydrophilic. Cellular uptake was performed to evaluate the intracellular transport capabilities of HA-SWCNTs for tumor cells and the uptake rank was HA-SWCNTs> SWCNTs owing to the presence of HA, which was also evidenced by flow cytometry. The safety evaluation of this MRI CAs was investigated in vitro and in vivo. It revealed that HA-SWCNTs could stand as a biocompatible nanocarrier and gadolinium (Gd/HA-SWCNTs demonstrated almost no toxicity compared with free GdCl3. Moreover, GdCl3 bearing HA-SWCNTs could significantly increase the circulation time for MRI. Finally, to investigate the MRI contrast enhancing capabilities of Gd/HA-SWCNTs, T1-weighted MR images of tumor-bearing mice were acquired. The results suggested Gd/HA-SWCNTs had the highest tumor-targeting efficiency and T1-relaxivity enhancement, indicating HA-SWCNTs could be developed as a tumor-targeting carrier to deliver the CAs, GdCl3, for the identifiable diagnosis of tumor.Keywords: gadolinium, magnetic resonance, SWCNTs, hyaluronic acid, contrast agent

  14. Mesenchymal Stem Cell-Based Tumor-Targeted Gene Therapy in Gastrointestinal Cancer

    Science.gov (United States)

    Bao, Qi; Zhao, Yue; Niess, Hanno; Conrad, Claudius; Schwarz, Bettina; Jauch, Karl-Walter; Huss, Ralf; Nelson, Peter J.

    2012-01-01

    Mesenchymal stem (or stromal) cells (MSCs) are nonhematopoietic progenitor cells that can be obtained from bone marrow aspirates or adipose tissue, expanded and genetically modified in vitro, and then used for cancer therapeutic strategies in vivo. Here, we review available data regarding the application of MSC-based tumor-targeted therapy in gastrointestinal cancer, provide an overview of the general history of MSC-based gene therapy in cancer research, and discuss potential problems associated with the utility of MSC-based therapy such as biosafety, immunoprivilege, transfection methods, and distribution in the host. PMID:22530882

  15. Liposomal Tumor Targeting in Drug Delivery Utilizing MMP-2- and MMP-9-Binding Ligands

    Directory of Open Access Journals (Sweden)

    Oula Penate Medina

    2011-01-01

    Full Text Available Nanotechnology offers an alternative to conventional treatment options by enabling different drug delivery and controlled-release delivery strategies. Liposomes being especially biodegradable and in most cases essentially nontoxic offer a versatile platform for several different delivery approaches that can potentially enhance the delivery and targeting of therapies to tumors. Liposomes penetrate tumors spontaneously as a result of fenestrated blood vessels within tumors, leading to known enhanced permeability and subsequent drug retention effects. In addition, liposomes can be used to carry radioactive moieties, such as radiotracers, which can be bound at multiple locations within liposomes, making them attractive carriers for molecular imaging applications. Phage display is a technique that can deliver various high-affinity and selectivity peptides to different targets. In this study, gelatinase-binding peptides, found by phage display, were attached to liposomes by covalent peptide-PEG-PE anchor creating a targeted drug delivery vehicle. Gelatinases as extracellular targets for tumor targeting offer a viable alternative for tumor targeting. Our findings show that targeted drug delivery is more efficient than non-targeted drug delivery.

  16. PEGylated chitosan grafted with polyamidoaminedendron as tumor-targeted magnetic resonance imaging contrast agent

    International Nuclear Information System (INIS)

    Guangyue Zu; Xiaoyan Tong; Yi Cao; Ye Kuang; Yajie Zhang; Min Liu; Renjun Pei

    2017-01-01

    Macromolecular contrast agents labeled with targeting ligands are now receiving growing interest in tumor-targeted magnetic resonance imaging. In this study, a macromolecular contrast agent based on PEGylated chitosan was synthesized and characterized, and its application as an MRI contrast agent was then demonstrated both in vitro and in vivo. First, the chitosan backbone was partially grafted with poly(ethylene glycol), which was used to improve the in vivo stability, followed by modifying with azide groups. Second, alkynyl-terminated PAMAM dendron modified with gadolinium diethylenetriaminepentaacetic acid (Gd-DTPA) was synthesized and conjugated onto the chitosan backbone through click chemistry. Finally, the obtained mCA was further functionalized with folic acid to improve the target specificity. The obtained FA labeled mCA exhibited higher relaxivity (9.53 mM"-"1.s"-"1) relative to Gd-DTPA (4.25 mM"-"1.s"-"1) and showed negligible toxicity as determined by the WST assay. In vivo MRI results suggested that a relatively high signal enhancement was observed in the tumor region, which made it a promising candidate for tumor-targeted MRI CA. (authors)

  17. In vivo tomographic imaging with fluorescence and MRI using tumor-targeted dual-labeled nanoparticles

    Directory of Open Access Journals (Sweden)

    Zhang Y

    2013-12-01

    Full Text Available Yue Zhang,1 Bin Zhang,1 Fei Liu,1,2 Jianwen Luo,1,3 Jing Bai1 1Department of Biomedical Engineering, School of Medicine, 2Tsinghua-Peking Center for Life Sciences, 3Center for Biomedical Imaging Research, Tsinghua University, Beijing, People's Republic of China Abstract: Dual-modality imaging combines the complementary advantages of different modalities, and offers the prospect of improved preclinical research. The combination of fluorescence imaging and magnetic resonance imaging (MRI provides cross-validated information and direct comparison between these modalities. Here, we report on the application of a novel tumor-targeted, dual-labeled nanoparticle (NP, utilizing iron oxide as the MRI contrast agent and near infrared (NIR dye Cy5.5 as the fluorescent agent. Results of in vitro experiments verified the specificity of the NP to tumor cells. In vivo tumor targeting and uptake of the NPs in a mouse model were visualized by fluorescence and MR imaging collected at different time points. Quantitative analysis was carried out to evaluate the efficacy of MRI contrast enhancement. Furthermore, tomographic images were also acquired using both imaging modalities and cross-validated information of tumor location and size between these two modalities was revealed. The results demonstrate that the use of dual-labeled NPs can facilitate the dual-modal detection of tumors, information cross-validation, and direct comparison by combing fluorescence molecular tomography (FMT and MRI. Keywords: dual-modality, fluorescence molecular tomography (FMT, magnetic resonance imaging (MRI, nanoparticle

  18. Polyethylene Glycol Modified, Cross-Linked Starch Coated Iron Oxide Nanoparticles for Enhanced Magnetic Tumor Targeting

    Science.gov (United States)

    Cole, Adam J.; David, Allan E.; Wang, Jianxin; Galbán, Craig J.; Hill, Hannah L.; Yang, Victor C.

    2010-01-01

    While successful magnetic tumor targeting of iron oxide nanoparticles has been achieved in a number of models, the rapid blood clearance of magnetically suitable particles by the reticuloendothelial system (RES) limits their availability for targeting. This work aimed to develop a long-circulating magnetic iron oxide nanoparticle (MNP) platform capable of sustained tumor exposure via the circulation and, thus, enhanced magnetic tumor targeting. Aminated, cross-linked starch (DN) and aminosilane (A) coated MNPs were successfully modified with 5 kDa (A5, D5) or 20 kDa (A20, D20) polyethylene glycol (PEG) chains using simple N-Hydroxysuccinimide (NHS) chemistry and characterized. Identical PEG-weight analogues between platforms (A5 & D5, A20 & D20) were similar in size (140–190 nm) and relative PEG labeling (1.5% of surface amines – A5/D5, 0.4% – A20/D20), with all PEG-MNPs possessing magnetization properties suitable for magnetic targeting. Candidate PEG-MNPs were studied in RES simulations in vitro to predict long-circulating character. D5 and D20 performed best showing sustained size stability in cell culture medium at 37°C and 7 (D20) to 10 (D5) fold less uptake in RAW264.7 macrophages when compared to previously targeted, unmodified starch MNPs (D). Observations in vitro were validated in vivo, with D5 (7.29 hr) and D20 (11.75 hr) showing much longer half-lives than D (0.12 hr). Improved plasma stability enhanced tumor MNP exposure 100 (D5) to 150 (D20) fold as measured by plasma AUC0-∞ Sustained tumor exposure over 24 hours was visually confirmed in a 9L-glioma rat model (12 mg Fe/kg) using magnetic resonance imaging (MRI). Findings indicate that both D5 and D20 are promising MNP platforms for enhanced magnetic tumor targeting, warranting further study in tumor models. PMID:21176955

  19. A Functional Iron Oxide Nanoparticles Modified with PLA-PEG-DG as Tumor-Targeted MRI Contrast Agent.

    Science.gov (United States)

    Xiong, Fei; Hu, Ke; Yu, Haoli; Zhou, Lijun; Song, Lina; Zhang, Yu; Shan, Xiuhong; Liu, Jianping; Gu, Ning

    2017-08-01

    Tumor targeting could greatly promote the performance of magnetic nanomaterials as MRI (Magnetic Resonance Imaging) agent for tumor diagnosis. Herein, we reported a novel magnetic nanoparticle modified with PLA (poly lactic acid)-PEG (polyethylene glycol)-DG (D-glucosamine) as Tumor-targeted MRI Contrast Agent. In this work, we took use of the D-glucose passive targeting on tumor cells, combining it on PLA-PEG through amide reaction, and then wrapped the PLA-PEG-DG up to the Fe 3 O 4 @OA NPs. The stability and anti phagocytosis of Fe 3 O 4 @OA@PLA-PEG-DG was tested in vitro; the MRI efficiency and toxicity was also detected in vivo. These functional magnetic nanoparticles demonstrated good biocompatibility and stability both in vitro and in vivo. Cell experiments showed that Fe 3 O 4 @OA@PLA-PEG-DG nanoparticles exist good anti phagocytosis and high targetability. In vivo MRI images showed that the contrast effect of Fe 3 O 4 @OA@PLA-PEG-DG nanoparticles prevailed over the commercial non tumor-targeting magnetic nanomaterials MRI agent at a relatively low dose. The DG can validly enhance the tumor-targetting effect of Fe 3 O 4 @OA@PLA-PEG nanoparticle. Maybe MRI agents with DG can hold promise as tumor-targetting development in the future.

  20. [Advances of tumor targeting peptides drug delivery system with pH-sensitive activities].

    Science.gov (United States)

    Ma, Yin-yun; Li, Li; Huang, Hai-feng; Gou, San-hu; Ni, Jing-man

    2016-05-01

    The pH-sensitive peptides drug delivery systems, which target to acidic extracellular environment of tumor tissue, have many advantages in drug delivery. They exhibit a high specificity to tumor and low cytotoxicity, which significantly increase the efficacy of traditional anti-cancer drugs. In recent years the systems have received a great attention. The pH-sensitive peptides drug delivery systems can be divided into five types according to the difference in pH-responsive mechanism,type of peptides and carrier materials. This paper summarizes the recent progresses in the field with a focus on the five types of pH-sensitive peptides in drug delivery systems. This may provide a guideline to design and application of tumor targeting drugs.

  1. Oligo-branched peptides for tumor targeting: from magic bullets to magic forks.

    Science.gov (United States)

    Falciani, Chiara; Pini, Alessandro; Bracci, Luisa

    2009-02-01

    Selective targeting of tumor cells is the final goal of research and drug discovery for cancer diagnosis, imaging and therapy. After the invention of hybridoma technology, the concept of magic bullet was introduced into the field of oncology, referring to selective killing of tumor cells, by specific antibodies. More recently, small molecules and peptides have also been proposed as selective targeting agents. We analyze the state of the art of tumor-selective agents that are presently available and tested in clinical settings. A novel approach based on 'armed' oligo-branched peptides as tumor targeting agents, is discussed and compared with existing tumor-selective therapies mediated by antibodies, small molecules or monomeric peptides. Oligo-branched peptides could be novel drugs that combine the advantages of antibodies and small molecules.

  2. Canine parvovirus-like particles, a novel nanomaterial for tumor targeting

    Directory of Open Access Journals (Sweden)

    Destito Giuseppe

    2006-02-01

    Full Text Available Abstract Specific targeting of tumor cells is an important goal for the design of nanotherapeutics for the treatment of cancer. Recently, viruses have been explored as nano-containers for specific targeting applications, however these systems typically require modification of the virus surface using chemical or genetic means to achieve tumor-specific delivery. Interestingly, there exists a subset of viruses with natural affinity for receptors on tumor cells that could be exploited for nanotechnology applications. For example, the canine parvovirus (CPV utilizes transferrin receptors (TfRs for binding and cell entry into canine as well as human cells. TfRs are over-expressed by a variety of tumor cells and are widely being investigated for tumor-targeted drug delivery. We explored whether the natural tropism of CPV to TfRs could be harnessed for targeting tumor cells. Towards this goal, CPV virus-like particles (VLPs produced by expression of the CPV-VP2 capsid protein in a baculovirus expression system were examined for attachment of small molecules and delivery to tumor cells. Structural modeling suggested that six lysines per VP2 subunit are presumably addressable for bioconjugation on the CPV capsid exterior. Between 45 and 100 of the possible 360 lysines/particle could be routinely derivatized with dye molecules depending on the conjugation conditions. Dye conjugation also demonstrated that the CPV-VLPs could withstand conditions for chemical modification on lysines. Attachment of fluorescent dyes neither impaired binding to the TfRs nor affected internalization of the 26 nm-sized VLPs into several human tumor cell lines. CPV-VLPs therefore exhibit highly favorable characteristics for development as a novel nanomaterial for tumor targeting.

  3. Multifunctional nanosheets based on folic acid modified manganese oxide for tumor-targeting theranostic application

    Science.gov (United States)

    Hao, Yongwei; Wang, Lei; Zhang, Bingxiang; Zhao, Hongjuan; Niu, Mengya; Hu, Yujie; Zheng, Cuixia; Zhang, Hongling; Chang, Junbiao; Zhang, Zhenzhong; Zhang, Yun

    2016-01-01

    It is highly desirable to develop smart nanocarriers with stimuli-responsive drug-releasing and diagnostic-imaging functions for cancer theranostics. Herein, we develop a reduction and pH dual-responsive tumor theranostic platform based on degradable manganese dioxide (MnO2) nanosheets. The MnO2 nanosheets with a size of 20-60 nm were first synthesized and modified with (3-Aminopropyl) trimethoxysilane (APTMS) to get amine-functionalized MnO2, and then functionalized by NH2-PEG2000-COOH (PEG). The tumor-targeting group, folic acid (FA), was finally conjugated with the PEGylated MnO2 nanosheets. Then, doxorubicin (DOX), a chemotherapeutic agent, was loaded onto the modified nanosheets through a physical adsorption, which was designated as MnO2-PEG-FA/DOX. The prepared MnO2-PEG-FA/DOX nanosheets with good biocompatibility can not only efficiently deliver DOX to tumor cells in vitro and in vivo, leading to enhanced anti-tumor efficiency, but can also respond to a slightly acidic environment and high concentration of reduced glutathione (GSH), which caused degradation of MnO2 into manganese ions enabling magnetic resonance imaging (MRI). The longitudinal relaxation rate r 1 was 2.26 mM-1 s-1 at pH 5.0 containing 2 mM GSH. These reduction and pH dual-responsive biodegradable nanosheets combining efficient MRI and chemotherapy provide a novel and promising platform for tumor-targeting theranostic application.

  4. Conjugate of biotin with silicon(IV) phthalocyanine for tumor-targeting photodynamic therapy.

    Science.gov (United States)

    Li, Ke; Qiu, Ling; Liu, Qingzhu; Lv, Gaochao; Zhao, Xueyu; Wang, Shanshan; Lin, Jianguo

    2017-09-01

    In order to improve the efficacy of photodynamic therapy (PDT), biotin was axially conjugated with silicon(IV) phthalocyanine (SiPc) skeleton to develop a new tumor-targeting photosensitizer SiPc-biotin. The target compound SiPc-biotin showed much higher binding affinity toward BR-positive (biotin receptor overexpressed) HeLa human cervical carcinoma cells than its precursor SiPc-pip. However, when the biotin receptors of HeLa cells were blocked by free biotin, >50% uptake of SiPc-biotin was suppressed, demonstrating that SiPc-biotin could selectively accumulate in BR-positive cancer cells via the BR-mediated internalization. The confocal fluorescence images further confirmed the target binding ability of SiPc-biotin. As a consequence of specificity of SiPc-biotin toward BR-positive HeLa cells, the photodynamic effect was also largely dependent on the BR expression level of HeLa cells. The photodynamic activities of SiPc-biotin against HeLa cells were dramatically reduced when the biotin receptors were blocked by the free biotin (IC 50 : 0.18μM vs. 0.46μM). It is concluded that SiPc-biotin can selectively damage BR-positive cancer cells under irradiation. Furthermore, the dark toxicity of SiPc-biotin toward human normal liver cell lines LO2 was much lower than that of its precursor SiPc-pip. The targeting photodynamic activity and low dark toxicity suggest that SiPc-biotin is a promising photosensitizer for tumor-targeting photodynamic therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Innovations that influence the pharmacology of monoclonal antibody guided tumor targeting

    International Nuclear Information System (INIS)

    Schlom, J.; Hand, P.H.; Greiner, J.W.; Colcher, D.; Shrivastav, S.; Carrasquillo, J.A.; Reynolds, J.C.; Larson, S.M.; Raubitschek, A.

    1990-01-01

    Tumor targeting by monoclonal antibodies (MAbs) can be enhanced by (a) increasing the percentage of injected dose taken up by the tumor and/or (b) increasing the tumor:nontumor ratios. Several groups have demonstrated that one can increase tumor to nontumor ratios by the use of antibody fragments or the administration of second antibodies. Several other modalities are also possible: (a) the use of recombinant interferons to up-regulate the expression of specific tumor associated antigens such as carcinoembryonic antigen or TAG-72 on the surface of carcinoma cells and thus increase MAb tumor binding has proved successful in both in vitro and in vivo studies; (b) the intracavitary administration of MAbs. Recent studies have demonstrated that when radiolabeled B72.3 is administered i.p. to patients with carcinoma of the peritoneal cavity, it localizes tumor masses with greater efficiency than does concurrent i.v. administered antibody. Studies involving the comparative pharmacology of intracavitary administration of radiolabeled MAb in patients and several animal models will be discussed; (c) it has been reported that prior exposure of hepatoma to external beam radiation will increase radiolabeled MAb tumor targeting. We and others have not been able to duplicate this phenomenon with a human colon cancer xenograft model and radiolabeled MAbs to two different colon carcinoma associated antigens. The possible reasons for these differences will be discussed; (d) the cloning and expression of recombinant MAbs with human constant regions and subsequent size modification constructs will also undoubtedly alter the pharmacology of MAb tumor binding in both diagnostic and therapeutic applications. 66 references

  6. Physico-Chemical Strategies to Enhance Stability and Drug Retention of Polymeric Micelles for Tumor-Targeted Drug Delivery

    NARCIS (Netherlands)

    Shi, Y.; Lammers, Twan Gerardus Gertudis Maria; Storm, Gerrit; Hennink, W.E.

    2017-01-01

    Polymeric micelles (PM) have been extensively used for tumor-targeted delivery of hydrophobic anti-cancer drugs. The lipophilic core of PM is naturally suitable for loading hydrophobic drugs and the hydrophilic shell endows them with colloidal stability and stealth properties. Decades of research on

  7. In vivo tumor targeting and imaging with engineered trivalent antibody fragments containing collagen-derived sequences.

    Directory of Open Access Journals (Sweden)

    Angel M Cuesta

    Full Text Available There is an urgent need to develop new and effective agents for cancer targeting. In this work, a multivalent antibody is characterized in vivo in living animals. The antibody, termed "trimerbody", comprises a single-chain antibody (scFv fragment connected to the N-terminal trimerization subdomain of collagen XVIII NC1 by a flexible linker. As indicated by computer graphic modeling, the trimerbody has a tripod-shaped structure with three highly flexible scFv heads radially outward oriented. Trimerbodies are trimeric in solution and exhibited multivalent binding, which provides them with at least a 100-fold increase in functional affinity than the monovalent scFv. Our results also demonstrate the feasibility of producing functional bispecific trimerbodies, which concurrently bind two different ligands. A trimerbody specific for the carcinoembryonic antigen (CEA, a classic tumor-associated antigen, showed efficient tumor targeting after systemic administration in mice bearing CEA-positive tumors. Importantly, a trimerbody that recognizes an angiogenesis-associated laminin epitope, showed excellent tumor localization in several cancer types, including fibrosarcomas and carcinomas. These results illustrate the potential of this new antibody format for imaging and therapeutic applications, and suggest that some laminin epitopes might be universal targets for cancer targeting.

  8. Bioconjugated PLGA-4-arm-PEG branched polymeric nanoparticles as novel tumor targeting carriers

    International Nuclear Information System (INIS)

    Ding Hong; Yong, Ken-Tye; Roy, Indrajit; Hu Rui; Zhao Lingling; Law, Wing-Cheung; Ji Wei; Liu Liwei; Bergey, Earl J; Prasad, Paras N; Wu Fang; Zhao Weiwei

    2011-01-01

    In this study, we have developed a novel carrier, micelle-type bioconjugated PLGA-4-arm-PEG branched polymeric nanoparticles (NPs), for the detection and treatment of pancreatic cancer. These NPs contained 4-arm-PEG as corona, and PLGA as core, the particle surface was conjugated with cyclo(arginine-glycine-aspartate) (cRGD) as ligand for in vivo tumor targeting. The hydrodynamic size of the NPs was determined to be 150-180 nm and the critical micellar concentration (CMC) was estimated to be 10.5 mg l -1 . Our in vitro study shows that these NPs by themselves had negligible cytotoxicity to human pancreatic cancer (Panc-1) and human glioblastoma (U87) cell lines. Near infrared (NIR) microscopy and flow cytometry demonstrated that the cRGD conjugated PLGA-4-arm-PEG polymeric NPs were taken up more efficiently by U87MG glioma cells, over-expressing the α v β 3 integrin, when compared with the non-targeted NPs. Whole body imaging showed that the cRGD conjugated PLGA-4-arm-PEG branched polymeric NPs had the highest accumulation in the pancreatic tumor site of mice at 48 h post-injection. Physical, hematological, and pathological assays indicated low in vivo toxicity of this NP formulation. These studies on the ability of these bioconjugated PLGA-4-arm-PEG polymeric NPs suggest that the prepared polymeric NPs may serve as a promising platform for detection and targeted drug delivery for pancreatic cancer.

  9. A Tumor-Targeted Nanodelivery System to Improve Early MRI Detection of Cancer

    Directory of Open Access Journals (Sweden)

    Kathleen F. Pirollo

    2006-01-01

    Full Text Available The development of improvements in magnetic resonance imaging (MRI that would enhance sensitivity, leading to earlier detection of cancer and visualization of metastatic disease, is an area of intense exploration. We have devised a tumor-targeting, liposomal nanodelivery platform for use in gene medicine. This systemically administered nanocomplex has been shown to specifically and efficiently deliver both genes and oligonucleotides to primary and metastatic tumor cells, resulting in significant tumor growth inhibition and even tumor regression. Here we examine the effect on MRI of incorporating conventional MRI contrast agent Magnevist® into our anti-transferrin receptor single-chain antibody (TfRscFv liposomal complex. Both in vitro and in an in vivo orthotopic mouse model of pancreatic cancer, we show increased resolution and image intensity with the complexed Magnevist®. Using advanced microscopy techniques (scanning electron microscopy and scanning probe microscopy, we also established that the Magnevist® is in fact encapsulated by the liposome in the complex and that the complex still retains its nanodimensional size. These results demonstrate that this TfRscFv-liposome-Magnevist® nanocomplex has the potential to become a useful tool in early cancer detection.

  10. Development of tumor-targeted near infrared probes for fluorescence guided surgery.

    Science.gov (United States)

    Kelderhouse, Lindsay E; Chelvam, Venkatesh; Wayua, Charity; Mahalingam, Sakkarapalayam; Poh, Scott; Kularatne, Sumith A; Low, Philip S

    2013-06-19

    Complete surgical resection of malignant disease is the only reliable method to cure cancer. Unfortunately, quantitative tumor resection is often limited by a surgeon's ability to locate all malignant disease and distinguish it from healthy tissue. Fluorescence-guided surgery has emerged as a tool to aid surgeons in the identification and removal of malignant lesions. While nontargeted fluorescent dyes have been shown to passively accumulate in some tumors, the resulting tumor-to-background ratios are often poor, and the boundaries between malignant and healthy tissues can be difficult to define. To circumvent these problems, our laboratory has developed high affinity tumor targeting ligands that bind to receptors that are overexpressed on cancer cells and deliver attached molecules selectively into these cells. In this study, we explore the use of two tumor-specific targeting ligands (i.e., folic acid that targets the folate receptor (FR) and DUPA that targets prostate specific membrane antigen (PSMA)) to deliver near-infrared (NIR) fluorescent dyes specifically to FR and PSMA expressing cancers, thereby rendering only the malignant cells highly fluorescent. We report here that all FR- and PSMA-targeted NIR probes examined bind cultured cancer cells in the low nanomolar range. Moreover, upon intravenous injection into tumor-bearing mice with metastatic disease, these same ligand-NIR dye conjugates render receptor-expressing tumor tissues fluorescent, enabling their facile resection with minimal contamination from healthy tissues.

  11. Hyaluronate tethered, "smart" multiwalled carbon nanotubes for tumor-targeted delivery of doxorubicin.

    Science.gov (United States)

    Datir, Satyajit R; Das, Manasmita; Singh, Raman Preet; Jain, Sanyog

    2012-11-21

    The present study reports the optimized synthesis, physicochemical characterization, and biological evaluation of a novel, multiwalled carbon nanotube-hyaluronic acid (MWCNT-HA) conjugate, complexed with an anticancer agent, Doxorubicin (DOX) via π-π stacking interaction. The therapeutic conjugate was concomitantly labeled with a near-infrared fluorescent dye, Alexa-Flour-647 (AF-647), and radiotracer Technetium-99m ((99m)Tc) to track its whereabouts both in vitro and in vivo via optical and scintigraphic imaging techniques. Covalent functionalization of MWCNTs with HA facilitated their internalization into human lung adenocarcinoma, A549 cells via hyaluronan receptors (HR) mediated endocytosis. Internalized nanotubes showed lysosomal trafficking, followed by low pH-triggered DOX release under endolysosomal conditions. Consequently, DOX-loaded HA-MWCNTs exhibited 3.2 times higher cytotoxicity and increased apoptotic activity than free DOX in equivalent concentrations. Organ distribution studies in Ehlrich ascites tumor (EAT) bearing mice model indicated that tumor specific localization of (99m)Tc-MWCNT-HA-DOX is significantly higher than both free drug and nontargeted MWCNTs. Pharmacodynamic studies in chemically breast-cancer-induced rats showed that the tumor-growth inhibitory effect of HA-MWCNT-DOX was 5 times higher than free DOX in equivalent concentration. DOX delivered through HA-MWCNTs was devoid of any detectable cardiotoxity, hepatotoxicity, or nephrotoxicity. All these promising attributes make HA-MWCNTs a "smart" platform for tumor-targeted delivery of anticancer agents.

  12. Analysis and modeling of localized heat generation by tumor-targeted nanoparticles (Monte Carlo methods)

    Science.gov (United States)

    Sanattalab, Ehsan; SalmanOgli, Ahmad; Piskin, Erhan

    2016-04-01

    We investigated the tumor-targeted nanoparticles that influence heat generation. We suppose that all nanoparticles are fully functionalized and can find the target using active targeting methods. Unlike the commonly used methods, such as chemotherapy and radiotherapy, the treatment procedure proposed in this study is purely noninvasive, which is considered to be a significant merit. It is found that the localized heat generation due to targeted nanoparticles is significantly higher than other areas. By engineering the optical properties of nanoparticles, including scattering, absorption coefficients, and asymmetry factor (cosine scattering angle), the heat generated in the tumor's area reaches to such critical state that can burn the targeted tumor. The amount of heat generated by inserting smart agents, due to the surface Plasmon resonance, will be remarkably high. The light-matter interactions and trajectory of incident photon upon targeted tissues are simulated by MIE theory and Monte Carlo method, respectively. Monte Carlo method is a statistical one by which we can accurately probe the photon trajectories into a simulation area.

  13. Fabrication of a nanocarrier system through self-assembly of plasma protein and its tumor targeting

    International Nuclear Information System (INIS)

    Gong Guangming; Zhi Feng; Wang Kaikai; Tang Xiaolei; Yuan Ahu; Zhao Lili; Ding Dawei; Hu Yiqiao

    2011-01-01

    Human serum albumin (HSA) nanoparticles hold great promise as a nanocarrier system for targeted drug delivery. The objective of this study was to explore the possibility of preparing size controllable albumin nanoparticles using the disulfide bond breaking reagent β-mercaptoethanol (β-ME). The results showed that the protein concentration and temperature had positive effects on the sizes of the albumin nanoparticles, while pH had a negative effect on the rate of nanoparticle formation. The addition of β-ME induced changes in HSA secondary structure and exposed the hydrophobic core of HSA, leading to the formation of nanoparticles. Human serum albumin nanoparticles could be internalized by MCF-7 cells and mainly accumulated in cytoplasm. After injection in tumor bearing mice, the HSA nanoparticles accumulated in tumor tissues, demonstrating the targeting ability of the nanoparticles. Therefore, human serum albumin can be fabricated into nanoparticles by breaking the disulfide bonds and these nanoparticles exhibit high tumor targeting ability. Human serum albumin nanoparticles could be ideal for the targeted delivery of pharmacologically active substances.

  14. RGD-modified lipid disks as drug carriers for tumor targeted drug delivery

    Science.gov (United States)

    Gao, Jie; Xie, Cao; Zhang, Mingfei; Wei, Xiaoli; Yan, Zhiqiang; Ren, Yachao; Ying, Man; Lu, Weiyue

    2016-03-01

    Melittin, the major component of the European bee venom, is a potential anticancer candidate due to its lytic properties. However, in vivo applications of melittin are limited due to its main side effect, hemolysis, especially when applied through intravenous administration. The polyethylene glycol-stabilized lipid disk is a novel type of nanocarrier, and the rim of lipid disks has a high affinity to amphiphilic peptides. In our study, a c(RGDyK) modified lipid disk was developed as a tumor targeted drug delivery system for melittin. Cryo-TEM was used to confirm the shape and size of lipid disks with or without c(RGDyK) modification. In vitro and in vivo hemolysis analyses revealed that the hemolysis effect significantly decreased after melittin associated with lipid disks. Importantly, the results of our in vivo biodistribution and tumor growth inhibitory experiments showed that c(RGDyK) modification increased the distribution of lipid disks in the tumor and the anticancer efficacy of melittin loaded lipid disks. Thus, we successfully achieved a targeted drug delivery system for melittin and other amphiphilic peptides with a good therapeutic effect and low side effects.

  15. Premature drug release of polymeric micelles and its effects on tumor targeting.

    Science.gov (United States)

    Miller, Tobias; Breyer, Sandra; van Colen, Gwenaelle; Mier, Walter; Haberkorn, Uwe; Geissler, Simon; Voss, Senta; Weigandt, Markus; Goepferich, Achim

    2013-03-10

    Based on the enhanced permeability and retention (EPR) effect, nanoparticles are believed to accumulate in tumors. In this conjunction, the stability of drug encapsulation is assumed to be sufficient. For clarification purposes, PEGylated poly-(D,L-lactic acid) (PEG-PDLLA) micelles which incorporated the hydrophobic model drug dechloro-4-iodo-fenofibrate (IFF) were investigated. H2N-PEG-PDLLA was synthesized, coupled to 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) and labeled with 111-indium. From this polymeric species, mixed micelles with H3CO-PEG-PDLLA were prepared which encapsulated the 125-iodine or 131-iodine labeled drug IFF. Bioimaging and biodistribution experiments in healthy and AR42J-tumor bearing mice were carried out to quantify the uptake of the drug and its carrier in single organs. As a result, upon injection of this system, a rapid dissociation of the polymeric carrier and the incorporated drug (system allowed for successful solubilization of the hydrophobic drug by physical incorporation into micelles whereas the tumor targeting properties of the drug delivery system could not be sufficiently shown. Copyright © 2013 Elsevier B.V. All rights reserved.

  16. Enhancing the effect of radionuclide tumor targeting, using lysosomotropic weak bases

    International Nuclear Information System (INIS)

    Sundberg, Asa Liljegren; Steffen, Ann-Charlott

    2007-01-01

    Purpose: The aim of the present study was to investigate if treatment with lysosomotropic weak bases could increase the intracellular retention of radiohalogens and thereby increase the therapeutic effect of radionuclide tumor targeting. Methods and Materials: Four different lysosomotropic bases, chloroquine, ammonium chloride, amantadine, and thioridazine, were investigated for their ability to increase radiohalogen retention in vitro. The two most promising substances, chloroquine and ammonium chloride, were studied in several cell lines (A431, U343MGaCl2:6, SKOV-3, and SKBR-3) in combination with radiolabeled epidermal growth factor (EGF) or the HER2 binding affibody (Z HER2:4 ) 2 . Results: The uptake and retention of radionuclides was found to be substantially increased by simultaneous treatment with the lysosomotropic bases. The effect was, however, more pronounced in the epidermal growth factor:epidermal growth factor receptor (EGF:EGFR) system than in the (Z HER2:4 ) 2 :HER2 system. The therapeutic effect of ammonium chloride treatment combined with 211 At-EGF was also studied. The effect obtained after combined treatment was found to be much better than after 211 At-EGF treatment alone. Conclusions: The encouraging results from the present study indicate that the use of lysosomotropic weak bases is a promising approach for increasing the therapeutic effect of radionuclide targeting with radiohalogens

  17. Hybrid protein-inorganic nanoparticles: From tumor-targeted drug delivery to cancer imaging.

    Science.gov (United States)

    Elzoghby, Ahmed O; Hemasa, Ayman L; Freag, May S

    2016-12-10

    Recently, a great interest has been paid to the development of hybrid protein-inorganic nanoparticles (NPs) for drug delivery and cancer diagnostics in order to combine the merits of both inorganic and protein nanocarriers. This review primarily discusses the most outstanding advances in the applications of the hybrids of naturally-occurring proteins with iron oxide, gadolinium, gold, silica, calcium phosphate NPs, carbon nanotubes, and quantum dots in drug delivery and cancer imaging. Various strategies that have been utilized for the preparation of protein-functionalized inorganic NPs and the mechanisms involved in the drug loading process are discussed. How can the protein functionalization overcome the limitations of colloidal stability, poor dispersibility and toxicity associated with inorganic NPs is also investigated. Moreover, issues relating to the influence of protein hybridization on the cellular uptake, tumor targeting efficiency, systemic circulation, mucosal penetration and skin permeation of inorganic NPs are highlighted. A special emphasis is devoted to the novel approaches utilizing the protein-inorganic nanohybrids in combined cancer therapy, tumor imaging, and theranostic applications as well as stimuli-responsive drug release from the nanohybrids. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. GLUT1-mediated selective tumor targeting with fluorine containing platinum(II) glycoconjugates.

    Science.gov (United States)

    Liu, Ran; Fu, Zheng; Zhao, Meng; Gao, Xiangqian; Li, Hong; Mi, Qian; Liu, Pengxing; Yang, Jinna; Yao, Zhi; Gao, Qingzhi

    2017-06-13

    Increased glycolysis and overexpression of glucose transporters (GLUTs) are physiological characteristics of human malignancies. Based on the so-called Warburg effect, 18flurodeoxyglucose-positron emission tomography (FDG-PET) has successfully developed as clinical modality for the diagnosis and staging of many cancers. To leverage this glucose transporter mediated metabolic disparity between normal and malignant cells, in the current report, we focus on the fluorine substituted series of glucose, mannose and galactose-conjugated (trans-R,R-cyclohexane-1,2-diamine)-2-flouromalonato-platinum(II) complexes for a comprehensive evaluation on their selective tumor targeting. Besides highly improved water solubility, these sugar-conjugates presented improved cytotoxicity than oxaliplatin in glucose tranporters (GLUTs) overexpressing cancer cell lines and exhibited no cross-resistance to cisplatin. For the highly water soluble glucose-conjugated complex (5a), two novel in vivo assessments were conducted and the results revealed that 5a was more efficacious at a lower equitoxic dose (70% MTD) than oxaliplatin (100% MTD) in HT29 xenograft model, and it was significantly more potent than oxaliplatin in leukemia-bearing DBA/2 mice as well even at equimolar dose levels (18% vs 90% MTD). GLUT inhibitor mediated cell viability analysis, GLUT1 knockdown cell line-based cytotoxicity evaluation, and platinum accumulation study demonstrated that the cellular uptake of the sugar-conjugates was regulated by GLUT1. The higher intrinsic DNA reactivity of the sugar-conjugates was confirmed by kinetic study of platinum(II)-guanosine adduct formation. The mechanistic origin of the antitumor effect of the fluorine complexes was found to be forming the bifunctional Pt-guanine-guanine (Pt-GG) intrastrand cross-links with DNA. The results provide a rationale for Warburg effect targeted anticancer drug design.

  19. Recombinant expression and purification of a tumor-targeted toxin in Bacillus anthracis

    International Nuclear Information System (INIS)

    Bachran, Christopher; Abdelazim, Suzanne; Fattah, Rasem J.; Liu, Shihui; Leppla, Stephen H.

    2013-01-01

    Highlights: ► Non-infectious and protease-deficient Bacillus anthracis protein expression system. ► Successful expression and purification of a tumor-targeted fusion protein drug. ► Very low endotoxin contamination of purified protein. ► Efficient protein secretion simplifies purification. ► Functional anti-tumor fusion protein purified. -- Abstract: Many recombinant therapeutic proteins are purified from Escherichia coli. While expression in E. coli is easily achieved, some disadvantages such as protein aggregation, formation of inclusion bodies, and contamination of purified proteins with the lipopolysaccharides arise. Lipopolysaccharides have to be removed to prevent inflammatory responses in patients. Use of the Gram-positive Bacillus anthracis as an expression host offers a solution to circumvent these problems. Using the multiple protease-deficient strain BH460, we expressed a fusion of the N-terminal 254 amino acids of anthrax lethal factor (LFn), the N-terminal 389 amino acids of diphtheria toxin (DT389) and human transforming growth factor alpha (TGFα). The resulting fusion protein was constitutively expressed and successfully secreted by B. anthracis into the culture supernatant. Purification was achieved by anion exchange chromatography and proteolytic cleavage removed LFn from the desired fusion protein (DT389 fused to TGFα). The fusion protein showed the intended specific cytotoxicity to epidermal growth factor receptor-expressing human head and neck cancer cells. Final analyses showed low levels of lipopolysaccharides, originating most likely from contamination during the purification process. Thus, the fusion to LFn for protein secretion and expression in B. anthracis BH460 provides an elegant tool to obtain high levels of lipopolysaccharide-free recombinant protein.

  20. 188Re labeling and biodistribution of magnetic nanoparticles for the tumor targeting

    International Nuclear Information System (INIS)

    Li Guiping; Zhang Hui; Wang Yongxian; Zhang Chunfu

    2006-01-01

    Objective: To prepare 188 Re labeled monoclonal antibody (Herceptin)-coated magnetic nanoparticles for tumor targeting and to study its biodistribution in mice. Methods: Herceptin and histidine were covalently linked to the amine group upon silica-coated magnetic nanoparticles modified by N-[3-(trimethyoxysilyl)prowl]-ethylenediamine using glutaraldehyde method. The Herceptin-coated magnetic nanoparticles and Herceptin were radiolabeled with 188 Re by a direct labelling method, whereas the histidine-coated magnetic nanoparticles was radiolabeled with 188 Re using fac-[ 188 Re(CO) 3 (H 2 0) 3 ] + as a precursor. The labelling efficiency and immunoreactivity as well as labelling stability were determined. Also, the biodistribution of 188 Re-magnetic and 188 Re-Herceptin-magnetic nanoparticles were observed in mice. Results: Herceptin-coated magnetic nanoparticles was characterized by transmission electron microscope (TEM) with diameter about 60 nm, while histidine-coated magnetic nanoparticles about 30 nm. The labeling efficiency for 188 Re-Herceptin, 188 Re-magnetic nanoparticles and 188 Re-Herceptin-magnetic nanoparticles were all > 90% and had a better stability in vitro. The immunoreactivity of Herceptin linked to magnetic nanoparticles was still high. The biodistribution in mice was shown that 188 Re-magnetic nanoparticles and 188 Re-Herceptin- magnetic nanoparticles had higher radioactivity levels in blood. Magnetic nanoparticles with diameter of 30 or 60 nm had a long half-life in blood stream and were accumulated in liver. Conclusion: The efficiency and stability of labelling Herceptin-coated magnetic nanoparticles and labelling magnetic nanoparticles with 188 Re are suitable for in vivo study in tumor-beating nude mice models. (authors)

  1. Photoacoustic imaging of tumor targeting with biotin conjugated nanostructured phthalocyanine assemblies

    Science.gov (United States)

    Lee, Seunghyun; Li, Xingshu; Lee, Dayoung; Yoon, Juyoung; Kim, Chulhong

    2018-02-01

    Visualizing biological markers and delivering bioactive agents to living organisms are important to biological research. In recent decades, photoacoustic imaging (PAI) has been significantly improved in the area of molecular imaging, which provides high-resolution volume imaging with high optical absorption contrast. To demonstrate the ability of nanoprobes to target tumors using PAI, we synthesize convertible nanostructured agents with strong photothermal and photoacoustic properties and linked the nanoprobe with biotin to target tumors in small animal model. Interestingly, these nanoprobes allow partial to disassemble in the presence of targeted proteins that switchable photoactivity, thus the nanoprobes provides a fluorescent-cancer imaging with high signal-to-background ratios. The proposed nanoprobe produce a much stronger PA signal compared to the same concentration of methylene blue (MB), which is widely used in clinical study and contrast agent for PAI. The biotin conjugated nanoprobe has high selectivity for biotin receptor positive cancer cells such as A549 (human lung cancer). Then we subsequently examined the PA properties of the nanoprobe that are inherently suitable for in vivo PAI. After injecting of the nanoprobe via intravenous method, we observed the mice's whole body by PA imaging and acquired the PA signal near the cancer. The PA signal increased linearly with time after injection and the fluorescence signal near the cancer was confirmed by fluorescence imaging. The ability to target a specific cancer of the nanoprobe was well verified by PA imaging. This study provides valuable perspective on the advancement of clinical translations and in the design of tumor-targeting phototheranostic agents that could act as new nanomedicines.

  2. Recombinant expression and purification of a tumor-targeted toxin in Bacillus anthracis

    Energy Technology Data Exchange (ETDEWEB)

    Bachran, Christopher; Abdelazim, Suzanne; Fattah, Rasem J.; Liu, Shihui [National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD 20892 (United States); Leppla, Stephen H., E-mail: sleppla@niaid.nih.gov [National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD 20892 (United States)

    2013-01-04

    Highlights: Black-Right-Pointing-Pointer Non-infectious and protease-deficient Bacillus anthracis protein expression system. Black-Right-Pointing-Pointer Successful expression and purification of a tumor-targeted fusion protein drug. Black-Right-Pointing-Pointer Very low endotoxin contamination of purified protein. Black-Right-Pointing-Pointer Efficient protein secretion simplifies purification. Black-Right-Pointing-Pointer Functional anti-tumor fusion protein purified. -- Abstract: Many recombinant therapeutic proteins are purified from Escherichia coli. While expression in E. coli is easily achieved, some disadvantages such as protein aggregation, formation of inclusion bodies, and contamination of purified proteins with the lipopolysaccharides arise. Lipopolysaccharides have to be removed to prevent inflammatory responses in patients. Use of the Gram-positive Bacillus anthracis as an expression host offers a solution to circumvent these problems. Using the multiple protease-deficient strain BH460, we expressed a fusion of the N-terminal 254 amino acids of anthrax lethal factor (LFn), the N-terminal 389 amino acids of diphtheria toxin (DT389) and human transforming growth factor alpha (TGF{alpha}). The resulting fusion protein was constitutively expressed and successfully secreted by B. anthracis into the culture supernatant. Purification was achieved by anion exchange chromatography and proteolytic cleavage removed LFn from the desired fusion protein (DT389 fused to TGF{alpha}). The fusion protein showed the intended specific cytotoxicity to epidermal growth factor receptor-expressing human head and neck cancer cells. Final analyses showed low levels of lipopolysaccharides, originating most likely from contamination during the purification process. Thus, the fusion to LFn for protein secretion and expression in B. anthracis BH460 provides an elegant tool to obtain high levels of lipopolysaccharide-free recombinant protein.

  3. Bioconjugated PLGA-4-arm-PEG branched polymeric nanoparticles as novel tumor targeting carriers

    Energy Technology Data Exchange (ETDEWEB)

    Ding Hong; Yong, Ken-Tye; Roy, Indrajit; Hu Rui; Zhao Lingling; Law, Wing-Cheung; Ji Wei; Liu Liwei; Bergey, Earl J; Prasad, Paras N [Department of Chemistry, Institute for Lasers, Photonics and Biophotonics, University at Buffalo, State University of New York, Buffalo, NY 14260 (United States); Wu Fang [Department of Pharmaceutical Sciences, University at Buffalo, State University of New York, Buffalo, NY 14260 (United States); Zhao Weiwei, E-mail: bergeye@buffalo.edu, E-mail: pnprasad@buffalo.edu [Department of Microbiology and Immunology, University at Buffalo, State University of New York, Buffalo, NY 14215 (United States)

    2011-04-22

    In this study, we have developed a novel carrier, micelle-type bioconjugated PLGA-4-arm-PEG branched polymeric nanoparticles (NPs), for the detection and treatment of pancreatic cancer. These NPs contained 4-arm-PEG as corona, and PLGA as core, the particle surface was conjugated with cyclo(arginine-glycine-aspartate) (cRGD) as ligand for in vivo tumor targeting. The hydrodynamic size of the NPs was determined to be 150-180 nm and the critical micellar concentration (CMC) was estimated to be 10.5 mg l{sup -1}. Our in vitro study shows that these NPs by themselves had negligible cytotoxicity to human pancreatic cancer (Panc-1) and human glioblastoma (U87) cell lines. Near infrared (NIR) microscopy and flow cytometry demonstrated that the cRGD conjugated PLGA-4-arm-PEG polymeric NPs were taken up more efficiently by U87MG glioma cells, over-expressing the {alpha}{sub v{beta}3} integrin, when compared with the non-targeted NPs. Whole body imaging showed that the cRGD conjugated PLGA-4-arm-PEG branched polymeric NPs had the highest accumulation in the pancreatic tumor site of mice at 48 h post-injection. Physical, hematological, and pathological assays indicated low in vivo toxicity of this NP formulation. These studies on the ability of these bioconjugated PLGA-4-arm-PEG polymeric NPs suggest that the prepared polymeric NPs may serve as a promising platform for detection and targeted drug delivery for pancreatic cancer.

  4. Change of tumor target volume during waiting time for intensity-modulated radiotherapy (IMRT) in nasopharyngeal carcinoma

    International Nuclear Information System (INIS)

    Chen Bo; Yi Junlin; Gao Li; Xu Guozhen; Huang Xiaodong; Zhang Zhong; Luo Jingwei; Li Suyan

    2007-01-01

    Objective: To determine the influence of change in tumor target volume of nasopharyngeal carcinoma (NPC) while waiting for intensity modulated radiation therapy (IMRT). Methods: From March 2005 to December 2005, 31 patients with nasopharyngeal carcinoma received IMRT as the initial treatment at the Cancer Hospital of Chinese Academic of Medical Sciences. The original simulation CT scan was acquired before IMRT planning. A second CT scan was acquired before the start of radiotherapy. Wait- ing time was defined as the duration between CT simulation and start of radiotherapy. CT-CT fusion was used to minimize the error of delineation between the first tumor target volume (GTV) and the second tumor target volume (sGTV). Tumor target volume was calculated by treatment planning system. T test was carried out to analyse the difference between GTV and sGTV. Pearson correlation and multivariate linear regression was used to analyse the influence factor of the change betweent GTV and sGTV. Results: Median waiting time was 18 days (range, 9-27 days). There were significant differences between GTV and sGTV of both primary tumor (P=0.009) and metastatic lymphoma (P=0.005 ). Both Pearson correlation and multivariate linear regression showed that the change of primary tumor target volume had significant correlation with the first tumor target volume but had no significant correlation with the waiting time, sex, age, T stage and N stage (1992 Chinese Fuzhou Staging Classification). Conclusions: Within the range of the waiting time ob- served in our study, large volume primary tumor would have had a significant increase in volume, but whether the therapeutic effect would be influenced or not would need to be proved by study of large number of cases. Patients with large volume tumor should be considered to reduce the influence of waiting time by enlarging gross target volume and clinical targe volume and by neoadjuveant chemotherapy. For avoiding the unnecessary high-dose to normal

  5. Improved tumor-targeting MRI contrast agents: Gd(DOTA) conjugates of a cycloalkane-based RGD peptide

    International Nuclear Information System (INIS)

    Park, Ji-Ae; Lee, Yong Jin; Ko, In Ok; Kim, Tae-Jeong; Chang, Yongmin; Lim, Sang Moo; Kim, Kyeong Min; Kim, Jung Young

    2014-01-01

    Highlights: • Development of improved tumor-targeting MRI contrast agents. • To increase the targeting ability of RGD, we developed cycloalkane-based RGD peptides. • Gd(DOTA) conjugates of cycloalkane-based RGD peptide show improved tumor signal enhancement in vivo MR images. - Abstract: Two new MRI contrast agents, Gd-DOTA-c(RGD-ACP-K) (1) and Gd-DOTA-c(RGD-ACH-K) (2), which were designed by incorporating aminocyclopentane (ACP)- or aminocyclohexane (ACH)-carboxylic acid into Gd-DOTA (gadolinium-tetraazacyclo dodecanetetraacetic acid) and cyclic RGDK peptides, were synthesized and evaluated for tumor-targeting ability in vitro and in vivo. Binding affinity studies showed that both 1 and 2 exhibited higher affinity for integrin receptors than cyclic RGDyK peptides, which were used as a reference. These complexes showed high relaxivity and good stability in human serum and have the potential to improve target-specific signal enhancement in vivo MR images

  6. Improved tumor-targeting MRI contrast agents: Gd(DOTA) conjugates of a cycloalkane-based RGD peptide

    Energy Technology Data Exchange (ETDEWEB)

    Park, Ji-Ae, E-mail: jpark@kirams.re.kr [Molecular Imaging Research Center, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of); Lee, Yong Jin; Ko, In Ok [Molecular Imaging Research Center, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of); Kim, Tae-Jeong; Chang, Yongmin [Institute of Biomedical Engineering, Kyungpook National University, Daegu (Korea, Republic of); Lim, Sang Moo [Department of Nuclear Medicine, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of); Kim, Kyeong Min [Molecular Imaging Research Center, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of); Kim, Jung Young, E-mail: jykim@kirams.re.kr [Molecular Imaging Research Center, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of)

    2014-12-12

    Highlights: • Development of improved tumor-targeting MRI contrast agents. • To increase the targeting ability of RGD, we developed cycloalkane-based RGD peptides. • Gd(DOTA) conjugates of cycloalkane-based RGD peptide show improved tumor signal enhancement in vivo MR images. - Abstract: Two new MRI contrast agents, Gd-DOTA-c(RGD-ACP-K) (1) and Gd-DOTA-c(RGD-ACH-K) (2), which were designed by incorporating aminocyclopentane (ACP)- or aminocyclohexane (ACH)-carboxylic acid into Gd-DOTA (gadolinium-tetraazacyclo dodecanetetraacetic acid) and cyclic RGDK peptides, were synthesized and evaluated for tumor-targeting ability in vitro and in vivo. Binding affinity studies showed that both 1 and 2 exhibited higher affinity for integrin receptors than cyclic RGDyK peptides, which were used as a reference. These complexes showed high relaxivity and good stability in human serum and have the potential to improve target-specific signal enhancement in vivo MR images.

  7. Macromolecular pHPMA-based nanoparticles with cholesterol for solid tumor targeting: behavior in HSA protein environment

    Czech Academy of Sciences Publication Activity Database

    Zhang, X.; Niebuur, B.-J.; Chytil, Petr; Etrych, Tomáš; Filippov, Sergey K.; Kikhney, A.; Wieland, D. C. F.; Svergun, D. I.; Papadakis, C. M.

    2018-01-01

    Roč. 19, č. 2 (2018), s. 470-480 ISSN 1525-7797 R&D Projects: GA ČR(CZ) GC15-10527J; GA MZd(CZ) NV16-28594A; GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : polymer carriers * N-(2-hydroxypropyl)methacrylamide * tumor targeting Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.246, year: 2016

  8. Passive tumor targeting of polymer therapeutics: in vivo imaging of both the polymer carrier and the enzymatically cleavable drug model

    Czech Academy of Sciences Publication Activity Database

    Pola, Robert; Heinrich, A. K.; Mueller, T.; Kostka, Libor; Mäder, K.; Pechar, Michal; Etrych, Tomáš

    2016-01-01

    Roč. 16, č. 11 (2016), s. 1577-1582 ISSN 1616-5187 R&D Projects: GA ČR(CZ) GA15-02986S; GA ČR(CZ) GA16-17207S; GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : polymer drug carriers * tumor targeting * enzymatic release Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.238, year: 2016

  9. High molecular weight chitosan derivative polymeric micelles encapsulating superparamagnetic iron oxide for tumor-targeted magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Xiao Y

    2015-02-01

    Full Text Available Yunbin Xiao,1,* Zuan Tao Lin,2,* Yanmei Chen,1 He Wang,1 Ya Li Deng,2 D Elizabeth Le,3 Jianguo Bin,1 Meiyu Li,1 Yulin Liao,1 Yili Liu,1 Gangbiao Jiang,2 Jianping Bin1 1State Key Laboratory of Organ Failure Research, Division of Cardiology, Nanfang Hospital, Southern Medical University, Guangzhou, People’s Republic of China; 2Department of Pharmaceutical Engineering, South China Agricultural University, Guangzhou, People’s Republic of China; 3Cardiovascular Division, Oregon Health and Science University, Portland, OR, USA *These authors contributed equally to this work Abstract: Magnetic resonance imaging (MRI contrast agents based on chitosan derivatives have great potential for diagnosing diseases. However, stable tumor-targeted MRI contrast agents using micelles prepared from high molecular weight chitosan derivatives are seldom reported. In this study, we developed a novel tumor-targeted MRI vehicle via superparamagnetic iron oxide nanoparticles (SPIONs encapsulated in self-aggregating polymeric folate-conjugated N-palmitoyl chitosan (FAPLCS micelles. The tumor-targeting ability of FAPLCS/SPIONs was demonstrated in vitro and in vivo. The results of dynamic light scattering experiments showed that the micelles had a relatively narrow size distribution (136.60±3.90 nm and excellent stability. FAPLCS/SPIONs showed low cytotoxicity and excellent biocompatibility in cellular toxicity tests. Both in vitro and in vivo studies demonstrated that FAPLCS/SPIONs bound specifically to folate receptor-positive HeLa cells, and that FAPLCS/SPIONs accumulated predominantly in established HeLa-derived tumors in mice. The signal intensities of T2-weighted images in established HeLa-derived tumors were reduced dramatically after intravenous micelle administration. Our study indicates that FAPLCS/SPION micelles can potentially serve as safe and effective MRI contrast agents for detecting tumors that overexpress folate receptors. Keywords: superparamagnetic

  10. The Trope of Apotheosis and Intimations of Self-Immolation: A ...

    African Journals Online (AJOL)

    Contemporary Journal of African Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 4, No 1 (2016) >. Log in or Register to get access to full text downloads.

  11. RGD-modified poly(D,L-lactic acid nanoparticles enhance tumor targeting of oridonin

    Directory of Open Access Journals (Sweden)

    Xu J

    2012-01-01

    -PLA-NPs or ORI solution. Consistent with these observations, ORI-PLA-RGD-NPs showed greater antitumor efficacy than ORI-PLA-RGD-NPs or ORI solution, as reflected by the decreased tumor growth and the prolonged survival time of mice bearing H22 tumors.Conclusion: The tumor-targeting efficiency and subsequent antitumor efficacy of ORI is increased by incorporation into ORI-PLA-RGD-NPs.Keywords: ORI, antitumor activity, RGD, poly(D,L-lactic acid, nanoparticles

  12. Bilayered near-infrared fluorescent nanoparticles based on low molecular weight PEI for tumor-targeted in vivo imaging

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Hao; Li, Ke [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China); Xu, Liang [The University of Kansas, Department of Molecular Biosciences (United States); Wu, Daocheng, E-mail: wudaocheng@mail.xjtu.edu.cn [Xi’an Jiaotong University, Key Laboratory of Biomedical Information Engineering of Education Ministry, School of Life Science and Technology (China)

    2014-12-15

    To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications.

  13. Bilayered near-infrared fluorescent nanoparticles based on low molecular weight PEI for tumor-targeted in vivo imaging

    International Nuclear Information System (INIS)

    Liu, Hao; Li, Ke; Xu, Liang; Wu, Daocheng

    2014-01-01

    To improve the tumor fluorescent imaging results in vivo, bilayered nanoparticles encapsulating a lipophilic near-infrared (NIR) fluorescent dye 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotri-carbocyanine iodide (DiR) were prepared using low molecular weight stearic acid-grafted polyethyleneimine and hyaluronic acid (DiR-PgSHA nanoparticles), which were investigated as a novel NIR fluorescent nano-probe for in vivo tumor-targeted optical imaging. These nanoparticles were characterized by transmission electron microscopy (TEM), infrared (IR) spectra, UV-visual absorption, and fluorescent emission spectra. Their cytotoxicity in vitro and hepatotoxicity in vivo were tested by MTT assay and histological study, respectively. In vivo NIR fluorescence imaging of the DiR-PgSHA nanoparticles was performed using a Carestream imaging system. The DiR-PgSHA nanoparticles were sphere shaped with a diameter of approximately 50 nm according to the TEM images. The DiR-PgSHA nanoparticles had a low cytotoxicity in vitro according to the MTT assay and low hepatotoxicity in vivo as determined in histological studies. The fluorescent emission of DiR-PgSHA nanoparticles was stable in pH values of 5–9 in solution, with only slight blue-shifts of the emission maxima at the basic pH range. The DiR-PgSHA nanoparticles exhibited a substantial tumor-targeting ability in the optical imaging with the use of tumor-bearing mice. These results demonstrated that the DiR-PgSHA nanoparticle is an excellent biocompatible nano-probe for in vivo tumor-targeted NIR fluorescence imaging with a potential for clinical applications

  14. Dual actions of albumin packaging and tumor targeting enhance the antitumor efficacy and reduce the cardiotoxicity of doxorubicin in vivo

    Directory of Open Access Journals (Sweden)

    Zheng K

    2015-08-01

    Full Text Available Ke Zheng,1 Rui Li,2 Xiaolei Zhou,2 Ping Hu,2 Yaxin Zhang,2 Yunmei Huang,3 Zhuo Chen,2 Mingdong Huang2 1College of Chemistry, Fuzhou University, Fuzhou, People’s Republic of China; 2State Key Laboratory of Structural Chemistry, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, People’s Republic of China; 3Fujian Academy of Integrative Medicine, Fujian University of Traditional Chinese Medicine, Fuzhou, People’s Republic of China Abstract: Doxorubicin (DOX is an effective chemotherapy drug used to treat different types of cancers. However, DOX has severe side effects, especially life-threatening cardiotoxicity. We herein report a new approach to reduce the toxicity of DOX by embedding DOX inside human serum albumin (HSA. HSA is further fused by a molecular biology technique with a tumor-targeting agent, amino-terminal fragment of urokinase (ATF. ATF binds with a high affinity to urokinase receptor, which is a cell-surface receptor overexpressed in many types of tumors. The as-prepared macromolecule complex (ATF–HSA:DOX was not as cytotoxic as free DOX to cells in vitro, and was mainly localized in cell cytosol in contrast to DOX that was localized in cell nuclei. However, in tumor-bearing mice, ATF–HSA:DOX was demonstrated to have an enhanced tumor-targeting and antitumor efficacy compared with free DOX. More importantly, histopathological examinations of the hearts from the mice treated with ATF–HSA:DOX showed a significantly reduced cardiotoxicity compared with hearts from mice treated with free DOX. These results demonstrate the feasibility of this approach in reducing the cardiotoxicity of DOX while strengthening its antitumor efficacy. Such a tumor-targeted albumin packaging strategy can also be applied to other antitumor drugs. Keywords: amino-terminal fragment of urokinase, urokinase receptor, drug carrier, human serum albumin, doxorubicin, cytotoxicity

  15. Chondroitin sulfate-functionalized polyamidoamine as a tumor-targeted carrier for miR-34a delivery.

    Science.gov (United States)

    Chen, Wenqi; Liu, Yong; Liang, Xiao; Huang, Yu; Li, Quanshun

    2017-07-15

    Chondroitin sulfate (CS) was modified on a polyamidoamine dendrimer (PAMAM) through Michael addition to construct a tumor-targeted carrier CS-PAMAM for miR-34a delivery. The derivative CS-PAMAM was demonstrated to achieve an efficient cellular uptake of miR-34a in a CD44-dependent endocytosis way and further facilitate the endosomal escape of miR-34a after 4h. Through the miR-34a delivery, obvious inhibition of cell proliferation could be detected which was attributed to the enhancement of cell apoptosis and cell cycle arrest, and meanwhile the cell migration and invasion has been observed to be inhibited. Finally, the intravenous injection of CS-PAMAM/miR-34a formulation into mice bearing human lung adenocarcinoma cell A549 xenografts could efficiently inhibit the tumor growth and induce the tumor apoptosis owing to the enhanced accumulation of miR-34a in tumor tissue. Overall, CS-PAMAM is potential to be used as a tumor-targeted oligonucleotide carrier for achieving tumor gene therapy. The cationic dendrimer PAMAM was modified by chondroitin sulfate (CS) through Michael addition to construct a tumor-targeted carrier CS-PAMAM for miR-34a delivery. The introduction of CS could achieve an efficient cellular uptake and intracellular transfection of miR-34a in a CD44-dependent endocytosis manner. The miR-34a delivery could execute the anti-proliferation activity by simultaneously inducing cell apoptosis and cell cycle arrest, and also the anti-migration activity. The CS-PAMAM-mediated systemic delivery of miR-34a showed significant inhibition of tumor growth and induction of tumor apoptosis using a mice model of subcutaneously implanted tumors. Copyright © 2017 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  16. Biological Evaluation of 99mTc-HYNIC-EDDA/tricine-(Ser)-D4 Peptide for Tumor Targeting.

    Science.gov (United States)

    Kazemi, Ziba; Zahmatkesh, Mona Haddad; Abedi, Seyed Mohammad; Hosseinimehr, Seyed Jalal

    2017-08-24

    D4 small peptide (Leu-Ala-Arg-Leu-Leu-Thr) was selected as an appropriate agent for specific targeting of epidermal growth factor receptor (EGFR). The aim of study was to investigate the 99mTc-labeled D4 peptide for non-small cell lung tumor targeting. HYNIC-(Ser)3-D4 peptide was labeled with 99mTc using mixture of tricine and ethylenediamine diacetic acid (EDDA) as co-ligands. The in vitro cellular uptake of radiolabeled peptide was evaluated by blocking test on human non-small cell lung cancer (A-549) cell line and its biodistribution was evaluated in A-549 xenografted nude mice. This conjugated peptide was labeled with 99mTc in high radiochemical purity and it was highly stable in buffer and serum. The un-blocked to blocked cellular radioactivity ratio was 4- fold that showed a specific binding of this radiolabeled peptide on A-549 cell. Animal biodistribution in A-549 xenografted nude mice showed rapid clearance from blood and other non-target organs. Tumor uptake values as %ID/g (percentage of injection dose per gram of tissue) were 2.47% and 1.30% at 1 and 4 h after injection. This study showed the 99mTc-EDDA/tricine-HYNIC-(Ser)3-D4 peptide had tumor targeting on the non-small cell lung tumor. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  17. Multiple cues on the physiochemical, mesenchymal, and intracellular trafficking interactions with nanocarriers to maximize tumor target efficiency

    Directory of Open Access Journals (Sweden)

    Kim SW

    2015-06-01

    Full Text Available Sang-Woo Kim, Dongwoo Khang Nanomedicine Laboratory, Department of Molecular Medicine, School of Medicine, Gachon University, Incheon, South Korea Abstract: Over the past 60 years, numerous medical strategies have been employed to overcome neoplasms. In fact, with the exception of lung, bronchial, and pancreatic cancers, the 5-year survival rate of most cancers currently exceeds 70%. However, the quality of life of patients during chemotherapy remains unsatisfactory despite the increase in survival rate. The side effects of current chemotherapies stem from poor target efficiency at tumor sites due to the uncontrolled biodistribution of anticancer agents (ie, conventional or current approved nanodrugs. This review discusses the effective physiochemical factors for determining biodistribution of nanocarriers and, ultimately, increasing tumor-targeting probability by avoiding the reticuloendothelial system. Second, stem cell-conjugated nanotherapeutics was addressed to maximize the tumor searching ability and to inhibit tumor growth. Lastly, physicochemical material properties of anticancer nanodrugs were discussed for targeting cellular organelles with modulation of drug-release time. A better understanding of suggested topics will increase the tumor-targeting ability of anticancer drugs and, ultimately, promote the quality of life of cancer patients during chemotherapy. Keywords: cancer, anticancer nanodrugs, mesenchymal stem cell, intracellular trafficking

  18. A pre-protective strategy for precise tumor targeting and efficient photodynamic therapy with a switchable DNA/upconversion nanocomposite.

    Science.gov (United States)

    Yu, Zhengze; Ge, Yegang; Sun, Qiaoqiao; Pan, Wei; Wan, Xiuyan; Li, Na; Tang, Bo

    2018-04-14

    Tumor-specific targeting based on folic acid (FA) is one of the most common and significant approaches in cancer therapy. However, the expression of folate receptors (FRs) in normal tissues will lead to unexpected targeting and unsatisfactory therapeutic effect. To address this issue, we develop a pre-protective strategy for precise tumor targeting and efficient photodynamic therapy (PDT) using a switchable DNA/upconversion nanocomposite, which can be triggered in the acidic tumor microenvironment. The DNA/upconversion nanocomposite is composed of polyacrylic acid (PAA) coated upconversion nanoparticles (UCNPs), the surface of which is modified using FA and chlorin e6 (Ce6) functionalized DNA sequences with different lengths. Initially, FA on the shorter DNA was protected by a longer DNA to prevent the bonding to FRs on normal cells. Once reaching the acidic tumor microenvironment, C base-rich longer DNA forms a C-quadruplex, resulting in the exposure of the FA groups and the bonding of FA and FRs on cancer cell membranes to achieve precise targeting. Simultaneously, the photosensitizer chlorin e6 (Ce6) gets close to the surface of UCNPs, enabling the excitation of Ce6 to generate singlet oxygen ( 1 O 2 ) under near infrared light via Förster resonance energy transfer (FRET). In vivo experiments indicated that higher tumor targeting efficiency was achieved and the tumor growth was greatly inhibited through the pre-protective strategy.

  19. Nano-sized metabolic precursors for heterogeneous tumor-targeting strategy using bioorthogonal click chemistry in vivo.

    Science.gov (United States)

    Lee, Sangmin; Jung, Seulhee; Koo, Heebeom; Na, Jin Hee; Yoon, Hong Yeol; Shim, Man Kyu; Park, Jooho; Kim, Jong-Ho; Lee, Seulki; Pomper, Martin G; Kwon, Ick Chan; Ahn, Cheol-Hee; Kim, Kwangmeyung

    2017-12-01

    Herein, we developed nano-sized metabolic precursors (Nano-MPs) for new tumor-targeting strategy to overcome the intrinsic limitations of biological ligands such as the limited number of biological receptors and the heterogeneity in tumor tissues. We conjugated the azide group-containing metabolic precursors, triacetylated N-azidoacetyl-d-mannosamine to generation 4 poly(amidoamine) dendrimer backbone. The nano-sized dendrimer of Nano-MPs could generate azide groups on the surface of tumor cells homogeneously regardless of cell types via metabolic glycoengineering. Importantly, these exogenously generated 'artificial chemical receptors' containing azide groups could be used for bioorthogonal click chemistry, regardless of phenotypes of different tumor cells. Furthermore, in tumor-bearing mice models, Nano-MPs could be mainly localized at the target tumor tissues by the enhanced permeation and retention (EPR) effect, and they successfully generated azide groups on tumor cells in vivo after an intravenous injection. Finally, we showed that these azide groups on tumor tissues could be used as 'artificial chemical receptors' that were conjugated to bioorthogonal chemical group-containing liposomes via in vivo click chemistry in heterogeneous tumor-bearing mice. Therefore, overall results demonstrated that our nano-sized metabolic precursors could be extensively applied to new alternative tumor-targeting technique for molecular imaging and drug delivery system, regardless of the phenotype of heterogeneous tumor cells. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Evaluation of tumor targeting with radiolabeled F(ab2 fragment of a humanized monoclonal antibody

    Directory of Open Access Journals (Sweden)

    "Babaei MH

    2002-08-01

    Full Text Available Humanized monoclonal antibody U36 and its F(ab'2 fragment, radio labeled with 125I, were tested for tumor localization in nude mice bearing a squamous cell carcinoma xenograft line derived from a head and neck carcinoma. Monoclonal antibody IgG or F(ab'2 fragment were injected in parallel and at days 1, 2 and 3, mice were dissected for determination of isotope biodistribution. IgG as well as F(ab'2 showed highly specific localization in tumor tissue. The mean tumor uptake (n=3 is expressed as the percentage of the injected dose per gram of tumor tissue (%ID/g. %ID/g of IgG was 11.7% at day 1 and decreased to 10.9% at day 3 whereas %ID/g of F(ab'2 was 2.9% at day 1 and decreased on following days. Tumor to blood ratios (T/B at day 1 were 0.86 for IgG and 1.32 for F(ab'2 and reached a maximum at day 3 with values of 4.41 and 1.84 respectively. These findings suggest that the superior tumor to non-tumor ratios in the day of 1 render the F(ab'2 fragment more qualified for specific targeting radioisotopes to tumor xenografts in this exprimental setting.

  1. Enhanced anticancer efficacy of paclitaxel through multistage tumor-targeting liposomes modified with RGD and KLA peptides

    Directory of Open Access Journals (Sweden)

    Sun J

    2017-02-01

    Full Text Available Jiawei Sun,1 Lei Jiang,2 Yi Lin,3 Ethan Michael Gerhard,4 Xuehua Jiang,1 Li Li,3 Jian Yang,4 Zhongwei Gu3 1West China School of Pharmacy, Sichuan University, Chengdu, Sichuan, 2Department of Pharmaceutics, China Pharmaceutical University, Nanjing, Jiangsu, 3National Engineering Research Center for Biomaterials, Sichuan University, Chengdu, Sichuan, People’s Republic of China; 4Department of Biomedical Engineering Materials Research Institute, The Huck Institutes of The Life Sciences, The Pennsylvania State University, University Park, PA, USA Abstract: Mitochondria serve as both “energy factories” and “suicide weapon stores” of cells. Targeted delivery of cytotoxic drugs to the mitochondria of tumor cells and tumor vascular cells is a promising strategy to improve the efficacy of chemotherapy. Here, multistage tumor-targeting liposomes containing two targeted peptide-modified lipids, cRGD-PEG2000-DSPE and KLA-PEG2000-DSPE, were developed for encapsulation of the anticancer drug paclitaxel (PTX, RGD-KLA/PTX-Lips. Compared with Taxol (free PTX, RGD/PTX-Lips and KLA/PTX-Lips, the half-maximal inhibitory concentration (IC50 value of RGD-KLA/PTX-Lips in vitro was 1.9-, 36.7- and 22.7-fold lower with 4T1 cells, respectively, because of higher levels of cellular uptake. Similar results were also observed with human umbilical vascular endothelial cells (HUVECs. An apoptosis assay showed that the total apoptotic ratio of RGD-KLA/PTX-Lips was the highest because of the mitochondria-targeted drug delivery and the activation of mitochondrial apoptosis pathways, as evidenced by visible mitochondrial localization, decreased mitochondrial membrane potential, release of cytochrome c and increased activities of caspase-9 and caspase-3. The strongest tumor growth inhibition (TGI; 80.6% and antiangiogenesis effects without systemic toxicity were also observed in RGD-KLA/PTX-Lip-treated 4T1 tumor xenograft BALB/c mice. In conclusion, these multistage

  2. Novel functionalized nanoparticles for tumor-targeting co-delivery of doxorubicin and siRNA to enhance cancer therapy

    Directory of Open Access Journals (Sweden)

    Xia Y

    2017-12-01

    Full Text Available Yu Xia, Tiantian Xu, Changbing Wang, Yinghua Li, Zhengfang Lin, Mingqi Zhao, Bing Zhu Central Laboratory, Guangzhou Women and Children’s Medical Center, Guangzhou Medical University, Guangzhou, People’s Republic of China Abstract: Human homeobox protein (Nanog is highly expressed in most cancer cells and has gradually emerged as an excellent target in cancer therapy, owing to its regulation of cancer cell proliferation, metastasis and apoptosis. In this study, we prepared tumor-targeting functionalized selenium nanoparticles (RGDfC-SeNPs to load chemotherapeutic doxorubicin (DOX and Nanog siRNA. Herein, RGDfC peptide was used as a tumor-targeting moiety which could specifically bind to αvβ3 integrins overexpressed on various cancer cells. The sizes of RGDfC-SeNPs@DOX nanoparticles (~12 nm were confirmed by both dynamic light scattering and transmission electron microscopy. The chemical structure of RGDfC-SeNPs@DOX was characterized via Fourier-transform infrared spectroscopy. The RGDfC-SeNPs@DOX was compacted with siRNA (anti-Nanog by electrostatic interaction to fabricate the RGDfC-SeNPs@DOX/siRNA complex. The RGDfC-SeNPs@DOX/siRNA complex nanoparticles could efficiently enter into HepG2 cells via clathrin-associated endocytosis, and showed high gene transfection efficiency that resulted in enhanced gene silencing. The in vivo biodistribution experiment indicated that RGDfC-SeNPs@DOX/siRNA nanoparticles were capable of specifically accumulating in the tumor site. Furthermore, treatment with RGDfC-SeNPs@DOX/siRNA resulted in a more significant anticancer activity than the free DOX, RGDfC-SeNPs@DOX or RGDfC-SeNPs/siRNA in vitro and in vivo. In summary, this study shows a novel type of DOX and siRNA co-delivery system, thereby providing an alternative route for cancer treatment. Keywords: nanoparticles, tumor targeting, drug delivery, doxorubicin, Nanog siRNA

  3. Nano-Engineered Mesenchymal Stem Cells Increase Therapeutic Efficacy of Anticancer Drug Through True Active Tumor Targeting.

    Science.gov (United States)

    Layek, Buddhadev; Sadhukha, Tanmoy; Panyam, Jayanth; Prabha, Swayam

    2018-06-01

    Tumor-targeted drug delivery has the potential to improve therapeutic efficacy and mitigate non-specific toxicity of anticancer drugs. However, current drug delivery approaches rely on inefficient passive accumulation of the drug carrier in the tumor. We have developed a unique, truly active tumor-targeting strategy that relies on engineering mesenchymal stem cells (MSC) with drug-loaded nanoparticles. Our studies using the A549 orthotopic lung tumor model show that nano-engineered MSCs carrying the anticancer drug paclitaxel (PTX) home to tumors and create cellular drug depots that release the drug payload over several days. Despite significantly lower doses of PTX, nano-engineered MSCs resulted in significant inhibition of tumor growth and superior survival. Anticancer efficacy of nano-engineered MSCs was confirmed in immunocompetent C57BL/6 albino female mice bearing orthotopic Lewis Lung Carcinoma (LL/2-luc) tumors. Furthermore, at doses that resulted in equivalent therapeutic efficacy, nano-engineered MSCs had no effect on white blood cell count, whereas PTX solution and PTX nanoparticle treatments caused leukopenia. Biodistribution studies showed that nano-engineered MSCs resulted in greater than 9-fold higher AUC lung of PTX (1.5 μg.day/g) than PTX solution and nanoparticles (0.2 and 0.1 μg.day/g tissue, respectively) in the target lung tumors. Furthermore, the lung-to-liver and the lung-to-spleen ratios of PTX were several folds higher for nano-engineered MSCs relative to those for PTX solution and nanoparticle groups, suggesting that nano-engineered MSCs demonstrate significantly less off-target deposition. In summary, our results demonstrate that nano-engineered MSCs can serve as an efficient carrier for tumor-specific drug delivery and significantly improved anti-cancer efficacy of conventional chemotherapeutic drugs. Mol Cancer Ther; 17(6); 1196-206. ©2018 AACR . ©2018 American Association for Cancer Research.

  4. Preparation of a folate-mediated tumor targeting ultraparamagnetic polymeric micelles and its in vitro experimental study

    International Nuclear Information System (INIS)

    Hong Guobin; Zhou Jingxing; Shen Jun; Liang Biling; Yuan Renxu; Shuai Xintao

    2008-01-01

    Objective: To evaluate the tumor targeting characteristic of the Folate-SPIO-DOX- Micelles by in vitro studies, and to test the feasibility of monitor tumor targeting using it and clinical MRI. Methods: The polymeric micelles, Folate-SPIO-DOXO-Micelles were prepared. The in vitro tumor cell targeting efficacy of these folate modified and DOX or SPIO-loaded micelles (Folate-SPIO-DOX- MiceUes) was evaluated by observing the cellular uptake of micelles by human hepatic carcinoma cells (Bel 7402 cells) which overexpressed folate surface receptors. Cell suspensions were incubated with Folate-SPIO- DOXO-Micelles for 1 h. Prussian blue staining was performed to show intracellular irons. Flow cytometry was used to further quantify the cellular uptake of the nanoparticles into Bel 7402 cells. MRI was performed to show the signal intensity changes by using T 2 WI sequences at a clinical 1.5 T MR system. Results Prussian blue staining showed much more intracellular iron in cells incubated with Folate-SPIO-DOX- Micelles than the cells incubated with the non-targeting SPIO-DOX-Micelles. As revealed by flow cytometry, the mean fluorescence intensity of cells in the folate group and the non-folate group were 117.88 and 46. 33, respectively. The T 2 signal intensity in MRI of cells treated with the folate targeting micelles decreased significantly(when the concentration of SPIO in cell culture medium was 5, 10, 20, 40, and 80 μg/ml, respectively, T 2 signal intensity decreased by -5.02%, -23.58%, -45.89%, -70.34%, and -92.41%, respectively). In contrast, T 2 signal intensity did not show obvious decrease for cells treated with the folate-free micelles (when the concentration of SPIO in cell culture medium was at 5, 10, 20, 40, and 80 μg/ml, respectively, T 2 signal intensity decreased by -3.77%, -2.16%, -2.18%, -2.74% and -19.77%, respectively). Conclusion: The polymeric micelles, Folate-SPIO-DOX-Micelles has good targeting ability to the hepatic carcinoma cells in vitro, and

  5. Dosimetric evaluation of a moving tumor target in intensity-modulated radiation therapy (IMRT) for lung cancer patients

    Science.gov (United States)

    Kim, Sung Kyu; Kang, Min Kyu; Yea, Ji Woon; Oh, Se An

    2013-07-01

    Immobilization plays an important role in intensity-modulated radiation therapy (IMRT). The application of IMRT in lung cancer patients is very difficult due to the movement of the tumor target. Patient setup in radiation treatment demands high accuracy because IMRT employs a treatment size of a 1mm pixel unit. Hence, quality assurance of the dose delivered to patients must be at its highest. The radiation dose was evaluated for breathing rates of 9, 14, and 18 breaths per minute (bpm) for tumor targets moving up and down by 1.0 cm and 1.5 cm. The dose of the moving planned target volume (PTV) was measured by using a thermo-luminescent dosimeter (TLD) and Gafchromic™ EBT film. The measurement points were 1.0 cm away from the top, the bottom and the left and the right sides of the PTV center. The evaluated dose differences ranged from 94.2 to 103.8%, from 94.4 to 105.4%, and from 90.7 to 108.5% for 9, 14 and 18 bpm, respectively, for a tumor movement of 1.0 cm. The mean values of the doses were 101.4, 99.9, and 99.5% for 9, 14 and 18 bpm, respectively, for a tumor movement of 1.0 cm. Meanwhile, the evaluated dose differences ranged from 93.6 to 105.8%, from 95.9 to 111.5%, and from 96.2 to 111.7% for 9, 14 and 18 bpm, respectively, for a tumor movement of 1.5 cm. The mean values of the doses were 102.3, 103.4, and 103.1% for 9, 14 and 18 bpm, respectively, for a tumor movement of 1.5 cm. Therefore, we suggest that IMRT can be used in the treatment of lung cancer patients with vertical target movements within the range of 1.0 to 1.5 cm.

  6. Long-circulating and passively tumor-targeted polymer-drug conjugates improve the efficacy and reduce the toxicity of radiochemotherapy

    Czech Academy of Sciences Publication Activity Database

    Lammers, T.; Šubr, Vladimír; Ulbrich, Karel; Peschke, P.; Huber, P. E.; Hennink, W. E.; Storm, G.; Kiessling, F.

    2010-01-01

    Roč. 12, č. 9 (2010), B413-B421 ISSN 1438-1656 R&D Projects: GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z40500505 Keywords : HPMA copolymers * targeting * tumor targeting Subject RIV: EI - Biotechnology ; Bionics Impact factor: 1.746, year: 2010

  7. Brain Tumor Targeting of Magnetic Nanoparticles for Potential Drug Delivery: Effect of Administration Route and Magnetic Field Topography

    Science.gov (United States)

    Chertok, Beata; David, Allan E.; Yang, Victor C.

    2011-01-01

    Our previous studies demonstrated feasibility of magnetically-mediated retention of iron-oxide nanoparticles in brain tumors after intravascular administration. The purpose of this study was to elucidate strategies for further improvement of this promising approach. In particular, we explored administration of the nanoparticles via a non-occluded carotid artery as a way to increase the passive exposure of tumor vasculature to nanoparticles for subsequent magnetic entrapment. However, aggregation of nanoparticles in the afferent vasculature interfered with tumor targeting. The magnetic setup employed in our experiments was found to generate a relatively uniform magnetic flux density over a broad range, exposing the region of the afferent vasculature to high magnetic force. To overcome this problem, the magnetic setup was modified with a 9-mm diameter cylindrical NdFeB magnet to exhibit steeper magnetic field topography. Six-fold reduction of the magnetic force at the injection site, achieved with this modification, alleviated the aggregation problem under the conditions of intact carotid blood flow. Using this setup, carotid administration was found to present 1.8-fold increase in nanoparticle accumulation in glioma compared to the intravenous route at 350 mT. This increase was found to be in reasonable agreement with the theoretically estimated 1.9-fold advantage of carotid administration, Rd. The developed approach is expected to present an even greater advantage when applied to drug-loaded nanoparticles exhibiting higher values of Rd. PMID:21763736

  8. Styrene-maleic acid-copolymer conjugated zinc protoporphyrin as a candidate drug for tumor-targeted therapy and imaging.

    Science.gov (United States)

    Fang, Jun; Tsukigawa, Kenji; Liao, Long; Yin, Hongzhuan; Eguchi, Kanami; Maeda, Hiroshi

    2016-01-01

    Previous studies indicated the potential of zinc protoporphyrin (ZnPP) as an antitumor agent targeting to the tumor survival factor heme oxygenase-1, and/or for photodynamic therapy (PDT). In this study, to achieve tumor-targeted delivery, styrene-maleic acid-copolymer conjugated ZnPP (SMA-ZnPP) was synthesized via amide bond, which showed good water solubility, having ZnPP loading of 15%. More importantly, it forms micelles in aqueous solution with a mean particle size of 111.6 nm, whereas it has an apparent Mw of 65 kDa. This micelle formation was not detracted by serum albumin, suggesting it is stable in circulation. Further SMA-ZnPP conjugate will behave as an albumin complex in blood with much larger size (235 kDa) by virtue of the albumin binding property of SMA. Consequently, SMA-ZnPP conjugate exhibited prolonged circulating retention and preferential tumor accumulation by taking advantage of enhanced permeability and retention (EPR) effect. Clear tumor imaging was thus achieved by detecting the fluorescence of ZnPP. In addition, the cytotoxicity and PDT effect of SMA-ZnPP conjugate was confirmed in human cervical cancer HeLa cells. Light irradiation remarkably increased the cytotoxicity (IC50, from 33 to 5 μM). These findings may provide new options and knowledge for developing ZnPP based anticancer theranostic drugs.

  9. Tumor targeted gene therapy

    International Nuclear Information System (INIS)

    Kang, Joo Hyun

    2006-01-01

    Knowledge of molecular mechanisms governing malignant transformation brings new opportunities for therapeutic intervention against cancer using novel approaches. One of them is gene therapy based on the transfer of genetic material to an organism with the aim of correcting a disease. The application of gene therapy to the cancer treatment had led to the development of new experimental approaches such as suicidal gene therapy, inhibition of oncogenes and restoration of tumor-suppressor genes. Suicidal gene therapy is based on the expression in tumor cells of a gene encoding an enzyme that converts a prodrug into a toxic product. Representative suicidal genes are Herpes simplex virus type 1 thymidine kinase (HSV1-tk) and cytosine deaminase (CD). Especially, physicians and scientists of nuclear medicine field take an interest in suicidal gene therapy because they can monitor the location and magnitude, and duration of expression of HSV1-tk and CD by PET scanner

  10. Improved decision making for prioritizing tumor targeting antibodies in human xenografts: Utility of fluorescence imaging to verify tumor target expression, antibody binding and optimization of dosage and application schedule.

    Science.gov (United States)

    Dobosz, Michael; Haupt, Ute; Scheuer, Werner

    2017-01-01

    Preclinical efficacy studies of antibodies targeting a tumor-associated antigen are only justified when the expression of the relevant antigen has been demonstrated. Conventionally, antigen expression level is examined by immunohistochemistry of formalin-fixed paraffin-embedded tumor tissue section. This method represents the diagnostic "gold standard" for tumor target evaluation, but is affected by a number of factors, such as epitope masking and insufficient antigen retrieval. As a consequence, variances and discrepancies in histological staining results can occur, which may influence decision-making and therapeutic outcome. To overcome these problems, we have used different fluorescence-labeled therapeutic antibodies targeting human epidermal growth factor receptor (HER) family members and insulin-like growth factor-1 receptor (IGF1R) in combination with fluorescence imaging modalities to determine tumor antigen expression, drug-target interaction, and biodistribution and tumor saturation kinetics in non-small cell lung cancer xenografts. For this, whole-body fluorescence intensities of labeled antibodies, applied as a single compound or antibody mixture, were measured in Calu-1 and Calu-3 tumor-bearing mice, then ex vivo multispectral tumor tissue analysis at microscopic resolution was performed. With the aid of this simple and fast imaging method, we were able to analyze the tumor cell receptor status of HER1-3 and IGF1R, monitor the antibody-target interaction and evaluate the receptor binding sites of anti-HER2-targeting antibodies. Based on this, the most suitable tumor model, best therapeutic antibody, and optimal treatment dosage and application schedule was selected. Predictions drawn from obtained imaging data were in excellent concordance with outcome of conducted preclinical efficacy studies. Our results clearly demonstrate the great potential of combined in vivo and ex vivo fluorescence imaging for the preclinical development and characterization of

  11. Anti-EGFR-iRGD recombinant protein conjugated silk fibroin nanoparticles for enhanced tumor targeting and antitumor efficiency

    Directory of Open Access Journals (Sweden)

    Bian X

    2016-05-01

    Full Text Available Xinyu Bian,* Puyuan Wu,* Huizi Sha, Hanqing Qian, Qing Wang, Lei Cheng, Yang Yang, Mi Yang, Baorui LiuComprehensive Cancer Center of Drum-Tower Hospital, Medical School of Nanjing University, Clinical Cancer Institute of Nanjing University, Nanjing, People’s Republic of China*These authors contributed equally to this workAbstract: In this study, we report a novel kind of targeting with paclitaxel (PTX-loaded silk fibroin nanoparticles conjugated with iRGD–EGFR nanobody recombinant protein (anti-EGFR-iRGD. The new nanoparticles (called A-PTX-SF-NPs were prepared using the carbodiimide-mediated coupling procedure and their characteristics were evaluated. The cellular cytotoxicity and cellular uptake of A-PTX-SF-NPs were also investigated. The results in vivo suggested that NPs conjugated with the recombinant protein exhibited more targeting and anti-neoplastic property in cells with high EGFR expression. In the in vivo antitumor efficacy assay, the A-PTX-SF-NPs group showed slower tumor growth and smaller tumor volumes than PTX-SF-NPs in a HeLa xenograft mouse model. A real-time near-infrared fluorescence imaging study showed that A-PTX-SF-NPs could target the tumor more effectively. These results suggest that the anticancer activity and tumor targeting of A-PTX-SF-NPs were superior to those of PTX-SF-NPs and may have the potential to be used for targeted delivery for tumor therapies. Keywords: EGFR, nanobody, iRGD, recombinant protein, targeting drug carriers, antitumor efficiency

  12. Tumor-targeted inhibition by a novel strategy - mimoretrovirus expressing siRNA targeting the Pokemon gene.

    Science.gov (United States)

    Tian, Zhiqiang; Wang, Huaizhi; Jia, Zhengcai; Shi, Jinglei; Tang, Jun; Mao, Liwei; Liu, Hongli; Deng, Yijing; He, Yangdong; Ruan, Zhihua; Li, Jintao; Wu, Yuzhang; Ni, Bing

    2010-12-01

    Pokemon gene has crucial but versatile functions in cell differentiation, proliferation and tumorigenesis. It is a master regulator of the ARF-HDM2-p53 and Rb-E2F pathways. The facts that the expression of Pokemon is essential for tumor formation and many kinds of tumors over-express the Pokemon gene make it an attractive target for therapeutic intervention for cancer treatment. In this study, we used an RNAi strategy to silence the Pokemon gene in a cervical cancer model. To address the issues involving tumor specific delivery and durable expression of siRNA, we applied the Arg-Gly-Asp (RGD) peptide ligand and polylysine (K(18)) fusion peptide to encapsulate a recombinant retrovirus plasmid expressing a siRNA targeting the Pokemon gene and produced the 'mimoretrovirus'. At charge ratio 2.0 of fusion peptide/plasmid, the mimoretrovirus formed stable and homogenous nanoparticles, and provided complete DNase I protection and complete gel retardation. This nanoparticle inhibited SiHa cell proliferation and invasion, while it promoted SiHa cell apoptosis. The binding of the nanoparticle to SiHa cells was mediated via the RGD-integrin α(v)β(3) interaction, as evidenced by the finding that unconjugated RGD peptide inhibited this binding significantly. This tumor-targeting mimoretrovirus exhibited excellent anti-tumor capacity in vivo in a nude mouse model. Moreover, the mimoretrovirus inhibited tumor growth with a much higher efficiency than recombinant retrovirus expressing siRNA or the K(18)/P4 nanoparticle lacking the RGD peptide. Results suggest that the RNAi/RGD-based mimoretrovirus developed in this study represents a novel anti-tumor strategy that may be applicable to most research involving cancer therapy and, thus, has promising potential as a cervical cancer treatment.

  13. 99mTc-HYNIC-(tricine/EDDA)-FROP peptide for MCF-7 breast tumor targeting and imaging.

    Science.gov (United States)

    Ahmadpour, Sajjad; Noaparast, Zohreh; Abedi, Seyed Mohammad; Hosseinimehr, Seyed Jalal

    2018-02-19

    Breast cancer is the most common malignancy among women in the world. Development of novel tumor-specific radiopharmaceuticals for early breast tumor diagnosis is highly desirable. In this study we developed 99m Tc-HYNIC-(tricine/EDDA)-Lys-FROP peptide with the ability of specific binding to MCF-7 breast tumor. The FROP-1 peptide was conjugated with the bifunctional chelator hydrazinonicotinamide (HYNIC) and labeled with 99m Tc using tricine/EDDA co-ligand. The cellular specific binding of 99m Tc-HYNIC-FROP was evaluated on different cell lines as well as with blocking experiment on MCF-7 (human breast adenocarcinoma). The tumor targeting and imaging of this labeled peptide were performed on MCF-7 tumor bearing mice. Radiochemical purity for 99m Tc-HYNIC-(tricine/EDDA)-FROP was 99% which was determined with ITLC method. This radiolabeled peptide showed high stability in normal saline and serum about 98% which was monitored with HPLC method. In saturation binding experiments, the binding constant (K d ) to MCF-7 cells was determined to be 158 nM. Biodistribution results revealed that the 99m Tc-HYNIC-FROP was mainly exerted from urinary route. The maximum tumor uptake was found after 30 min post injection (p.i.); however maximum tumor/muscle ratio was seen at 15 min p.i. The tumor uptake of this labeled peptide was specific and blocked by co-injection of excess FROP. According to the planar gamma imaging result, tumor was clearly visible due to the tumor uptake of 99m Tc-HYNIC-(tricine/EDDA)-FROP in mouse after 15 min p.i. The 99m Tc-HYNIC-(tricine/EDDA)-FROP is considered a promising probe with high specific binding to MCF-7 breast cancer cells.

  14. Synthesis and Bioevaluation of Iodine-131 Directly Labeled Cyclic RGD-PEGylated Gold Nanorods for Tumor-Targeted Imaging

    Directory of Open Access Journals (Sweden)

    Yingying Zhang

    2017-01-01

    Full Text Available Introduction. Radiolabeled gold nanoparticles play an important role in biomedical application. The aim of this study was to prepare iodine-131 (131I-labeled gold nanorods (GNRs conjugated with cyclic RGD and evaluate its biological characteristics for targeted imaging of integrin αvβ3-expressing tumors. Methods. HS-PEG(5000-COOH molecules were applied to replace CTAB covering the surface of bare GNRs for better biocompatibility, and c(RGDfK peptides were conjugated onto the carboxyl terminal of GNR-PEG-COOH via EDC/NHS coupling reactions. The nanoconjugate was characterized, and 131I was directly tagged on the surface of GNRs via AuI bonds for SPECT/CT imaging. We preliminarily studied the characteristics of the probe and its feasibility for tumor-targeting SPECT/CT imaging. Results. The [131I]GNR-PEG-cRGD probe was prepared in a simple and rapid manner and was stable in both PBS and fetal bovine serum. It targeted selectively and could be taken up by tumor cells mainly via integrin αvβ3-receptor-mediated endocytosis. In vivo imaging, biodistribution, and autoradiography results showed evident tumor uptake in integrin αvβ3-expressing tumors. Conclusions. These promising results showed that this smart nanoprobe can be used for angiogenesis-targeted SPECT/CT imaging. Furthermore, the nanoprobe possesses a remarkable capacity for highly efficient photothermal conversion in the near-infrared region, suggesting its potential as a multifunctional theranostic agent.

  15. Enhanced tumor targeting of cRGD peptide-conjugated albumin nanoparticles in the BxPC-3 cell line.

    Science.gov (United States)

    Yu, Xinzhe; Song, Yunlong; Di, Yang; He, Hang; Fu, Deliang; Jin, Chen

    2016-08-12

    The emerging albumin nanoparticle brings new hope for the delivery of antitumor drugs. However, a lack of robust tumor targeting greatly limits its application. In this paper, cyclic arginine-glycine-aspartic-conjugated, gemcitabine-loaded human serum albumin nanoparticles (cRGD-Gem-HSA-NPs) were successfully prepared, characterized, and tested in vitro in the BxPC-3 cell line. Initially, 4-N-myristoyl-gemcitabine (Gem-C14) was formed by conjugating myristoyl to the 4-amino group of gemcitabine. Then, cRGD-HSA was synthesized using sulfosuccinimidyl-(4-N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC) cross-linkers. Finally, cRGD-Gem-HSA-NPs were formulated based on the nanoparticle albumin-bound (nab) technology. The resulting NPs were characterized for particle size, zeta potential, morphology, encapsulation efficiency, and drug loading efficiency. In vitro cellular uptake and inhibition studies were conducted to compare Gem-HSA-NPs and cRGD-Gem-HSA-NPs in a human pancreatic cancer cell line (BxPC-3). The cRGD-Gem-HSA-NPs exhibited an average particle size of 160 ± 23 nm. The encapsulation rate and drug loading rate were approximately 83 ± 5.6% and 11 ± 4.2%, respectively. In vitro, the cRGD-anchored NPs exhibited a significantly greater affinity for the BxPC-3 cells compared to non-targeted NPs and free drug. The cRGD-Gem-HSA-NPs also showed the strongest inhibitory effect in the BxPC-3 cells among all the analyzed groups. The improved efficacy of cRGD-Gem-HSA-NPs in the BxPC-3 cell line warrants further in vivo investigations.

  16. Improved tumor targeting of anti-HER2 nanobody through N-succinimidyl 4-guanidinomethyl-3-iodobenzoate radiolabeling.

    Science.gov (United States)

    Pruszynski, Marek; Koumarianou, Eftychia; Vaidyanathan, Ganesan; Revets, Hilde; Devoogdt, Nick; Lahoutte, Tony; Lyerly, H Kim; Zalutsky, Michael R

    2014-04-01

    Nanobodies are approximately 15-kDa proteins based on the smallest functional fragments of naturally occurring heavy chain-only antibodies and represent an attractive platform for the development of molecularly targeted agents for cancer diagnosis and therapy. Because the human epidermal growth factor receptor type 2 (HER2) is overexpressed in breast and ovarian carcinoma, as well as in other malignancies, HER2-specific Nanobodies may be valuable radiodiagnostics and therapeutics for these diseases. The aim of the present study was to evaluate the tumor-targeting potential of anti-HER2 5F7GGC Nanobody after radioiodination with the residualizing agent N-succinimidyl 4-guanidinomethyl 3-(125/131)I-iodobenzoate (*I-SGMIB). The 5F7GGC Nanobody was radiolabeled using *I-SGMIB and, for comparison, with N(ε)-(3-*I-iodobenzoyl)-Lys(5)-N(α)-maleimido-Gly(1)-GEEEK (*I-IB-Mal-d-GEEEK), another residualizing agent, and by direct radioiodination using IODO-GEN ((125)I-Nanobody). The 3 labeled Nanobodies were evaluated in affinity measurements, and paired-label internalization assays were performed on HER2-expressing BT474M1 breast carcinoma cells and in paired-label tissue distribution measurements in mice bearing subcutaneous BT474M1 xenografts. *I-SGMIB-Nanobody was produced in 50.4% ± 3.6% radiochemical yield and exhibited a dissociation constant of 1.5 ± 0.5 nM. Internalization assays demonstrated that intracellular retention of radioactivity was up to 1.5-fold higher for *I-SGMIB-Nanobody than for coincubated (125)I-Nanobody or *I-IB-Mal-d-GEEEK-Nanobody. Peak tumor uptake for *I-SGMIB-Nanobody was 24.50% ± 9.89% injected dose/g at 2 h, 2- to 4-fold higher than observed with other labeling methods, and was reduced by 90% with trastuzumab blocking, confirming the HER2 specificity of localization. Moreover, normal-organ clearance was fastest for *I-SGMIB-Nanobody, such that tumor-to-normal-organ ratios greater than 50:1 were reached by 24 h in all tissues except lungs

  17. A comparison of prostate tumor targeting strategies using magnetic resonance imaging-targeted, transrectal ultrasound-guided fusion biopsy.

    Science.gov (United States)

    Martin, Peter R; Cool, Derek W; Fenster, Aaron; Ward, Aaron D

    2018-03-01

    Magnetic resonance imaging (MRI)-targeted, three-dimensional (3D) transrectal ultrasound (TRUS)-guided prostate biopsy aims to reduce the 21-47% false-negative rate of clinical two-dimensional (2D) TRUS-guided systematic biopsy, but continues to yield false-negative results. This may be improved via needle target optimization, accounting for guidance system errors and image registration errors. As an initial step toward the goal of optimized prostate biopsy targeting, we investigated how needle delivery error impacts tumor sampling probability for two targeting strategies. We obtained MRI and 3D TRUS images from 49 patients. A radiologist and radiology resident assessed these MR images and contoured 81 suspicious regions, yielding tumor surfaces that were registered to 3D TRUS. The biopsy system's root-mean-squared needle delivery error (RMSE) and systematic error were modeled using an isotropic 3D Gaussian distribution. We investigated two different prostate tumor-targeting strategies using (a) the tumor's centroid and (b) a ring in the lateral-elevational plane. For each simulation, targets were spaced at equal arc lengths on a ring with radius equal to the systematic error magnitude. A total of 1000 biopsy simulations were conducted for each tumor, with RMSE and systematic error magnitudes ranging from 1 to 6 mm. The difference in median tumor sampling probability and probability of obtaining a 50% core involvement was determined for ring vs centroid targeting. Our simulation results indicate that ring targeting outperformed centroid targeting in situations where systematic error exceeds RMSE. In these instances, we observed statistically significant differences showing 1-32% improvement in sampling probability due to ring targeting. Likewise, we observed statistically significant differences showing 1-39% improvement in 50% core involvement probability due to ring targeting. Our results suggest that the optimal targeting scheme for prostate biopsy depends on

  18. An effective tumor-targeting strategy utilizing hypoxia-sensitive siRNA delivery system for improved anti-tumor outcome.

    Science.gov (United States)

    Kang, Lin; Fan, Bo; Sun, Ping; Huang, Wei; Jin, Mingji; Wang, Qiming; Gao, Zhonggao

    2016-10-15

    Hypoxia is a feature of most solid tumors, targeting hypoxia is considered as the best validated yet not extensively exploited strategy in cancer therapy. Here, we reported a novel tumor-targeting strategy using a hypoxia-sensitive siRNA delivery system. In the study, 2-nitroimidazole (NI), a hydrophobic component that can be converted to hydrophilic 2-aminoimidazole (AI) through bioreduction under hypoxic conditions, was conjugated to the alkylated polyethyleneimine (bPEI1.8k-C6) to form amphiphilic bPEI1.8k-C6-NI polycations. bPEI1.8k-C6-NI could self-assemble into micelle-like aggregations in aqueous, which contributed to the improved stability of the bPEI1.8k-C6-NI/siRNA polyplexes, resulted in increased cellular uptake. After being transported into the hypoxic tumor cells, the selective nitro-to-amino reduction would cause structural change and elicit a relatively loose structure to facilitate the siRNA dissociation in the cytoplasm, for enhanced gene silencing efficiency ultimately. Therefore, the conflict between the extracellular stability and the intracellular siRNA release ability of the polyplexes was solved by introducing the hypoxia-responsive unit. Consequently, the survivin-targeted siRNA loaded polyplexes shown remarkable anti-tumor effect not only in hypoxic cells, but also in tumor spheroids and tumor-bearing mice, indicating that the hypoxia-sensitive siRNA delivery system had great potential for tumor-targeted therapy. Hypoxia is one of the most remarkable features of most solid tumors, and targeting hypoxia is considered as the best validated strategy in cancer therapy. However, in the past decades, there were few reports about using this strategy in the drug delivery system, especially in siRNA delivery system. Therefore, we constructed a hypoxia-sensitive siRNA delivery system utilizing a hypoxia-responsive unit, 2-nitroimidazole, by which the unavoidable conflict between improved extracellular stability and promoted intracellular si

  19. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  20. A tumor-targeting p53 nanodelivery system limits chemoresistance to temozolomide prolonging survival in a mouse model of glioblastoma multiforme.

    Science.gov (United States)

    Kim, Sang-Soo; Rait, Antonina; Kim, Eric; Pirollo, Kathleen F; Chang, Esther H

    2015-02-01

    Development of temozolomide (TMZ) resistance contributes to the poor prognosis for glioblastoma multiforme (GBM) patients. It was previously demonstrated that delivery of exogenous wild-type tumor suppressor gene p53 via a tumor-targeted nanocomplex (SGT-53) which crosses the blood-brain barrier could sensitize highly TMZ-resistant GBM tumors to TMZ. Here we assessed whether SGT-53 could inhibit development of TMZ resistance. SGT-53 significantly chemosensitized TMZ-sensitive human GBM cell lines (U87 and U251), in vitro and in vivo. Furthermore, in an intracranial GBM tumor model, two cycles of concurrent treatment with systemically administered SGT-53 and TMZ inhibited tumor growth, increased apoptosis and most importantly, significantly prolonged median survival. In contrast TMZ alone had no significant effect on median survival compared to a single cycle of TMZ. These results suggest that combining SGT-53 with TMZ appears to limit development of TMZ resistance, prolonging its anti-tumor effect and could be a more effective therapy for GBM. Using human glioblastoma multiforma cell lines, this research team demonstrated that the delivery of exogenous wild-type tumor suppressor gene p53 via a tumor-targeted nanocomplex limited the development of temozolomide resistance and prolonged its anti-tumor effect, which may enable future human application of this or similar techniques. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. In vivo tumor-targeted dual-modal fluorescence/CT imaging using a nanoprobe co-loaded with an aggregation-induced emission dye and gold nanoparticles.

    Science.gov (United States)

    Zhang, Jimei; Li, Chan; Zhang, Xu; Huo, Shuaidong; Jin, Shubin; An, Fei-Fei; Wang, Xiaodan; Xue, Xiangdong; Okeke, C I; Duan, Guiyun; Guo, Fengguang; Zhang, Xiaohong; Hao, Jifu; Wang, Paul C; Zhang, Jinchao; Liang, Xing-Jie

    2015-02-01

    As an intensely studied computed tomography (CT) contrast agent, gold nanoparticle has been suggested to be combined with fluorescence imaging modality to offset the low sensitivity of CT. However, the strong quenching of gold nanoparticle on fluorescent dyes requires complicated design and shielding to overcome. Herein, we report a unique nanoprobe (M-NPAPF-Au) co-loading an aggregation-induced emission (AIE) red dye and gold nanoparticles into DSPE-PEG(2000) micelles for dual-modal fluorescence/CT imaging. The nanoprobe was prepared based on a facile method of "one-pot ultrasonic emulsification". Surprisingly, in the micelles system, fluorescence dye (NPAPF) efficiently overcame the strong fluorescence quenching of shielding-free gold nanoparticles and retained the crucial AIE feature. In vivo studies demonstrated the nanoprobe had superior tumor-targeting ability, excellent fluorescence and CT imaging effects. The totality of present studies clearly indicates the significant potential application of M-NPAPF-Au as a dual-modal non-invasive fluorescence/X-ray CT nanoprobe for in vivo tumor-targeted imaging and diagnosis. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. PET Imaging of 64Cu-DOTA-scFv-Anti-PSMA Lipid Nanoparticles (LNPs): Enhanced Tumor Targeting over Anti-PSMA scFv or Untargeted LNPs

    Science.gov (United States)

    Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

    2017-01-01

    Introduction Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in Knowledge and implications for patient care Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to a LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery. PMID:28126683

  3. PET imaging of 64Cu-DOTA-scFv-anti-PSMA lipid nanoparticles (LNPs): Enhanced tumor targeting over anti-PSMA scFv or untargeted LNPs

    International Nuclear Information System (INIS)

    Wong, Patty; Li, Lin; Chea, Junie; Delgado, Melissa K.; Crow, Desiree; Poku, Erasmus; Szpikowska, Barbara; Bowles, Nicole; Channappa, Divya; Colcher, David; Wong, Jeffrey Y.C.; Shively, John E.; Yazaki, Paul J.

    2017-01-01

    Introduction: Single chain (scFv) antibodies are ideal targeting ligands due to their modular structure, high antigen specificity and affinity. These monovalent ligands display rapid tumor targeting but have limitations due to their fast urinary clearance. Methods: An anti-prostate membrane antigen (PSMA) scFv with a site-specific cysteine was expressed and evaluated in a prostate cancer xenograft model by Cu-64 PET imaging. To enhance tumor accumulation, the scFv-cys was conjugated to the co-polymer DSPE-PEG-maleimide that spontaneously assembled into a homogeneous multivalent lipid nanoparticle (LNP). Results: The targeted LNP exhibited a 2-fold increase in tumor uptake compared to the scFv alone using two different thiol ester chemistries. The anti-PSMA scFv-LNP exhibited a 1.6 fold increase in tumor targeting over the untargeted LNP. Conclusions: The targeted anti-PSMA scFv-LNP showed enhanced tumor accumulation over the scFv alone or the untargeted DOTA-micelle providing evidence for the development of this system for drug delivery. Advances in knowledge and implications for patient care: Anti-tumor scFv antibody fragments have not achieved their therapeutic potential due to their fast blood clearance. Conjugation to an LNP enables multivalency to the tumor antigen as well as increased molecular size for chemotherapy drug delivery.

  4. Isotopic clusters

    International Nuclear Information System (INIS)

    Geraedts, J.M.P.

    1983-01-01

    Spectra of isotopically mixed clusters (dimers of SF 6 ) are calculated as well as transition frequencies. The result leads to speculations about the suitability of the laser-cluster fragmentation process for isotope separation. (Auth.)

  5. Stable isotopes

    International Nuclear Information System (INIS)

    Evans, D.K.

    1986-01-01

    Seventy-five percent of the world's stable isotope supply comes from one producer, Oak Ridge Nuclear Laboratory (ORNL) in the US. Canadian concern is that foreign needs will be met only after domestic needs, thus creating a shortage of stable isotopes in Canada. This article describes the present situation in Canada (availability and cost) of stable isotopes, the isotope enrichment techniques, and related research programs at Chalk River Nuclear Laboratories (CRNL)

  6. Isotope separation

    International Nuclear Information System (INIS)

    Eerkens, J.W.

    1979-01-01

    A method of isotope separation is described which involves the use of a laser photon beam to selectively induce energy level transitions of an isotope molecule containing the isotope to be separated. The use of the technique for 235 U enrichment is demonstrated. (UK)

  7. Evaluation of cytotoxic and tumor targeting capability of (177)Lu-DOTATATE-nanoparticles: a trailblazing strategy in peptide receptor radionuclide therapy.

    Science.gov (United States)

    Arora, Geetanjali; Dubey, Priyanka; Shukla, Jaya; Ghosh, Sourabh; Bandopadhyaya, Gurupad

    2016-06-01

    We propose an innovative strategy of nanoparticle-mediated-peptide receptor radionuclide therapy (PRRT) employing PLGA-nanoparticles together with anti-β-hCG antibodies that can protect kidneys from radiation damage while simultaneously enhancing its tumor targeting and cytotoxic ability for somatostatin receptor (SSR) positive tumors. PEG-coated-(177)Lu-DOTATATE-PLGA-nanoparticles (PEG-LuD-NP) were formulated and characterized. In vitro toxicity of these particles was tested on human glioblastoma cell line U87MG over a radiation dose range of 19-78 Gy, using MTT assay and flow cytometry. To further enhance cytotoxicity and test the feasibility of active tumor targeting, apoptosis-inducing anti-β-hCG monoclonal antibodies were employed in vitro, after confirming expression of β-hCG on U87MG. In vivo tumor targeting ability of these particles, in comparison to uncoated particles and un-encapsulated (177)Lu-DOTATATE, was assessed by intravenous administration in tumor-induced wistar rats. Rats were first imaged in a gamma camera followed by euthanasia for organ extraction and counting in gamma counter. The particles were spherical in shape with mean diameter of 300 nm. Highest cytotoxicity that could be achieved with PEG-LuD-NP, on radio-resistant U87MG cells, was 35.8 % due to complex cellular response triggered by ionizing radiation. Interestingly, synergistic action of antibodies and PEG-LuD-NP doubled the cytotoxicity (80 %). PEG-LuD-NP showed the highest tumor uptake (4.3 ± 0.46 % ID/g) as compared to (177)Lu-DOTATATE (3.5 ± 0.31 %) and uncoated-(177)Lu-DOTATATE-nanoparticles (3.4 ± 0.35 %) in tumor-inoculated wistar rats (p targeting SSR positive tumors for enhanced cytoxicity and reduced renal radiation dose associated with conventional PRRT. To our knowledge of literature, this is the first study to establish in vitro and in vivo efficacy profile of nanoparticles in PRRT providing a stepping-stone for undergoing and future research

  8. Tumor-targeting properties of 90Y- and 177Lu-labeled α-melanocyte stimulating hormone peptide analogues in a murine melanoma model

    International Nuclear Information System (INIS)

    Miao Yubin; Hoffman, Timothy J.; Quinn, Thomas P.

    2005-01-01

    The purpose of this study was to compare the tumor-targeting properties of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH in a murine melanoma mouse model. Methods: The in vitro properties of cellular internalization and retention of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH were studied in B16/F1 murine melanoma cells. The pharmacokinetics of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH were determined in B16/F1 melanoma-bearing C57 mice. Results: 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH exhibited fast cellular internalization and extended cellular retention in B16/F1 cells. High receptor-mediated tumor uptake and retention coupled with fast whole-body clearance of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH were demonstrated in B16/F1 tumor-bearing C57 mice. The tumor uptakes of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH were 25.70±4.64 and 14.48±0.85 %ID/g at 2 h, and 14.09±2.73 and 17.68±3.32 %ID/g at 4 h postinjection. There was little activity accumulated in normal organs except for kidney. Conclusions: High tumor-targeting properties of 90 Y-DOTA-Re(Arg 11 )CCMSH and 177 Lu-DOTA-Re(Arg 11 )CCMSH highlighted their potential as radiopharmaceuticals for targeted radionuclide therapy of melanoma in further investigations

  9. In vitro study of novel gadolinium-loaded liposomes guided by GBI-10 aptamer for promising tumor targeting and tumor diagnosis by magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Gu MJ

    2015-08-01

    Full Text Available Meng-Jie Gu,1,* Kun-Feng Li,1,* Lan-Xin Zhang,1 Huan Wang,1 Li-Si Liu,2 Zhuo-Zhao Zheng,2 Nan-Yin Han,1 Zhen-Jun Yang,1 Tian-Yuan Fan1 1State Key Laboratory of Natural and Biomimetic Drugs, School of Pharmaceutical Sciences, Peking University, 2Department of Radiology, Peking University Third Hospital, Beijing, People’s Republic of China *These authors contributed equally to this work Abstract: Novel gadolinium-loaded liposomes guided by GBI-10 aptamer were developed and evaluated in vitro to enhance magnetic resonance imaging (MRI diagnosis of tumor. Nontargeted gadolinium-loaded liposomes were achieved by incorporating amphipathic material, Gd (III [N,N-bis-stearylamidomethyl-N'-amidomethyl] diethylenetriamine tetraacetic acid, into the liposome membrane using lipid film hydration method. GBI-10, as the targeting ligand, was then conjugated onto the liposome surface to get GBI-10-targeted gadolinium-loaded liposomes (GTLs. Both nontargeted gadolinium-loaded liposomes and GTLs displayed good dispersion stability, optimal size, and zeta potential for tumor targeting, as well as favorable imaging properties with enhanced relaxivity compared with a commercial MRI contrast agent (CA, gadopentetate dimeglumine. The use of GBI-10 aptamer in this liposomal system was intended to result in increased accumulation of gadolinium at the periphery of C6 glioma cells, where the targeting extracellular matrix protein tenascin-C is overexpressed. Increased cellular binding of GTLs to C6 cells was confirmed by confocal microscopy, flow cytometry, and MRI, demonstrating the promise of this novel delivery system as a carrier of MRI contrast agent for the diagnosis of tumor. These studies provide a new strategy furthering the development of nanomedicine for both diagnosis and therapy of tumor. Keywords: magnetic resonance imaging, gadolinium, liposomes, tenascin-C, GBI-10 aptamer, tumor targeting

  10. Tumor-targeted polymeric nanostructured lipid carriers with precise ratiometric control over dual-drug loading for combination therapy in non-small-cell lung cancer.

    Science.gov (United States)

    Liang, Yan; Tian, Baocheng; Zhang, Jing; Li, Keke; Wang, Lele; Han, Jingtian; Wu, Zimei

    2017-01-01

    Gemcitabine (GEM) and paclitaxel (PTX) are effective combination anticancer agents against non-small-cell lung cancer (NSCLC). At the present time, a main challenge of combination treatment is the precision of control that will maximize the combined effects. Here, we report a novel method to load GEM (hydrophilic) and PTX (hydrophobic) into simplex tumor-targeted nanostructured lipid carriers (NLCs) for accurate control of the ratio of the two drugs. We covalently preconjugated the dual drugs through a hydrolyzable ester linker to form drug conjugates. N -acetyl-d-glucosamine (NAG) is a glucose receptor-targeting ligand. We added NAG to the formation of NAG-NLCs. In general, synthesis of poly(6- O -methacryloyl-d-galactopyranose)-GEM/PTX (PMAGP-GEM/PTX) conjugates was demonstrated, and NAG-NLCs were prepared using emulsification and solvent evaporation. NAG-NLCs displayed sphericity with an average diameter of 120.3±1.3 nm, a low polydispersity index of 0.233±0.04, and accurate ratiometric control over the two drugs. A cytotoxicity assay showed that the NAG-NLCs had better antitumor activity on NSCLC cells than normal cells. There was an optimal ratio of the two drugs, exhibiting the best cytotoxicity and combinatorial effects among all the formulations we tested. In comparison with both the free-drug combinations and separately nanopackaged drug conjugates, PMAGP-GEM/PTX NAG-NLCs (3:1) exhibited superior synergism. Flow cytometry and confocal laser scanning microscopy showed that NAG-NLCs exhibited higher uptake efficiency in A549 cells via glucose receptor-mediated endocytosis. This combinatorial delivery system settles problems with ratiometric coloading of hydrophilic and hydrophobic drugs for tumor-targeted combination therapy to achieve maximal anticancer efficacy in NSCLC.

  11. Isotope enrichment

    International Nuclear Information System (INIS)

    Garbuny, M.

    1979-01-01

    The invention discloses a method for deriving, from a starting material including an element having a plurality of isotopes, derived material enriched in one isotope of the element. The starting material is deposited on a substrate at less than a critical submonatomic surface density, typically less than 10 16 atoms per square centimeter. The deposit is then selectively irradiated by a laser (maser or electronic oscillator) beam with monochromatic coherent radiation resonant with the one isotope causing the material including the one istope to escape from the substrate. The escaping enriched material is then collected. Where the element has two isotopes, one of which is to be collected, the deposit may be irradiated with radiation resonant with the other isotope and the residual material enriched in the one isotope may be evaporated from the substrate and collected

  12. Stable isotopes

    International Nuclear Information System (INIS)

    Brazier, J.L.; Guinamant, J.L.

    1995-01-01

    According to the progress which has been realised in the technology of separating and measuring isotopes, the stable isotopes are used as preferable 'labelling elements' for big number of applications. The isotopic composition of natural products shows significant variations as a result of different reasons like the climate, the seasons, or their geographic origins. So, it was proved that the same product has a different isotopic composition of alimentary and agriculture products. It is also important in detecting the pharmacological and medical chemicals. This review article deals with the technology, like chromatography and spectrophotometry, adapted to this aim, and some important applications. 17 refs. 6 figs

  13. Isotope separation

    International Nuclear Information System (INIS)

    Bartlett, R.J.; Morrey, J.R.

    1978-01-01

    A method and apparatus is described for separating gas molecules containing one isotope of an element from gas molecules containing other isotopes of the same element in which all of the molecules of the gas are at the same electronic state in their ground state. Gas molecules in a gas stream containing one of the isotopes are selectively excited to a different electronic state while leaving the other gas molecules in their original ground state. Gas molecules containing one of the isotopes are then deflected from the other gas molecules in the stream and thus physically separated

  14. Isotopic separation

    International Nuclear Information System (INIS)

    Castle, P.M.

    1979-01-01

    This invention relates to molecular and atomic isotope separation and is particularly applicable to the separation of 235 U from other uranium isotopes including 238 U. In the method described a desired isotope is separated mechanically from an atomic or molecular beam formed from an isotope mixture utilising the isotropic recoil momenta resulting from selective excitation of the desired isotope species by radiation, followed by ionization or dissociation by radiation or electron attachment. By forming a matrix of UF 6 molecules in HBr molecules so as to collapse the V 3 vibrational mode of the UF 6 molecule the 235 UF 6 molecules are selectively excited to promote reduction of UF 6 molecules containing 235 U and facilitate separation. (UK)

  15. Isotopic separation

    International Nuclear Information System (INIS)

    Chen, C.L.

    1979-01-01

    Isotopic species in an isotopic mixture including a first species having a first isotope and a second species having a second isotope are separated by selectively exciting the first species in preference to the second species and then reacting the selectively excited first species with an additional preselected radiation, an electron or another chemical species so as to form a product having a mass different from the original species and separating the product from the balance of the mixture in a centrifugal separating device such as centrifuge or aerodynamic nozzle. In the centrifuge the isotopic mixture is passed into a rotor where it is irradiated through a window. Heavier and lighter components can be withdrawn. The irradiated mixture experiences a large centrifugal force and is separated in a deflection area into lighter and heavier components. (UK)

  16. Dual tumor-targeted poly(lactic-co-glycolic acid–polyethylene glycol–folic acid nanoparticles: a novel biodegradable nanocarrier for secure and efficient antitumor drug delivery

    Directory of Open Access Journals (Sweden)

    Chen J

    2017-08-01

    Full Text Available Jia Chen,1,2,* Qi Wu,1,* Li Luo,1 Yi Wang,1 Yuan Zhong,1 Han-Bin Dai,1 Da Sun,1,3 Mao-Ling Luo,4 Wei Wu,1 Gui-Xue Wang1 1Key Laboratory for Biorheological Science and Technology, Ministry of Education, State and Local Joint Engineering Laboratory for Vascular Implants, Bioengineering College, Chongqing University, Chongqing, 2Institute of Laboratory Animals, Sichuan Academy of Medical Science, Sichuan Provincial People’s Hospital, Chengdu, 3Institute of Life Sciences, Wenzhou University, Wenzhou, 4School of Medicine, Wuhan University, Wuhan, China *These authors contributed equally to this work Abstract: Further specific target-ability development of biodegradable nanocarriers is extremely important to promote their security and efficiency in antitumor drug-delivery applications. In this study, a facilely prepared poly(lactic-co-glycolic acid (PLGA–polyethylene glycol (PEG–folic acid (FA copolymer was able to self-assemble into nanoparticles with favorable hydrodynamic diameters of around 100 nm and negative surface charge in aqueous solution, which was expected to enhance intracellular antitumor drug delivery by advanced dual tumor-target effects, ie, enhanced permeability and retention induced the passive target, and FA mediated the positive target. Fluorescence-activated cell-sorting and confocal laser-scanning microscopy results confirmed that doxorubicin (model drug loaded into PLGA-PEG-FA nanoparticles was able to be delivered efficiently into tumor cells and accumulated at nuclei. In addition, all hemolysis, 3-(4,5-dimethylthiazol-2-yl-5-(3-carboxymethoxyphenyl-2-(4-sulfophenyl-2H-tetrazolium, and zebrafish-development experiments demonstrated that PLGA-PEG-FA nanoparticles were biocompatible and secure for biomedical applications, even at high polymer concentration (0.1 mg/mL, both in vitro and in vivo. Therefore, PLGA-PEG-FA nanoparticles provide a feasible controlled-release platform for secure and efficient antitumor drug

  17. Development of PLGA-lipid nanoparticles with covalently conjugated indocyanine green as a versatile nanoplatform for tumor-targeted imaging and drug delivery

    Directory of Open Access Journals (Sweden)

    Xin Y

    2016-11-01

    course of the treatment (1 month. The results obtained demonstrate the versatility of the NPs, featuring stable fluorescence and tumor-targeting characteristics, with promising future applications in cancer therapy. Keywords: indocyanine green, resveratrol, near-infrared nanoprobe, tumor targeting, fluorescence imaging, drug delivery 

  18. Tumor-targeted polymeric nanostructured lipid carriers with precise ratiometric control over dual-drug loading for combination therapy in non-small-cell lung cancer

    Directory of Open Access Journals (Sweden)

    Liang Y

    2017-03-01

    Full Text Available Yan Liang,1 Baocheng Tian,1 Jing Zhang,1 Keke Li,1 Lele Wang,1 Jingtian Han,1,* Zimei Wu2,* 1School of Pharmacy, Binzhou Medical University, 2School of Pharmacy, Yantai University, Yantai, China *These authors contributed equally to this work Abstract: Gemcitabine (GEM and paclitaxel (PTX are effective combination anticancer agents against non-small-cell lung cancer (NSCLC. At the present time, a main challenge of combination treatment is the precision of control that will maximize the combined effects. Here, we report a novel method to load GEM (hydrophilic and PTX (hydrophobic into simplex tumor-targeted nanostructured lipid carriers (NLCs for accurate control of the ratio of the two drugs. We covalently preconjugated the dual drugs through a hydrolyzable ester linker to form drug conjugates. N-acetyl-D-glucosamine (NAG is a glucose receptor-targeting ligand. We added NAG to the formation of NAG-NLCs. In general, synthesis of poly(6-O-methacryloyl-d-galactopyranose–GEM/PTX (PMAGP-GEM/PTX conjugates was demonstrated, and NAG-NLCs were prepared using emulsification and solvent evaporation. NAG-NLCs displayed sphericity with an average diameter of 120.3±1.3 nm, a low polydispersity index of 0.233±0.04, and accurate ratiometric control over the two drugs. A cytotoxicity assay showed that the NAG-NLCs had better antitumor activity on NSCLC cells than normal cells. There was an optimal ratio of the two drugs, exhibiting the best cytotoxicity and combinatorial effects among all the formulations we tested. In comparison with both the free-drug combinations and separately nanopackaged drug conjugates, PMAGP-GEM/PTX NAG-NLCs (3:1 exhibited superior synergism. Flow cytometry and confocal laser scanning microscopy showed that NAG-NLCs exhibited higher uptake efficiency in A549 cells via glucose receptor-mediated endocytosis. This combinatorial delivery system settles problems with ratiometric coloading of hydrophilic and hydrophobic drugs for tumor-targeted

  19. A theranostic nanoplatform: magneto-gold@fluorescence polymer nanoparticles for tumor targeting T1&T2-MRI/CT/NIR fluorescence imaging and induction of genuine autophagy mediated chemotherapy.

    Science.gov (United States)

    Wang, Guannan; Qian, Kun; Mei, Xifan

    2018-06-14

    Multifunctional nanoparticles, bearing low toxicity and tumor-targeting properties, coupled with multifunctional diagnostic imaging and enhanced treatment efficacy, have drawn tremendous attention due to their enormous potential for medical applications. Herein, we report a new kind of biocompatible and tumor-targeting magneto-gold@fluorescent polymer nanoparticle (MGFs-LyP-1), which is based on ultra-small magneto-gold (Fe 3 O 4 -Au) nanoparticles and NIR emissive fluorescent polymers by a solvent-mediated method. This kind of nanoparticle could be taken up efficiently and simultaneously serve for in vivo tumor targeting T 1 &T 2 -MRI/CT/near infrared (NIR) fluorescence bioimaging. Furthermore, the nanoparticles exhibit small size, higher tumor targeting accumulation, excellent cytocompatibility for long-term tracking, and no disturbing cell proliferation and differentiation. Moreover, clear and convincing evidence proves that as-synthesized MGFs-LyP-1 could elicit genuine autophagy via inducing autophagosome formation, which offers a definite synergistic effect to enhance cancer therapy with doxorubicin (DOX) at a nontoxic concentration through enhancement of the autophagy flux. Meanwhile, the as-prepared nanoparticles could be rapidly cleared from mice without any obvious organ impairment. The results indeed reveal a promising prospect of an MGFs-LyP-1 contrast agent with low toxicity and high efficiency for promising application in biomedicine.

  20. Tumor-targeting Salmonella typhimurium A1-R is a highly effective general therapeutic for undifferentiated soft tissue sarcoma patient-derived orthotopic xenograft nude-mouse models.

    Science.gov (United States)

    Igarashi, Kentaro; Kawaguchi, Kei; Kiyuna, Tasuku; Miyake, Kentaro; Miyake, Masuyo; Singh, Arun S; Eckardt, Mark A; Nelson, Scott D; Russell, Tara A; Dry, Sarah M; Li, Yunfeng; Yamamoto, Norio; Hayashi, Katsuhiro; Kimura, Hiroaki; Miwa, Shinji; Tsuchiya, Hiroyuki; Singh, Shree Ram; Eilber, Fritz C; Hoffman, Robert M

    2018-03-18

    Undifferentiated soft tissue sarcoma (USTS) is a recalcitrant and heterogeneous subgroup of soft tissue sarcoma with high risk of metastasis and recurrence. Due to heterogeneity of USTS, there is no reliably effective first-line therapy. We have generated tumor-targeting Salmonella typhimurium A1-R (S. typhimurium A1-R), which previously showed strong efficacy on single patient-derived orthotopic xenograft (PDOX) models of Ewing's sarcoma and follicular dendritic cell sarcoma. In the present study, tumor resected from 4 patients with a biopsy-proven USTS (2 undifferentiated pleomorphic sarcoma [UPS], 1 undifferentiated sarcoma not otherwise specified [NOS] and 1 undifferentiated spindle cell sarcoma [USS]) were grown orthotopically in the biceps femoris muscle of mice to establish PDOX models. One USS model and one UPS model were doxorubicin (DOX) resistant. One UPS and the NOS model were partially sensitive to DOX. DOX is first-line therapy for these diseases. S. typhimurium A1-R arrested tumor growth all 4 models. In addition to arresting tumor growth in each case, S. typhimurium A1-R was significantly more efficacious than DOX in each case, thereby surpassing first-line therapy. These results suggest that S. typhimurium A1-R can be a general therapeutic for USTS and possibly sarcoma in general. Published by Elsevier Inc.

  1. Supporting Data for Multifunctional all-in-one drug delivery systems for tumor targeting and sequential release of three different anti-tumor drugs

    Directory of Open Access Journals (Sweden)

    Guowei Wu

    2016-06-01

    Full Text Available Although nanoparticulate drug delivery systems (NDDSs can preferentially accumulate in tumors, active targeting by targeting ligands (e.g. monoclonal antibody is necessary for increasing its targeting efficacy in vivo. We conjugated mAb198.3 on the SiO2@AuNP system surface to make it obtain active targeting efficacy. The FAT1 targeting capability of SiO2@AuNP system is the first issue to be solved. Thus, flow cytometry analysis was attempted to demonstrate that the SiO2@AuNP system could bind to native FAT1 molecules on the surface of Colo205 cells. Also, together with the drug release behavior study of self-decomposable SiO2 NPs, the continuous morphological evolution needed to be clarified. Therefore, to characterize the morphological evolution in vitro, we analyzed the morphology of inner self-decomposable NPs in different time intervals using transmission electron microscopy (TEM. A more comprehensive analysis of this data may be obtained from the article “Multifunctional all-in-one drug delivery systems for tumor targeting and sequential release of three different anti-tumor drugs” in Biomaterials.

  2. Isotope angiocardiography

    International Nuclear Information System (INIS)

    Stepinska, J.; Ruzyllo, W.; Konieczny, W.

    1979-01-01

    Method of technetium isotope 99 m pass through the heart recording with the aid of radioisotope scanner connected with seriograph and computer is being presented. Preliminary tests were carried out in 26 patients with coronary disease without or with previous myocardial infarction, cardiomyopathy, ventricular septal defect and in patients with artificial mitral and aortic valves. The obtained scans were evaluated qualitatively and compared with performed later contrast X-rays of the heart. Size of the right ventricle, volume and rate of left atrial evacuation, size and contractability of left ventricle were evaluated. Similarity of direct and isotope angiocardiographs, non-invasional character and repeatability of isotope angiocardiography advocate its usefulness. (author)

  3. Leatherback Isotopes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC is currently working on a project identifying global marine isotopes using leatherback turtles (Dermochelys coriacea) as the indicator species. We currently...

  4. Isotope Identification

    Energy Technology Data Exchange (ETDEWEB)

    Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-09-18

    The objective of this training modules is to examine the process of using gamma spectroscopy for radionuclide identification; apply pattern recognition to gamma spectra; identify methods of verifying energy calibration; and discuss potential causes of isotope misidentification.

  5. Isotope laboratories

    International Nuclear Information System (INIS)

    1978-01-01

    This report from the Dutch Ministry of Health is an advisory document concerned with isotope laboratories in hospitals, in connection with the Dutch laws for hospitals. It discusses which hospitals should have isotope laboratories and concludes that as many hospitals as possible should have small laboratories so that emergency cases can be dealt with. It divides the Netherlands into regions and suggests which hospitals should have these facilities. The questions of how big each lab. is to be, what equipment each has, how each lab. is organised, what therapeutic and diagnostic work should be carried out by each, etc. are discussed. The answers are provided by reports from working groups for in vivo diagnostics, in vitro diagnostics, therapy, and safety and their results form the criteria for the licences of isotope labs. The results of a questionnaire for isotope labs. already in the Netherlands are presented, and their activities outlined. (C.F.)

  6. Isotopic chirality

    Energy Technology Data Exchange (ETDEWEB)

    Floss, H.G. [Univ. of Washington, Seattle, WA (United States)

    1994-12-01

    This paper deals with compounds that are chiral-at least in part, due to isotope substitution-and their use in tracing the steric course of enzyme reaction in vitro and in vivo. There are other applications of isotopically chiral compounds (for example, in analyzing the steric course of nonenzymatic reactions and in probing the conformation of biomolecules) that are important but they will not be discussed in this context.

  7. Isotopic separation

    International Nuclear Information System (INIS)

    Chen, C.L.

    1982-01-01

    A method is described for separating isotopes in which photo-excitation of selected isotope species is used together with the reaction of the excited species with postive ions of predetermined ionization energy, other excited species, or free electrons to produce ions or ion fragments of the selected species. Ions and electrons are produced by an electrical discharge, and separation is achieved through radial ambipolar diffusion, electrostatic techniques, or magnetohydrodynamic methods

  8. Isotope enrichment

    International Nuclear Information System (INIS)

    Lydtin, H-J.; Wilden, R.J.; Severin, P.J.W.

    1978-01-01

    The isotope enrichment method described is based on the recognition that, owing to mass diffusion and thermal diffusion in the conversion of substances at a heated substrate while depositing an element or compound onto the substrate, enrichment of the element, or a compound of the element, with a lighter isotope will occur. The cycle is repeated for as many times as is necessary to obtain the degree of enrichment required

  9. Tumor-Targeting Salmonella typhimurium A1-R in Combination with Trastuzumab Eradicates HER-2-Positive Cervical Cancer Cells in Patient-Derived Mouse Models.

    Directory of Open Access Journals (Sweden)

    Yukihiko Hiroshima

    Full Text Available We have previously developed mouse models of HER-2-positive cervical cancer. Tumors in nude mice had histological structures similar to the original tumor and were stained by anti-HER-2 antibody in the same pattern as the patient's cancer. We have also previously developed tumor-targeting Salmonella typhimurium A1-R and have demonstrated its efficacy against patient-derived tumor mouse models, both alone and in combination. In the current study, we determined the efficacy of S. typhimurium A1-R in combination with trastuzumab on a patient-cancer nude-mouse model of HER-2 positive cervical cancer. Mice were randomized to 5 groups and treated as follows: (1 no treatment; (2 carboplatinum (30 mg/kg, ip, weekly, 5 weeks; (3 trastuzumab (20 mg/kg, ip, weekly, 5 weeks; (4 S. typhimurium A1-R (5 × 107 CFU/body, ip, weekly, 5 weeks; (5 S. typhimurium A1-R (5 × 107 CFU/body, ip, weekly, 5 weeks + trastuzumab (20 mg/kg, ip, weekly, 5 weeks. All regimens had significant efficacy compared to the untreated mice. The relative tumor volume of S. typhimurium A1-R + trastuzumab-treated mice was smaller compared to trastuzumab alone (p = 0.007 and S. typhimurium A1-R alone (p = 0.039. No significant body weight loss was found compared to the no treatment group except for carboplatinum-treated mice (p = 0.021. Upon histological examination, viable tumor cells were not detected, and replaced by stromal cells in the tumors treated with S. typhimurium A1-R + trastuzumab. The results of the present study suggest that S. typhimurium A1-R and trastuzumab in combination are highly effective against HER-2-expressing cervical cancer.

  10. Tumor-targeting Salmonella typhimurium A1-R Inhibits Osteosarcoma Angiogenesis in the In Vivo Gelfoam® Assay Visualized by Color-coded Imaging.

    Science.gov (United States)

    Kiyuna, Tasuku; Tome, Yasunori; Uehara, Fuminari; Murakami, Takashi; Zhang, Yong; Zhao, Ming; Kanaya, Fuminori; Hoffman, Robert M

    2018-01-01

    We previously developed a color-coded imaging model that can quantify the length of nascent blood vessels using Gelfoam® implanted in nestin-driven green fluorescent protein (ND-GFP) nude mice. In this model, nascent blood vessels selectively express GFP. We also previously showed that osteosarcoma cells promote angiogenesis in this assay. We have also previously demonstrated the tumor-targeting bacteria Salmonella typhimurium A1-R (S. typhimurium A1-R) can inhibit or regress all tested tumor types in mouse models. The aim of the present study was to determine if S. typhimurium A1-R could inhibit osteosarcoma angiogenesis in the in vivo Gelfoam® color-coded imaging assay. Gelfoam® was implanted subcutaneously in ND-GFP nude mice. Skin flaps were made 7 days after implantation and 143B-RFP human osteosarcoma cells expressing red fluorescent protein (RFP) were injected into the implanted Gelfoam. After establishment of tumors in the Gelfoam®, control-group mice were treated with phosphate buffered saline via tail-vein injection (iv) and the experimental group was treated with S. typhimurium A1-R iv Skin flaps were made at day 7, 14, 21, and 28 after implantation of the Gelfoam® to allow imaging of vascularization in the Gelfoam® using a variable-magnification small-animal imaging system and confocal fluorescence microscopy. Nascent blood vessels expressing ND-GFP extended into the Gelfoam® over time in both groups. However, the extent of nascent blood-vessel growth was significantly inhibited by S. typhimurium A1-R treatment by day 28. The present results indicate S. typhimurium A1-R has potential for anti-angiogenic targeted therapy of osteosarcoma. Copyright© 2018, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  11. Isotopes Project

    International Nuclear Information System (INIS)

    Dairiki, J.M.; Browne, E.; Firestone, R.B.; Lederer, C.M.; Shirley, V.S.

    1984-01-01

    The Isotopes Project compiles and evaluates nuclear structure and decay data and disseminates these data to the scientific community. From 1940-1978 the Project had as its main objective the production of the Table of Isotopes. Since publication of the seventh (and last) edition in 1978, the group now coordinates its nuclear data evaluation efforts with those of other data centers via national and international nuclear data networks. The group is currently responsible for the evaluation of mass chains A = 167-194. All evaluated data are entered into the International Evaluated Nuclear Structure Data File (ENSDF) and are published in Nuclear Data Sheets. In addition to the evaluation effort, the Isotopes Project is responsible for production of the Radioactivity Handbook

  12. Isotope production

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Dewi M.

    1995-07-15

    Some 2 0% of patients using radiopharmaceuticals receive injections of materials produced by cyclotrons. There are over 200 cyclotrons worldwide; around 35 are operated by commercial companies solely for the production of radio-pharmaceuticals with another 25 accelerators producing medically useful isotopes. These neutron-deficient isotopes are usually produced by proton bombardment. All commonly used medical isotopes can be generated by 'compact' cyclotrons with energies up to 40 MeV and beam intensities in the range 50 to 400 microamps. Specially designed target systems contain gram-quantities of highly enriched stable isotopes as starting materials. The targets can accommodate the high power densities of the proton beams and are designed for automated remote handling. The complete manufacturing cycle includes large-scale target production, isotope generation by cyclotron beam bombardment, radio-chemical extraction, pharmaceutical dispensing, raw material recovery, and labelling/packaging prior to the rapid delivery of these short-lived products. All these manufacturing steps adhere to the pharmaceutical industry standards of Good Manufacturing Practice (GMP). Unlike research accelerators, commercial cyclotrons are customized 'compact' machines usually supplied by specialist companies such as IBA (Belgium), EBCO (Canada) or Scanditronix (Sweden). The design criteria for these commercial cyclotrons are - small magnet dimensions, power-efficient operation of magnet and radiofrequency systems, high intensity extracted proton beams, well defined beam size and automated computer control. Performance requirements include rapid startup and shutdown, high reliability to support the daily production of short-lived isotopes and low maintenance to minimize the radiation dose to personnel. In 1987 a major step forward in meeting these exacting industrial requirements came when IBA, together with the University of Louvain-La-Neuve in Belgium, developed the Cyclone-30

  13. Isotopically modified compounds

    International Nuclear Information System (INIS)

    Kuruc, J.

    2009-01-01

    In this chapter the nomenclature of isotopically modified compounds in Slovak language is described. This chapter consists of following parts: (1) Isotopically substituted compounds; (2) Specifically isotopically labelled compounds; (3) Selectively isotopically labelled compounds; (4) Non-selectively isotopically labelled compounds; (5) Isotopically deficient compounds.

  14. An efficient PEGylated liposomal nanocarrier containing cell-penetrating peptide and pH-sensitive hydrazone bond for enhancing tumor-targeted drug delivery

    Directory of Open Access Journals (Sweden)

    Ding Y

    2015-10-01

    Full Text Available Yuan Ding,1,* Dan Sun,1,* Gui-Ling Wang,1 Hong-Ge Yang,1 Hai-Feng Xu,1 Jian-Hua Chen,2 Ying Xie,1,3 Zhi-Qiang Wang4 1Beijing Key Laboratory of Molecular Pharmaceutics and New Drug Delivery Systems, School of Pharmaceutical Sciences, Peking University, Beijing, 2School of Medicine, Jianghan University, Wuhan, 3State Key Laboratory of Natural and Biomimetic Drugs, Peking University, Beijing, People’s Republic of China; 4Department of Chemistry and Biochemistry, Kent State University Geauga, Burton, OH, USA *These authors contributed equally to this work Abstract: Cell-penetrating peptides (CPPs as small molecular transporters with abilities of cell penetrating, internalization, and endosomal escape have potential prospect in drug delivery systems. However, a bottleneck hampering their application is the poor specificity for cells. By utilizing the function of hydration shell of polyethylene glycol (PEG and acid sensitivity of hydrazone bond, we constructed a kind of CPP-modified pH-sensitive PEGylated liposomes (CPPL to improve the selectivity of these peptides for tumor targeting. In CPPL, CPP was directly attached to liposome surfaces via coupling with stearate (STR to avoid the hindrance of PEG as a linker on the penetrating efficiency of CPP. A PEG derivative by conjugating PEG with STR via acid-degradable hydrazone bond (PEG2000-Hz-STR, PHS was synthesized. High-performance liquid chromatography and flow cytometry demonstrated that PHS was stable at normal neutral conditions and PEG could be completely cleaved from liposome surface to expose CPP under acidic environments in tumor. An optimal CPP density on liposomes was screened to guaranty a maximum targeting efficiency on tumor cells as well as not being captured by normal cells that consequently lead to a long circulation in blood. In vitro and in vivo studies indicated, in 4 mol% CPP of lipid modified system, that CPP exerted higher efficiency on internalizing the liposomes into

  15. iRGD-modified lipid–polymer hybrid nanoparticles loaded with isoliquiritigenin to enhance anti-breast cancer effect and tumor-targeting ability

    Directory of Open Access Journals (Sweden)

    Gao F

    2017-06-01

    Full Text Available Fei Gao,1–3 Jinming Zhang,3 Chaomei Fu,3 Xiaoming Xie,4 Fu Peng,1–3 Jieshu You,1,2 Hailin Tang,1,2,4 Zhiyu Wang,5 Peng Li,6 Jianping Chen1–3 1School of Chinese Medicine, Li Ka Shing Faculty of Medicine, University of Hong Kong, Hong Kong, 2Shenzhen Institute of Research and Innovation, University of Hong Kong, Shenzhen, 3College of Pharmacy, Chengdu University of Chinese Medicine, Chengdu, 4Department of Breast Oncology, Sun Yat-Sen University Cancer Center, State Key Laboratory of Oncology in South China, Collaborative Innovation Center for Cancer Medicine, 5Department of Mammary Disease, Guangdong Provincial Hospital of Chinese Medicine, Guangzhou, 6State Key Laboratory of Quality Research in Chinese Medicine, Institute of Chinese Medical Sciences, University of Macau, Macau, People’s Republic of China Abstract: Isoliquiritigenin (ISL, a natural anti-breast cancer dietary compound, has poor delivery characteristics and low bioavailability. In order to promote the therapeutic outcome of ISL, a tumor-targeting lipid–polymer hybrid nanoparticle (NP system modified by tumor-homing iRGD peptides has been developed. The hybrid NPs were prepared by a modified single-step nanoprecipitation method to encapsulate ISL. iRGD peptides were anchored on the surface by a postinsertion method (ISL-iRGD NPs. The stable lipid–polymer structure of ISL-iRGD NPs, with high encapsulation and loading efficiency, was confirmed. Compared to free ISL and non-iRGD-modified counterparts, ISL-iRGD NPs showed higher cytotoxicity and cell apoptosis against the different type of breast cancer cells. This was attributable to higher cellular accumulation mediated by the iRGD-integrin recognition and the nanoscale effect. More importantly, based on the active tumor-tissue accumulation by iRGD peptides and the prolonged in vivo circulation by the stealth nanostructure, ISL-iRGD NPs displayed higher tumor-growth inhibition efficiency in 4T1-bearing breast-tumor mouse

  16. Isotope generator

    International Nuclear Information System (INIS)

    1979-01-01

    The patent describes an isotope generator incorporating the possibility of stopping elution before the elution vessel is completely full. Sterile ventilation of the whole system can then occur, including of both generator reservoir and elution vessel. A sterile, and therefore pharmaceutically acceptable, elution fluid is thus obtained and the interior of the generator is not polluted with non-sterile air. (T.P.)

  17. Isotope hydrology

    International Nuclear Information System (INIS)

    Drost, W.

    1978-01-01

    The International Symposium on Isotope Hydrology was jointly organized by the IAEA and UNESCO, in co-operation with the National Committee of the Federal Republic of Germany for the International Hydrological Programme (IHP) and the Gesellschaft fuer Strahlen- und Umweltforschung mbH (GSF). Upon the invitation of the Federal Republic of Germany the Symposium was held from 19-23 June 1978 in Neuherberg on the GSF campus. The Symposium was officially opened by Mr. S. Eklund, Director General of the IAEA. The symposium - the fifth meeting held on isotope hydrology - was attended by over 160 participants from 44 countries and four international organizations and by about 30 observers from the Federal Republic of Germany. Due to the absence of scientists from the USSR five papers were cancelled and therefore only 46 papers of the original programme were presented in ten sessions

  18. Preclinical evaluation of isostructural Tc-99m- and Re-188-folate-Gly-Gly-Cys-Glu for folate receptor-positive tumor targeting.

    Science.gov (United States)

    Kim, Woo Hyoung; Kim, Chang Guhn; Kim, Myoung Hyoun; Kim, Dae-Weung; Park, Cho Rong; Park, Ji Yong; Lee, Yun-Sang; Youn, Hyewon; Kang, Keon Wook; Jeong, Jae Min; Chung, June-Key

    2016-06-01

    -188-folate-GGCE. The tumor uptake of these molecules was completely suppressed when excess free folate was co-administered. Isostructural Tc-99m- and Re-188-folate-GGCE showed high and FR-specific uptake by tumors and generally favorable tumor:normal organ ratios. The tumor targeting capabilities of Tc-99m- and Re-188-folate-GGCE were clearly evident on serial imaging studies. This isostructural pair may have potential diagnostic and theranostic applications for FR-positive tumors.

  19. In vivo tumor targeting and imaging with anti-vascular endothelial growth factor antibody-conjugated dextran-coated iron oxide nanoparticles

    Directory of Open Access Journals (Sweden)

    Hsieh WJ

    2012-06-01

    sections of tumor tissues stained for the iron constituent of the NPs with Prussian blue revealed a strong blue reaction in the tumors of anti-VEGF-NP-treated mice, but only a weak reaction in mice injected with NPs. In both groups, at all time points, Prussian blue-stained liver and spleen sections showed only light staining, while stained cells were rarely detected in kidney and lung sections. Transmission electron microscopy showed that many more electron-dense particles were present in endothelial cells, tumor cells, and extracellular matrix in tumor tissues in mice injected with anti-VEGF-NPs than in NP-injected mice.Conclusion: These results demonstrated in vivo tumor targeting and efficient accumulation of anti-VEGF-NPs in tumor tissues after systemic delivery in a colon cancer model, showing that anti-VEGF-NPs have potential for use as a molecular-targeted tumor imaging agent in vivo.Keywords: nanoparticles, vascular endothelial growth factor, colon tumor, magnetic resonance imaging, transmission electron microscopy

  20. One-pot synthesis of reactive oxygen species (ROS)-self-immolative polyoxalate prodrug nanoparticles for hormone dependent cancer therapy with minimized side effects

    Czech Academy of Sciences Publication Activity Database

    Höcherl, Anita; Jäger, Eliezer; Jäger, Alessandro; Hrubý, Martin; Konefal, Rafal; Janoušková, Olga; Spěváček, Jiří; Jiang, Y.; Schmidt, P. W.; Lodge, T. P.; Štěpánek, Petr

    2017-01-01

    Roč. 8, č. 13 (2017), s. 1999-2004 ISSN 1759-9954 R&D Projects: GA MŠk(CZ) LH14079; GA MŠk(CZ) LO1507; GA ČR(CZ) GA16-02870S; GA ČR(CZ) GA15-13853S; GA ČR(CZ) GA17-09998S Institutional support: RVO:61389013 Keywords : polyprodrug * diethylstilbestrol * cancer Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.375, year: 2016

  1. Natural isotopes

    International Nuclear Information System (INIS)

    Vogel, J.C.

    1986-01-01

    14 C dates between 600 and 900 AD were obtained for early Iron Age sites in Natal, and from 1300 to 1450 AD for rock engraving sites in Bushmanland. Palaeoenvironmental data derived from the dating of samples related to sedimentary and geomorphic features in the central and northern Namib Desert enabled the production of a tentative graph for the changes in humidity in the region over the past 40000 years. These results suggest that relatively humid conditions came to an end in the Namib at ±25000 BP (before present). The increased precision of the SIRA mass spectrometer enabled the remeasurement of 13 C and 18 O in the Cango stalagmite. This data confirmed that the environmental temperatures in the Southern Cape remained constant to within ±1 o C during the past 5500 years. Techniques and applications for environmental isotopes in hydrology were developed to determine the origin and movement of ground water. Isotopic fractionation effects in light elements in nature were investigated. The 15 N/ 14 N ratio in bones of animals and humans increases in proportion to the aridity of the environment. This suggests that 15 N in bone from dated archaeological sites could be used to detect changes in past climatic conditions as naturally formed nitrate minerals are higly soluble and are only preserved in special, very dry environments. The sources and sinks of CO 2 on the South African subcontinent were also determined. The 13 C/ 12 C ratios of air CO 2 obtained suggest that the vegetation provides the major proportion of respired CO 2 . 9 refs., 1 fig

  2. Stable isotope studies

    International Nuclear Information System (INIS)

    Ishida, T.

    1992-01-01

    The research has been in four general areas: (1) correlation of isotope effects with molecular forces and molecular structures, (2) correlation of zero-point energy and its isotope effects with molecular structure and molecular forces, (3) vapor pressure isotope effects, and (4) fractionation of stable isotopes. 73 refs, 38 figs, 29 tabs

  3. Method for separating isotopes

    International Nuclear Information System (INIS)

    Jepson, B.E.

    1975-01-01

    Isotopes are separated by contacting a feed solution containing the isotopes with a cyclic polyether wherein a complex of one isotope is formed with the cyclic polyether, the cyclic polyether complex is extracted from the feed solution, and the isotope is thereafter separated from the cyclic polyether

  4. Method for separating isotopes

    International Nuclear Information System (INIS)

    Jepson, B.E.

    1976-01-01

    The invention comprises a method for separating different isotopes of elements from each other by contacting a feed solution containing the different isotopes with a macrocyclic polyether to preferentially form a macrocyclic polyether complex with the lighter of the different isotopes. The macrocyclic polyether complex is then separated from the lighter isotope depleted feed solution. A chemical separation of isotopes is carried out in which a constant refluxing system permits a continuous countercurrent liquid-liquid extraction. (LL)

  5. Method for separating isotopes

    International Nuclear Information System (INIS)

    Schlenker, R.F.

    1978-01-01

    A vortex tube for separating isotopes is described. A gas mixture containing the isotopic molecules enters the vortex tube under pressure and is separated into a hot discharge flow stream and a cold discharge flow stream. The hot discharge is enriched in lighter isotopic molecules whereas the cold discharge flow stream is enriched in the heavier isotopic molecules. The vortex tube can be used in a single stage or multistage isotope separation apparatus

  6. Isotope puzzle in sputtering

    International Nuclear Information System (INIS)

    Zheng Liping

    1998-01-01

    Mechanisms affecting multicomponent material sputtering are complex. Isotope sputtering is the simplest in the multicomponent materials sputtering. Although only mass effect plays a dominant role in the isotope sputtering, there is still an isotope puzzle in sputtering by ion bombardment. The major arguments are as follows: (1) At the zero fluence, is the isotope enrichment ejection-angle-independent or ejection-angle-dependent? (2) Is the isotope angular effect the primary or the secondary sputter effect? (3) How to understand the action of momentum asymmetry in collision cascade on the isotope sputtering?

  7. Tumor-Targeting Salmonella typhimurium A1-R Promotes Tumoricidal CD8+ T Cell Tumor Infiltration and Arrests Growth and Metastasis in a Syngeneic Pancreatic-Cancer Orthotopic Mouse Model.

    Science.gov (United States)

    Murakami, Takashi; Hiroshima, Yukihiko; Zhang, Yong; Zhao, Ming; Kiyuna, Tasuku; Hwang, Ho Kyoung; Miyake, Kentaro; Homma, Yuki; Mori, Ryutaro; Matsuyama, Ryusei; Chishima, Takashi; Ichikawa, Yasushi; Tanaka, Kuniya; Bouvet, Michael; Endo, Itaru; Hoffman, Robert M

    2018-01-01

    The present study determined the effect of the tumor-targeting strain Salmonella typhimurium A1-R (S. typhimurium A1-R) on CD8 + tumor-infiltrating lymphocytes (TILs) in a syngeneic pancreatic-cancer orthotopic mouse model. The effect of tumor-targeting S. typhimurium A1-R on CD8 + TILs was determined on the Pan02 murine pancreatic-adenocarcinoma implanted orthotopically in the pancreatic tail of C57BL/6 immunocompromised mice. Three weeks after orthotopic implantation, mice were randomized as follows G1: untreated control group (n = 8); and G2: S. typhimurium A1-R-treatment group (n = 8, 1 × 10 7 colony forming units [CFU]/body, iv, weekly, 3 weeks). On the 22nd day from initial treatment, all mice were sacrificed and tumors were harvested. The tumor-volume ratio was defined as ratio of tumor volume on the 22nd day relative to the 1st day. The tumor volume ratio was significantly lower in the S. typhimurium A1-R-treated group (G2) (3.0 ± 2.8) than the untreated control (G1) (39.9 ± 30.7, P R-treated mice (G2). Six mice in G1 had peritoneal dissemination, whereas no mice showed peritoneal dissemination in G2 (P R promotes CD8 + T cell infiltration and inhibition of tumor growth and metastasis. J. Cell. Biochem. 119: 634-639, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  8. Isotopically exchangeable phosphorus

    International Nuclear Information System (INIS)

    Barbaro, N.O.

    1984-01-01

    A critique revision of isotope dilution is presented. The concepts and use of exchangeable phosphorus, the phosphate adsorption, the kinetics of isotopic exchange and the equilibrium time in soils are discussed. (M.A.C.) [pt

  9. Optical isotope shifts for unstable samarium isotopes

    International Nuclear Information System (INIS)

    Eastham, D.A.; Walker, P.M.; Griffith, J.A.R.; Evans, D.E.; Grant, I.S.; England, J.G.; Fawcett, M.J.

    1984-01-01

    Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144 Sm and 154 Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

  10. Isotopes in heterogeneous catalysis

    CERN Document Server

    Hargreaves, Justin SJ

    2006-01-01

    The purpose of this book is to review the current, state-of-the-art application of isotopic methods to the field of heterogeneous catalysis. Isotopic studies are arguably the ultimate technique in in situ methods for heterogeneous catalysis. In this review volume, chapters have been contributed by experts in the field and the coverage includes both the application of specific isotopes - Deuterium, Tritium, Carbon-14, Sulfur-35 and Oxygen-18 - as well as isotopic techniques - determination of surface mobility, steady state transient isotope kinetic analysis, and positron emission profiling.

  11. Geochemistry of silicon isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Tiping; Li, Yanhe; Gao, Jianfei; Hu, Bin [Chinese Academy of Geological Science, Beijing (China). Inst. of Mineral Resources; Jiang, Shaoyong [China Univ. of Geosciences, Wuhan (China).

    2018-04-01

    Silicon is one of the most abundant elements in the Earth and silicon isotope geochemistry is important in identifying the silicon source for various geological bodies and in studying the behavior of silicon in different geological processes. This book starts with an introduction on the development of silicon isotope geochemistry. Various analytical methods are described and compared with each other in detail. The mechanisms of silicon isotope fractionation are discussed, and silicon isotope distributions in various extraterrestrial and terrestrial reservoirs are updated. Besides, the applications of silicon isotopes in several important fields are presented.

  12. Applications of stable isotopes

    International Nuclear Information System (INIS)

    Letolle, R.; Mariotti, A.; Bariac, T.

    1991-06-01

    This report reviews the historical background and the properties of stable isotopes, the methods used for their measurement (mass spectrometry and others), the present technics for isotope enrichment and separation, and at last the various present and foreseeable application (in nuclear energy, physical and chemical research, materials industry and research; tracing in industrial, medical and agronomical tests; the use of natural isotope variations for environmental studies, agronomy, natural resources appraising: water, minerals, energy). Some new possibilities in the use of stable isotope are offered. A last chapter gives the present state and forecast development of stable isotope uses in France and Europe

  13. Process for isotope separation

    International Nuclear Information System (INIS)

    Emile, B.F.M.

    1983-11-01

    A process is claimed for isotopic separation applied to isotopes of elements that can be placed in at least a physicochemical form in which the isotopic atoms or the molecules containing these atoms can be easily displaced and for which there are selective radiations preferentially absorbed by the isotopes of a certain type or by the molecules containing them, said absorption substantially increasing the probability of ionization of said atoms or molecules relative to the atoms or molecules that did not absorb the radiation. The process consists of placing the isotopic mixture in such a form, subjecting it in a separation zone to selective radiations and to an electrical field that produces migration of positive ions toward the negative electrodes and negative ions toward the positive electrodes, and withdrawing from certain such zones the fractions thus enriched in certain isotopes

  14. Tumor-targeted nanomedicines for cancer theranostics

    Science.gov (United States)

    Lammers, Twan; Shi, Yang

    2017-01-01

    Chemotherapeutic drugs have multiple drawbacks, including severe side effects and suboptimal therapeutic efficacy. Nanomedicines assist in improving the biodistribution and the target accumulation of chemotherapeutic drugs, and are therefore able to enhance the balance between efficacy and toxicity. Multiple different types of nanomedicines have been evaluated over the years, including liposomes, polymer-drug conjugates and polymeric micelles, which rely on strategies such as passive targeting, active targeting and triggered release for improved tumor-directed drug delivery. Based on the notion that tumors and metastases are highly heterogeneous, it is important to integrate imaging properties in nanomedicine formulations in order to enable non-invasive and quantitative assessment of targeting efficiency. By allowing for patient pre-selection, such next generation nanotheranostics are useful for facilitating clinical translation and personalizing nanomedicine treatments. PMID:27865762

  15. Uncertainces in tumor target definition using PET

    International Nuclear Information System (INIS)

    Kirov, A.

    2013-01-01

    Full text: Introduction: PET entered into the clinics for radiation therapy as a means of displaying the metabolically active part of the tumor. However this advantage, PET has a number of shortcomings that prevent its use for precise determination of the tumor boundaries. What you will learn: The aim of the lecture is to present: the requirements for the accuracy of the determination of tumor boundaries in radiation therapy; the main phenomena which bring uncertainty using PET and a brief overview of methods for segmentation of tumors and their problems

  16. Isotopic marking and tracers

    International Nuclear Information System (INIS)

    Morel, F.

    1997-01-01

    The use of radioactive isotopes as tracers in biology has been developed thanks to the economic generation of the required isotopes in accelerators and nuclear reactors, and to the multiple applications of tracers in the life domain; the most usual isotopes employed in biology are carbon, hydrogen, phosphorus and sulfur isotopes, because these elements are present in most of organic molecules. Most of the life science knowledge appears to be dependent to the extensive use of nuclear tools and radioactive tracers; the example of the utilization of radioactive phosphorus marked ATP to study the multiple reactions with proteins, nucleic acids, etc., is given

  17. Isotopes in oxidation reactions

    International Nuclear Information System (INIS)

    Stewart, R.

    1976-01-01

    The use of isotopes in the study of organic oxidation mechanisms is discussed. The help provided by tracer studies to demonstrate the two-equivalent path - hydride transfer, is illustrated by the examples of carbonium oxidants and the Wacker reaction. The role of kinetic isotope effects in the study of the scission of carbon-hydrogen bonds is illustrated by hydride abstraction, hydrogen atom abstraction, proton abstraction and quantum mechanical tunnelling. Isotopic studies on the oxidation of alcohols, carbonyl compounds, amines and hydrocarbons are discussed. The role of isotopes in the study of biochemical oxidation is illustrated with a discussion on nicotinamide and flavin coenzymes. (B.R.H.)

  18. Isotope separation process

    International Nuclear Information System (INIS)

    Lyon, R.K.

    1976-01-01

    The instant invention relates to a process for separating a material into two or more parts in each of which the abundances of the isotopes of a given element differ from the abundances of the isotopes of the same material in said material. In one embodiment, the invention relates to a method for the isotopically selective excitation of gas phase molecules by multiple infrared photon absorption followed by selective dissociation of said excited molecules by the absorption of a single photon of visible or ultraviolet light. This invention is useful for, but not limited to, the separation of the principal isotopes of uranium. 11 Claims, 2 Drawing Figures

  19. Intracellular Cadmium Isotope Fractionation

    Science.gov (United States)

    Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.

    2011-12-01

    Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

  20. Discovery of the iron isotopes

    International Nuclear Information System (INIS)

    Schuh, A.; Fritsch, A.; Heim, M.; Shore, A.; Thoennessen, M.

    2010-01-01

    Twenty-eight iron isotopes have been observed so far and the discovery of these isotopes is discussed here. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  1. Discovery of the silver isotopes

    International Nuclear Information System (INIS)

    Schuh, A.; Fritsch, A.; Ginepro, J.Q.; Heim, M.; Shore, A.; Thoennessen, M.

    2010-01-01

    Thirty-eight silver isotopes have been observed so far and the discovery of these isotopes is discussed here. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  2. Discovery of the cadmium isotopes

    International Nuclear Information System (INIS)

    Amos, S.; Thoennessen, M.

    2010-01-01

    Thirty-seven cadmium isotopes have been observed so far and the discovery of these isotopes is discussed here. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Isotopic research in Antarctica

    International Nuclear Information System (INIS)

    Schuetze, H.

    1983-01-01

    Since 1978 scientists of the Central Institute of Isotope- and Radiation Research of the Academy of Sciences of the GDR have participated in antarctic research. Substantial results have been achieved in research on isotope ratios, on the dynamics of water resources, on concentration of deuterium in lichens, and on age determination of a mummified seal and a penguin colony

  4. Uses of stable isotopes

    International Nuclear Information System (INIS)

    Axente, Damian

    1998-01-01

    The most important fields of stable isotope use with examples are presented. These are: 1. Isotope dilution analysis: trace analysis, measurements of volumes and masses; 2. Stable isotopes as tracers: transport phenomena, environmental studies, agricultural research, authentication of products and objects, archaeometry, studies of reaction mechanisms, structure and function determination of complex biological entities, studies of metabolism, breath test for diagnostic; 3. Isotope equilibrium effects: measurement of equilibrium effects, investigation of equilibrium conditions, mechanism of drug action, study of natural processes, water cycle, temperature measurements; 4. Stable isotope for advanced nuclear reactors: uranium nitride with 15 N as nuclear fuel, 157 Gd for reactor control. In spite of some difficulties of stable isotope use, particularly related to the analytical techniques, which are slow and expensive, the number of papers reporting on this subject is steadily growing as well as the number of scientific meetings organized by International Isotope Section and IAEA, Gordon Conferences, and regional meeting in Germany, France, etc. Stable isotope application development on large scale is determined by improving their production technologies as well as those of labeled compound and the analytical techniques. (author)

  5. Detecting isotopic ratio outliers

    International Nuclear Information System (INIS)

    Bayne, C.K.; Smith, D.H.

    1985-01-01

    An alternative method is proposed for improving isotopic ratio estimates. This method mathematically models pulse-count data and uses iterative reweighted Poisson regression to estimate model parameters to calculate the isotopic ratios. This computer-oriented approach provides theoretically better methods than conventional techniques to establish error limits and to identify outliers. 6 refs., 3 figs., 3 tabs

  6. Stable isotopes labelled compounds

    International Nuclear Information System (INIS)

    1982-09-01

    The catalogue on stable isotopes labelled compounds offers deuterium, nitrogen-15, and multiply labelled compounds. It includes: (1) conditions of sale and delivery, (2) the application of stable isotopes, (3) technical information, (4) product specifications, and (5) the complete delivery programme

  7. ICT: isotope correction toolbox.

    Science.gov (United States)

    Jungreuthmayer, Christian; Neubauer, Stefan; Mairinger, Teresa; Zanghellini, Jürgen; Hann, Stephan

    2016-01-01

    Isotope tracer experiments are an invaluable technique to analyze and study the metabolism of biological systems. However, isotope labeling experiments are often affected by naturally abundant isotopes especially in cases where mass spectrometric methods make use of derivatization. The correction of these additive interferences--in particular for complex isotopic systems--is numerically challenging and still an emerging field of research. When positional information is generated via collision-induced dissociation, even more complex calculations for isotopic interference correction are necessary. So far, no freely available tools can handle tandem mass spectrometry data. We present isotope correction toolbox, a program that corrects tandem mass isotopomer data from tandem mass spectrometry experiments. Isotope correction toolbox is written in the multi-platform programming language Perl and, therefore, can be used on all commonly available computer platforms. Source code and documentation can be freely obtained under the Artistic License or the GNU General Public License from: https://github.com/jungreuc/isotope_correction_toolbox/ {christian.jungreuthmayer@boku.ac.at,juergen.zanghellini@boku.ac.at} Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  8. Separation of uranium isotopes

    International Nuclear Information System (INIS)

    Porter, J.T.

    1980-01-01

    Methods and apparatus are disclosed for separation of uranium isotopes by selective isotopic excitation of photochemically reactive uranyl salt source material at cryogenic temperatures, followed by chemical separation of selectively photochemically reduced U+4 thereby produced from remaining uranyl source material

  9. Isotope research materials

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    Preparation of research isotope materials is described. Topics covered include: separation of tritium from aqueous effluents by bipolar electrolysis; stable isotope targets and research materials; radioisotope targets and research materials; preparation of an 241 Am metallurgical specimen; reactor dosimeters; ceramic and cermet development; fission-fragment-generating targets of 235 UO 2 ; and wire dosimeters for Westinghouse--Bettis

  10. Isotope separation process

    International Nuclear Information System (INIS)

    Lyon, R.K.

    1979-01-01

    A method is described for the isotopically selective excitation of gas phase molecules by multiple infrared photon absorption after which more of the excited molecules than nonexcited molecules are converted to a chemically different form which may be separated by means known in the art. This invention is useful for, but not limited to, the separation of the principal isotopes of uranium

  11. Superdeformation in Pb isotopes

    International Nuclear Information System (INIS)

    Naz, Tabassum; Ahmad, Shakeb

    2017-01-01

    The Relatvistic Hartree-Bogoliubov (RHB) theory is used to explore the structure of superdeformed (SD) 190,212 Pb isotopes using the non-linear NL3* and density dependent (DD-ME2, DD-PC1) interactions. We have studied the the excitation energy, the potential depth and the deformation of these Pb isotopes

  12. Detecting isotopic ratio outliers

    Science.gov (United States)

    Bayne, C. K.; Smith, D. H.

    An alternative method is proposed for improving isotopic ratio estimates. This method mathematically models pulse-count data and uses iterative reweighted Poisson regression to estimate model parameters to calculate the isotopic ratios. This computer-oriented approach provides theoretically better methods than conventional techniques to establish error limits and to identify outliers.

  13. Detecting isotopic ratio outliers

    International Nuclear Information System (INIS)

    Bayne, C.K.; Smith, D.H.

    1986-01-01

    An alternative method is proposed for improving isotopic ratio estimates. This method mathematically models pulse-count data and uses iterative reweighted Poisson regression to estimate model parameters to calculate the isotopic ratios. This computer-oriented approach provides theoretically better methods than conventional techniques to establish error limits and to identify outliers

  14. Isotope dilution analysis

    Energy Technology Data Exchange (ETDEWEB)

    Fudge, A.

    1978-12-15

    The following aspects of isotope dilution analysis are covered in this report: fundamental aspects of the technique; elements of interest in the nuclear field, choice and standardization of spike nuclide; pre-treatment to achieve isotopic exchange and chemical separation; sensitivity; selectivity; and accuracy.

  15. Wide angle isotope separator

    International Nuclear Information System (INIS)

    Kantrowitz, A.

    1976-01-01

    A method and apparatus is described for particle separation. The method uses a wide angle radially expanding vapor of a particle mixture. In particular, selective ionization of one isotope type in the particle mixture is produced in a multichamber separator and the ionized isotope type is accelerated out of the path of the vapor expansion for separate collection

  16. Environmental isotope hydrology

    International Nuclear Information System (INIS)

    1973-01-01

    Environmental isotope hydrology is a relatively new field of investigation based on isotopic variations observed in natural waters. These isotopic characteristics have been established over a broad space and time scale. They cannot be controlled by man, but can be observed and interpreted to gain valuable regional information on the origin, turnover and transit time of water in the system which often cannot be obtained by other techniques. The cost of such investigations is usually relatively small in comparison with the cost of classical hydrological studies. The main environmental isotopes of hydrological interest are the stable isotopes deuterium (hydrogen-2), carbon-13, oxygen-18, and the radioactive isotopes tritium (hydrogen-3) and carbon-14. Isotopes of hydrogen and oxygen are ideal geochemical tracers of water because their concentrations are usually not subject to change by interaction with the aquifer material. On the other hand, carbon compounds in groundwater may interact with the aquifer material, complicating the interpretation of carbon-14 data. A few other environmental isotopes such as 32 Si and 238 U/ 234 U have been proposed recently for hydrological purposes but their use has been quite limited until now and they will not be discussed here. (author)

  17. Laser assisted aerodynamic isotope separation

    International Nuclear Information System (INIS)

    Berg, H. van den

    1985-01-01

    It is shown that the efficiency of conventional aerodynamic isotope seperation can be improved by two orders of magnitude with the aid of a relatively weak cw infrared laser which is used to induce isotopically selective condensation. Overall isotope enrichment factors in excess of 2 are obtained as compared to about 1.02 in the conventional seperation. Sulphur isotopes in SF 6 as well as Silicon isotopes in SiF 4 and Bromine isotopes in CF 3 Br are seperated on a laboratory scale. Infrared vibrational predissociation by itself and in combination with isotopically selective condensation are also shown to be effective new ways of isotope separation. (orig.) [de

  18. Isotopes in Greenland Precipitation

    DEFF Research Database (Denmark)

    Faber, Anne-Katrine

    Greenland ice cores offer a unique opportunity to investigate the climate system behaviour. The objective of this PhD project is to investigate isotope modelling of present- day conditions and conduct model-data comparison using Greenland ice cores. Thus this thesis investigates how the integration...... of model and data can be used to improve the understanding of climate changes. This is done through analysis of isotope modelling, observations and ice core measurements. This dissertation comprises three projects: (1) Modelling the isotopic response to changes in Arctic sea surface conditions, (2......) Constructing a new Greenland database of observations and present-day ice core measurements, and (3) Performance test of isotope-enabled CAM5 for Greenland. The recent decades of rapid Arctic sea ice decline are used as a basis for an observational-based model experiment using the isotope-enabled CAM model 3...

  19. Applications of isotopes

    International Nuclear Information System (INIS)

    Kirby-Smith, J.S.

    1976-01-01

    Current and potential applications of stable isotopes as tracers in a number of biomedical and environmental areas are discussed. It is pointed out that a wide variety of problems exist in these fields whose solutions in principle are amenable to the isotopic approach. The number and diversity of these problems as well as the unique role stable isotopes can play in their solution illustrate the importance of achieving and maintaining a broad inventory of isotopic species. Experience has demonstrated unequivocally an additional overriding requirement for widespread exploration of stable isotopes by the scientific and technical community, i.e., the need for low cost availability of the materials in quantity. Some representative applications of 12 C, 13 C, 14 N, 15 N, 16 O, 17 O, and 18 O are discussed

  20. Chromium isotope variations

    DEFF Research Database (Denmark)

    D'Arcy, Joan Mary

    the δ53Cr value of continental runoff into the ocean. The major findings were that river water is characterised by heavy δ53Cr values (+0.1‰ to +1.6‰), while soils are characterised by light δ53Cr values (-0.3‰), relative to the catchment bedrock (-0.17‰ to -0.21‰), indicating that Cr isotopes......, and the quantification the Cr isotope composition of major Cr fluxes into and out of ocean. This thesis adds to the current knowledge of the Cr isotope system and is divided into two studies. The focus of the first study was to determine what processes control the Cr isotopic compositionof river water and to quantify......Chromium (Cr) stable isotopes are a useful tracer of changes in redox conditions because changes in its oxidation state are accompanied by an isotopic fractionation. For this reason the Cr isotope system is being developed as a potential tool for paleo-redox reconstruction. Dissolved Cr in seawater...

  1. Isotopically controlled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Haller, Eugene E.

    2006-06-19

    The following article is an edited transcript based on the Turnbull Lecture given by Eugene E. Haller at the 2005 Materials Research Society Fall Meeting in Boston on November 29, 2005. The David Turnbull Lectureship is awarded to recognize the career of a scientist who has made outstanding contributions to understanding materials phenomena and properties through research, writing, and lecturing, as exemplified by the life work of David Turnbull. Haller was named the 2005 David Turnbull Lecturer for his 'pioneering achievements and leadership in establishing the field of isotopically engineered semiconductors; for outstanding contributions to materials growth, doping and diffusion; and for excellence in lecturing, writing, and fostering international collaborations'. The scientific interest, increased availability, and technological promise of highly enriched isotopes have led to a sharp rise in the number of experimental and theoretical studies with isotopically controlled semiconductor crystals. This article reviews results obtained with isotopically controlled semiconductor bulk and thin-film heterostructures. Isotopic composition affects several properties such as phonon energies, band structure, and lattice constant in subtle, but, for their physical understanding, significant ways. Large isotope-related effects are observed for thermal conductivity in local vibrational modes of impurities and after neutron transmutation doping. Spectacularly sharp photoluminescence lines have been observed in ultrapure, isotopically enriched silicon crystals. Isotope multilayer structures are especially well suited for simultaneous self- and dopant-diffusion studies. The absence of any chemical, mechanical, or electrical driving forces makes possible the study of an ideal random-walk problem. Isotopically controlled semiconductors may find applications in quantum computing, nanoscience, and spintronics.

  2. Isotope separation process

    International Nuclear Information System (INIS)

    1976-01-01

    The invention relates to a process for separating a given material into two or more parts, in each of which the abundances of the isotopes of a given element differ from the abundances of the isotopes of the same material in the said material. More particularly, the invention relates to a method for the isotopically selective excitation of gas phase UF 6 by infrared photon absorption followed by selective reaction of said excited UF 6 with atomic chlorine, bromine, or iodine to form a product which may be separated by means known in the art

  3. Radiation gradient isotope separator

    International Nuclear Information System (INIS)

    Hughes, J.L.

    1980-01-01

    A system is described for transporting, separating and storing charged particles, charged antiparticles and fully or partially ionized isotopes of any element comprising a laser beam generator, laser beam intensity profiler, a laser beam variable intensity attenuator, and means for injecting charged particles, charged antiparticles and ionized isotopes into the beam and extracting them from the system as required. The invention is particularly useful for channelling electrons and ions used for fuel pellet compression in inertial fusion systems, for separating the isotopes of elements and for the confinement of charged antiparticles and particle/antiparticle plasmas

  4. Atomic and molecular isotope separation

    International Nuclear Information System (INIS)

    Melamed, N.T.

    1979-01-01

    A method for differentially exciting a selected isotopic species in a mixture of isotopic species is described characterized in that almost the entire isotopic mixture is placed in an excited gaseous state; and a preselected isotopic species is then selectively de-excited through stimulated emission

  5. Isotope Production Facility (IPF)

    Data.gov (United States)

    Federal Laboratory Consortium — The Los Alamos National Laboratory has produced radioactive isotopes for medicine and research since the mid 1970s, when targets were first irradiated using the 800...

  6. Calcium stable isotope geochemistry

    Energy Technology Data Exchange (ETDEWEB)

    Gausonne, Nikolaus [Muenster Univ. (Germany). Inst. fuer Mineralogie; Schmitt, Anne-Desiree [Strasbourg Univ. (France). LHyGeS/EOST; Heuser, Alexander [Bonn Univ. (Germany). Steinmann-Inst. fuer Geologie, Mineralogie und Palaeontologie; Wombacher, Frank [Koeln Univ. (Germany). Inst. fuer Geologie und Mineralogie; Dietzel, Martin [Technische Univ. Graz (Austria). Inst. fuer Angewandte Geowissenschaften; Tipper, Edward [Cambridge Univ. (United Kingdom). Dept. of Earth Sciences; Schiller, Martin [Copenhagen Univ. (Denmark). Natural History Museum of Denmark

    2016-08-01

    This book provides an overview of the fundamentals and reference values for Ca stable isotope research, as well as current analytical methodologies including detailed instructions for sample preparation and isotope analysis. As such, it introduces readers to the different fields of application, including low-temperature mineral precipitation and biomineralisation, Earth surface processes and global cycling, high-temperature processes and cosmochemistry, and lastly human studies and biomedical applications. The current state of the art in these major areas is discussed, and open questions and possible future directions are identified. In terms of its depth and coverage, the current work extends and complements the previous reviews of Ca stable isotope geochemistry, addressing the needs of graduate students and advanced researchers who want to familiarize themselves with Ca stable isotope research.

  7. Isotope separation process

    International Nuclear Information System (INIS)

    Lyon, R.K.

    1977-01-01

    The instant invention relates to a process for separating a material into two or more parts in each of which the abundances of the isotopes of a given element differ from the abundances of the isotopes of the same material in said material. More particularly, the invention relates to a method for the isotopically selective excitation of gas phase molecules by multiple infrared photon absorption followed by a step wherein more of the excited molecules than nonexcited molecules are converted to a chemically different form which may be separated by means known in the art. This invention is useful for, but not limited to, the separation of the principal isotopes of uranium. 15 claims, 1 figure

  8. Isotope separation process

    International Nuclear Information System (INIS)

    Thomas, W.R.L.

    1979-01-01

    The instant invention relates to an improved process for separating a material into two or more parts in each of which the abundances of the isotopes of a given element differ from the abundances of the isotopes of the same element in said material. More particularly, the invention relates to a method for the isotopically selective excitation of gas phase molecules by multiple infrared photon absorption followed by a step wherein more of the excited molecules than non-excited molecules are converted to a chemically different form which may be separated by means known in the art. This invention is useful for, but not limited to, the separation of the principal isotopes of uranium

  9. Calcium stable isotope geochemistry

    International Nuclear Information System (INIS)

    Gausonne, Nikolaus; Schmitt, Anne-Desiree; Heuser, Alexander; Wombacher, Frank; Dietzel, Martin; Tipper, Edward; Schiller, Martin

    2016-01-01

    This book provides an overview of the fundamentals and reference values for Ca stable isotope research, as well as current analytical methodologies including detailed instructions for sample preparation and isotope analysis. As such, it introduces readers to the different fields of application, including low-temperature mineral precipitation and biomineralisation, Earth surface processes and global cycling, high-temperature processes and cosmochemistry, and lastly human studies and biomedical applications. The current state of the art in these major areas is discussed, and open questions and possible future directions are identified. In terms of its depth and coverage, the current work extends and complements the previous reviews of Ca stable isotope geochemistry, addressing the needs of graduate students and advanced researchers who want to familiarize themselves with Ca stable isotope research.

  10. Laser separation of uranium isotopes

    International Nuclear Information System (INIS)

    Porter, J.T.

    1981-01-01

    Method and apparatus for separating uranium isotopes are claimed. The method comprises the steps of irradiating a uranyl source material at a wavelength selective to a desired isotope and at an effective temperature for isotope spectral line splitting below about 77 deg.K., further irradiating the source material within the fluorescent lifetime of the source material to selectively photochemically reduce the excited isotopic species, and chemically separating the reduced isotope species from the remaining uranyl salt compound

  11. High mass isotope separation arrangement

    International Nuclear Information System (INIS)

    Eerkens, J.W.

    1980-01-01

    This invention relates to the isotope separation art and, more particularly, to a selectively photon-induced energy level transition of an isotopic molecule containing the isotope to be separated and a chemical reaction with a chemically reactive agent to provide a chemical compound containing atoms of the isotope desired. In particular a description is given of a method of laser isotope separation applied to the separation of 235 UF 6 from 238 UF 6 . (U.K.)

  12. Emission spectrometric isotope analyzer

    International Nuclear Information System (INIS)

    Mauersberger, K.; Meier, G.; Nitschke, W.; Rose, W.; Schmidt, G.; Rahm, N.; Andrae, G.; Krieg, D.; Kuefner, W.; Tamme, G.; Wichlacz, D.

    1982-01-01

    An emission spectrometric isotope analyzer has been designed for determining relative abundances of stable isotopes in gaseous samples in discharge tubes, in liquid samples, and in flowing gaseous samples. It consists of a high-frequency generator, a device for defined positioning of discharge tubes, a grating monochromator with oscillating slit and signal converter, signal generator, window discriminator, AND connection, read-out display, oscillograph, gas dosing device and chemical conversion system with carrier gas source and vacuum pump

  13. Isotope toolbox turns 10

    DEFF Research Database (Denmark)

    Wenander, Fredrik; Riisager, Karsten

    2012-01-01

    REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes.......REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes....

  14. Laser isotope separation

    International Nuclear Information System (INIS)

    1976-01-01

    The claimed invention is a method of isotope separation based on the unimolecular decomposition of vibrationally excited negative ions which are produced in the reaction of thermal electrons and molecules which have been vibrationally excited in an isotope selective manner. This method is especially applicable to molecules represented by the formula MF 6 wherein M is selected from the group consisting of U, S, W, Se, Te, Mo, Re and Tc

  15. UWIS isotope separator

    Energy Technology Data Exchange (ETDEWEB)

    Wojtasiewicz, A. [Warsaw Univ., Inst. of Experimental Physics, Nuclear Physics Div., Warsaw (Poland)

    1997-12-31

    Since 1995 the University of Warsaw Isotope Separator group has participated in the ISOL/IGISOL project at the Heavy Ion Cyclotron. This project consists in installation of an isotope separator (on line with cyclotron heavy ion beam) with a hot plasma ion source (ISOL system) and/or with an ion guide source (IGISOL system). In the report the short description of the present status of the project is presented. 2 figs, 10 refs.

  16. Laser isotope separation process

    International Nuclear Information System (INIS)

    Kaldor, A.

    1976-01-01

    The claimed invention is a method of isotope separation based on the unimolecular decomposition of vibrationally excited negative ions which are produced in the reaction of thermal electrons and molecules which have been vibrationally excited in an isotope selective manner. This method is especially applicable to molecules represented by the formula MF 6 wherein M is selected from the group consisting of U, S, W, Se, Te, Mo, Re, and Tc. 9 claims, 1 drawing figure

  17. Isotopes in environmental research

    International Nuclear Information System (INIS)

    Bowen, G.; Rozanski, K.; Vose, P.

    1990-01-01

    Radioactive and stable isotopes have long been considered a very efficient tool for studying physical and biological aspects of how the global ecosystem functions. Their applications in environmental research are numerous, embracing research at all levels. This article looks at only a few of the approaches to environmental problems that involve the use of isotopes. Special attention is given to studies of the Amazon Basin. Environmental isotopes are very efficient tools in water cycle studies. Tritium, a radioactive tracer, is especially useful in studying dynamics of water movement in different compartments of the hydrosphere, both on the local and global scales. Heavy stable isotopes of hydrogen and oxygen (deuterium and oxygen-18) provide information about steady-state characteristics of the water cycle. Isotope methods, some relatively new, have a major role in site-specific studies. Some indicative examples include: Studying turnover of organic matter. Changes in the carbon-13/carbon-12 isotopic ratio of organic matter were used to determine the respective contributions of organic carbon derived from forest and pasture. Studying biological nitrogen fixation. One of the ways nitrogen levels in soil can be maintained for productivity is by biological nitrogen fixation. Studying nitrogen availability and losses. The experimental use of nitrogen-15 is invaluable for defining losses of soil nitrogen to the atmosphere and to groundwater. Studies can similarly be done with stable and radioactive sulphur isotopes. This article indicates some potential uses of isotopes in environmental research. While the major problem of global climate change has not been specifically addressed here, the clearing of the Amazon forest, one focus of the IAEA's environmental programme, may have serious consequences for the global climate. These include substantial reduction of the amount of latent heat transported to the regions outside the tropics and acceleration of the greenhouse

  18. Isotopes in everyday life

    International Nuclear Information System (INIS)

    Seligman, H.; Gillen, V.A.

    1990-12-01

    Isotopes represent a tool which can do certain jobs better, easier, quicker, more simply and cheaper than competitive methods. Some measurements could not be done at all without the use of isotopes as there are no alternative methods available. A short review of these tools of science in their different fields is given: food and agriculture, human health applications, industry, hydrology, geology, geochemistry, geophysics and dating, environment, basic scientific research

  19. Isotope separation process

    International Nuclear Information System (INIS)

    Cabicar, J.; Stamberg, K.; Katzer, J.

    1983-01-01

    A process for separating isotopes by the method of controlled distribution is claimed. A first phase is either a solution of isotopic components and a ligand (from 10 - 6 M to a saturated solution), or a gaseous mixture of isotopic components, or a gaseous mixture of isotopic components and an inert gas. The isotopes are in the starting mixture in molar ratio from 1:10 5 to 1:10 - 5 . The second phase is a solid sorbent such as styrene-divinylbenzene ion exchangers, or bio-sorbents on the basis of mycelium of lower fungi and sorbents on the basis of cellulose, or an extraction agent such as tributyl phosphate and trioctyl amine, if need be, kept by a carrier such as teflon, silica gel and cellulose. The two-phase system exhibits non-linear equilibrium isotherm for sorption and/or desorption or for extraction and/or re-extraction. After bringing both phases into contact the rate of transport of isotopic components from one phase into another is not equal. Retardation of isotopic exchange takes place by complexation of isotopes with ligands such as cabonate, sulphate, citrate, chloride and ethylenediamine tetraacetate ions, or by using sorbents and extraction agents with chelating functional groups such as carboxyl and hyroxyl groups, groups on the basis of phosphorus, nitrogen and sulphur and/or by operating in darkness, or in the light having wave length between 2.5x10 2 and 10 9 nm. The contact time is between 10 - 2 and 10 6 s, temperature between 10 2 and 10 3 K, the number of stirrer revolutions between 10 - 2 and 10 4 revolutions per s, flow rate at column arrangement between 10 - 6 and 10 - 1 m/s and the size of particles of sorbent between 10 - 6 and 10 - 2 m

  20. WE-G-BRE-07: Proton Therapy Enhanced by Tumor-Targeting Gold Nanoparticles: A Pilot in Vivo Experiment at The Proton Therapy Center at MD Anderson Cancer Center

    Energy Technology Data Exchange (ETDEWEB)

    Wolfe, T; Grant, J; Wolfe, A; Gillin, M; Krishnan, S [MD Anderson Cancer Ctr., Houston, TX (United States)

    2014-06-15

    Purpose: Assess tumor-growth delay and survival in a mouse model of prostate cancer treated with tumor-targeting gold nanoparticles (AuNPs) and proton therapy. Methods: We first examined the accumulation of targeting nanoparticles within prostate tumors by imaging AuNPs with ultrasound-guided photoacoustics at 24h after the intravenous administration of goserelin-conjugated AuNPs (gAuNP) in three mice. Nanoparticles were also imaged at the cellular level with TEM in PC3 cells incubated with gAuNP for 24h. Pegylated AuNPs (pAuNP) were also imaged in vivo and in vitro for comparison. PC3 cells were then implanted subcutaneously in nude mice; 51mice with 8–10mm tumors were included. AuNPs were injected intravenously at 0.2%w/w final gold concentration 24h before irradiation. A special jig was designed to facilitate tumor irradiation perpendicular to the proton beam. Proton energy was set to 180MeV, the radiation field was 18×18cm{sup 2}, and 9cm or 13.5cm thick solid-water compensators were used to position the tumors at either the beam entrance (BE) or the SOBP. Physical doses of 5Gy were delivered to all tumors on a patient beam line at MD Anderson's Proton Therapy Center. Results: The photoacoustic experiment reveled that our nanoparticles leak from the tumor-feeding vasculature and accumulate within the tumor volume over time. Additionally, TEM images showed gAuNP are internalized in cancer cells, accumulating within the cytoplasm, whereas pAuNP are not. Tumor-growth was delayed by 11 or 32days in mice receiving gAuNP irradiated at the BE or the SOBP, relative to proton radiation alone. Survival curves (ongoing experiment) reveal that gAuNPs improved survival by 36% or 74% for tumors irradiated at the BE or SOBP. Conclusion: These important, albeit preliminary, in vivo findings reveal nanoparticles to be potent sensitizers to proton therapy. Further, conjugation of AuNPs to tumor-specific antigens that promote enhanced cellular internalization improved

  1. Synthesis of star-branched PLA-b-PMPC copolymer micelles as long blood circulation vectors to enhance tumor-targeted delivery of hydrophobic drugs in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Long, Li-xia [Tianjin Key Laboratory of Composite and Functional Materials, School of Materials Science & Engineering, Tianjin University, Tianjin 300072 (China); Zhao, Jin, E-mail: zhaojin@tju.edu.cn [Tianjin Key Laboratory of Composite and Functional Materials, School of Materials Science & Engineering, Tianjin University, Tianjin 300072 (China); Li, Ke; He, Li-gang; Qian, Xiao-ming; Liu, Chao-yong; Wang, Li-mei; Yang, Xin-qi [Tianjin Key Laboratory of Composite and Functional Materials, School of Materials Science & Engineering, Tianjin University, Tianjin 300072 (China); Sun, Jinjin [Department of General Surgery, The Second Hospital of Tianjin Medical University, Tianjin 300211 (China); Ren, Yu [Tianjin Research Center of Basic Medical Science, Tianjin Medical University, Tianjin 300070 (China); Kang, Chun-sheng, E-mail: kang97061@yahoo.com [Department of Neurosurgery, Tianjin Medical University General Hospital, Tianjin 300052 (China); Yuan, Xu-bo, E-mail: xbyuan@tju.edu.cn [Tianjin Key Laboratory of Composite and Functional Materials, School of Materials Science & Engineering, Tianjin University, Tianjin 300072 (China)

    2016-09-01

    Star-branched amphiphilic copolymer nanocarriers with high-density zwitterionic shell show great promise in drug delivery due to their controllable small size and excellent anti-biofouling properties. This gives the hydrophobic cargo with high stability and long blood circulation in vivo. In the present study, star-branched polylactic acid and poly(2-methacryloyloxyethyl phosphorylcholine) copolymers with (AB{sub 3}){sub 3}–type architecture (PLA-b-PMPC{sub 3}){sub 3} were conceived as drug vectors, and the copolymers were synthesized by an “arm-first” approach via the combination of ring opening polymerization (ROP), atom transfer radical polymerization (ATRP) and the click reaction. The self-assembled star-branched copolymer micelles (sCPM) had an average diameter of about 64.5 nm and exhibited an ultra-hydrophilic surface with an ultralow water contact angle of about 12.7°, which efficiently suppressed the adhesion of serum proteins. In vivo experiments showed that the sCPM loading strongly enhanced the blood circulation time of DiI and the plasma half-life of DiI in sCPM was 19.3 h. The relative accumulation concentration in tumor of DiI delivered by sCPM was 2.37-fold higher than that of PLA-PEG, at 4 h after intravenous injection. These results demonstrated that the star-branched copolymer (PLA-b-PMPC{sub 3}){sub 3} is a promising alternative carrier material for intravenous delivery versus classic PEG-modified strategies. - Highlights: • Star-branched amphiphilic copolymer micelles (sCPM) with zwitterionic shells were prepared. • sCPM possess an ultra-hydrophilic surface and thus inhibited the protein absorption. • sCPM can effectively prolong the cargo’s plasma circulation time. • sCPM can enhance the cargo’s passive tumor-targeted delivery.

  2. Isotope separation apparatus

    International Nuclear Information System (INIS)

    Lyon, R.K.; Eisner, P.N.; Thomas, W.R.I.

    1983-01-01

    This application discloses a method for and an apparatus in which isotopes of an element in a compared are separated from each other while that compound, i.e., including a mixture of such isotopes, flows along a predetermined path. The apparatus includes a flow tube having a beginning and an end. The mixture of isotopes is introduced into the flow tube at a first introduction point between the beginning and the end thereof to flow the mixture toward the end thereof. A laser irradiates the flow tube dissociating compounds of a preselected one of said isotopes thereby converting the mixture in an isotopically selective manner. The dissociation products are removed from the tube at a first removal point between the first introduction point and the end. The dissociation product removed at the the first removal point are reconverted back into the comound thereby providing a first stage enriched compound. This first stage enriched compound is reintroduced into the flow tube at a second introduction point between the beginning thereof and the first introduction point. Further product is removed from the flow tube at a second removal point between the second introduction point and the first introduction point. The second introduction point is chosen so that the isotope composition of the first stage enriched compound is approximately the same as that of the compound in the flow tube

  3. International Isotopes Markets

    Directory of Open Access Journals (Sweden)

    Stanislaw Z. Zhiznin

    2016-01-01

    Full Text Available The paper studies world markets of stable and radioactive isotopes. Isotopes have found various applications in science, industry, agriculture and other sectors of the economy, but especially - in medicine. Nuclear medicine is developing intensively all over the world thanks to the success in the treatment of various diseases with the help of radioactive pharmaceuticals (radiopharmaceuticals. The article uses empirical data from a forecast study of the global radiopharmaceuticals market made in 2015 by a research company «Markets and Markets» for the European, North American and global markets. The paper also analyzes the statistical data on the global export and import of natural uranium, enriched and depleted uranium, plutonium, thorium and some stable isotopes of non-medical purposes, presented by a company «Trend economy» in 2014. Despite a unique industrial base for the production of isotopes created in the Soviet Union Russia occupies a modest position on the world market of nuclear medicine except for certain areas. More than 80% of isotopes, produced in USSR were consumed domestically, the export of the stable and radioactive isotopes was in equal proportions. Now the country's domestic radiopharmaceuticals market is poorly developed. To radically change the situation, it is necessary to carry out reforms that stimulate the development of nuclear medicine.

  4. Beneficial use of isotopes

    International Nuclear Information System (INIS)

    Bertel, E.; Stevens, G.H.

    1998-01-01

    The paper gives an outlook on the main isotopes currently used for beneficial applications, provides an overview on geographic distribution of isotope production capabilities and identifies the main suppliers world-wide. It analyses trends in different countries and regions, including the refurbishment and/or replacement of ageing facilities and the implementation of new capabilities. Issues related to adequate supply of isotopes and potential under or over capacity of production for some key products are discussed. The evolution of the isotope production sector is analysed. Issues such as lowering of governmental support to production facilities, emergence of international co-operation and agreements on production capabilities, and developments in non-OECD/NEA countries are addressed. The paper offers some concluding remarks on the importance of maintaining and enhancing beneficial uses of isotopes, the role of government policies, the need for co-operation between countries and between the private and public sectors. The paper addresses the role of international cooperation in making efficient use of existing isotope production capacity and investigates ways for reducing the need for investment in additional capacity. (author)

  5. Transportation of medical isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, D.L.

    1997-11-19

    A Draft Technical Information Document (HNF-1855) is being prepared to evaluate proposed interim tritium and medical isotope production at the Fast Flux Test Facility (FFTF). This assessment examines the potential health and safety impacts of transportation operations associated with the production of medical isotopes. Incident-free and accidental impacts are assessed using bounding source terms for the shipment of nonradiological target materials to the Hanford Site, the shipment of irradiated targets from the FFTF to the 325 Building, and the shipment of medical isotope products from the 325 Building to medical distributors. The health and safety consequences to workers and the public from the incident-free transportation of targets and isotope products would be within acceptable levels. For transportation accidents, risks to works and the public also would be within acceptable levels. This assessment is based on best information available at this time. As the medical isotope program matures, this analysis will be revised, if necessary, to support development of a final revision to the Technical Information Document.

  6. Isotope separation process

    International Nuclear Information System (INIS)

    Wexler, Sol; Young, C.E.

    1976-01-01

    Description is given of method for separating a specific isotope from a mixture of isotopes of an actinide element present as MF 6 , wherein M is the actinide element. It comprises: preparing a feed gas mixture of MF 6 in a propellant gas; passing the feed gas mixture under pressure through an expansion nozzle while heating the mixture to about 600 0 C; releasing the heated gas mixture from the nozzle into an exhaust chamber having a reduced pressure, whereby a gas jet of MF 6 molecules, MF 6 molecular clusters and propellant gas molecules is formed, the MF 6 molecules having a translational energy of about 3 eV; converting the MF 6 molecules to MF 6 ions by passing the jet through a cross jet of electron donor atoms so that an electron transfer takes place between the MF 6 - molecules and the electron donor atoms whereby the jet is now quasi-neutral, containing negative MF 6 - ions and positive donor ions; passing the quasi-neutral jet through a radiofrequency mass filter tuned to separate the MF 6 ions containing the specific isotope from the MF 6 - ions of the other isotopes and neutralizing and collecting the MF 6 molecules of the specific isotope [fr

  7. Noncovalent Hydrogen Isotope Effects

    Science.gov (United States)

    Buchachenko, A. L.; Breslavskaya, N. N.

    2018-02-01

    Zero-point energies (ZPE) and isotope effects, induced by intermolecular, noncovalent vibrations, are computed and tested by experimental data. The ZPE differences of H- and D-complexes of water with hydrogen, methane, and water molecules are about 100-300 cal/mol; they result to isotope effects IE of 1.20-1.70. Semi-ionic bonds between metal ions and water ligands in M(H2O) 6 2+ complexes are much stronger; their ZPEs are about 12-14 kcal/mol per molecule and result to IE of 1.9-2.1 at 300 K. Protonated (deuterated) water and biwater exhibit the largest ZPE differences and isotope effects; the latter are 25-28 and 12-13 for water and biwater, respectively. Noncovalent IEs contribute markedly into the experimentally measured effects and explain many anomalous and even magic properties of the effects, such as the dependence of IE on the solvents and on the presence of the third substances, enormously large isotope effects at the mild conditions, the difference between IEs measured in the reactions of individual protiated and deuterated compounds and those measured in their mixture. Noncovalent IEs are not negligible and should be taken into account to make correct and substantiated conclusions on the reaction mechanisms. The kinetic equations are derived for the total isotope effects, which include noncovalent IEs as additive factors.

  8. Transportation of medical isotopes

    International Nuclear Information System (INIS)

    Nielsen, D.L.

    1997-01-01

    A Draft Technical Information Document (HNF-1855) is being prepared to evaluate proposed interim tritium and medical isotope production at the Fast Flux Test Facility (FFTF). This assessment examines the potential health and safety impacts of transportation operations associated with the production of medical isotopes. Incident-free and accidental impacts are assessed using bounding source terms for the shipment of nonradiological target materials to the Hanford Site, the shipment of irradiated targets from the FFTF to the 325 Building, and the shipment of medical isotope products from the 325 Building to medical distributors. The health and safety consequences to workers and the public from the incident-free transportation of targets and isotope products would be within acceptable levels. For transportation accidents, risks to works and the public also would be within acceptable levels. This assessment is based on best information available at this time. As the medical isotope program matures, this analysis will be revised, if necessary, to support development of a final revision to the Technical Information Document

  9. Isotope methods in hydrology

    International Nuclear Information System (INIS)

    Moser, H.; Rauert, W.

    1980-01-01

    Of the investigation methods used in hydrology, tracer methods hold a special place as they are the only ones which give direct insight into the movement and distribution processes taking place in surface and ground waters. Besides the labelling of water with salts and dyes, as in the past, in recent years the use of isotopes in hydrology, in water research and use, in ground-water protection and in hydraulic engineering has increased. This by no means replaces proven methods of hydrological investigation but tends rather to complement and expand them through inter-disciplinary cooperation. The book offers a general introduction to the application of various isotope methods to specific hydrogeological and hydrological problems. The idea is to place the hydrogeologist and the hydrologist in the position to recognize which isotope method will help him solve his particular problem or indeed, make a solution possible at all. He should also be able to recognize what the prerequisites are and what work and expenditure the use of such methods involves. May the book contribute to promoting cooperation between hydrogeologists, hydrologists, hydraulic engineers and isotope specialists, and thus supplement proven methods of investigation in hydrological research and water utilization and protection wherever the use of isotope methods proves to be of advantage. (orig./HP) [de

  10. Separation of uranium isotopes by accelerated isotope exchange reactions

    International Nuclear Information System (INIS)

    Seko, M.; Miyake, T.; Inada, K.; Ochi, K.; Sakamoto, T.

    1977-01-01

    A novel catalyst for isotope exchange reaction between uranium(IV) and uranium(VI) compounds enables acceleration of the reaction rate as much as 3000 times to make industrial separation of uranium isotopes economically possible

  11. Stable Isotope Group 1982 progress report

    International Nuclear Information System (INIS)

    Stewart, M.K.

    1983-06-01

    The work of the Stable Isotope Group of the Institute of Nuclear Sciences during 1982, in the fields of isotope geology, isotope hydrology, geochronology, isotope biology and mass spectrometer instrumentation, is described

  12. Stable Isotope Group 1983 progress report

    International Nuclear Information System (INIS)

    Stewart, M.K.

    1984-06-01

    The work of the Stable Isotope Group of the Institute of Nuclear Sciences in the fields of isotope geology, isotope hydrology, geochronology, isotope biology and related fields, and mass spectrometer instrumentation, during 1983, is described

  13. Isotope separation system

    International Nuclear Information System (INIS)

    Lehmann, J.-C.

    1975-01-01

    A description is given of an isotope separation device comprising a system for converting into gaseous form a first and second isotope to be separated, a monochromatic excitation light source to excite the gaseous molecules of these two isotopes in a distinct manner, a first and second receiver to collect selectively the molecules of the first and second distinctly excited isotopes. The frequency FL of the excitation light is selected between a lower limit and a higher limit F2 + 1/2 LD, depending on the frequences F1 and F2 of two absorption lines near this first and second isotope. The difference DF between these two frequencies F1 and F2 is less than the Doppler width LD of each one of these lines and greater than the natural width LN of each of these two lines and also the width of line LR of the excitation light source. The probability that the molecules will be excited by this light depends on the direction of their displacement to a major and different extent for both isotopes. An ionising light source LI is set up to irradiate the seat of interaction between the excitation light and the gaseous molecules with an ionisation light able to ionise the excited molecules without ionising the molecules that are not excited. The receivers are able to collect selectively the ionised molecules. A sufficiently low gas pressure is selected for the distance between the place of interaction and the first receiver to be less than double the free mean travel of the molecules in the gas [fr

  14. Climate and isotopic tracers

    International Nuclear Information System (INIS)

    Jean-Baptiste, Ph.

    1997-01-01

    The applications of natural radioactivity and isotopic measurements in the sciences concerning Earth and its atmosphere, are numerous: carbon 14 dating with the Tandetron apparatus at the Cea, measurement of oxygen 18 in coral or sediment limestone for the determination of ocean temperature and salinity, carbon 14 dating of corals for the determination of sea level variations, deuterium content in polar ice-cap leads to temperature variations determination; isotopic measurements also enable the determination of present climate features such as global warming, oceanic general circulation

  15. Method to separate isotopes

    International Nuclear Information System (INIS)

    Coenen, H.; Neuschuetz, D.

    1980-01-01

    An extraction by means of supercritical pure gases (e.g. CD 2 ) or gas mixtures is proposed to separate isotopes, especially H/D, Li-6/Li-7, and U-235/U-238, and water or benzol is used as entrainer. The extraction shall be carried out at pressure rates of about 350 bar above the critical pressure with the temperature being by up to 100 0 C above the critical temperature. A NaCl-solution and the change of the isotopic ratio Cl-35/Cl-37 are investigated for example purpose. (UWI) [de

  16. Environmental isotope survey

    International Nuclear Information System (INIS)

    Jacovides, J.S.

    1979-03-01

    Work was initiated on the 1st of September 1971 with the objective of finding out how best to use environmental isotopes in the interpretation of the hydrology, particularly subsurface hydrology, of Cyprus through a sparse reconnaissance sampling of all the major aquifers and springs covering the whole island. The distribution of sampling was such that the survey in itself could assist in clarifying particular hydrogeologic problems, provide a better understanding of the water systems of the island, establish a general environmental isotope - framework of the hydrologic regimen of Cyprus as well as to provide the basis for specific, more detailed, studies to be undertaken subsequently

  17. Lectures in isotope geology

    International Nuclear Information System (INIS)

    Jaeger, E.; Hunziker, J.C.

    1979-01-01

    Designed for a introductory course in geochronology and the geochemistry of stable isotopes, this text has been written by recognized experts in the field. Emphasis is on the interpretation and on applications, and examples of these are offered along with each technique. Extraterrestrial applications have been avoided and the treatment of pure experimentation has been kept at a minimum. This text will be appreciated by geologists who want to learn more about methods used in isotope geology, how they can be applied, and how to gauge their usefulness. (orig.) [de

  18. High mass isotope separation arrangement

    International Nuclear Information System (INIS)

    Eerkens, J.W.

    1976-01-01

    An isotope separation arrangement for separating a preselected isotope from a mixture of chemically-identical but isotopically-different molecules by either photon-induced pure revibrational or vibronic selective excitation of the molecules containing the atoms of the isotope to be separated from a lower to a higher energy state, and a chemical reaction of the higher energy state molecules with a chemically-reactive agent to form a chemical compound containing primarily the atoms of the isotope to be separated in a physicochemical state different from the physicochemical state of the mixture of chemically-identical but isotopically-different molecules. The chemical compound containing the atoms of the isotope to be separated may be subsequently processed to obtain the isotope. The laser configuration used to generate the photon beam is fully described

  19. Isotope separation method and apparatus

    International Nuclear Information System (INIS)

    Lyon, R.K.; Eisner, P.N.; Thomas, W.R.L.

    1980-01-01

    A method and apparatus are specified for separating a mixture of isotopes present in a compound, preferably a gaseous compound, into two or more parts in each of which the abundances of the isotopes differ from the natural abundances of the isotopes in the compound. The invention particularly relates to carrying out a laser induced, isotopically selective conversion of gaseous molecules in such a manner as to achieve more than one stage of isotope separation along the length of the laser beam. As an example, the invention is applied to the separation of the isotopes of uranium in UF 6 , in which either the U-235 or U-238 isotope is selectively excited by means of irradiation from an infrared laser, and the selectively excited isotope converted into a product that can be recovered from UF 6 by one of a variety of methods that are described. (U.K.)

  20. Techniques for preparing isotopic targets

    International Nuclear Information System (INIS)

    Xu Guoji; Guan Shouren; Luo Xinghua; Sun Shuhua

    1987-12-01

    The techniques of making isotopic targets for nuclear physics experiments are introduced. Vacuum evaporation, electroplating, centrifugal precipitation, rolling and focused heavy-ion beam sputtering used to prepare various isotopic targets at IAE are described. Reduction-distillation with active metals and electrolytic reduction for converting isotope oxides to metals are mentioned. The stripping processes of producing self-supporting isotopic targets are summarized. The store methods of metallic targets are given

  1. Isotope separation using tunable lasers

    International Nuclear Information System (INIS)

    Snavely, B.B.

    1975-01-01

    Various processes for laser isotope separation based upon the use of the spectroscopic isotope effect in atomic and molecular vapors are discussed. Emphasis is placed upon processes which are suitable for uranium enrichment. A demonstration process for the separation of uranium isotopes using selective photoionization is described. (U.S.)

  2. Isotope effects on nuclear shielding

    International Nuclear Information System (INIS)

    Hansen, P.E.

    1983-01-01

    This review concentrates upon empirical trends and practical uses of mostly secondary isotope effects, both of the intrinsic and equilibrium types. The text and the tables are arranged in the following fashion. The most 'popular' isotope effect is treated first, deuterium isotope effects on 13 C nuclear shielding, followed by deuterium on 1 H nuclear shieldings, etc. Focus is thus on the isotopes producing the effect rather than on the nuclei suffering the effect. After a brief treatment of each type of isotope effect, general trends are dealt with. Basic trends of intrinsic isotope effects such as additivity, solvent effects, temperature effects, steric effects, substituent effects and hyperconjugation are discussed. Uses of isotope effects for assignment purposes, in stereochemical studies, in hydrogen bonding and in isotopic tracer studies are dealt with. Kinetic studies, especially of phosphates, are frequently performed by utilizing isotope effects. In addition, equilibrium isotope effects are treated in great detail as these are felt to be new and very important and may lead to new uses of isotope effects. Techniques used to obtain isotope effects are briefly surveyed at the end of the chapter. (author)

  3. Isotope shifting capacity of rock

    International Nuclear Information System (INIS)

    Blattner, P.; Department of Scientific and Industrial Research, Lower Hutt

    1980-01-01

    Any oxygen isotope shifted rock volume exactly defines a past throughput of water. An expression is derived that relates the throughput of an open system to the isotope shift of reservoir rock and present-day output. The small isotope shift of Ngawha reservoir rock and the small, high delta oxygen-18 output are best accounted for by a magmatic water source

  4. Uranium Isotopic Analysis with the FRAM Isotopic Analysis Code

    International Nuclear Information System (INIS)

    Vo, D.T.; Sampson, T.E.

    1999-01-01

    FRAM is the acronym for Fixed-Energy Response-Function Analysis with Multiple efficiency. This software was developed at Los Alamos National Laboratory originally for plutonium isotopic analysis. Later, it was adapted for uranium isotopic analysis in addition to plutonium. It is a code based on a self-calibration using several gamma-ray peaks for determining the isotopic ratios. The versatile-parameter database structure governs all facets of the data analysis. User editing of the parameter sets allows great flexibility in handling data with different isotopic distributions, interfering isotopes, and different acquisition parameters such as energy calibration and detector type

  5. Isotopes in aquaculture research

    International Nuclear Information System (INIS)

    Ayyappan, S.; Dash, B.; Ghosh, A.S.

    1996-01-01

    The applications of isotopes in aquaculture research include areas like aquatic production process, nutrient cycles and food chain dynamics, fish nutrition, fish physiology, genetics and immunology. The radioisotopes commonly used are beta emitters. The use of different radioisotopes in aquaculture research are presented. 2 tabs

  6. Process for isotope separation

    International Nuclear Information System (INIS)

    Schuster, E.; Kersting, A.; Gebauhr, W.

    1980-01-01

    Isotope separation in UF 6 gas takes place on the principle of selective excitation by laser irradiation and separation by chemical conversion with a partner in a reaction. Atomic H, N or O or the CH 3 or CHO radicals are suitable partners in the reaction. The recombination takes place by catalytic acceleration on leaving the reaction area. (DG) [de

  7. SHELL ISOTOPE GEOCHEMISTRY

    African Journals Online (AJOL)

    ABSTRACT: The land snail Limicolaria kambeul chudeaui Germain was collected ... Key words/phrases: Ethiopia, isotope geochemistry, Lake Tilo, Limicolaria .... 1984), (c) 6'80 values of precipitation at Addis Ababa, with i 1 S.D. bars for the .... (breakfast cereal), deionised water and cuttlefish bone, the carbon and oxygen.

  8. Isotope separation process

    International Nuclear Information System (INIS)

    Cox, D.M.; Maas, E.T.

    1982-01-01

    Processes are disclosed for the separation of isotopes of an element comprising vaporizing uranyl compounds having the formula (UO2a2)n, where a is a monovalent anion and n in an integer from 2 to 4, the compounds having an isotopically shifted infrared absorption spectrum associated with uranyl ions containing said element which is to be separated, and then irradiating the uranyl compound with infrared radiation which is preferentially absorbed by a molecular vibration of uranyl ions of the compound containing a predetermined isotope of that element so that excited molecules of the compound are provided which are enriched in the molecules of the compound containing that predetermined isotope, thus enabling separation of these excited molecules. The processes disclosed include separation of the excited molecules by irradiating under conditions such that the excited molecules dissociate, and also separating the excited molecules by a discrete separation step. The latter includes irradiating the excited molecules by a second infrared laser in order to convert the excited molecules into a separable product, or also by chemically converting the excited molecules, preferably by reaction with a gaseous reactant

  9. Isotopic effect giant resonances

    International Nuclear Information System (INIS)

    Buenerd, M.; Lebrun, D.; Martin, P.; Perrin, G.; Saintignon, P. de; Chauvin, J.; Duhamel, G.

    1981-10-01

    The systematics of the excitation energy of the giant dipole, monopole, and quadrupole resonances are shown to exhibit an isotopic effect. For a given element, the excitation energy of the transition decreases faster with the increasing neutron number than the empirical laws fitting the overall data. This effect is discussed in terms of the available models

  10. Isotopes in action

    International Nuclear Information System (INIS)

    1987-01-01

    For most people the obvious application of nuclear technology is in power generation. But there are many other uses for radioactive materials or for products made with their help. They are found in our factories, hospitals, offices and homes. ''Isotopes in Action'' looks at the many applications of radioisotopes in our society. (author)

  11. Forensic Stable Isotope Biogeochemistry

    Science.gov (United States)

    Cerling, Thure E.; Barnette, Janet E.; Bowen, Gabriel J.; Chesson, Lesley A.; Ehleringer, James R.; Remien, Christopher H.; Shea, Patrick; Tipple, Brett J.; West, Jason B.

    2016-06-01

    Stable isotopes are being used for forensic science studies, with applications to both natural and manufactured products. In this review we discuss how scientific evidence can be used in the legal context and where the scientific progress of hypothesis revisions can be in tension with the legal expectations of widely used methods for measurements. Although this review is written in the context of US law, many of the considerations of scientific reproducibility and acceptance of relevant scientific data span other legal systems that might apply different legal principles and therefore reach different conclusions. Stable isotopes are used in legal situations for comparing samples for authenticity or evidentiary considerations, in understanding trade patterns of illegal materials, and in understanding the origins of unknown decedents. Isotope evidence is particularly useful when considered in the broad framework of physiochemical processes and in recognizing regional to global patterns found in many materials, including foods and food products, drugs, and humans. Stable isotopes considered in the larger spatial context add an important dimension to forensic science.

  12. Isotopes and atomic weights

    International Nuclear Information System (INIS)

    Zhang Qinglian

    1990-01-01

    A review of the chemical and mass spectrometric methods of determining the atomic weights of elements is presented. A, special discussion is devoted to the calibration of the mass spectrometer with highly enriched isotopes. It is illustrated by the recent work on europium. How to choose the candidate element for new atomic weight determination forms the last section of the article

  13. Actinide isotopic analysis systems

    International Nuclear Information System (INIS)

    Koenig, Z.M.; Ruhter, W.D.; Gunnink, R.

    1990-01-01

    This manual provides instructions and procedures for using the Lawrence Livermore National Laboratory's two-detector actinide isotope analysis system to measure plutonium samples with other possible actinides (including uranium, americium, and neptunium) by gamma-ray spectrometry. The computer program that controls the system and analyzes the gamma-ray spectral data is driven by a menu of one-, two-, or three-letter options chosen by the operator. Provided in this manual are descriptions of these options and their functions, plus detailed instructions (operator dialog) for choosing among the options. Also provided are general instructions for calibrating the actinide isotropic analysis system and for monitoring its performance. The inventory measurement of a sample's total plutonium and other actinides content is determined by two nondestructive measurements. One is a calorimetry measurement of the sample's heat or power output, and the other is a gamma-ray spectrometry measurement of its relative isotopic abundances. The isotopic measurements needed to interpret the observed calorimetric power measurement are the relative abundances of various plutonium and uranium isotopes and americium-241. The actinide analysis system carries out these measurements. 8 figs

  14. Application of the isotopic index in isotope geochemical investigation

    International Nuclear Information System (INIS)

    Schuetze, H.

    1982-06-01

    A method is described which allows to calculate approximately isotope exchange equilibria between different crystalline silicates. The algorithm uses a newly introduced isotopic index. It is defined using isotopic increments of the variant types of silicatic bonds. This isotopic index gives a quantitative measure of the ability to enrich 18 O or 30 Si, respectively. The dependence of isotopic fractionations on temperature can be calculated approximately by means of the isotopic index, too. On this theoretical base some problems of magmatism and two varieties of an isotope geochemical model of the evolution of the Earth's crust are treated. Finally, the possibility is demonstrated to give prognostic statements about the likelihood of ore bearing of different granites. (author)

  15. Isotopic separation by ion chromatography

    International Nuclear Information System (INIS)

    Albert, M.G.; Barre, Y.; Neige, R.

    1994-01-01

    The isotopic exchange reaction and the isotopic separation factor are first recalled; the principles of ion chromatography applied to lithium isotope separation are then reviewed (displacement chromatography) and the process is modelled in the view of dimensioning and optimizing the industrial process; the various dimensioning parameters are the isotopic separation factor, the isotopic exchange kinetics and the material flow rate. Effects of the resin type and structure are presented. Dimensioning is also affected by physico-chemical and hydraulic parameters. Industrial implementation features are also discussed. 1 fig., 1 tab., 5 refs

  16. Physics with isotopically controlled semiconductors

    International Nuclear Information System (INIS)

    Haller, E.E.

    1994-08-01

    Control of the isotopic composition of semiconductors offers a wide range of new scientific opportunities. In this paper a number of recent results obtained with isotopically pure as well as deliberately mixed diamond and Ge bulk single crystals and Ge isotope superlattices will be reviewed. Isotopic composition affects several properties such as phonon energies, bandstructure and lattice constant in subtle but theoretically well understood ways. Large effects are observed for thermal conductivity, local vibrational modes of impurities and after neutron transmutation doping (NTD). Several experiments which could profit greatly from isotope control are proposed

  17. Isotope separation process

    International Nuclear Information System (INIS)

    Kaldor, A.; Rabinowitz, P.

    1979-01-01

    A method of separating the isotopes of an element is described, which comprises the steps of (i) subjecting molecules of a gaseous compound of the element simultaneously to two infrared radiations of different wavelengths, the first radiation having a wavelength which corresponds to an absorption band of the compound, which in turn corresponds to a mode of molecular motion in which there is participation by atoms of the element, and the second radiation having a power density greater than 10 6 watts per cm 2 , thereby exciting molecules of the compound in an isotopically selective manner, this step being conducted in such manner that the excited molecules either receive a level of energy sufficient to cause them to undergo conversion by unimolecular decomposition or receive a level of energy sufficient to cause them to undergo conversion by reaction with molecules of another gas present for that purpose; and (ii) separating and recovering converted molecules from unconverted molecules. (author)

  18. Decontamination of radioactive isotopes

    International Nuclear Information System (INIS)

    Despotovic, R.; Music, S.; Subotic, B.; Wolf, R.H.H.

    1979-01-01

    Removal of radioactive isotopes under controlled conditions is determined by a number of physical and chemical properties considered radiocontaminating and by the characteristics of the contaminated object. Determination of quantitative and qualitative factors for equilibrium in a contamination-decontamination system provides the basis for rational and successful decontamination. The decontamination of various ''solid/liquid'' systems is interesting from the scientific and technological point of view. These systems are of great importance in radiation protection (decontamination of various surfaces, liquids, drinking water, fixation or collection of radiocontaminants). Different types of decontamination systems are discussed. The dependence of rate and efficiency of the preparation conditions and on the ageing of the scavenger is described. The influence of coagulating electrolyte on radioactive isotope fixation efficiency was also determined. The fixation of fission radionuclide on oxide scavengers has been studied. The connection between fundamental investigations and practical decontamination of the ''solid/liquid'' systems is discussed. (author)

  19. Cyclotrons for isotope production

    International Nuclear Information System (INIS)

    Milton, B.F.; Stevenson, N.R.

    1995-06-01

    Cyclotrons continue to be efficient accelerators for radioisotope production. In recent years, developments in the accelerator technology have greatly increased the practical beam current in these machines while also improving the overall system reliability. These developments combined with the development of new isotopes for medicine and industry, and a retiring of older machines indicates a strong future for commercial cyclotrons. In this paper we will survey recent developments in the areas of cyclotron technology, and isotope production, as they relate to the new generation of commercial cyclotrons. We will also discuss the possibility of systems capable of extracted energies up to 100 MeV and extracted beam currents of up to 2.0 mA. (author). 6 refs., 2 tabs., 3 figs

  20. Rechargeable radioactive isotope generator

    International Nuclear Information System (INIS)

    Thornton, A.K.; Cerone, F.E.

    1978-01-01

    The description is given of a rechargeable radioactive isotope generator having the following features: a box containing a transport shield, a shielded generator including elements for the absorption and holding of the parent isotope, an eluant tank, a first pipe causing this tank to communicate with the transport shield, a second pipe causing this transport shield to communicate with the shielded generator and a third pipe placing the shielded generator in communication with the outside of the unit. It also includes a shelf across the external front part of the unit a part of which is shielded by external components, a shielded elution flask in which the eluate is poured and a filter set at a point between the flask and the third pipe [fr

  1. Equipment for isotope diagnostics

    International Nuclear Information System (INIS)

    Platz, W.

    1976-01-01

    The invention concerns an improvement of equipment for isotope diagnostics allowing to mark special intensity ranges of the recorded measurements by means of different colors. For undisturbed operation it is of advantage to avoid electric circuits between movable and unmovable parts of the color recorder. According to the invention, long gear wheels of glass fiber-reinforced polyamide are used for these connections. (ORU) [de

  2. Stable isotope analysis

    International Nuclear Information System (INIS)

    Tibari, Elghali; Taous, Fouad; Marah, Hamid

    2014-01-01

    This report presents results related to stable isotopes analysis carried out at the CNESTEN DASTE in Rabat (Morocco), on behalf of Senegal. These analyzes cover 127 samples. These results demonstrate that Oxygen-18 and Deuterium in water analysis were performed by infrared Laser spectroscopy using a LGR / DLT-100 with Autosampler. Also, the results are expressed in δ values (‰) relative to V-SMOW to ± 0.3 ‰ for oxygen-18 and ± 1 ‰ for deuterium.

  3. Stable-isotope studies

    International Nuclear Information System (INIS)

    Anon.

    1975-01-01

    Structures of bacteriochlorophyll b and the Krasnovskii photoreduction products of chlorophyll a are given. All 55 13 C and 4 15 N NMR transitions in chlorophyl a and its magnesium-free derivative pheophytin a were assigned. ESR of triplet states of chlorophylls a, b, c/sub z/, and c 2 and bacteriochlorophyll a are reported. Experiments in the cultivation of 13 C-enriched morning glory plants indicated that the isotope enrichment can produce observable morphological changes. (U.S.)

  4. Protected isotope heat source

    International Nuclear Information System (INIS)

    Burns, R.K.; Shure, L.I.; Katzen, E.D.

    1975-01-01

    A radioactive isotope capsule is disposed in a container (heat shield) which will have a single stable trim attitude when reentering the earth's atmosphere and while falling to earth. The center of gravity of the heat source is located forward of the midpoint between the front face and the rear face of the container. The capsule is insulated from the front face of the container but not from the rear surface of the container. (auth)

  5. Isotopes and agriculture

    International Nuclear Information System (INIS)

    Malavolta, E.

    1988-01-01

    The agriculture is defined as the art of desturbing the ecosystems in economical terms with the minimum of irreversible damage. Man survival in the biosphere will depend on its ability of using four technologies - mechanization, fertilizers, irrigation and pest disease control. The isotopes are usefull to establish means of producing more food and to preserve it; and clains of unbearable damages to the ecosystems caused by fertilizers and pesticides are not true, are presented. (author) [pt

  6. The isotope correlation experiment

    International Nuclear Information System (INIS)

    Koch, L.; Schoof, S.

    1983-01-01

    The ESARDA working group on Isotopic Correlation Techniques, ICT and Reprocessing Input Analysis performed an Isotope Correlation Experiment, ICE with the aim to check the feasibility of the new technique. Ten input batches of the reprocessing of the KWO fuel at the WAK plant were analysed by 4 laboratories. All information to compare ICT with the gravimetric and volumetric methods was available. ICT combined with simplified reactor physics calculation was included. The main objectives of the statistical data evaluation were detection of outliers, the estimation of random errors and of systematic errors of the measurements performed by the 4 laboratories. Different methods for outlier detection, analysis of variances, Grubbs' analysis for the constant-bias model and Jaech's non-constant-bias model were applied. Some of the results of the statistical analysis may seem inconsistent which is due to the following reasons. For the statistical evaluations isotope abundance data (weight percent) as well as nuclear concentration data (atoms/initial metal atoms) were subjected to different outlier criteria before being used for further statistical evaluations. None of the four data evaluation groups performed a complete statistical data analysis which would render possible a comparison of the different methods applied since no commonly agreed statistical evaluation procedure existed. The results prove that ICT is as accurate as conventional techniques which have to rely on costly mass spectrometric isotope dilution analysis. The potential of outlier detection by ICT on the basis of the results from a single laboratory is as good as outlier detection by costly interlaboratory comparison. The application of fission product or Cm-244 correlations would be more timely than remeasurements at safeguards laboratories

  7. Isotopic safeguards statistics

    International Nuclear Information System (INIS)

    Timmerman, C.L.; Stewart, K.B.

    1978-06-01

    The methods and results of our statistical analysis of isotopic data using isotopic safeguards techniques are illustrated using example data from the Yankee Rowe reactor. The statistical methods used in this analysis are the paired comparison and the regression analyses. A paired comparison results when a sample from a batch is analyzed by two different laboratories. Paired comparison techniques can be used with regression analysis to detect and identify outlier batches. The second analysis tool, linear regression, involves comparing various regression approaches. These approaches use two basic types of models: the intercept model (y = α + βx) and the initial point model [y - y 0 = β(x - x 0 )]. The intercept model fits strictly the exposure or burnup values of isotopic functions, while the initial point model utilizes the exposure values plus the initial or fabricator's data values in the regression analysis. Two fitting methods are applied to each of these models. These methods are: (1) the usual least squares fitting approach where x is measured without error, and (2) Deming's approach which uses the variance estimates obtained from the paired comparison results and considers x and y are both measured with error. The Yankee Rowe data were first measured by Nuclear Fuel Services (NFS) and remeasured by Nuclear Audit and Testing Company (NATCO). The ratio of Pu/U versus 235 D (in which 235 D is the amount of depleted 235 U expressed in weight percent) using actual numbers is the isotopic function illustrated. Statistical results using the Yankee Rowe data indicates the attractiveness of Deming's regression model over the usual approach by simple comparison of the given regression variances with the random variance from the paired comparison results

  8. Dual isotope assays

    International Nuclear Information System (INIS)

    Smith, G.F.W.; Stevens, R.A.J.; Jacoby, B.

    1980-01-01

    Dual isotope assays for thyroid function are performed by carrying out a radio-immunoassay for two of thyroxine (T4), tri-iodothyronine (T3), thyroid stimulating hormone (TSH), and thyroxine binding globulin (TBG), by a method wherein a version of one of the thyroid components, preferably T4 or T3 is labelled with Selenium-75 and the version of the other thyroid component is labelled with a different radionuclide, preferably Iodine-125. (author)

  9. Electrochemically controlled iron isotope fractionation

    Science.gov (United States)

    Black, Jay R.; Young, Edward D.; Kavner, Abby

    2010-02-01

    Variations in the stable isotope abundances of transition metals have been observed in the geologic record and trying to understand and reconstruct the physical/environmental conditions that produced these signatures is an area of active research. It is clear that changes in oxidation state lead to large fractionations of the stable isotopes of many transition metals such as iron, suggesting that transition metal stable isotope signatures could be used as a paleo-redox proxy. However, the factors contributing to these observed stable isotope variations are poorly understood. Here we investigate how the kinetics of iron redox electrochemistry generates isotope fractionation. Through a combination of electrodeposition experiments and modeling of electrochemical processes including mass-transport, we show that electron transfer reactions are the cause of a large isotope separation, while mass transport-limited supply of reactant to the electrode attenuates the observed isotopic fractionation. Furthermore, the stable isotope composition of electroplated transition metals can be tuned in the laboratory by controlling parameters such as solution chemistry, reaction overpotential, and solution convection. These methods are potentially useful for generating isotopically-marked metal surfaces for tracking and forensic purposes. In addition, our studies will help interpret stable isotope data in terms of identifying underlying electron transfer processes in laboratory and natural samples.

  10. ISOTOPE METHODS IN HOMOGENEOUS CATALYSIS.

    Energy Technology Data Exchange (ETDEWEB)

    BULLOCK,R.M.; BENDER,B.R.

    2000-12-01

    The use of isotope labels has had a fundamentally important role in the determination of mechanisms of homogeneously catalyzed reactions. Mechanistic data is valuable since it can assist in the design and rational improvement of homogeneous catalysts. There are several ways to use isotopes in mechanistic chemistry. Isotopes can be introduced into controlled experiments and followed where they go or don't go; in this way, Libby, Calvin, Taube and others used isotopes to elucidate mechanistic pathways for very different, yet important chemistries. Another important isotope method is the study of kinetic isotope effects (KIEs) and equilibrium isotope effect (EIEs). Here the mere observation of where a label winds up is no longer enough - what matters is how much slower (or faster) a labeled molecule reacts than the unlabeled material. The most careti studies essentially involve the measurement of isotope fractionation between a reference ground state and the transition state. Thus kinetic isotope effects provide unique data unavailable from other methods, since information about the transition state of a reaction is obtained. Because getting an experimental glimpse of transition states is really tantamount to understanding catalysis, kinetic isotope effects are very powerful.

  11. Isotope effects on chemical equilibria

    International Nuclear Information System (INIS)

    Golding, P.D.

    1974-01-01

    The thermodynamic equilibrium constants of three deuterated substituted acetic acids are reported. The calculation of secondary isotope effects of the second kind for the three isotopic acid pairs has been accomplished by the appropriate comparison of thermodynamic equilibrium constants, and by the comparison of isotopic slopes. The effect of substituent variation on the isotope effects reported here disqualifies the simple inductive model as a legitimate description of secondary isotope effects of the second kind. The correlation of diminishing isotope effect per deuterium atom with increasing acidity is also invalidated by the present results. The syntheses of 9-thia-9,10-dihydrophenanthrene-9-oxide and thioxanthene-10-oxide are described. These compounds have been partially deuterated at their respective methylene positions. Spectral evidence indicates stereoselectivity of the methylene protons in the exchange reactions of both compounds. (author)

  12. Therapeutic use of radioactive isotopes

    CERN Document Server

    Caroline Duc

    2013-01-01

    In December, researchers from ISOLDE-CERN, the Paul Scherrer Institute (PSI) and the Institut Laue-Langevin (ILL) published the results of an in vivo study which successfully proved the effectiveness of four terbium isotopes for diagnosing and treating cancerous tumours.   Four terbium isotopes suitable for clinical purposes. “ISOLDE is the only installation capable of supplying terbium isotopes of such purity and intensity in the case of three out of the four types used in this study,” explains Karl Johnson, a physicist at ISOLDE.  “Producing over a thousand different isotopes, our equipment offers the widest choice of isotopes in the world!” Initially intended for fundamental physics research, ISOLDE has diversified its activities over time to invest in various projects in the materials science, biochemistry and nuclear medicine fields. The proof-of-concept study has confirmed that the four terbium isotopes 149Tb, 152Tb, 155Tb produ...

  13. Stable isotope research pool inventory

    International Nuclear Information System (INIS)

    1984-03-01

    This report contains a listing of electromagnetically separated stable isotopes which are available at the Oak Ridge National Laboratory for distribution for nondestructive research use on a loan basis. This inventory includes all samples of stable isotopes in the Research Materials Collection and does not designate whether a sample is out on loan or is in reprocessing. For some of the high abundance naturally occurring isotopes, larger amounts can be made available; for example, Ca-40 and Fe-56

  14. French days on stable isotopes

    International Nuclear Information System (INIS)

    2000-01-01

    These first French days on stable isotopes took place in parallel with the 1. French days of environmental chemistry. Both conferences had common plenary sessions. The conference covers all aspects of the use of stable isotopes in the following domains: medicine, biology, environment, tracer techniques, agronomy, food industry, geology, petroleum geochemistry, cosmo-geochemistry, archaeology, bio-geochemistry, hydrology, climatology, nuclear and particle physics, astrophysics, isotope separations etc.. Abstracts available on CD-Rom only. (J.S.)

  15. Stable isotope research pool inventory

    International Nuclear Information System (INIS)

    1982-01-01

    This report contains a listing of electromagnetically separated stable isotopes which are available for distribution within the United States for nondestructive research use from the Oak Ridge National Laboratory on a loan basis. This inventory includes all samples of stable isotopes in the Material Research Collection and does not designate whether a sample is out on loan or in reprocessing. For some of the high abundance naturally occurring isotopes, larger amounts can be made available; for example, Ca-40 and Fe-56

  16. Chemical separation of boron isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Palko, A.A.

    1978-06-01

    This is the final report of the research performed at ORNL on the chemical fractionation of boron isotopes between BF/sub 3/ gas and the liquid molecular addition compounds of BF/sub 3/. Thirty compounds were studied, ten of them in detail. Graphs and equations are given for variation of isotopic equilibrium constant, vapor pressure, and BF/sub 3/ solubility as a function of temperature. Rate of isotopic exchange and melting points were determined. Several of the compounds are likely candidates for use in a gas-liquid countercurrent exchange system for large-scale separation of boron isotopes. 23 figs, 53 tables, 39 references.

  17. Melatonin labeled with hydrogen isotopes

    International Nuclear Information System (INIS)

    Dmitrevskaya, L.I.; Smushkevich, Yu.I.; Kurkovskaya, L.N.; Ponomarenko, N.K.; Suvorov, N.N.

    1989-01-01

    A study has been made of isotope exchange between melatonin and deuterium (D 2 O) or tritium (HTO) oxide under different conditions. The ease of isotope exchange for the indole ring hydrogens of melatonin in an acidic medium decreases over the series H 4 > H 2 H 6 >> H 7 , enabling the authors to process a route for production of melatonin labeled with hydrogen isotopes at positions 4,6, and 2 of the indole ring. A method has been suggested for producing melatonin labeled with hydrogen isotopes at position 2 by desulfurization of 2-(2,4-dinitro-phenylsulfenyl)melatonin at Ni(Re) (D)

  18. Melatonin labelled by hydrogen isotopes

    International Nuclear Information System (INIS)

    Dmitrevskaya, L.I.; Smushkevich, Yu.I.; Kurkovskaya, L.N.; Ponomarenko, N.K.; Suvorov, N.N.

    1988-01-01

    Isotope exchange of melatonin with deuterium (D 2 O) and tritium (HTO) oxides under different conditions is studied. Simplicity of isotope exchange of hydrogens of the indole ring of melatonin in the acidic medium decreases in series H 4 >H 2 >H 6 >>H 7 , that permits to suggest the way of melatonin preparation labelled by hydrogen isotopes in positions 4,6 and 2 of the indole ring. The way of melatonin preparation labelled by hydrogen isotopes in position 2 according to the reaction of desulfation 2-(2,4-dinitrophenylsulphenyl) melatonin at catalyst Ni(Re)(D) is suggested

  19. Development of Stable Isotope Technology

    International Nuclear Information System (INIS)

    Jeong, Do Young; Kim, Cheol Jung; Han, Jae Min

    2009-03-01

    KAERI has obtained an advanced technology with singular originality for laser stable isotope separation. Objectives for this project are to get production technology of Tl-203 stable isotope used for medical application and are to establish the foundation of the pilot system, while we are taking aim at 'Laser Isotope Separation Technology to make resistance to the nuclear proliferation'. And we will contribute to ensuring a nuclear transparency in the world society by taking part in a practical group of NSG and being collaboration with various international groups related to stable isotope separation technology

  20. Isotope separation by ion waves

    International Nuclear Information System (INIS)

    Dawson, J.M.

    1978-01-01

    One of the isotopes of an element having several isotopes can be separated from the others in a dense, neutral plasma. Thus initially a neutral plasma is prepared including the element in question. This may consist of positive ions and negative electrons or alternatively of positive and negative ions, or else of a mixture of positive ions, negative ions and electrons. The plasma may then be injected into a magnetic field or may be generated in the field where more energy is imparted to a selected isotope than to the others. Finally, the isotopes are separated from each other on the basis of their differential energies. For example, the selected isotope may be given more energy than the others by stimulating it within the plasma at its resonant frequency which may be close to the cyclotron frequency, either by an electric field or by a magnetic field. In order to excite the other isotope, a different resonant frequency is required which depends on the plasma density, the relative concentration of electrons if the plasma contains electrons, the strength of the magnetic field, the ratio of charge to mass of the isotope, and possibly on the physical parameters of the plasma apparatus itself, such as the ratio of the length of the plasma column to its radius. The more energetic isotope may be separated by energy dependent chemical reactions, it may be collected by a positively biased probe or else the isotopes may be separated from each other by magnetic fields or in various other ways

  1. Chemical separation of boron isotopes

    International Nuclear Information System (INIS)

    Palko, A.A.

    1978-06-01

    This is the final report of the research performed at ORNL on the chemical fractionation of boron isotopes between BF 3 gas and the liquid molecular addition compounds of BF 3 . Thirty compounds were studied, ten of them in detail. Graphs and equations are given for variation of isotopic equilibrium constant, vapor pressure, and BF 3 solubility as a function of temperature. Rate of isotopic exchange and melting points were determined. Several of the compounds are likely candidates for use in a gas-liquid countercurrent exchange system for large-scale separation of boron isotopes. 23 figs, 53 tables, 39 references

  2. Isotope separation by magnetic fields

    International Nuclear Information System (INIS)

    Dawson, J.M.

    1978-01-01

    One of the isotopes of an element having several isotopes can be separated from the others in a dense, neutral plasma. Thus initially a neutral plasma is prepared including the element in question. This may consist of positive ions and negative electrons or alternatively of positive and negative ions, or else of a mixture of positive ions, negative ions and electrons. The plasma may then be injected into a magnetic field or may be generated in the field where more energy is imparted to a selected isotope than to the others. Finally, the isotopes are separated from each other on the basis of their differential energies. For example, the selected isotope may be given more energy than the others by stimulating it within the plasma at its resonant frequency which may be close to the cyclotron frequency, either by an electric field or by a magnetic field. In order to excite the other isotope, a different resonant frequency is required which depends on the plasma density, the relative concentration of electrons if the plasma contains electrons, the strength of the magnetic field, the ratio of charge to mass of the isotope, and possibly on the physical parameters of the plasma apparatus itself, such as the ratio of the length of the plasma column to its radius. The more energetic isotope may be separated by energy dependent chemical reactions, it may be collected by a positively biased probe or else the isotopes may be separated from each other by magnetic fields or in various other ways

  3. Advanced isotope separation

    International Nuclear Information System (INIS)

    1982-01-01

    The Study Group briefly reviewed the technical status of the three Advanced Isotope Separation (AIS) processes. It also reviewed the evaluation work that has been carried out by DOE's Process Evaluation Board (PEB) and the Union Carbide Corporation-Nuclear Division (UCCND). The Study Group briefly reviewed a recent draft assessment made for DOE staff of the nonproliferation implications of the AIS technologies. The staff also very briefly summarized the status of GCEP and Advanced Centrifuge development. The Study Group concluded that: (1) there has not been sufficient progress to provide a firm scientific, technical or economic basis on which to select one of the three competing AIS processes for full-scale engineering development at this time; and (2) however, should budgetary restraints or other factors force such a selection, we believe that the evaluation process that is being carried out by the PEB provides the best basis available for making a decision. The Study Group recommended that: (1) any decisions on AIS processes should include a comparison with gas centrifuge processes, and should not be made independently from the plutonium isotope program; (2) in evaluating the various enrichment processes, all applicable costs (including R and D and sales overhead) and an appropriate discounting approach should be included in order to make comparisons on a private industry basis; (3) if the three AIS programs continue with limited resources, the work should be reoriented to focus only on the most pressing technical problems; and (4) if a decision is made to develop the Atomic Vapor Laser Isotope Separation process, the solid collector option should be pursued in parallel to alleviate the potential program impact of liquid collector thermal control problems

  4. Isotope effect and isotope separation. A chemist's view

    International Nuclear Information System (INIS)

    Ishida, Takanobu

    2002-01-01

    What causes the isotope effects (IE)? This presentation will be centered around the equilibrium isotope effects due to the differences in the nuclear masses. The occurrence of the equilibrium constant, K, of isotope exchange reactions which differ from the values predicted by the classical theory of statistical mechanics, K cl , is explored. The non-classical K corresponds to the unit-stage separation factor, α, that is different from unity and forms a basis of an isotope separation process involving the chemical exchange reaction. Here, the word 'chemical exchange' includes not only the isotope exchange chemical reactions between two or more chemical species but also the isotope exchanges involving the equilibria between liquid and vapor phases and liquid-gas, liquid solution-gas, liquid-liquid, and solid-liquid phases. In Section I, origins of the isotope effect phenomena will be explored and, in the process, various quantities used in discussions of isotope effect that have often caused confusions will be unambiguously defined. This Section will also correlate equilibrium constant with separation factor. In Section II, various forms of temperature-dependence of IE and separation factor will be discussed. (author)

  5. Container for hydrogen isotopes

    Energy Technology Data Exchange (ETDEWEB)

    1976-01-12

    A container is described for storage, shipping and and dispensing of hydrogen isotopes such as hydrogen, deuterium, tritium, or mixtures of the same. The container is compact, safe against fracture or accident, and is reusable. It consists of an outer housing with suitable inlet and outlet openings and electrical feed elements, the housing containing an activated sorber material in the form, for example of titanium sponge or an activated zirconium aluminate cartridge. The gas to be stored is introduced into the chamber under conditions of heat and vacuum and is retained in the sorber material. Subsequently, it may be released by heating the unit to drive off the stored gas at desired rates.

  6. Cold regions isotope applications

    International Nuclear Information System (INIS)

    Perrigo, L.D.; Divine, T.E.

    1976-04-01

    Pacific Northwest Laboratories (PNL) started the Cold Regions Isotope Applications Program in FY-1975 to identify special conditions in the Arctic and similar geographic areas (Cold Regions) where radioisotope power, heater, or sterilization systems would be desirable and economically viable. Significant progress was made in the first year of this program and all objectives for this initial 12-month period were achieved. The major conclusions and recommendations resulting for this effort are described below. The areas of interest covered include: radiosterilization of sewage; heating of septic tanks; and radioisotope thermoelectric generators as power sources for meteorological instruments and navigational aids

  7. Applied isotope hydrogeology

    International Nuclear Information System (INIS)

    Pearson, F.J. jr; Balderer, W.; Gautschi, A.

    1991-01-01

    This volume is a report on the isotopic investigations of ground-water in northern Switzerland and adjacent regions carried out since 1981 by Nagra, the Swiss National Cooperation for the Storage of Radio-active Waste. This study was undertaken to support a programme assessing potential sites for nuclear waste repositories. It includes measurements on a large number of stable- and radioisotopes and noble gases, supported by complete water chemical analyses and many rock and mineral analyses. A synthesis and interpretation of the data, along with the data themselves, are given here. (author). refs.; figs.; tabs

  8. Chromatographic hydrogen isotope separation

    International Nuclear Information System (INIS)

    Aldridge, F.T.

    1983-01-01

    Intermetallic compounds with the CaCu5 type of crystal structure, particularly LaNiCo and CaNi5, exhibit high separation factors and fast equilibrium times and therefore are useful for packing a chromatographic hydrogen isotope separation column. The addition of an inert metal to dilute the hydride improves performance of the column. A large scale multi-stage chromatographic separation process run as a secondary process off a hydrogen feedstream from an industrial plant which uses large volumes of hydrogen can produce large quantities of heavy water at an effective cost for use in heavy water reactors

  9. Chromatographic hydrogen isotope separation

    International Nuclear Information System (INIS)

    Aldridge, F.T.

    1981-01-01

    Intermetallic compounds with the CaCu5 type of crystal structure , particularly LaNiCo and CaNi5, exhibit high separation factors and fast equilibrium times and therefore are useful for packing a chromatographic hydrogen isotope separation colum. The addition of an inert metal to dilute the hydride improves performance of the column. A large scale mutli-stage chromatographic separation process run as a secondary process off a hydrogen feedstream from an industrial plant which uses large volumes of hydrogen can produce large quantities of heavy water at an effective cost for use in heavy water reactors

  10. Isotope diagnostics apparatus

    International Nuclear Information System (INIS)

    Herrschaft, H.

    1976-01-01

    The invention relates to a measuring probe for an isotope diagnostics apparatus to determine the distribution of radioactive substances in a body by measuring the radiation emanating from this body by means of a multiplicity of measuring probes directed simultaneously towards areas of measuring surfae and carried in guidances of a holding block. The measuring results of the individual probes are recorded separately, thus allowing the possibility of being evaluated separately, too. Measuring probes of this kind are used in multi-channel measuring objects and are useful particularly for determining the regional cerebral blood flow. (orig./ORU) [de

  11. Container for hydrogen isotopes

    International Nuclear Information System (INIS)

    1976-01-01

    A container is described for storage, shipping and and dispensing of hydrogen isotopes such as hydrogen, deuterium, tritium, or mixtures of the same. The container is compact, safe against fracture or accident, and is reusable. It consists of an outer housing with suitable inlet and outlet openings and electrical feed elements, the housing containing an activated sorber material in the form, for example of titanium sponge or an activated zirconium aluminate cartridge. The gas to be stored is introduced into the chamber under conditions of heat and vacuum and is retained in the sorber material. Subsequently, it may be released by heating the unit to drive off the stored gas at desired rates

  12. Isotopic Thermionic Generator

    International Nuclear Information System (INIS)

    Clemot, M.; Devin, B.; Durand, J.P.

    1967-01-01

    This report describes the general design of a thermionic direct conversion space generator. The power source used is a radioisotope. Two radioisotopes are considered: Pu 238 and Cm 244. The system is made up of a heat pipe concentrating the thermal flux from the isotope to the emitter, and of a second heat pipe evacuating the waste heat from the collector to the outer wall used as radiating panel. Calculations are given in the particular case of a 100 electrical watts output power. (authors) [fr

  13. Isotope separation process

    International Nuclear Information System (INIS)

    Lyon, R.K.; Kaldor, A.

    1977-01-01

    In a method for the separation of isotopes of uranium in UF 6 , the UF 6 is subjected to ir radiation at a predetermined wavelength or set of wavelengths for less than 10 -3 sec in such a manner that at least 0.1% of the 235 UF 6 molecules absorb an energy of more than 2000 cm -1 . The excited UF 6 is then reacted with a gaseous reagent, F 2 , Cl 2 , or Br 2 , to produce a product which is then recovered by means known in the art

  14. Stable isotope mass spectrometry in petroleum exploration

    International Nuclear Information System (INIS)

    Mathur, Manju

    1997-01-01

    The stable isotope mass spectrometry plays an important role to evaluate the stable isotopic composition of hydrocarbons. The isotopic ratios of certain elements in petroleum samples reflect certain characteristics which are useful for petroleum exploration

  15. Isotope anomalies in oxygen isotope exchange equilibrium systems

    International Nuclear Information System (INIS)

    Kotaka, M.

    1997-01-01

    The purpose of the present work is to elucidate the isotope anomalies in oxygen isotope exchange equilibrium systems, according to the calculations of the equilibrium constants for oxygen isotopic exchange reactions, and the calculations of the oxygen isotope separation factors between two phases. The equilibrium constants (K65, K67, K68 and K69) of 16 O- 15 O, 16 O 17 O, 16 O- 18 O, and 16 O- 19 O exchange reactions between diatomic oxides were calculated in a wide temperature range on the basis of quantum statistical mechanics. Many equilibrium constants showed the anomalous mass effects, and then had the crossover temperatures and the mass independent fractionation (MIF) temperatures which held K67 = K65, K67 = K68, or K67 = K69, etc. For example, the equilibrium constants for the reactions between OH and the other diatomic oxides (MO) showed the anomalous mass effects, when M was Li, Na, Mg, K, Fe, Al, Ge, Zr, Pt, etc. The 16 O 15 O, 16 O 17 O, 16 O- 18 O, and 16 O- 19 O oxygen isotope separation factors (S65, S67, S68 and S69) between two phases were calculated, when OH and CO were in the first phase, and SiO was in the second phase. Although the oxygen isotopic exchange equilibria in the two phases had no MIF and crossover temperatures, the separation factors showed the anomalous mass effects and had the temperatures. According to what is called the normal mass effects for the equilibrium constant of isotopic exchange reaction, the value of InK68/InK67 is 1.885. Therefore, the value of InS68/InS67 should be 1.885 too. The value calculated, however, widely changed. It can be concluded from the results obtained in the present work that some oxygen isotopic exchange equilibria cause the anomalous mass effects, the anomalous oxygen isotope separation factors, and then isotope anomalies

  16. Zirconium isotope separation process

    International Nuclear Information System (INIS)

    Peterson, S.H.; Lahoda, E.J.

    1988-01-01

    A process is described for reducing the amount of zirconium 91 isotope in zirconium comprising: forming a first solution of (a) a first solvent, (b) a scavenger, and (c) a zirconium compound which is soluble in the first solvent and reacts with the scavenger when exposed to light of a wavelength of 220 to 600 nm; irradiating the first solution with light at the wavelength for a time sufficient to photoreact a disproportionate amount of the zirconium compound containing the zirconium 91 isotope with the scavenger to form a reaction product in the first solution; contacting the first solution, while effecting the irradiation, with a second solvent which is immiscible with the first solvent, which the second solvent is a preferential solvent for the reaction product relative to the first solvent, such that at least a portion of the reaction product is transferred to the second solvent to form a second solution; and separating the second solution from the first solution after the contacting

  17. Isotope techniques for hydrology

    International Nuclear Information System (INIS)

    1964-01-01

    In the body of the Panel's report specific conclusions and recommendations are presented in the context of each subject. The general consensus of the Panel is as follows: by the study of this report, the 1961 Panel report, the Proceedings of the March 1963 Tokyo Symposium and other reports of research and technological advances, isotope-technique applications to hydrologic problems have provided some useful avenues for understanding the nature of the hydrologic cycle and in the solution of specific engineering problems. Some techniques are developed thoroughly enough for fairly routine application as tools for use in the solution of practical problems, but further research and development is needed on other concepts to determined whether or not they can be beneficially applied to either research or engineering problems. A concerted effort is required on the part of both hydrologists and isotope specialists working as teams to assure that proper synthesis of scientific advances in the respective fields and translation of these advances into practical technology is achieved

  18. Isotopes in agriculture

    International Nuclear Information System (INIS)

    1983-01-01

    Part 1: The stable isotope of nitrogen 15N has become widely used as tracer in agriculture, medicine and biology research. The film gives an overview of the sample preparation and analytical procedures followed in the analysis of the nitrogen isotopic composition (14N/15N ratio) by optical emission spectrometry at the Seibersdorf Laboratory. The subsampling of plant material and the several steps of chemical pretreatment such as Kjeldahl digestion, distillation, titration and adjustment of the proper N concentration in the extract are demonstrated. The preparation of the discharge tubes is shown in detail. Final measurement of the 14N/15N ratio is carried out with the NOI-5 and JASCO emission spectrometers. Part 2: This training film deals with the use of 32P-labelled materials in field and greenhouse experimentation in soil-plant relationships studies. All technical aspects, including safe handling and radiation protection procedures to be considered in the layout and harvesting of field experiments are documented in detail. Procedures followed up in the evaluation of P fertilizers such as rock phosphates under greenhouse conditions are described. Several soil injection techniques available for determination of the root activity pattern of trees are shown

  19. Isotope techniques for hydrology

    Energy Technology Data Exchange (ETDEWEB)

    1964-01-01

    In the body of the Panel's report specific conclusions and recommendations are presented in the context of each subject. The general consensus of the Panel is as follows: by the study of this report, the 1961 Panel report, the Proceedings of the March 1963 Tokyo Symposium and other reports of research and technological advances, isotope-technique applications to hydrologic problems have provided some useful avenues for understanding the nature of the hydrologic cycle and in the solution of specific engineering problems. Some techniques are developed thoroughly enough for fairly routine application as tools for use in the solution of practical problems, but further research and development is needed on other concepts to determined whether or not they can be beneficially applied to either research or engineering problems. A concerted effort is required on the part of both hydrologists and isotope specialists working as teams to assure that proper synthesis of scientific advances in the respective fields and translation of these advances into practical technology is achieved.

  20. Method of isotope separation

    Energy Technology Data Exchange (ETDEWEB)

    Lyon, R K

    1975-05-22

    Isotopes of a gaseous compound can be separated by multi-infrared photoabsorption which follows a selective dissociation of the excited molecules by single photon absorption of photons of visible or UV radiation. The process involves three steps. Firstly, the molecules to be separated are irradiated with a high-energy IR laser, whereby the molecules of the compound containing the lighter isotopes are preferably excited. They are then irradiated by a second laser with UV or visible light whose frequency of radiation brings the excited molecules into a form in which they can be separated from the non-excited molecules. The third step is the reformation of the substances according to known methods. A power density of at least 10/sup 4/ watt/cm/sup 2/ per torr gas pressure with an irradiation time of 10/sup -10/ to 5 x 10/sup -5/ seconds in the presence of a second gas with at least 5 times higher partial pressure is necessary for the IR radiation. The method may be used for UF/sub 6/ for which an example is given here.

  1. Isotopic geochemistry at Wairakei

    International Nuclear Information System (INIS)

    Stewart, M.K.

    1985-12-01

    Deuterium measurements on geothermal water at Wairakei are consistent with the water being derived from rainfall which has percolated down from the surface. The oxygen-18 content, however, is enriched compared to average rainfall. This 18 O shift is due to isotopic exchange between water and rock at greater-than-explored depths. The magnitude of the shift implied that the mass ration (W/R) of water that has passed through the system (W) to the rock it has exchanged with (R) is about 1 assuming open (i.e. single-pass) conditions. (The ratio is about 2 if it has been a closed system, but this is thought to be less likely). The residence time of water underground cannot be determined from tritium and carbon-14 measurements at present, but arguments based on the argon isotope and deuterium contents suggest mean residence times of a few tens of thousand years. The water-rock ratio and large natural outflow of thermal water prior to exploitation are consistent with this. The 18 O content of the water has changed only slightly, and the D content not at all, during exploitation at Wairakei (measurements from 1963, 1974 and 1981). An initial tendency for the 18 O to increase because of steam loss (also shown more clearly by chloride), has been followed by decrease of 18 O (and chloride) because of dilution with infiltrating near-surface water in parts of the field

  2. Dielectrophoretic separation of gaseous isotopes

    International Nuclear Information System (INIS)

    McConnell, D.B.

    1975-01-01

    Gaseous isotopes are separated from a mixture in a vertically elongated chamber by subjecting the mixture to a nonuniform transverse electric field. Dielectrophoretic separation of the isotopes is effected, producing a transverse temperature gradient in the chamber, thereby enhancing the separation by convective countercurrent flow. In the example given, the process and apparatus are applied to the production of heavy water from steam

  3. Boron isotopes in geothermal systems

    International Nuclear Information System (INIS)

    Aggarwal, J.

    1997-01-01

    Boron is a highly mobile element and during water-rock reactions, boron is leached out of rocks with no apparent fractionation. In geothermal systems where the water recharging the systems are meteoric in origin, the B isotope ratio of the geothermal fluid reflects the B isotope ratio of the rocks. Seawater has a distinctive B isotope ratio and where seawater recharges the geothermal system, the B isotope ratio of the geothermal system reflects the mixing of rock derived B and seawater derived B. Any deviations of the actual B isotope ratio of a mixture reflects subtle differences in the water-rock ratios in the cold downwelling limb of the hydrothermal system. This paper will present data from a variety of different geothermal systems, including New Zealand; Iceland; Yellowston, USA; Ibusuki, Japan to show the range in B isotope ratios in active geothermal systems. Some of these systems show well defined mixing trends between seawater and the host rocks, whilst others show the boron isotope ratios of the host rock only. In geothermal systems containing high amounts of CO 2 boron isotope ratios from a volatile B source can also be inferred. (auth)

  4. Basic methods of isotope analysis

    International Nuclear Information System (INIS)

    Ochkin, A.V.; Rozenkevich, M.B.

    2000-01-01

    The bases of the most applied methods of the isotope analysis are briefly presented. The possibilities and analytical characteristics of the mass-spectrometric, spectral, radiochemical and special methods of the isotope analysis, including application of the magnetic resonance, chromatography and refractometry, are considered [ru

  5. Lead isotope in mineral exploration

    International Nuclear Information System (INIS)

    Gulson, B.L.

    1986-01-01

    This book provides an up-to-date state-of-the-art review of lead isotopes in mineral exploration. Beginning with an historical review on suggested uses of lead isotopes in mineral exploration, the author then outlines the theoretical aspects of lead isotopes and illustrates that the method is based on well-known principles of radioactive decay, from which isotopic signatures for different styles of mineralization are derived. The varying isotopic signatures are then introduced. The major part of the book details over 40 case histories for base and precious metals, uranium and tin using sampling media such as sulfides, gossans, soils, weathered bedrock, vegetation and groundwaters. Advantages and disadvantages of each are discussed. Examples are given of the use of lead isotopes in testing conceptual models for exploration. The success rate and cost-effectiveness of the method are illustrated by actual exploration examples. Analytical advances which should lower the cost of the method and future uses are outlined. Many of the case histories use recently published or unpublished data, 27 tables of which are given in an appendix. Details of sampling, the methods for obtaining the isotope ratios, and a commercially-available integrated lead isotope service are also provided. (Auth.)

  6. Method for separating krypton isotopes

    International Nuclear Information System (INIS)

    Porter, J.T.

    1980-01-01

    Methods and apparatus for separating krypton isotopes utilizing low temperature selective infrared excitation of 85krypton difluoride in an isotopic compound mixture. Multiphoton ir excitation and uv excitation techniques are used, as well as cryogenic matrix isolation and inert buffer gas isolation techniques

  7. Stable isotope research pool inventory

    International Nuclear Information System (INIS)

    1980-12-01

    This report contains a listing of electromagnetically separated stable isotopes which are available for distribution within the United States for non-destructive research use from the Oak Ridge National Laboratory on a loan basis. This inventory includes all samples of stable isotopes in the Materials Research Collection and does not designate whether a sample is out on loan or in reprocessing

  8. Calcium isotopes in wine

    Science.gov (United States)

    Holmden, C. E.

    2011-12-01

    The δ 44/40Ca values of bottled wine vary between -0.76% to -1.55% on the seawater scale and correlate weakly with inverse Ca concentration and Mg/Ca ratio, such that the lowest δ 44/40Ca values have the highest Ca concentrations and lowest Mg/Ca ratios. The correlation is notable in the sense that the measured wines include both whites and reds sampled from different wine growing regions of the world, and cover a wide range of quality. Trends among the data yield clues regarding the cause of the observed isotopic fractionation. White wines, and wines generally perceived to be of lower quality, have lower δ 44/40Ca values compared to red wines and wines of generally perceived higher quality. Quality was assessed qualitatively through sensory evaluation, price, and scores assigned by critics. The relationship between δ 44/40Ca and wine quality was most apparent when comparing wines of one varietal from one producer from the same growing region. In the vineyard, wine quality is related to factors such as the tonnage of the crop and the ripeness of the grapes at the time of harvesting, the thickness of the skins for reds, the age of the vines, as well as the place where the grapes were grown (terroir). Quality is also influenced by winemaking practices such as fermentation temperature, duration of skin contact, and barrel ageing. Accordingly, the relationship between δ 44/40Ca and wine quality may originate during grape ripening in the vineyard or during winemaking in the cellar. We tested the grape ripening hypothesis using Merlot grapes sampled from a vineyard in the Okanagan, British Columbia, using sugar content (degrees Brix) as an indicator of ripeness. The grapes were separated into pulp, skin, and pip fractions and were analyzed separately. Thus far, there is no clear evidence for a systematic change in δ 44/40Ca values associated with progressive ripening of grapes in the vineyard. On the day of harvesting, the δ 44/40Ca value of juice squeezed from

  9. Correlated optical and isotopic nanoscopy

    Science.gov (United States)

    Saka, Sinem K.; Vogts, Angela; Kröhnert, Katharina; Hillion, François; Rizzoli, Silvio O.; Wessels, Johannes T.

    2014-04-01

    The isotopic composition of different materials can be imaged by secondary ion mass spectrometry. In biology, this method is mainly used to study cellular metabolism and turnover, by pulsing the cells with marker molecules such as amino acids labelled with stable isotopes (15N, 13C). The incorporation of the markers is then imaged with a lateral resolution that can surpass 100 nm. However, secondary ion mass spectrometry cannot identify specific subcellular structures like organelles, and needs to be correlated with a second technique, such as fluorescence imaging. Here, we present a method based on stimulated emission depletion microscopy that provides correlated optical and isotopic nanoscopy (COIN) images. We use this approach to study the protein turnover in different organelles from cultured hippocampal neurons. Correlated optical and isotopic nanoscopy can be applied to a variety of biological samples, and should therefore enable the investigation of the isotopic composition of many organelles and subcellular structures.

  10. Stable isotope enrichment: Current and future potential

    International Nuclear Information System (INIS)

    Tracy, J.G.; Aaron, W.S.

    1992-01-01

    Oak Ridge National Laboratory (ORNL) operates the Isotope Enrichment Facility for the purpose of providing enriched stable isotopes, selected radioactive isotopes (including the actinides), and isotope-related materials and services for use in various research applications. ORNL is responsible for isotope enrichment and the distribution of approximately 225 nongaseous stable isotopes from 50 multi-isotopic elements. Many enriched isotope products are of prime importance in the fabrication of nuclear targets and the subsequent production of special radionuclides. State-of-the-art techniques to achieve special isotopic, chemical, and physical requirements are performed at ORNL This report describes the status and capabilities of the Isotope Enrichment Facility and the Isotope Research Materials Laboratory as well as emphasizing potential advancements in enrichment capabilities

  11. Stable isotope enrichment - current and future potential

    International Nuclear Information System (INIS)

    Tracy, J.G.; Aaron, W.S.

    1993-01-01

    Oak Ridge National Laboratory (ORNL) operates the Isotope Enrichment Facility for the purpose of providing enriched stable isotopes, selected radioactive isotopes (including the actinides), and isotope-related materials and services for use in various research applications. ORNL is responsible for isotope enrichment and the distribution of approximately 225 nongaseous stable isotopes from 50 multi-isotopic elements. Many enriched isotope products are of prime importance in the fabrication of nuclear targets and the subsequent production of special radionuclides. State-of-the-art techniques to achieve special isotopic, chemical, and physical requirements are performed at ORNL. This report describes the status and capabilities of the Isotope Enrichment Facility and the Isotope Research Materials Laboratory as well as emphasizing potential advancements in enrichment capabilities. (orig.)

  12. Lasers for isotope separation

    International Nuclear Information System (INIS)

    O'Hair, E.A.; Piltch, M.S.

    1976-01-01

    The Los Alamos Scientific Laboratory is conducting research on uranium enrichment. All processes being studied employ uranium molecules and use lasers to provide isotopic selectivity and enrichment. There are four well-defined infrared frequencies and two ultraviolet frequency bands of interest. The infrared frequencies are outside the range of the available lasers and an extensive research and development activity is currently underway. Lasers are available in the uv bands, however, much development work remains. The specification for the commercial uranium enrichment plant lasers will depend upon the results of the current enrichment experiments, the laser capital cost, reliability, and maintenance cost. For the processes under investigation there are specific photon requirements but latitude in how these requirements can be met. The final laser selections for the pilot plant need not be made until the mid-1980's. Between now and that time as extensive as possible a research and development effort will be maintained

  13. Applications of stable isotopes

    International Nuclear Information System (INIS)

    Gregg, C.T.

    1977-01-01

    Clinical applications include the galactose breath test which consists of oral administration of 13 C-labeled galactose and measurement of the 13 C content of respired CO 2 as a function of time in patients with cirrhotic livers for diagnosis of liver dysfunction. Another application was the breath test to study glucose metabolism in children. Respired 13 CO 2 from ingested glucose- 13 C was measured for normal and diabetic children. Studies on mice in which 60 percent of the body carbon was replaced with 13 C failed to show significant effects of the isotope. Studies on biochemical applications include nuclear magnetic resonance studies of 13 C-labeled amino acids from Chlorella pyrenoidosa; studies on 15 N nmr spectra of arginine-guanidino- 13 C-2,3-- 15 N 2 as a function of pH; and isolation of fatty acids from algae

  14. Galilei-isotopic relativities

    International Nuclear Information System (INIS)

    Santilli, R.M.

    1991-09-01

    In this note we further develop the proposal made in preceding works of constructing the infinite family of Lie-isotopic liftings of Galilei's relativity for closed-isolated systems of particles possessing local, potential and selfadjoint, as well as nonlocal, nonhamiltonian and non selfadjoint internal forces. In particular, we show that the nonlinear and nonlocal generalization of the Galilei transformations introduced in a preceding note do indeed represent motion of extended particles within resistive media, but in such a way to coincide with the conventional transformations at the abstract, realization-free level. This allows the preservation of the basic, physical and mathematical axioms of Galilei's relativity under our liftings, and their realization in the most general possible nonlinear, nonlocal and nonhamiltonian way. (author). 18 refs, 1 fig

  15. Stable-isotope paleoclimatology

    International Nuclear Information System (INIS)

    Deuser, W.G.

    1978-01-01

    Seasonal variations of temperature and salinity in the surface waters of large parts of the oceans are well established. Available data on seasonal distributions of planktonic foraminifera show that the abundances of different species groups peak at different times of the year with an apparent succession of abundance peaks through most of the year. This evidence suggests that a measure of seasonal contrast is recorded in the isotope ratios of oxygen, and perhaps carbon, in the tests of different foraminiferal species. The evaluation of this potential paleoclimatologic tool awaits planned experiments with recent foraminifera in well-known settings, but a variety of available data is consistent with the idea that interspecies differences in 18 O content contain a seasonal component.(auth.)

  16. Container for hydrogen isotopes

    International Nuclear Information System (INIS)

    Solomon, D.E.

    1977-01-01

    A container for the storage, shipping and dispensing of hydrogen isotopes such as hydrogen, deuterium, tritium, or mixtures of the same which has compactness, which is safe against fracture or accident, and which is reusable is described. The container consists of an outer housing with suitable inlet and outlet openings and electrical feed elements, the housing containing an activated sorber material in the form, for example, of titanium sponge or an activated zirconium aluminate cartridge. The gas to be stored is introduced into the chamber under conditions of heat and vacuum and will be retained in the sorber material. Subsequently, it may be released by heating the unit to drive off the stored gas at desired rates

  17. Radio-isotopic tracers

    International Nuclear Information System (INIS)

    Wolfangel, R.G.

    1976-01-01

    The invention concerns the dispersions that may be used for preparing radio-isotopic tracers, technetium labelled dispersions, processes for preparing these dispersions and their use as tracers. Technetium 99m sulphur colloids are utilized as scintillation tracers to give a picture of the reticulo-endothelial system, particularly the liver and spleen. A dispersion is provided which only requires the addition of a radioactive nuclide to form a radioactively labelled dispersion that can be injected as a tracer. It is formed of a colloid of tin sulphur dispersed in an aqueous buffer solution. Such a reagent has the advantage of being safe and reliable and is easier to use. The colloid can be prepared more quickly since additions of several different reagents are avoided. There is no need to heat up and no sulphuretted hydrogen, which is a toxic gas, is used [fr

  18. Isotopically labelled benzodiazepines

    International Nuclear Information System (INIS)

    Liebman, A.A.

    1987-01-01

    This paper reports on the benzodiazepines which are a class of therapeutic agents. Improvements in the analytical methodology in the areas of biochemistry and pharmacology were significant, particularly in the application of chromatographic and spectroscopic techniques. In addition, the discovery and subsequent development of tritium and carbon-14 as an analytical tool in the biological sciences were essentially post-world war II phenomena. Thus, as these new chemical entities were found to be biologically active, they could be prepared in labeled form for metabolic study, biological half-life determination (pharmacokinetics), tissue distribution study, etc. This use of tracer methodology has been liberally applied to the benzodiazepines and also more recently to the study of receptor-ligand interactions, in which tritium, carbon-11 or fluorine-18 isotopes have been used. The history of benzodiazepines as medicinal agents is indeed an interesting one; an integral part of that history is their use in just about every conceivable labeled form

  19. Canada's isotope crisis : what next?

    International Nuclear Information System (INIS)

    Nathwani, J.; Wallace, D.

    2010-01-01

    Canada urgently requires a rigorous debate on the strategic options for ensuring a robust, reliable, and affordable supply of radioactive isotopes. Should the debate be confined to how Canada can best develop the necessary technologies solely for our own use or should Canada abandon the idea of producing its own isotope supply and any future aspirations to serve the global market? Canada's Isotope Crisis focuses on the central policy question: do we dare to try to shape the future or do we retreat into silence because we are not prepared to make the necessary investments for the future well-being of Canadians? This volume showcases pointed essays and analysis from members of the academy and individuals who have made contributions to the development of medical isotopes and pioneered their use in medical practice. It also includes commentary from those involved in the production, manufacturing, processing, and distribution of isotopes. Canada's Isotope Crisis is a multi-disciplinary effort that addresses the global dimension of isotope supply and combines expert opinions on the present and past with knowledge of the relevant government agencies and the basis for their decisions at critical junctures.

  20. Isotopically labelled pyrimidines and purines

    International Nuclear Information System (INIS)

    Balaban, A.T.; Bally, I.

    1987-01-01

    Among the three diazines, pyrimidine is by far the most important one because its derivatives uracil, thymine and cytosine are constituents of the ubiquitous deoxynucleic acids (DNA) and ribonucleic acids (RNA). Other derivatives of pyrimidine without condensed rings include barbiturates, alloxan, orotic acid and thiamine or vitamin B 1 . From the polycyclic derivatives of pyrimidine such as pteridine, alloxazine, and purine, the latter, through its derivatives adenine and guanine complete the list of bases which occur in DNA and RNA: in addition, other purine derivatives such as hypoxanthine, xanthine, theobromine, theophylline, caffeine and uric acid are important natural products with biological activity. The paper presents methods for preparing isotopically labeled pyrimidines as well as purine derivatives. For convenience, the authors describe separately carbon-labeled with radioisotopes 11 C (T 1/2 = 20.3 min) and 14 C (T 1/2 = 5736 years) or the stable isotope 13 C (natural abundance 1.1%) and then hydrogen-labeled systems with the radioisotope 3 H ≡ T (T 1/2 = 12.346 years) or with the stable isotope 2 H ≡ D (natural abundance 0.015%). We do not separate stable from radioactive isotopes because the synthetic methods are identical for the same element; however, the introduction of hydrogen isotopes into organic molecules is often performed by reactions such as isotope exchange which cannot take place in the case of carbon isotopes

  1. Isotopic shift in even-even barium isotopes

    International Nuclear Information System (INIS)

    Karim, Afaque; Naz, Tabassum; Ahmad, Shakeb

    2017-01-01

    We have discussed the correlation between a nuclear shape and its matter distribution. Here, we present the root-mean-square radii (r rms ) and rms charge radius (r ch ). We have also discussed the isotopic shift in terms of the observable ‹Δr 2 c › N,82 and its differential ‹Δr 2 c › N-2,N . We present nuclear radii evaluated using different interactions. Neutron radii and charge radii for all the isotopic chains are shown. Neutron radii for Ba isotopes show an increasing trend with the neutron number for all isotopic chains. One can observe a clear kink about magic number N=82

  2. Stable isotope genealogy of meteorites

    International Nuclear Information System (INIS)

    Pillinger, C.T.

    1988-01-01

    One of the oldest problems in meteoritics is that of taxonomically grouping samples. In recent years the use of isotopes, particularly oxygen isotopes has proved very successful in this respect. Other light-element systematics potentially can perform the same function. For example, nitrogen in iron meteorites, and nitrogen and carbon in ureilites and SNC meteorites. These measurements will serve to extend and augment existing classification schemes and provide clues to the nature of meteorite parent bodies. They can also aid in the recognition of the isotopic signatures relating to inaccessible regions of the Earth. (author)

  3. Compelling Research Opportunities using Isotopes

    International Nuclear Information System (INIS)

    2009-01-01

    Isotopes are vital to the science and technology base of the US economy. Isotopes, both stable and radioactive, are essential tools in the growing science, technology, engineering, and health enterprises of the 21st century. The scientific discoveries and associated advances made as a result of the availability of isotopes today span widely from medicine to biology, physics, chemistry, and a broad range of applications in environmental and material sciences. Isotope issues have become crucial aspects of homeland security. Isotopes are utilized in new resource development, in energy from bio-fuels, petrochemical and nuclear fuels, in drug discovery, health care therapies and diagnostics, in nutrition, in agriculture, and in many other areas. The development and production of isotope products unavailable or difficult to get commercially have been most recently the responsibility of the Department of Energy's Nuclear Energy program. The President's FY09 Budget request proposed the transfer of the Isotope Production program to the Department of Energy's Office of Science in Nuclear Physics and to rename it the National Isotope Production and Application program (NIPA). The transfer has now taken place with the signing of the 2009 appropriations bill. In preparation for this, the Nuclear Science Advisory Committee (NSAC) was requested to establish a standing subcommittee, the NSAC Isotope Subcommittee (NSACI), to advise the DOE Office of Nuclear Physics. The request came in the form of two charges: one, on setting research priorities in the short term for the most compelling opportunities from the vast array of disciplines that develop and use isotopes and two, on making a long term strategic plan for the NIPA program. This is the final report to address charge 1. NSACI membership is comprised of experts from the diverse research communities, industry, production, and homeland security. NSACI discussed research opportunities divided into three areas: (1) medicine

  4. Advances in laser isotope separation

    International Nuclear Information System (INIS)

    Herman, I.P.; Bernhardt, A.F.

    1988-01-01

    The physical and chemical concepts required to understand laser isotope separation are presented and discussed. The numerous successful demonstrations of separating isotopes using lasers are reviewed to 1983. Emphasis is placed on the separation of 235-U from 238-U by multi-step selective ioniation of uranium atomic vapor, and on the separation of D and H and of T from D, by pulsed infrared laser multiple-photon dissociation of fluoroform and chloroform, respectively, because they are among the most successful and important examples of laser isotope separation to date. 161 refs.; 7 figs

  5. Isotope Exchange in Oxide Catalyst

    Science.gov (United States)

    Hess, Robert V.; Miller, Irvin M.; Schryer, David R.; Sidney, Barry D.; Wood, George M., Jr.; Hoyt, Ronald F.; Upchurch, Billy T.; Brown, Kenneth G.

    1987-01-01

    Replacement technique maintains level of CO2/18 in closed-cycle CO2 lasers. High-energy, pulsed CO2 lasers using rare chemical isotopes must be operated in closed cycles to conserve gas. Rare isotopes operated in closed cycles to conserve gas. Rare isotopes as CO2/18 used for improved transmission of laser beam in atmosphere. To maintain laser power, CO2 must be regenerated, and O2 concentration kept below few tenths of percent. Conditions achieved by recombining CO and O2.

  6. Stable isotopes - separation and application

    International Nuclear Information System (INIS)

    Lockhart, I.M.

    1980-01-01

    In this review, methods used for the separation of stable isotopes ( 12 C, 13 C, 14 N, 15 N, 16 O, 17 O, 18 O, 34 S) will be described. The synthesis of labelled compounds, techniques for detection and assay, and areas of application will also be discussed. Particular attention will be paid to the isotopes of carbon, nitrogen, and oxygen; to date, sulphur isotopes have only assumed a minor role. The field of deuterium chemistry is too extensive for adequate treatment; it will therefore be essentially excluded. (author)

  7. Iodine isotopes and radiation safety

    International Nuclear Information System (INIS)

    Styro, B.; Nedvekajte, T.; Filistovich, V.

    1992-01-01

    Methods of concentration determination of stable and radioactive iodine isotopes in the Earth's different geospheres are described. Iodine isotopes concentration data, chemical forms and transformations as well as their exchange among separate geospheres of their global biochemical circulation (ocean, atmosphere, lithosphere and biosphere) are presented. Information on iodine isotopes as after-effects of nuclear installations accident (in particular, the Chernobyl accident) is generalized. The book is intended for scientists and practical workers in ecology and radioactivity protection and for a students of physics. 442 refs.; 82 figs.; 36 tabs

  8. Compelling Research Opportunities using Isotopes

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-04-23

    Isotopes are vital to the science and technology base of the US economy. Isotopes, both stable and radioactive, are essential tools in the growing science, technology, engineering, and health enterprises of the 21st century. The scientific discoveries and associated advances made as a result of the availability of isotopes today span widely from medicine to biology, physics, chemistry, and a broad range of applications in environmental and material sciences. Isotope issues have become crucial aspects of homeland security. Isotopes are utilized in new resource development, in energy from bio-fuels, petrochemical and nuclear fuels, in drug discovery, health care therapies and diagnostics, in nutrition, in agriculture, and in many other areas. The development and production of isotope products unavailable or difficult to get commercially have been most recently the responsibility of the Department of Energy's Nuclear Energy program. The President's FY09 Budget request proposed the transfer of the Isotope Production program to the Department of Energy's Office of Science in Nuclear Physics and to rename it the National Isotope Production and Application program (NIPA). The transfer has now taken place with the signing of the 2009 appropriations bill. In preparation for this, the Nuclear Science Advisory Committee (NSAC) was requested to establish a standing subcommittee, the NSAC Isotope Subcommittee (NSACI), to advise the DOE Office of Nuclear Physics. The request came in the form of two charges: one, on setting research priorities in the short term for the most compelling opportunities from the vast array of disciplines that develop and use isotopes and two, on making a long term strategic plan for the NIPA program. This is the final report to address charge 1. NSACI membership is comprised of experts from the diverse research communities, industry, production, and homeland security. NSACI discussed research opportunities divided into three areas: (1

  9. Neodymium isotopic variations in seawater

    Science.gov (United States)

    Piepgras, D. J.; Wasserburg, G. J.

    1980-01-01

    Direct measurement of the isotopic composition of Nd in the Atlantic agree with the Nd content in ferromanganese sediments and differ from the observed amounts in the Pacific samples. These data indicate the existence of distinctive differences in the isotopic composition of Nd in the waters of major oceans; the average values determined from seawater and ferromanganese sediments are considerably lower than in sources with oceanic mantle affinities showing that the REE in the oceans is dominated by continental sources. The Nd isotopic variations in seawater are applied to relate the residence time of Nd and mixing rates between the oceans.

  10. General physical fundamentals of isotope hydrology

    International Nuclear Information System (INIS)

    Moser, H.; Rauert, W.

    1976-01-01

    A description is given of the measurement and measuring units of stable isotopes, the physical properties, measurement and measuring units of radioactive isotopes, the fundamentals of the tracer technique, the environmental isotope distribution in the hydrosphere and the radiation protection in isotope hydrological investigations. (HK) [de

  11. Raman scattering method and apparatus for measuring isotope ratios and isotopic abundances

    International Nuclear Information System (INIS)

    Harney, R.C.; Bloom, S.D.

    1978-01-01

    Raman scattering is used to measure isotope ratios and/or isotopic abundances. A beam of quasi-monochromatic photons is directed onto the sample to be analyzed, and the resulting Raman-scattered photons are detected and counted for each isotopic species of interest. These photon counts are treated mathematically to yield the desired isotope ratios or isotopic abundances

  12. Isotopic Changes During Digestion: Protein

    Science.gov (United States)

    Tuross, N.

    2013-12-01

    Nutrient and hydrological inputs traverse a complicated route of pH, enzymatic and cellular processes in digestion in higher animals. The end products of digestion are the starting products for biosynthesis that are often used to interpret past life-ways. Using an artificial gut system, the isotopic changes (dD, d18O, d13C and d15N) of protein are documented. Three separate protein sources are subjected to the conditions, chemical and enzymatic, found in the stomach and upper small intestine with only a small shift in the oxygen isotopic composition of the proteins observed. Middle to lower small intestine parameters produced both greater isotopic effects and significantly lower molecular weight products. The role of the gastric enterocyte and the likely involvement of the internal milieu of this cell in the isotopic composition of amino acids that are transported to the liver are reported.

  13. High atomic weight isotope separator

    International Nuclear Information System (INIS)

    Book, D.L.

    1978-01-01

    A continuously operating device is described which separates one isotopic species of a given element from a mixture. The given element is vaporized and formed into a neutral beam containing the isotopes desired to be separated. The plasma is accelerated through a laser beam which is formed by two separate lasers which operate in the continuous wave mode in which the beams are as nearly as possible in the same beam path. The two laser output beams excite and ionize the isotope of interest while leaving the remaining atoms unaffected. The ionized isotopes are then separated from the beam by an electrostatic deflection technique and the unaffected atoms continue on in their path and are directed to a recovery device

  14. Discoveries of isotopes by fission

    Indian Academy of Sciences (India)

    country of discovery as well as the production mechanism used to produce the isotopes. ... the disintegration products of bombarded uranium, as a consequence of a ..... advanced accelerator and newly developed separation and detection ...

  15. Isotope separation by standing waves

    International Nuclear Information System (INIS)

    Altshuler, S.

    1984-01-01

    The separation of isotopes is accomplished by scattering a beam of particles from a standing electromagnetic wave. The particles may consist of either atoms or molecules, the beam having in either case a desired isotope and at least one other. The particle beam is directed so as to impinge on the standing electromagnetic wave, which may be a light wave. The particles, that is, the atomic or molecular quantum-mechanical waves, see basically a diffraction grating corresponding to the troughs and peaks of the electromagnetic wave. The frequency of the standing electromagnetic wave substantially corresponds to an internal energy level-transition of the desired isotope. Accordingly, the desired isotope is spatially separated by being scattered or diffracted. (author)

  16. Isotope analysis in petroleum exploration

    International Nuclear Information System (INIS)

    Rodrigues, R.

    1982-01-01

    The study about isotopic analysis in petroleum exploration performed at Petrobras Research Center is showed. The results of the petroleum recuperation in same Brazilian basin and shelves are comented. (L.H.L.L.) [pt

  17. Isotope-based quantum information

    CERN Document Server

    G Plekhanov, Vladimir

    2012-01-01

    The present book provides to the main ideas and techniques of the rapid progressing field of quantum information and quantum computation using isotope - mixed materials. It starts with an introduction to the isotope physics and then describes of the isotope - based quantum information and quantum computation. The ability to manipulate and control electron and/or nucleus spin in semiconductor devices provides a new route to expand the capabilities of inorganic semiconductor-based electronics and to design innovative devices with potential application in quantum computing. One of the major challenges towards these objectives is to develop semiconductor-based systems and architectures in which the spatial distribution of spins and their properties can be controlled. For instance, to eliminate electron spin decoherence resulting from hyperfine interaction due to nuclear spin background, isotopically controlled devices are needed (i.e., nuclear spin-depleted). In other emerging concepts, the control of the spatial...

  18. Isotope shifts in unstable nuclei

    International Nuclear Information System (INIS)

    Rebel, H.

    1980-05-01

    Current experimental investigations of isotope shifts in atomic spectra of unstable nuclei and the resulting information about size and shape of nuclei far off stability are discussed with reference to some representative examples. (orig.)

  19. Dielectrophoretic separation of gaseous isotopes

    International Nuclear Information System (INIS)

    McConnell, D.B.

    1976-01-01

    This invention relates to a process for the separation of gaseous isotopes by electrophoresis assisted by convective countercurrent flow and to an apparatus for use in the process. The invention is especially applicable to heavy water separation from steam; however, it is to be understood that the invention is broadly applicable to the separation of gaseous isotopes having different dipole moments and/or different molecular weights. (author)

  20. Isotope effects in photochemical rearrangements

    International Nuclear Information System (INIS)

    Sommer, F.

    1983-01-01

    Taking anthracene resp. 9-deuteroanthracene as the initial substance, different substitution products have been prepared. The products originating by direct photolysis have been characterized and their structure has been determined. By comparing the measured kinetic isotope effect and the quantum yield of the nondeuterated and the monodeuterated fluorenes formed it could been demonstrated that the isotope effect mainly is due to the reaction rates and the influence of the deuterium substitution upon the radiationless desactivation against that is small. (HBR) [de

  1. Isotope studies in brain diseases

    Energy Technology Data Exchange (ETDEWEB)

    Silfverskioeld, B [Department of Neurology, Soedersjukhuset, S-100 64 Stockholm (Sweden)

    1978-09-01

    Serial pictures of cerebral isotope flow and accumulation after intravenous injection provide several kinds of valuable diagnostic information. The reliability can be increased by using computer-processed pictures on a TV screen and by numerical analysis in accordance with paritcular programs constructed for our routine work. An isotope study should be done when computerized transmission tomography scans have failed to provide a conclusive diagnosis. It should then be performed with optimal technique in order to reduce the need of angiograms.

  2. Isotopes and radiations in agriculture

    International Nuclear Information System (INIS)

    Sawant, A.G.

    1998-01-01

    Some of the spectacular advances in agriculture in developing nations have stimulated wide interest both in basic as well as adaptive research and in harnessing all the tools that science can offer for progress of agriculture. The nuclear tools are relevant in this respect and also offer particular promise in some areas. Ionising radiations and isotopes have immense applications in agriculture. Both radioisotopes and stable isotopes are being used

  3. Phonon scattering by isotopic impurities

    International Nuclear Information System (INIS)

    Dacol, D.K.

    1974-06-01

    The effects upon vibrations of a perfect crystal lattice due to the replacement of some of its atoms by isotopes of these atoms are studied. The approach consists in considering the isotopic impurities as scattering centres for the quanta of the elastic waves the objective is to obtain the scattering amplitudes. These amplitudes are obtained through a canonical transformation method which was introduced by Chevalier and Rideau in the study of the Wentzel's model in quantum field theory

  4. Pharmaceuticals labelled with stable isotopes

    International Nuclear Information System (INIS)

    Krumbiegel, P.

    1986-11-01

    The relatively new field of pharmaceuticals labelled with stable isotopes is reviewed. Scientific, juridical, and ethical questions are discussed concerning the application of these pharmaceuticals in human medicine. 13 C, 15 N, and 2 H are the stable isotopes mainly utilized in metabolic function tests. Methodical contributions are given to the application of 2 H, 13 C, and 15 N pharmaceuticals showing new aspects and different states of development in the field under discussion. (author)

  5. Isotopic study of Karst water

    International Nuclear Information System (INIS)

    Leskovsek-Sefman, H.

    1985-01-01

    Measurement of the isotopic composition of water formed part of an extended investigation of the water drainage system in the Slovenian Karst. These studies were planned to complement geological and speleological investigations which are already being performed in this area, with the knowledge of the mechanism of changes in the isotopic composition of water in the natural environment on some smaller locations, Planina cave near Postojna where the vertical percolation of meteoric water through the karstified carbonate ceiling was studied and the water catchment areas of some small rivers, Ljubljanica, Rizana and Idrijca. Mass spectrometric investigations of the isotopic composition of some elements ( 18 O, D, 13 C and T) in water and in dissolved carbonates, as well as the isotopic composition of 18 O and 13 C in cave carbonates were performed. The results allow to conclude that the waters in karst aquifers in spite of producing the homogenisation to a great extent, qualitative determination of the retention time and of the prevailing sources for some springs and surface and underground water flows is nevertheless possible. The isotopic composition of 18 O in water and of 18 O and 13 C in dissolved carbonates depends on climatic conditions and on denudation processes. The investigation of cave carbonates revealed that they have different isotopic compositions of 18 O and 13 C because of different locations and also different ages

  6. Isotopic meteoric line for Colombia

    International Nuclear Information System (INIS)

    Rodriguez N, Cesar O

    2004-01-01

    Isotope analyses from representative rainfall samples taken from different areas in Colombia were processed to yield the meteoric line. Stable isotope composition in precipitation reflects the effects of temperature, altitude and of the continental site, being affected by different sources of atmospheric humidity over the Colombian territory. There is a seasonal variation in isotopic composition of precipitation with grater σ deviation during the rainy season and lower values in the dry season. In coastal areas the variation is smaller and is more pronounced than at continental stations. Correlation between altitude and isotope content led to equations, which indicate, on a regional level, a change in isotopic composition with altitude, of about 0.5 σ units per 200 m, for O 18 and 4 σ units per 200 m for H 2 . Such equations may be used to identify the original altitude of precipitation water, in hydrological surface and groundwater studies. Meteoric line and the concepts derived from the resulting equations presented in this paper may be applied to the interpretation of isotope analysis in future hydrological studies, particularly in areas without available data

  7. Isotope-based quantum information

    International Nuclear Information System (INIS)

    Plekhanov, Vladimir G.

    2012-01-01

    The present book provides to the main ideas and techniques of the rapid progressing field of quantum information and quantum computation using isotope - mixed materials. It starts with an introduction to the isotope physics and then describes of the isotope - based quantum information and quantum computation. The ability to manipulate and control electron and/or nucleus spin in semiconductor devices provides a new route to expand the capabilities of inorganic semiconductor-based electronics and to design innovative devices with potential application in quantum computing. One of the major challenges towards these objectives is to develop semiconductor-based systems and architectures in which the spatial distribution of spins and their properties can be controlled. For instance, to eliminate electron spin decoherence resulting from hyperfine interaction due to nuclear spin background, isotopically controlled devices are needed (i.e., nuclear spin-depleted). In other emerging concepts, the control of the spatial distribution of isotopes with nuclear spins is a prerequisite to implement the quantum bits (or qbits). Therefore, stable semiconductor isotopes are important elements in the development of solid-state quantum information. There are not only different algorithms of quantum computation discussed but also the different models of quantum computers are presented. With numerous illustrations this small book is of great interest for undergraduate students taking courses in mesoscopic physics or nanoelectronics as well as quantum information, and academic and industrial researches working in this field.

  8. Isotope separation apparatus and method

    International Nuclear Information System (INIS)

    Feldman, B. J.

    1985-01-01

    The invention relates to an improved method and apparatus for laser isotope separation by photodeflection. A molecular beam comprising at least two isotopes to be separated intersects, preferably substantially perpendicular to one broad side of the molecular beam, with a laser beam traveling in a first direction. The laser beam is reflected back through the molecular beam, preferably in a second direction essentially opposite to the first direction. Because the molecules in the beam occupy various degenerate energy levels, if the laser beam comprises chirped pulses comprising selected wavelengths, the laser beam will very efficiently excite substantially all unexcited molecules and will cause stimulated emission of substantially all excited molecules of a selected one of the isotopes in the beam which such pulses encounter. Excitation caused by first direction chirped pulses moves molecules of the isotope excited thereby in the first direction. Stimulated emission of excited molecules of the isotope is brought about by returning chirped pulses traveling in the second direction. Stimulated emission moves emitting molecules in a direction opposite to the photon emitted. Because emitted photons travel in the second direction, emitting molecules move in the first direction. Substantial molecular movement of essentially all the molecules containing the one isotope is accomplished by a large number of chirped pulse-molecule interactions. A beam corer collects the molecules in the resulting enriched divergent portions of the beam

  9. Separation of uranium isotopes

    International Nuclear Information System (INIS)

    Ehrfeld, W.; Ehrfeld, U.

    1977-01-01

    In the nuclear fuel cycle, uranium enrichment is not a principal problem of technological feasibility. Several processes exist for producing LWR fuel and the enrichment method can be selected in consideration of economical, environmental, and political aspects. To date, the gaseous diffusion process constitutes the major part of enrichment capacity. This process has been well demonstrated for over 30 years and, as a matter of fact, no major technological and economical progress is to be expected in the future. Because of their comparatively high development potential, the centrifuge and the separation nozzle method may become increasingly favorable in economics. The development of the centrifuge process which is superior by its low specific energy consumption aims at technological improvements. In the separation nozzle process which offers the advantage of a comparatively simple technology a further reduction of the specific energy consumption is to be expected because of the thermodynamically favorable separation mechanism of this process. Laser isotope separation methods are still on the laboratory scale, although large financial funds have been spent. (orig.) [de

  10. Insects, isotopes and radiations

    International Nuclear Information System (INIS)

    Lingkvist, D.A.

    1987-01-01

    The IAEA activity on coordinating the IAEA member-state efforts in the field of pest control is considered. A complex program of agricultural pest control (IPM), applied in many parts of the world is developed. The program provides for the use of natural means of control and cases of critical pest numbers-the use of insecticides. When controlling certain types of insects it is advisable to apply the 'large area control' methods which provide for the insect destruction in places of their concentration prior to migration. Methods of pest control over large areas also include radiation sexual sterilization method (SSM), application of insect phoromons (sexual attractants) to prevent mating, other types of chemical attractants, traps, mass cultivation and reproduction of parasite plants and animals, destroying insects, as well as improvement of host-plant resistance. A great attention is paid to isotope and radiation application in pest control (labelling, sexual sterilization using ionising radiation, radiation application in genetic engineering, mutant plant cultivation)

  11. Hydrogen isotope technology

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    Hydrogen pumping speeds on panels of molecular sieve types 5A and Na-Y were compared for a variety of sieve (and chevron) temperatures between 10 and 30 K. Although pumping speeds declined with time, probably because of the slow diffusion of hydrogen from the surface of the sieve crystals into the internal regions, the different sieve materials and operating conditions could be compared using time-averaged pump speeds. The (average) pumping speeds declined with increasing temperature. Under some conditions, the Na-Y sieve performed much better than the 5A sieve. Studies of the effect of small concentrations (approx. 4%) of hydrogen on helium pumping indicate that compound cryopumps in fusion reactors will not have to provide complete screening of hydrogen from helium panels. The concentrations of hydrogen did not lower effective helium pumping speeds or shorten the helium operating period between instabilities. Studies of tritium recovery from blankets of liquid lithium focused on design and construction of a flowing-lithium test system and on ultimate removal of tritium from yttrium sorbents. At 505 0 C, tritium release from yttrium behaves as a diffusion-controlled process, but the release rates are very low. Apparently, higher temperatures will be required for effective sorbent regeneration. An innovative technique for separating hydrogen isotopes by using bipolar electrolysis with permeable electrodes was analyzed to determine its potential usefulness in multistage separation

  12. Electron linac for medical isotope production with improved energy efficiency and isotope recovery

    Science.gov (United States)

    Noonan, John; Walters, Dean; Virgo, Matt; Lewellen, John

    2015-09-08

    A method and isotope linac system are provided for producing radio-isotopes and for recovering isotopes. The isotope linac is an energy recovery linac (ERL) with an electron beam being transmitted through an isotope-producing target. The electron beam energy is recollected and re-injected into an accelerating structure. The ERL provides improved efficiency with reduced power requirements and provides improved thermal management of an isotope target and an electron-to-x-ray converter.

  13. Calcium Isotope Analysis by Mass Spectrometry

    Science.gov (United States)

    Boulyga, S.; Richter, S.

    2010-12-01

    The variations in the isotopic composition of calcium caused by fractionation in heterogeneous systems and by nuclear reactions can provide insight into numerous biological, geological, and cosmic processes, and therefore isotopic analysis finds a wide spectrum of applications in cosmo- and geochemistry, paleoclimatic, nutritional, and biomedical studies. The measurement of calcium isotopic abundances in natural samples has challenged the analysts for more than three decades. Practically all Ca isotopes suffer from significant isobaric interferences, whereas low-abundant isotopes can be particularly affected by neighboring major isotopes. The extent of natural variations of stable isotopes appears to be relatively limited, and highly precise techniques are required to resolve isotopic effects. Isotope fractionation during sample preparation and measurements and instrumental mass bias can significantly exceed small isotope abundance variations in samples, which have to be investigated. Not surprisingly, a TIMS procedure developed by Russell et al. (Russell et al., 1978. Geochim Cosmochim Acta 42: 1075-1090) for Ca isotope measurements was considered as revolutionary for isotopic measurements in general, and that approach is used nowadays (with small modifications) for practically all isotopic systems and with different mass spectrometric techniques. Nevertheless, despite several decades of calcium research and corresponding development of mass spectrometers, the available precision and accuracy is still not always sufficient to achieve the challenging goals. This presentation discusses figures of merits of presently used analytical methods and instrumentation, and attempts to critically assess their limitations. Additionally, the availability of Ca isotope reference materials will be discussed.

  14. ITER isotope separation system

    International Nuclear Information System (INIS)

    Busigin, A.; Sood, S.K.; Kveton, O.K.; Sherman, R.H.; Anderson, J.L.

    1990-09-01

    This document presents the results of a study that examined the technical operating and economic viability of an alternative Isotope Separation System (ISS) design based on the distributed design concept. In the distributed design, the ISS is broken up into local independently operable subsystems matched to local processing requirements. The distributed design accepts the same feeds and produces essentially the same products as the reference design. The distributed design consists of two separate, independent subsystems. The first, called ISS-H, receives only protium-dominated streams and waste water from tritium extraction. It has two cryogenic distillation columns and can produce a 50 percent D, 50 percent T product since it lacks D/T separation capability. A final 80 percent T 2 concentration product can be obtained by blending the 50 percent T 2 stream from ISS-H with the more than 99 percent T 2 stream from the second subsystem, ISS-D. The second subsystem receives only deuterium-dominated feeds, which also contain some protium. ISS-D is as complex as the reference design, but smaller. Although each subsystem has some advantages, such as only two cryogenic distillation columns in ISS-H and better than 99 percent steady state T 2 product in ISS-D, the combined subsystems do not offer any real advantage compared to the reference IISS. The entire distributed ISS design has been simulated using Ontario Hydro's FLOSHEET steady state process simulator. Dynamic analysis has not been done for the distributed design. (10 refs., 3 figs., 8 tabs.)

  15. Development of isotope hydrology technology in China

    International Nuclear Information System (INIS)

    Li Zhangsu

    1988-01-01

    The development of isotope hydrology technology in China is described. The isotope technology provides an independent approach for solving hydrological problems. Isotope hydrology is applied in three ways: the use of change in environmental isotopic composition of water (especially used in water resources exploitation), the use of artificial radioactive tracers and the use of redioisotope instruments. Many important achievements have been obtained in application of isotopic hydrology technology. For the sake of promoting rapid development of isotope hydrology the topics on management, technology and others are commented

  16. Ca isotopes in refractory inclusions

    International Nuclear Information System (INIS)

    Niederer, F.R.; Papanastassiou, D.A.

    1984-01-01

    We report measurements of the absolute isotope abundance of Ca in Ca-Al-rich inclusions from the Allende and Leoville meteorites. Improved high precision measurements are reported also for 46 Ca. We find that nonlinear isotope effects in Ca are extremely rare in these inclusions. The absence of nonlinear effects in Ca, except for the effects in FUN inclusions, is in sharp contrast to the endemic effects in Ti. One fine-grained inclusion shows an excess of 46 Ca of (7 +- 1) per mille, which is consistent with addition of only 46 Ca or of an exotic (*) component with 46 Ca* approx. 48 Ca*. FUN inclusion EK-1-4-1 shows a small 46 Ca excess of (3.3 +- 1.0) per mille; this confirms that the exotic Ca components in EK-1-4-1 were even more deficient in 46 Ca relative to 48 Ca than is the case for normal Ca. The Ca in the Ca-Al-rich inclusions shows mass dependent isotope fractionation effects which have a range from -3.8 to +6.7 per mille per mass unit difference. This range is a factor of 20 wider than the range previously established for bulk meteorites and for terrestrial and lunar samples. Ca and Mg isotope fractionation effects in the Ca-Al-rich inclusions are common and attributed to kinetic isotope effects. (author)

  17. Handbook of environmental isotope geochemistry

    Energy Technology Data Exchange (ETDEWEB)

    Baskaran, Mark (ed.) [Wayne State Univ., Detroit, MI (United States). Dept. Geology

    2011-07-01

    Applications of radioactive and stable isotopes have revolutionized our understanding of the Earth and near-earth surface processes. The utility of the isotopes are ever-increasing and our sole focus is to bring out the applications of these isotopes as tracers and chronometers to a wider audience so that they can be used as powerful tools to solve environmental problems. New developments in this field remain mostly in peer-reviewed journal articles and hence our goal is to synthesize these findings for easy reference for students, faculty, regulators in governmental and non-governmental agencies, and environmental companies. While this volume maintains its rigor in terms of its depth of knowledge and quantitative information, it contains the breadth needed for wide variety problems and applications in the environmental sciences. This volume presents all of the newer and older applications of isotopes pertaining to the environmental problems in one place that is readily accessible to readers. This book not only has the depth and rigor that is needed for academia, but it has the breadth and case studies to illustrate the utility of the isotopes in a wide variety of environments (atmosphere, oceans, lakes, rivers and streams, terrestrial environments, and sub-surface environments) and serves a large audience, from students and researchers, regulators in federal, state and local governments, and environmental companies. (orig.)

  18. Isotope separation apparatus and method

    International Nuclear Information System (INIS)

    Cotter, T.P.

    1982-01-01

    The invention relates to a method and apparatus for laser isotope separation by photodeflection. A molecular beam comprising at least two isotopes to be separated intersects, preferable substantially perpendicular to one broad side of the molecular beam, with a laser beam traveling in a first direction. The laser beam is reflected back through the molecular beam, preferably in a second direction essentially opposite to the first direction. The laser beam comprises pi-pulses of a selected wavelength which excite unexcited molecules, or cause stimulated emission of excited molecules of one of the isotopes. Excitation caused by first direction pi-pulses moves molecules of the isotope excited thereby in the first direction. Stimulated emission of excited molecules of the isotope is brought about by returning pi-pulses traveling in the second direction. Stimulated emission moves emitting molecules in a direction opposite to the photon emitted. Because emitted photons travel in the second direction, emitting molecules move in the first direction. Substantial molecular movement is accomplished by a large number of pi-pulse-molecule interactions. A beam corer collects the molecules in the resulting enriched divergent portions of the beam

  19. Isotope-equipped measuring instruments

    International Nuclear Information System (INIS)

    Miyagawa, Kazuo; Amano, Hiroshi

    1980-01-01

    In the steel industry, though the investment in isotope-equipped measuring instruments is small as compared with that in machinery, they play important role in the moisture measurement in sintering and blast furnaces, the thickness measurement in rolling process and others in automatic control systems. The economic aspect of the isotope-equipped measuring instruments is described on the basis of the practices in Kimitsu Works of Nippon Steel Corporation: distribution of such instruments, evaluation of economic effects, usefulness evaluation in view of raising the accuracy, and usefulness evaluation viewed from the failure of the isotope instruments. The evaluation of economic effects was made under the premise that the isotope-equipped measuring instruments are not employed. Then, the effects of raising the accuracy are evaluated for a γ-ray plate thickness gauge and a neutron moisture gauge for coke in a blast furnace. Finally, the usefulness was evaluated, assuming possible failure of the isotope-equipped measuring instruments. (J.P.N.)

  20. Isotopes a very short introduction

    CERN Document Server

    Ellam, Rob

    2016-01-01

    An isotope is a variant form of a chemical element, containing a different number of neutrons in its nucleus. Most elements exist as several isotopes. Many are stable while others are radioactive, and some may only exist fleetingly before decaying into other elements. In this Very Short Introduction, Rob Ellam explains how isotopes have proved enormously important across all the sciences and in archaeology. Radioactive isotopes may be familiar from their use in nuclear weapons, nuclear power, and in medicine, as well as in carbon dating. They have been central to establishing the age of the Earth and the origins of the solar system. Combining previous and new research, Ellam provides an overview of the nature of stable and radioactive isotopes, and considers their wide range of modern applications. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost every subject area. These pocket-sized books are the perfect way to get ahead in a new subjec...

  1. Retention of gaseous isotopes

    International Nuclear Information System (INIS)

    Yarbro, O.O.; Mailen, J.C.; Stephenson, M.J.

    1977-01-01

    difficult as the tritium combines and distributes with the water inventory throughout the plant. To avoid this, a high temperature (550 0 C) volatilation step, termed voloxidation, is being developed at ORNL which drives most (up to 99%) of the tritium out of the fuel and traps it prior to aqueous processing. Other processes for tritium control under study include total retention of water and isotopic separation of tritium from plant aqueous effluents. Carbon-14 is produced in oxide fuels primarily by n-p reactions with 14 N contaminant in the fuel. Little is known about the actual behavior of 14 C in a reprocessing plant, and most of the effort is directed toward identifying the chemical forms and process sources of the 14 C effluents

  2. Oak Ridge National Laboratory's isotope enrichment program

    International Nuclear Information System (INIS)

    Tracy, J.G.; Aaron, W.C.

    1997-01-01

    The Isotope Enrichment Program (IEP) at Oak Ridge National Laboratory (ORNL) is responsible for the production and distribution of ∼225 enriched stable isotopes from 50 multi-isotopic elements. In addition, ORNL distributes enriched actinide isotopes and provides extensive physical- and chemical-form processing of enriched isotopes to meet customer requirements. For more than 50 yr, ORNL has been a major provider of enriched isotopes and isotope-related services to research, medical, and industrial institutions throughout the world. Consolidation of the Isotope Distribution Office (IDO), the Isotope Research Materials Laboratory (IRML), and the stable isotope inventories in the Isotope Enrichment Facility (IEF) have improved operational efficiencies and customer services. Recent changes in the IEP have included adopting policies for long-term contracts, which offer program stability and pricing advantages for the customer, and prorated service charges, which greatly improve pricing to the small research users. The former U.S. Department of Energy (DOE) Loan Program has been converted to a lease program, which makes large-quantity or very expensive isotopes available for nondestructive research at a nominal cost. Current efforts are being pursued to improve and expand the isotope separation capabilities as well as the extensive chemical- and physical-form processing that now exists. The IEF's quality management system is ISO 9002 registered and accredited in the United States, Canada, and Europe

  3. Isotopic depletion with Monte Carlo

    International Nuclear Information System (INIS)

    Martin, W.R.; Rathkopf, J.A.

    1996-06-01

    This work considers a method to deplete isotopes during a time- dependent Monte Carlo simulation of an evolving system. The method is based on explicitly combining a conventional estimator for the scalar flux with the analytical solutions to the isotopic depletion equations. There are no auxiliary calculations; the method is an integral part of the Monte Carlo calculation. The method eliminates negative densities and reduces the variance in the estimates for the isotope densities, compared to existing methods. Moreover, existing methods are shown to be special cases of the general method described in this work, as they can be derived by combining a high variance estimator for the scalar flux with a low-order approximation to the analytical solution to the depletion equation

  4. Stable isotope research pool inventory

    International Nuclear Information System (INIS)

    1986-08-01

    This report contains a listing of electromagnetically separated stable isotopes which are available at the Oak Ridge National Laboratory for distribution for nondestructive research use on a loan basis. This inventory includes all samples of stable isotopes in the Research Materials Collection and does not designate whether a sample is out on loan or is in reprocessing. For some of the high-abundance, naturally occurring isotopes, larger amounts can be made available; for example, Ca-40 and Fe-56. All requests for the loan of samples should be submitted with a summary of the purpose of the loan to: Iotope Distribution Office, Oak Ridge National Laboratory, P.O. Box X, Oak Ridge, Tennessee 37831. Requests from non-DOE contractors and from foreign institutions require DOE approval

  5. Stable isotopes and the environment

    International Nuclear Information System (INIS)

    Krouse, H.R.

    1990-01-01

    Whereas traditionally, stable isotope research has been directed towards resource exploration and development, it is finding more frequent applications in helping to assess the impacts of resource utilization upon ecosystems. Among the many pursuits, two themes are evident: tracing the transport and conversions of pollutants in the environment and better understanding of the interplay among environmental receptors, e.g. food web studies. Stable isotope data are used primarily to identify the presence of pollutants in the environment and with a few exceptions, the consequence of their presence must be assessed by other techniques. Increasing attention has been given to the isotopic composition of humans with many potential applications in areas such as paleodiets, medicine, and criminology. In this brief overview examples are used from the Pacific Rim to illustrate the above concepts. 26 refs., 1 tab., 3 figs

  6. Lithium isotopic separation: preliminary studies

    International Nuclear Information System (INIS)

    Macedo, Sandra Helena Goulart de

    1998-01-01

    In order to get the separation of natural isotopes of lithium by electrolytic amalgamation, an electrolytic cell with a confined mercury cathode was used to obtain data for the design of a separation stage. The initial work was followed by the design of a moving mercury cathode electrolytic cell and three experiments with six batches stages were performed for the determination of the elementary separation factor. The value obtained, 1.053, was ill agreement: with the specialized literature. It was verified in all experiments that the lithium - 6 isotope concentrated in the amalgam phase and that the lithium - 7 isotope concentrated in the aqueous phase. A stainless-steel cathode for the decomposition of the lithium amalgam and the selective desamalgamation were also studied. In view of the results obtained, a five stages continuous scheme was proposed. (author)

  7. Shielding container for radioactive isotopes

    International Nuclear Information System (INIS)

    Sumi, Tetsuo; Tosa, Masayoshi; Hatogai, Tatsuaki.

    1975-01-01

    Object: To effect opening and closing bidirectional radiation used particularly for a gamma densimeter or the like by one operation. Structure: This device comprises a rotatable shielding body for receiving radioactive isotope in the central portion thereof and having at least two radiation openings through which radiation is taken out of the isotope, and a shielding container having openings corresponding to the first mentioned radiation openings, respectively. The radioactive isotope is secured to a rotational shaft of the shielding body, and the shielding body is rotated to register the openings of the shielding container with the openings of the shielding body or to shield the openings, thereby effecting radiation and cut off of gamma ray in the bidirection by one operation. (Kamimura, M.)

  8. Shape coexistence in selenium isotopes

    International Nuclear Information System (INIS)

    Liu Ying; Cao Zhongbin; Xu Furong

    2010-01-01

    Nuclear shape change and shape coexistence in the Selenium isotopes have been investigated by Total-Routhian-Surface (TRS) calculations. It is found that nuclear shapes vary significantly with increasing neutron number. The TRS calculations for the ground states of 66,72,92,94 Se isotopes show that both neutron-deficient and neutron-dripline Selenium isotopes have oblate and prolate shape coexistence. The cranking shell-model calculations for 72,94 Se give that prolate and oblate shape coexistence in low rotational frequency. However, oblate rotational bands disappear and prolate rotational bands become yrast bands with increasing rotational frequency, which is due to the intrusion of the g 9/2 orbitals. (authors)

  9. Isotopic composition of past precipitation

    International Nuclear Information System (INIS)

    Edwards, T.W.D.

    1998-01-01

    The distribution of stable isotopes in precipitation provides critical quantitative information about the global water cycle. The first PAGES/IAEA ISOMAP workshop was held at the IAEA headquarters in Vienna, 24-26 August 1998, which gathered 32 participants. The presentation and discussions demonstrated that a high level of sophistication already exists in the development of transfer functions between measured parameters and precipitation, as a result of the extensive use of water isotope tracers in paleo-environmental investigations, but a major challenge facing both producers and users of paleo-isotope data is the effective management of data and meta-data, to permit ready retrieval of raw and inferred data for comparison and reinterpretation. This will be in important goal of future ISOMAP activities. The critical need for more paleo-data from low latitudes was clearly recognized

  10. Isotopes in research and industry

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1961-01-15

    A comprehensive review of the present state of the use of radioisotopes in the physical sciences and industry was made at a major international conference in Copenhagen from 6 to 16 September 1960. The conference covers the use of radioisotopes in geophysics, metallurgy, solid state physics and nuclear physics, industrial applications of radioisotopes, which were divided into two groups, namely applications based on the tracer function of isotopes and those based on the penetration, absorption or scattering of radiation, use of isotopes in various branches of chemistry - from analysis to determine extremely small amounts of material to a study of the mechanism of various chemical reactions.

  11. Electron scattering off palladium isotopes

    International Nuclear Information System (INIS)

    Laan, J.B. van der.

    1986-01-01

    The low-lying states of the even Pd isotopes are characterized by vibrator-like properties. In this thesis the results of an electron scattering experiment on the Pd isotopes, designed to study the description of such nuclei in the Anharmonic Vibrator Model (AVM) and the Interacting Boson Approximation (IBA), are presented and discussed. Data have been taken at the high-resolution electron scattering facility of NIKHEF-K and covered a momentum-transfer range of 0.4 to 2.5 fm -1 . (Auth.)

  12. Natural fractionation of uranium isotopes

    International Nuclear Information System (INIS)

    Noordmann, Janine

    2015-01-01

    The topic of this thesis was the investigation of U (n( 238 U) / n( 235 U)) isotope variations in nature with a focus on samples (1) that represent the continental crust and its weathering products (i.e. granites, shales and river water) (2) that represent products of hydrothermal alteration on mid-ocean ridges (i.e. altered basalts, carbonate veins and hydrothermal water) and (3) from restricted euxinic basins (i.e. from the water column and respective sediments). The overall goal was to explore the environmental conditions and unravel the mechanisms that fractionate the two most abundant U isotopes, n( 238 U) and n( 235 U), on Earth.

  13. Separation process for boron isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Rockwood, S D

    1975-06-12

    The method according to the invention is characterized by the steps of preparing a gaseous mixture of BCl/sub 3/ containing the isotopes of boron and oxygen as the extractor, irradiating that mixture in the tube of the separator device by means of P- or R-lines of a CO/sub 2/ laser for exciting the molecules containing a given isotope of boron, simultaneously irradiating the mixture with UV for photodissociating the excited BCl/sub 3/ molecules and separating BCl/sub 3/ from the reaction products of photodissociation and from oxygen. Such method is suitable for preparing boron used in nuclear reactors.

  14. Isotopic cisternography. Its clinical value

    International Nuclear Information System (INIS)

    Lemort, J.P.; Bizais, Y.; Herzog, B.

    1976-01-01

    A brief study of isotopic cisternography with a new tracer is performed. After describing the physiological circulation of the cerebrospinal fluid the different tracers used are studied and experience with 111 Indium DTPA which is tending to replace the other tracers is given. The indications and the normal and pathological results are discussed. The different forms of hydrocephalus are described; this examination makes it possible in particular to diagnose cases of hydrocephalus with normal pressure, cysts, or localized, subarachnoid pockets. Cerebrospinal fluid fistulas are detected by this technique. Finally, the place of isotopic cisternography in relation to the other neuroradiological examinations and in relation to tomodensitometric investigations is discussed [fr

  15. Recent development in isotope ratio mass spectrometry

    International Nuclear Information System (INIS)

    Platzner, I.

    1992-01-01

    Within the limited of this review the following topics will be briefly discussed: a) Accuracy, precision, internal relative standard deviation (RISD) and external relative standard deviation (RESD) of isotope ratio measurements. With advanced instrumentation and use of standard reference materials, high accuracy and RESD = 0.002% (or better) may be achieved; b) The advantages of modern automatic isotope ratio mass spectrometer are briefly described. Computer controlled operation and data acquisition, and multiple ion collection are the recent important improvement; c) The isotopic fractionation during the course of isotope ratio measurement is considered as a major source of errors in thermal ionization of metallic elements. The phenomenon in strontium, neodymium, uranium, lead and calcium and methods to correct the measured data are discussed; d) Applications of isotope ratio mass spectrometry in atomic weight determinations, the isotope dilution technique, isotope geology, and isotope effects in biological systems are described together with specific applications in various research and technology area. (author)

  16. Isotope separation using vibrationally excited molecules

    International Nuclear Information System (INIS)

    1979-01-01

    This invention relates to isotope separation employing isotopically selective vibrational excitation and vibration-translation reactions of the excited particles. Uranium enrichment, using uranium hexafluoride, is a particular embodiment. (U.K.)

  17. Isotope applications in the environmental field

    International Nuclear Information System (INIS)

    DeWitt, R.

    1978-01-01

    Established uses of enriched isotopes in the environmental field were surveyed to determine future trends in isotope needs. Based on established isotope uses, on the projected increase in the pollution problem, and on the apparent social and economic pressure for pollution abatement, a significant demand for enriched isotopes appears to be developing for the assessment and control of air, water, and soil pollutants. Isotopic techniques will be used in combination with conventional methods of detection and measurement, such as gas chromatography, x-ray fluorescence, and atomic absorption. Recent advances in economical isotope separation methods, instrumentation, and methodology promise to place isotopic technology within the reach of most research and industrial institutions. Increased application of isotope techniques appears most likely to occur in areas where data are needed to characterize the movement, behavior, and fate of pollutants in the environment

  18. High mass isotope separation process and arrangement

    International Nuclear Information System (INIS)

    Eerkens, J.W.

    1978-01-01

    An isotope separation arrangement for separating a preselected isotope from a mixture of chemically identical but isotopically different molecules by either photon-induced pure rovibrational or vibronic selective excitation of the molecules containing the atoms of the isotope to be separated from a lower to a higher energy state, and a chemical reaction of the higher energy state molecules with a chemically reactive agent to form a chemical compound containing primarily the atoms of isotope to be separated in a physicochemical state different from the physicochemical state of the mixture of chemically identical but isotopically different molecules. The chemical compound containing the atoms of the isotope to be separated may be subsequently processed to obtain the isotope

  19. Method and device for isotope separation

    International Nuclear Information System (INIS)

    Dawson, J.M.

    1976-01-01

    The method works with a converted Q machine. The plasma containing the isotopes to be separated is crossed by a magnetic field running in the direction of the plasma column. More energy is transfered to the chosen isotope by oscillating magnetic and/or electric fields or by sound waves by using the specific resonance frequency for the selected isotope. The isotopes thus heated to different extents can be separated according to various methods given in the patent claims. (GG) [de

  20. Isotope mixtures of hydrogen in vanadium

    International Nuclear Information System (INIS)

    Mecking-Schloetensack, P.

    1982-03-01

    The properties of isotope-mixtures of Protium and Deuterium stored in Vanadium have been studied. Protium and Deuterium are existing as interstitial-atoms on tetrahedral sites as well as on octahedral sites in this system. This feature leads to large isotopic-effects between the two isotopes. The dependence of the thermodynamic functions like heat of solution, nonconfigurational entropy, specific heat and ordering temperatures from the composition of the isotope-mixture has been determined. (orig.)

  1. Innovations in monoclonal antibody tumor targeting; Diagnostic and therapeutic implications

    International Nuclear Information System (INIS)

    Schlom, J.

    1989-01-01

    The detection of carcinoma lesions not identified by conventional radiological and physical examinations remains a major problem in the treatment of many carcinomas. This article reviews potential new modalities and areas of research for carcinoma diagnosis and treatment. A case history is presented

  2. Tumor Targeting and Drug Delivery by Anthrax Toxin

    OpenAIRE

    Bachran, Christopher; Leppla, Stephen H.

    2016-01-01

    Anthrax toxin is a potent tripartite protein toxin from Bacillus anthracis. It is one of the two virulence factors and causes the disease anthrax. The receptor-binding component of the toxin, protective antigen, needs to be cleaved by furin-like proteases to be activated and to deliver the enzymatic moieties lethal factor and edema factor to the cytosol of cells. Alteration of the protease cleavage site allows the activation of the toxin selectively in response to the presence of tumor-associ...

  3. Polymeric micelles as a drug carrier for tumor targeting

    Directory of Open Access Journals (Sweden)

    Neha M Dand

    2013-01-01

    Full Text Available Polymeric micelle can be targeted to tumor site by passive and active mechanism. Some inherent properties of polymeric micelle such as size in nanorange, stability in plasma, longevity in vivo, and pathological characteristics of tumor make polymeric micelles to be targeted at the tumor site by passive mechanism called enhanced permeability and retention effect. Polymeric micelle formed from the amphiphilic block copolymer is suitable for encapsulation of poorly water soluble, hydrophobic anticancer drugs. Other characteristics of polymeric micelles such as separated functionality at the outer shell are useful for targeting the anticancer drug to tumor by active mechanisms. Polymeric micelles can be conjugated with many ligands such as antibodies fragments, epidermal growth factors, α2 -glycoprotein, transferrine, and folate to target micelles to cancer cells. Application of heat and ultrasound are the alternative methods to enhance drug accumulation in tumoral cells. Targeting using micelles can also be done to tumor angiogenesis which is the potentially promising target for anticancer drugs. This review summarizes about recently available information regarding targeting the anticancer drug to the tumor site using polymeric micelles.

  4. Applications of polymeric micelles with tumor targeted in chemotherapy

    International Nuclear Information System (INIS)

    Ding Hui; Wang Xiaojun; Zhang Song; Liu Xinli

    2012-01-01

    Polymeric micelles (PMs) have gained more progress as a carrier system with the quick development of biological and nanoparticle techniques. In particular, PMs with smart targeting can deliver anti-cancer drugs directly into tumor cells at a sustained rate. PMs with core–shell structure (with diameters of 10 ∼ 100 nm) have been prepared by a variety of biodegradable and biocompatible polymers via a self-assembly process. The preparation of polymeric micelles with stimuli-responsive block copolymers or modification of target molecules on polymeric micelles’ surface are able to significantly improve the efficiency of drug delivery. Polymeric micelles, which have been considered as a novel promising drug carrier for cancer therapeutics, are rapidly evolving and being introduced in an attempt to overcome several limitations of traditional chemotherapeutics, including water solubility, tumor-specific accumulation, anti-tumor efficacy, and non-specific toxicity. This review describes the preparation of polymeric micelles and the targeted modification which greatly enhance the effects of chemotherapeutic agents.

  5. Engineering of magnetic DNA nanoparticles for tumor-targeted therapy

    International Nuclear Information System (INIS)

    Hosseinkhani, Hossein; Chen Yiru; He Wenjie; Hong Poda; Yu, Dah-Shyong; Domb, Abraham J.

    2013-01-01

    This study aims to engineer novel targeted delivery system composed of magnetic DNA nanoparticles to be effective as an efficient targeted gene therapy vehicle for tumor therapy. A polysaccharide, dextran, was chosen as the vector of plasmid DNA-encoded NK4 that acts as an HGF-antagonist and anti-angiogenic regulator for inhibitions of tumor growth, invasion, and metastasis. Spermine (Sm) was chemically introduced to the hydroxyl groups of dextran to obtain dextran-Sm. When Fe 2+ solution was added to the mixture of dextran-Sm and a plasmid DNA, homogenous DNA nanoparticles were formed via chemical metal coordination bonding with average size of 230 nm. Characterization of DNA nanoparticles was performed via dynamic light scattering measurement, electrophoretic light scattering measurement, as well as transmission electron microscope. DNA nanoparticles effectively condensed plasmid DNA into nanoparticles and enhanced the stability of DNA, while significantly improved transfection efficiency in vitro and tumor accumulation in vivo. In addition, magnetic DNA nanoparticles exhibited high efficiency in antitumor therapy with regards to tumor growth as well as survival of animals evaluated in the presence of external magnetic field. We conclude that the magnetic properties of these DNA nanoparticles would enhance the tracking of non-viral gene delivery systems when administrated in vivo in a test model. These findings suggest that DNA nanoparticles effectively deliver DNA to tumor and thereby inhibiting tumor growth.

  6. Phenylalanine-coupled solid lipid nanoparticles for brain tumor targeting

    Energy Technology Data Exchange (ETDEWEB)

    Kharya, Parul; Jain, Ashish; Gulbake, Arvind; Shilpi, Satish; Jain, Ankit; Hurkat, Pooja [Dr. Hari Singh Gour University, Pharmaceutical Research Projects Laboratory, Department of Pharmaceutical Sciences (India); Majumdar, Subrata [Bose Institute, Division of Molecular Medicine (India); Jain, Sanjay K., E-mail: drskjainin@yahoo.com [Dr. Hari Singh Gour University, Pharmaceutical Research Projects Laboratory, Department of Pharmaceutical Sciences (India)

    2013-11-15

    The purpose of this study is to investigate the targeting potential of amino acid (phenylalanine)-coupled solid lipid nanoparticles (SLN) loaded with ionically complexed doxorubicin HCl (Dox). Ionic complexation was used to enhance the loading efficiency and release characteristics of water soluble form of Dox. l-Type amino acid transporters (LAT1) are highly expressed on blood brain barrier as well as on many brain cancer cells, thus targeting LAT1 using phenylalanine improved anticancer activity of prepared nanocarrier. The phenylalanine-coupled SLN were characterized by fourier transform infrared spectroscopy, scanning electron microscope, transmission electron microscopy, particle size, zeta potential, entrapment efficiency and in vitro release. The particle size of the resulting SLN was found to be in the range of 163.3 ± 5.2 to 113.0 ± 2.6 nm, with a slightly negative surface charge. In ex vivo study on C6 glioma cell lines, the cellular cytotoxicity of the SLN was highly increased when coupled with phenylalanine. In addition, stealthing sheath of PEG present on the surface of the SLN enhanced the cellular uptake of the SLN on C6 glioma cell line. Results of biodistribution and fluorescence studies clearly revealed that phenylalanine-coupled SLN could deliver high amount of drug into the brain tumor cells and showed the brain-targeting potential.

  7. Recent Trends in Multifunctional Liposomal Nanocarriers for Enhanced Tumor Targeting

    Directory of Open Access Journals (Sweden)

    Federico Perche

    2013-01-01

    Full Text Available Liposomes are delivery systems that have been used to formulate a vast variety of therapeutic and imaging agents for the past several decades. They have significant advantages over their free forms in terms of pharmacokinetics, sensitivity for cancer diagnosis and therapeutic efficacy. The multifactorial nature of cancer and the complex physiology of the tumor microenvironment require the development of multifunctional nanocarriers. Multifunctional liposomal nanocarriers should combine long blood circulation to improve pharmacokinetics of the loaded agent and selective distribution to the tumor lesion relative to healthy tissues, remote-controlled or tumor stimuli-sensitive extravasation from blood at the tumor’s vicinity, internalization motifs to move from tumor bounds and/or tumor intercellular space to the cytoplasm of cancer cells for effective tumor cell killing. This review will focus on current strategies used for cancer detection and therapy using liposomes with special attention to combination therapies.

  8. Engineering of magnetic DNA nanoparticles for tumor-targeted therapy

    Energy Technology Data Exchange (ETDEWEB)

    Hosseinkhani, Hossein, E-mail: hosseinkhani@yahoo.com [Graduate Institute of Biomedical Engineering, National Taiwan University of Science and Technology (Taiwan Tech) (China); Chen Yiru [National Yang-Ming University, Department of Biomedical Engineering (China); He Wenjie; Hong Poda [Graduate Institute of Biomedical Engineering, National Taiwan University of Science and Technology (Taiwan Tech) (China); Yu, Dah-Shyong [Nanomedicine Research Center, National Defense Medical Center (China); Domb, Abraham J. [Institute of Drug Research, The Center for Nanoscience and Nanotechnology, School of Pharmacy, Faculty of Medicine, Hebrew University of Jerusalem (Israel)

    2013-01-15

    This study aims to engineer novel targeted delivery system composed of magnetic DNA nanoparticles to be effective as an efficient targeted gene therapy vehicle for tumor therapy. A polysaccharide, dextran, was chosen as the vector of plasmid DNA-encoded NK4 that acts as an HGF-antagonist and anti-angiogenic regulator for inhibitions of tumor growth, invasion, and metastasis. Spermine (Sm) was chemically introduced to the hydroxyl groups of dextran to obtain dextran-Sm. When Fe{sup 2+} solution was added to the mixture of dextran-Sm and a plasmid DNA, homogenous DNA nanoparticles were formed via chemical metal coordination bonding with average size of 230 nm. Characterization of DNA nanoparticles was performed via dynamic light scattering measurement, electrophoretic light scattering measurement, as well as transmission electron microscope. DNA nanoparticles effectively condensed plasmid DNA into nanoparticles and enhanced the stability of DNA, while significantly improved transfection efficiency in vitro and tumor accumulation in vivo. In addition, magnetic DNA nanoparticles exhibited high efficiency in antitumor therapy with regards to tumor growth as well as survival of animals evaluated in the presence of external magnetic field. We conclude that the magnetic properties of these DNA nanoparticles would enhance the tracking of non-viral gene delivery systems when administrated in vivo in a test model. These findings suggest that DNA nanoparticles effectively deliver DNA to tumor and thereby inhibiting tumor growth.

  9. Stable isotopes and biomarkers in microbial ecology

    NARCIS (Netherlands)

    Boschker, H.T.S.; Middelburg, J.J.

    2002-01-01

    The use of biomarkers in combination with stable isotope analysis is a new approach in microbial ecology and a number of papers on a variety of subjects have appeared. We will first discuss the techniques for analysing stable isotopes in biomarkers, primarily gas chromatography-combustion-isotope

  10. Isotope exchange reactions in hydrogen mixtures

    International Nuclear Information System (INIS)

    Czaplinski, W.; Gula, A.; Kravtsov, A.; Mikhailov, A.; Popov, N.

    1990-12-01

    The rates of isotopic exchange for the excited states of muonic hydrogen are calculated as functions of collision energy. Ground state population q 1s for different collision energies, target densities and isotope concentrations is obtained. It is shown that for principal quantum numbers n > 5 the isotopic exchange still considerably influences the value of q 1s . (author)

  11. Dynamical symmetry breaking in barium isotopes

    International Nuclear Information System (INIS)

    Rawat, Bir Singh; Chattopadhyay, P.K.

    1997-01-01

    The isotopes of Xe with mass numbers 124, 126, 128, 130 and the isotopes of barium with mass numbers 128, 130, 132, 134 were shown to correspond to the O(6) dynamical symmetry of IBM. In the investigation of the dynamical symmetry breaking in this region, the barium isotopes for departures from O(6) symmetry have been studied

  12. ICP-MS for isotope ratio measurement

    Science.gov (United States)

    The use of stable isotopes in mineral nutrition research has become a fundamental aspect of conducting this research. A gradual transition has occurred, now virtually complete, from radioactive isotope studies to those using stable isotopes. Although primarily used in human research, mineral stable ...

  13. Isotopes in day to day life

    Science.gov (United States)

    1984-06-01

    Developments are reported in the use of isotopic labeling and isotope irradiation in agriculture, medical science, hydrology, geochemistry, geophysics, environment pollution detection, and industries. Radioisotope instruments are described as well as techniques for gamma radiography, neutron radiography, and autoradiography. Isotope dating in geology and archaeology is covered. Basic scientific research topics in various areas are listed.

  14. Use of Isotopes for Studying Reaction Mechanisms

    Indian Academy of Sciences (India)

    In the first part of this series, we discussed how isotopes can be used as markers to determine the nature of intermediates in chemical reactions. The second part covered the effect of isotopes on equilibria and reactions, in processes where the bond to the isotopic a tom is broken. We showed with specific examples how.

  15. Radioactive isotopes on the Moon

    International Nuclear Information System (INIS)

    Davis, R. Jr.

    1975-01-01

    A limited review of experiments and studies of radioactivity and isotope ratios in lunar materials is given. Observations made on the first few millimeters of the surface where the effects of solar flare particles are important, some measurements on individual rocks, and some studies of radioactivities produced deep in the lunar soil by galactic cosmic rays, are among the experiments discussed

  16. Isotopes in the earth sciences

    Energy Technology Data Exchange (ETDEWEB)

    Bowen, Robert

    1988-01-01

    This book examines significant aspects of isotope applications in geology and geochemistry commencing with basic matters, such as atomic structure, stable nuclides and their fractionation, as well as the various decay modes of unstable nuclides. Modern mass spectrometry techniques including electrostatic tandem accelerators are followed by a review of radioisotope dating technology. The relatively new method using the rare earth elements samarium and neodymium are covered. Other geochronometers, applicable to both rocks and minerals not dateable otherwise, are included. A review is given of isotopes in the atmosphere, hydrosphere and lithosphere of the Earth. Those of oxygen and hydrogen together with the cosmogenic radionuclides tritium and radiocarbon are discussed in relation to the biosphere. The role of isotopes of carbon, nitrogen and sulphur is described and extended to fossil fuels and rocks as well as meteorites. Related themes such as Phanerozoic oceans, oceanic palaeothermometry, snow and ice stratigraphy and geothermal waters are covered. The field of isotopic palaeoecology is discussed. Radioactive wastes, their accumulation, dangers and disposal are investigated with especial reference to their environmental impacts.

  17. Isotopes in the atomic age

    International Nuclear Information System (INIS)

    Arnikar, H.J.

    1989-01-01

    The first accessible, practical account of isotopes separation processes for engineers. This guide gives expert guidance on all the most important methods (including references to the original papers), how to improve their yields, with discussions of theory and application of each technique. Presentation is clear and non-mathematical. Illustrated

  18. Progress in tropical isotope dendroclimatology

    Science.gov (United States)

    Evans, M. N.; Schrag, D. P.; Poussart, P. F.; Anchukaitis, K. J.

    2005-12-01

    The terrestrial tropics remain an important gap in the growing high resolution proxy network used to characterize the mean state and variability of the hydrological cycle. Here we review early efforts to develop a new class of proxy paleorainfall/humidity indicators using intraseasonal to interannual-resolution stable isotope data from tropical trees. The approach invokes a recently published model of oxygen isotopic composition of alpha-cellulose, rapid methods for cellulose extraction from raw wood, and continuous flow isotope ratio mass spectrometry to develop proxy chronological, rainfall and growth rate estimates from tropical trees, even those lacking annual rings. Isotopically-derived age models may be confirmed for modern intervals using trees of known age, radiocarbon measurements, direct measurements of tree diameter, and time series replication. Studies are now underway at a number of laboratories on samples from Costa Rica, northwestern coastal Peru, Indonesia, Thailand, New Guinea, Paraguay, Brazil, India, and the South American Altiplano. Improved sample extraction chemistry and online pyrolysis techniques should increase sample throughput, precision, and time series replication. Statistical calibration together with simple forward modeling based on the well-observed modern period can provide for objective interpretation of the data. Ultimately, replicated data series with well-defined uncertainties can be entered into multiproxy efforts to define aspects of tropical hydrological variability associated with ENSO, the meridional overturning circulation, and the monsoon systems.

  19. Dual temperature isotope exchange system

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1976-01-01

    Improvements in the method for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. In a preferred embodiment the first is a vaporizable liquid and the auxiliary fluid a gas, comprising steps for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations

  20. Theory of oxygen isotope exchange

    NARCIS (Netherlands)

    den Otter, M.W.; Boukamp, Bernard A.; Bouwmeester, Henricus J.M.

    2001-01-01

    Transients for oxygen molecular mass numbers 32, 34 and 36 are derived which can be used for the interpretation of oxygen isotope exchange data based on measurement of concentrations of 16O2, 16O18O and 18O2 in the gas phase. Key parameters in the theory are the rate at which oxygen molecules are

  1. Reorientation measurements on tungsten isotopes

    Energy Technology Data Exchange (ETDEWEB)

    O' Brien, J J; Saladin, J X; Baktash, C; Alessi, J G [Pittsburgh Univ., Pa. (USA)

    1977-11-14

    In a particle-..gamma.. coincidence experiment, a thick tungsten target, of natural isotopic abundance, was bombarded with ..cap alpha.. and /sup 16/O beams. From analysis of the deexcitation ..gamma..-rays following Coulomb excitation, the spectroscopic quadrupole moment of the second 2/sup +/ state (the 2/sup +/' state) was determined for /sup 186/W and /sup 184/W. In a separate Coulomb excitation experiment a thin, isotopically enriched /sup 186/W target was bombarded with /sup 16/O ions. From analysis of projectiles scattered elastically and inelastically the quadrupole moment of the 2/sup +/' state of /sup 186/W was extracted. The results of the two experiments are in good agreement. The quadrupole moment of the 2/sup +/' state is found to be opposite in sign to that of the first 2/sup +/ state for both isotopes studied. However, its magnitude decreases rapidly in going from /sup 186/W to /sup 184/W, in contrast to the predictions of the rotation-vibration of asymmetric rotor models. The microscopic theory of Kumar and Baranger does predict the experimental trend, qualitatively. Thus the present results are interpreted as being evidence of strong coupling between ..beta.. and ..gamma.. degrees of freedom in the tungsten isotopes, which, according to the theory of Kumar and Baranger, is the source of the reduced value of the quadrupole moment.

  2. Triplet states in lead isotopes

    International Nuclear Information System (INIS)

    Naz, Tabassum; Ahmad, Shakeb; Abusara, H.

    2017-01-01

    Axial and triaxial calculations within RHB have been done to study the shape coexistence phenomena in the lead isotopes. Triplet states have been found in the 184-190 Pb which are in accordance with the experimental and other theoretical observations. The energy difference (in MeV) between the first two excited states also gives the evidence for the same

  3. Non-linear Isotope Effects

    DEFF Research Database (Denmark)

    Schmidt, Johan Albrecht

    ’s stratosphere is nearly mass dependent, and only a small fraction of the observed anomalous oxygen-17 excess can be attributed to N2O photolysis. In contrast, stratospheric photolysis produces a significant inverse clumped isotope effect.(ii) Stratospheric OCS photolysis significantly enrich the remaining OCS...

  4. The isotopic dating of crystals

    International Nuclear Information System (INIS)

    Giuliani, G.; Cheilletz, A.

    1995-01-01

    The first part of this work deals with the answer to the question : why are the crystals dated ? Then, some isotopic dating methods are described : U-Th-Pb, K-Ar, 40 Ar/ 39 Ar, Rb-Sr, Sm-Nd, fission traces, carbon 14 methods. Examples concerning emeralds and diamonds are given. (O.L.). 12 refs., 2 figs

  5. Isotope hydrology: Investigating groundwater contamination

    International Nuclear Information System (INIS)

    Dubinchuk, V.; Froehlich, K.; Gonfiantini, R.

    1989-01-01

    Groundwater quality has worsened in many regions, with sometimes serious consequences. Decontaminating groundwater is an extremely slow process, and sometimes impossible, because of the generally long residence time of the water in most geological formations. Major causes of contamination are poor groundwater management (often dictated by immediate social needs) and the lack of regulations and control over the use and disposal of contaminants. These types of problems have prompted an increasing demand for investigations directed at gaining insight into the behaviour of contaminants in the hydrological cycle. Major objectives are to prevent pollution and degradation of groundwater resources, or, if contamination already has occurred, to identify its origin so that remedies can be proposed. Environmental isotopes have proved to be a powerful tool for groundwater pollution studies. The IAEA has had a co-ordinated research programme since 1987 on the application of nuclear techniques to determine the transport of contaminants in groundwater. An isotope hydrology project is being launched within the framework of the IAEA's regional co-operative programme in Latin America (known as ARCAL). Main objectives are the application of environmental isotopes to problems of groundwater assessment and contamination in Latin America. In 1989, another co-ordinated research programme is planned under which isotopic and other tracers will be used for the validation of mathematical models in groundwater transport studies

  6. PETROCHEMISTRY, Pb ISOTOPE SYSTEMATICS, AND ...

    African Journals Online (AJOL)

    The petrology, geochemistry, geotectonic setting and common Pb isotope model ages for the granite gneisses in Ilesha schist belt have been studied and presented in this paper. These gneisses, apart from the normal rock-forming silicates, contain apatite, monazite, ilmenite and zircon in trace amounts. The occurrence of ...

  7. Plutonium determination by isotope dilution

    International Nuclear Information System (INIS)

    Lucas, M.

    1980-01-01

    The principle is to add to a known amount of the analysed solution a known amount of a spike solution consisting of plutonium 242. The isotopic composition of the resulting mixture is then determined by surface ionization mass spectrometry, and the plutonium concentration in the solution is deduced, from this measurement. For irradiated fuels neutronic studies or for fissile materials balance measurements, requiring the knowledge of the ratio U/Pu or of concentration both uranium and plutonium, it is better to use the double spike isotope dilution method, with a spike solution of known 233 U- 242 Pu ratio. Using this method, the ratio of uranium to plutonium concentration in the irradiated fuel solution can be determined without any accurate measurement of the mixed amounts of sample and spike solutions. For fissile material balance measurements, the uranium concentration is determined by using single isotope dilution, and the plutonium concentration is deduced from the ratio Pu/U and U concentration. The main advantages of isotope dilution are its selectivity, accuracy and very high sensitivity. The recent improvements made to surface ionization mass spectrometers have considerably increased the precision of the measurements; a relative precision of about 0.2% to 0.3% is obtained currently, but it could be reduced to 0.1%, in the future, with a careful control of the experimental procedures. The detection limite is around 0.1 ppb [fr

  8. Paleogene Seawater Osmium Isotope Records

    Science.gov (United States)

    Rolewicz, Z.; Thomas, D. J.; Marcantonio, F.

    2012-12-01

    Paleoceanographic reconstructions of the Late Cretaceous and early Cenozoic require enhanced geographic coverage, particularly in the Pacific, in order to better constrain meridional variations in environmental conditions. The challenge with the existing inventory of Pacific deep-sea cores is that they consist almost exclusively of pelagic clay with little existing age control. Pelagic clay sequences are useful for reconstructions of dust accumulation and water mass composition, but accurate correlation of these records to other sites requires improved age control. Recent work indicates that seawater Os isotope analyses provide useful age control for red clay sequences. The residence time of Os in seawater is relatively long compared to oceanic mixing, therefore the global seawater 187Os/188Os composition is practically homogeneous. A growing body of Late Cretaceous and Cenozoic data has constrained the evolution of the seawater Os isotopic composition and this curve is now a viable stratigraphic tool, employed in dating layers of Fe-Mn crusts (e.g., Klemm et al., 2005). Ravizza (2007) also demonstrated that the seawater Os isotopic composition can be extracted reliably from pelagic red clay sediments by analyzing the leached oxide minerals. The drawback to using seawater Os isotope stratigraphy to date Paleogene age sediments is that the compilation of existing data has some significant temporal gaps, notably between ~38 and 55 Ma. To improve the temporal resolution of the seawater Os isotope curve, we present new data from Ocean Drilling Program (ODP) Site 865 in the equatorial Pacific. Site 865 has excellent biostratigraphic age control over the interval ~38-55Ma. Preliminary data indicate an increase in the seawater composition from 0.427 at 53.4 Ma to 0.499 by 43 Ma, consistent with the apparent trend in the few existing data points. We also analyzed the Os isotopic composition recorded by oxide minerals at Integrated Ocean Drilling Program (IODP) Site U1370

  9. Can a sponge fractionate isotopes?

    Science.gov (United States)

    Patel, B; Patel, S; Balani, M C

    1985-03-22

    The study has unequivocally demonstrated that siliceous sponges Spirastrella cuspidifera and Prostylyssa foetida from the same microecological niche exhibit a high degree of species specificity, while accumulating a host of heavy metal ions (Ni, Cr, Cd, Sn, Ti, Mo, Zr). S. cuspidifera accumulated, in addition, 60Co and 63Ni, showing discrimination against other radionuclides, 137Cs and 131I, present in the ambient waters receiving controlled low level waste discharges from a B.W.R. nuclear power station. P. foetida, on the other hand, accumulated only 131I and showed discrimination against other radionuclides including 60Co, although the stable iodine concentrations in both the sponges were the same. The specific activity of 60Co (in becquerels per gram of 59Co) in S. cuspidifera and 131I (in becquerels per gram of 127I) in P. foetida were at least two orders of magnitude greater than in the ambient sea water. That of 63Ni (in becquerels per gram of 62Ni) in S. cuspidifera, on the other hand, was lower by two orders of magnitude than in either abiotic matrices from the same environment. Thus, not only did both the species show bioaccumulation of a specific element, but also preferential uptake of isotopes of the same element, though they were equally available for intake. Such differential uptake of isotopes can possibly be explained in terms of two quite different mechanisms operating, each applicable in a particular case. One is that the xenobiotic isotope enters the environment in a physicochemical form or as a complex different from that of its natural counterpart. If equilibration with the latter is slow, so that the organism acquires the xenobiotic in an unfamiliar chemical context, it may treat it as a chemically distinct entity so that its concentration factor differs from that of stable isotope, thus changing the specific activity. Alternatively, if the xenobiotic is present in the same chemical form as the stable isotope, the only way in which specific

  10. Deformation properties of lead isotopes

    International Nuclear Information System (INIS)

    Tolokonnikov, S. V.; Borzov, I. N.; Lutostansky, Yu. S.; Saperstein, E. E.

    2016-01-01

    The deformation properties of a long lead isotopic chain up to the neutron drip line are analyzed on the basis of the energy density functional (EDF) in the FaNDF 0 Fayans form. The question of whether the ground state of neutron-deficient lead isotopes can have a stable deformation is studied in detail. The prediction of this deformation is contained in the results obtained on the basis of the HFB-17 and HFB-27 Skyrme EDF versions and reported on Internet. The present analysis reveals that this is at odds with experimental data on charge radii and magnetic moments of odd lead isotopes. The Fayans EDF version predicts a spherical ground state for all light lead isotopes, but some of them (for example, 180 Pb and 184 Pb) prove to be very soft—that is, close to the point of a phase transition to a deformed state. Also, the results obtained in our present study are compared with the predictions of some other Skyrme EDF versions, including SKM*, SLy4, SLy6, and UNE1. By and large, their predictions are closer to the results arising upon the application of the Fayans functional. For example, the SLy4 functional predicts, in just the same way as the FaNDF 0 functional, a spherical shape for all nuclei of this region. The remaining three Skyrme EDF versions lead to a deformation of some light lead isotopes, but their number is substantially smaller than that in the case of the HFB-17 and HFB-27 functionals. Moreover, the respective deformation energy is substantially lower, which gives grounds to hope for the restoration of a spherical shape upon going beyond the mean-field approximation, which we use here. Also, the deformation properties of neutron-rich lead isotopes are studied up to the neutron drip line. Here, the results obtained with the FaNDF 0 functional are compared with the predictions of the HFB-17, HFB-27, SKM*, and SLy4 Skyrme EDF versions. All of the EDF versions considered here predict the existence of a region where neutron-rich lead isotopes undergo

  11. The isotopic contamination in electromagnetic isotope separators; La contagion isotopique dans les separateurs electromagnetiques d'isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Cassignol, Ch [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    In the early years of isotope separation, and in particular electromagnetic isotope separation, needs for rapid results have conducted to empiric research. This paper describes fundamental research on the electromagnetic isotope separation to a better understanding of isotope separators as well as improving the performances. Focus has been made on the study of the principle of isotope contamination and the remedial action on the separator to improve the isotope separation ratio. In a first part, the author come back to the functioning of an electromagnetic separator and generalities on isotope contamination. Secondly, it describes the two stages separation method with two dispersive apparatus, an electromagnetic separation stage followed by an electrostatic separation stage, both separated by a diaphragm. The specifications of the electrostatic stage are given and its different settings and their consequences on isotope separation are investigated. In a third part, mechanisms and contamination factors in the isotope separation are discussed: natural isotope contamination, contamination by rebounding on the collector, contamination because of a low resolution, contamination by chromatism and diffusion effect, breakdown of condenser voltage. Analysis of experimental results shows the diffusion as the most important contamination factor in electromagnetic isotope separation. As contamination factors are dependent on geometric parameters, sector angle, radius of curvature in the magnetic field and clearance height are discussed in a fourth part. The better understanding of the mechanism of the different contamination factors and the study of influential parameters as pressure and geometric parameters lead to define a global scheme of isotope contamination and determinate optima separator design and experimental parameters. Finally, the global scheme of isotope contamination and hypothesis on optima specifications and experimental parameters has been checked during a

  12. The isotopic contamination in electromagnetic isotope separators; La contagion isotopique dans les separateurs electromagnetiques d'isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Cassignol, Ch. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1959-07-01

    In the early years of isotope separation, and in particular electromagnetic isotope separation, needs for rapid results have conducted to empiric research. This paper describes fundamental research on the electromagnetic isotope separation to a better understanding of isotope separators as well as improving the performances. Focus has been made on the study of the principle of isotope contamination and the remedial action on the separator to improve the isotope separation ratio. In a first part, the author come back to the functioning of an electromagnetic separator and generalities on isotope contamination. Secondly, it describes the two stages separation method with two dispersive apparatus, an electromagnetic separation stage followed by an electrostatic separation stage, both separated by a diaphragm. The specifications of the electrostatic stage are given and its different settings and their consequences on isotope separation are investigated. In a third part, mechanisms and contamination factors in the isotope separation are discussed: natural isotope contamination, contamination by rebounding on the collector, contamination because of a low resolution, contamination by chromatism and diffusion effect, breakdown of condenser voltage. Analysis of experimental results shows the diffusion as the most important contamination factor in electromagnetic isotope separation. As contamination factors are dependent on geometric parameters, sector angle, radius of curvature in the magnetic field and clearance height are discussed in a fourth part. The better understanding of the mechanism of the different contamination factors and the study of influential parameters as pressure and geometric parameters lead to define a global scheme of isotope contamination and determinate optima separator design and experimental parameters. Finally, the global scheme of isotope contamination and hypothesis on optima specifications and experimental parameters has been checked during a

  13. Method for separating gaseous mixtures of isotopes

    International Nuclear Information System (INIS)

    Neimann, H.J.; Schuster, E.; Kersting, A.

    1976-01-01

    A gaseous mixture of isotopes is separated by laser excitation of the isotope mixture with a narrow band of wavelengths, molecularly exciting mainly the isotope to be separated and thereby promoting its reaction with its chemical partner which is excited in a separate chamber. The excited isotopes and the chemical partner are mixed, perhaps in a reaction chamber to which the two excited components are conducted by very short conduits. The improvement of this method is the physical separation of the isotope mixture and its partner during excitation. The reaction between HCl and the mixture of 238 UF 6 and 235 UF 6 is discussed

  14. Isotopic anomalies - chemical memory of Galactic evolution

    International Nuclear Information System (INIS)

    Clayton, D.D.

    1988-01-01

    New mechanisms for the chemical memory of isotopic anomalies are proposed which are based on the temporal change during the chemical evolution of the Galaxy of the isotopic composition of the mean ejecta from stars. Because of the differing temporal evolution of primary and secondary products of nucleosynthesis, the isotopic composition of the bulk interstellar medium changes approximately linearly with time, and thus any dust component having an age different from that of average dust will be isotopically anomalous. Special attention is given to C, O, Mg, Si, and isotopically heavy average-stellar condensates of SiC. 20 references

  15. Uranium isotope separation using styrene cation exchangers

    International Nuclear Information System (INIS)

    Kahovec, J.

    1980-01-01

    The separation of 235 U and 238 U isotopes is carried out either by simple isotope exchange in the system uranium-cation exchanger (sulphonated styrene divinylbenzene resin), or by combination of isotope exchange in a uranium-cation exchanger (Dowex 50, Amberlite IR-120) system and a chemical reaction. A review is presented of elution agents used, the degree of cation exchanger cross-linking, columns length, and 235 U enrichment. The results are described of the isotope effect study in a U(IV)-U(VI)-cation exchanger system conducted by Japanese and Romanian authors (isotope exchange kinetics, frontal analysis, reverse (indirect) frontal analysis). (H.S.)

  16. Isotopic composition of cosmic ray nuclei

    International Nuclear Information System (INIS)

    Enge, W.

    1976-01-01

    A review will be given on the role of cosmic ray isotopes as tracers of the astrophysical nucleo-synthesis. The products of every nuclear burning chain are first of all isotopes and not elements. Thus, it is the study of the isotopes rather than that of the elements that responds to the questions on these nucleo-synthetic reactions. The problems concerning the solar system isotopic abundances and the cosmic ray isotopic abundances as well as a comparison between both will be presented. Furthermore the present stage of the experimental techniques and the latest results will be discussed. (orig.) [de

  17. 2. Workshop 'Isotopes in Nature'. 1

    International Nuclear Information System (INIS)

    1979-11-01

    The workshop was aimed at discussing in detail the following problems: (1) distribution of stable and radioactive isotopes in nature, (2) theoretical and experimental studies of isotopic effects in natural processes, (3) problems of sample preparation and sample measurement in determining the relative abundance of stable isotopes or radioactive isotopes in nature, (4) age estimations of samples from different areas of the geosphere, (5) contributions to the specification of global and regional substance cycles in nature with the aid of isotopic and geochemical studies. 75 summaries are included

  18. The centenary of the discovery of isotopes

    International Nuclear Information System (INIS)

    Soulie, Edgar

    2013-01-01

    This article recalls works performed by different scientists (Marckwald and Keetman, Stromholm and Svedberg, Soddy, Thompson, Aston) which resulted in the observation and identification of the existence of isotopes. The author also recalls various works related to mechanisms of production of isotopes, the discovery of uranium fission and the principle of chain reaction. The author notably evokes French scientists involved in the development of mass spectroscopy and in the research and applications on isotopes within the CEA after the Second World War. A bibliography of article and books published by one of them, Etienne Roth, is provided. References deal with nuclear applications of chemical engineering (heavy water and its production, chemical processes in fission reactors, tritium extraction and enrichment), isotopic fractioning and physical-chemical processes, mass spectrometry and isotopic analysis, isotopic geochemistry (on 07;Earth, search for deuterium in moon rocks and their consequences), first dating and the Oklo phenomenon, radioactive dating, water and climate (isotopic hydrology, isotopes and hailstone formation, the atmosphere), and miscellaneous scientific fields (nuclear measurements and radioactivity, isotopic abundances and atomic weight, isotopic separation and use of steady isotopes)

  19. Mass fractionation processes of transition metal isotopes

    Science.gov (United States)

    Zhu, X. K.; Guo, Y.; Williams, R. J. P.; O'Nions, R. K.; Matthews, A.; Belshaw, N. S.; Canters, G. W.; de Waal, E. C.; Weser, U.; Burgess, B. K.; Salvato, B.

    2002-06-01

    Recent advances in mass spectrometry make it possible to utilise isotope variations of transition metals to address some important issues in solar system and biological sciences. Realisation of the potential offered by these new isotope systems however requires an adequate understanding of the factors controlling their isotope fractionation. Here we show the results of a broadly based study on copper and iron isotope fractionation during various inorganic and biological processes. These results demonstrate that: (1) naturally occurring inorganic processes can fractionate Fe isotope to a detectable level even at temperature ˜1000°C, which challenges the previous view that Fe isotope variations in natural system are unique biosignatures; (2) multiple-step equilibrium processes at low temperatures may cause large mass fractionation of transition metal isotopes even when the fractionation per single step is small; (3) oxidation-reduction is an importation controlling factor of isotope fractionation of transition metal elements with multiple valences, which opens a wide range of applications of these new isotope systems, ranging from metal-silicate fractionation in the solar system to uptake pathways of these elements in biological systems; (4) organisms incorporate lighter isotopes of transition metals preferentially, and transition metal isotope fractionation occurs stepwise along their pathways within biological systems during their uptake.

  20. Isotope hydrology of catchment basins: lithogenic and cosmogenic isotopic systems

    Energy Technology Data Exchange (ETDEWEB)

    Nimz, G. J., LLNL

    1998-06-01

    A variety of physical processes affect solute concentrations within catchment waters. The isotopic compositions of the solutes can indicate which processes have determined the observed concentrations. These processes together constitute the physical history of the water. Many solutes in natural waters are derived from the interaction between the water and the rock and/or soil within the system - these are termed `lithogenic` solutes. The isotopic compositions of these solutes provide information regarding rock-water interactions. Many other solutes have their isotopic compositions determined both within and outside of the catchment - i.e., in addition to being derived from catchment rock and soil, they are solutes that are also transported into the catchment. Important members of this group include solutes that have isotopic compositions produced by atomic particle interactions with other nuclides. The source of the atomic particles can be cosmic radiation (producing `cosmogenic` nuclides in the atmosphere and land surface), anthropogenic nuclear reactions (producing `thermonuclear` nuclides), or radioactive and fission decay of naturally-occurring elements, principally {sup 238}U (producing `in-situ` lithogenic nuclides in the deep subsurface). Current language usage often combines all of the atomic particle-produced nuclides under the heading `cosmogenic nuclides`, and for simplicity we will often follow that usage here, although always indicating which variety is being discussed. This paper addresses the processes that affect the lithogenic and cosmogenic solute concentrations in catchment waters, and how the isotopic compositions of the solutes can be used in integrative ways to identify these processes, thereby revealing the physical history of the water within a catchment system. The concept of a `system` is important in catchment hydrology. A catchment is the smallest landscape unit that can both participate in all of the aspects of the hydrologic cycle and

  1. Isotopic contamination in electromagnetic isotope separators; La contagion isotopique dans les separateurs electromagnetiques d'isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Cassignol, C [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    The mechanisms producing isotopic contamination in the electromagnetic separation of isotopes are studied with the aid of the Separator of Saclay and an electrostatic analyzer in cascade. After a separate investigation the result of which is that no contamination comes from the spreading of initial energies of ions, two principal mechanisms are emphasized; scattering and instability of the regime of the sources. The characters of each type of contamination arising from both mechanisms are described in some detail. An unique scheme of isotopic contamination is then derived from the partial ones. This scheme is successfully verified in several experimental separations. The applications concern principally the performances of magnetic cascades and more complex apparatus. It is found that the isotopic purities that such machines can deliver are extremely high. (author) [French] On a etudie, a l'aide du separateur de Saclay et d'un analyseur electrostatique en cascade, les mecanismes par lesquels est produite la contamination isotopique dans la separation electromagnetique des isotopes. A la suite d'une deuxieme etude, qui a mene a la conclusion que la contamination ne provient pas d'une dispersion des energies initiales des ions, on propose deux mecanismes comme etant les plus importants; la diffusion et l'instabilite du regime des sources. On decrit en quelques details la nature de la contamination provenant de deux types de mecanisme. On deduit de ces deux mecanismes un seul schema qui a ete ensuite verifie par plusieurs separations experimentales. Les applications interessent surtout les performances des cascades magnetiques et les appareillages plus complexes. On trouve que les puretes isotopiques que peuvent fournir de tels appareils sont tres elevees. (auteur)

  2. Methane clumped isotopes: Progress and potential for a new isotopic tracer

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, Peter M. J.; Stolper, Daniel A.; Eiler, John M.; Sessions, Alex L.; Lawson, Michael; Shuai, Yanhua; Bishop, Andrew; Podlaha, Olaf G.; Ferreira, Alexandre A.; Santos Neto, Eugenio V.; Niemann, Martin; Steen, Arne S.; Huang, Ling; Chimiak, Laura; Valentine, David L.; Fiebig, Jens; Luhmann, Andrew J.; Seyfried, William E.; Etiope, Giuseppe; Schoell, Martin; Inskeep, William P.; Moran, James J.; Kitchen, Nami

    2017-11-01

    The isotopic composition of methane is of longstanding geochemical interest, with important implications for understanding hydrocarbon systems, atmospheric greenhouse gas concentrations, the global carbon cycle, and life in extreme environments. Recent analytical developments focusing on multiply substituted isotopologues (‘clumped isotopes’) are opening a potentially valuable new window into methane geochemistry. When methane forms in internal isotopic equilibrium, clumped isotopes can provide a direct record of formation temperature, making this property particularly valuable for identifying different methane origins. However, it has also become clear that in certain settings methane clumped isotope measurements record kinetic rather than equilibrium isotope effects. Here we present a substantially expanded dataset of methane clumped isotope analyses, and provide a synthesis of the current interpretive framework for this parameter. We review different processes affecting methane clumped isotope compositions, describe the relationships between conventional isotope and clumped isotope data, and summarize the types of information that this measurement can provide in different Earth and planetary environments.

  3. Natural fractionation of uranium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Noordmann, Janine

    2015-01-24

    The topic of this thesis was the investigation of U (n({sup 238}U) / n({sup 235}U)) isotope variations in nature with a focus on samples (1) that represent the continental crust and its weathering products (i.e. granites, shales and river water) (2) that represent products of hydrothermal alteration on mid-ocean ridges (i.e. altered basalts, carbonate veins and hydrothermal water) and (3) from restricted euxinic basins (i.e. from the water column and respective sediments). The overall goal was to explore the environmental conditions and unravel the mechanisms that fractionate the two most abundant U isotopes, n({sup 238}U) and n({sup 235}U), on Earth.

  4. Commercialization of DOE isotope production

    International Nuclear Information System (INIS)

    Laflin, S.

    1997-01-01

    This paper describes the business structure and operations of MAC Isotopes (MACI) L.L.C., a newly created business resulting from the commercialization of a former U.S. Department of Energy (DOE) mission at the Idaho National Engineering and Environmental Laboratory (INEEL). MACI began its commercial operations on October 1, 1996, and is the first U.S. commercial isotope production business to result from the commercialization of DOE facilities or programs. The commercialization was the culmination of an -2-yr competitive procurement process by the DOE and Lockheed Martin Idaho Technologies Company (LMITCO). MACI was selected from this competitive process as the commercial business of choice on the basis of providing the best value to the DOE/LMITCO and having the greatest potential for commercial success

  5. Nuclides and isotopes. Twelfth edition

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    This explanatory booklet was designed to be used with the Chart of the Nuclides. It contains a brief history of the atomic theory of matter: ancient speculations, periodic properties of elements (Mendeleev table), radioactivity, early models of atomic structure, the Bohr atom, quantum numbers, nature of isotopes, artificial radioactivity, and neutron fission. Information on the pre-Fermi (natural) nuclear reactor at Oklo and the search for superheavy elements is given. The booklet also discusses information presented on the Chart and its coding: stable nuclides, metastable states, data display and color, isotopic abundances, neutron cross sections, spins and parities, fission yields, half-life variability, radioisotope power and production data, radioactive decay chains, and elements without names. The Periodic Table of the Elements is appended. 3 figures, 3 tables

  6. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    1991-01-01

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue give U-Pb zircon ages for rocks in Newfoundland, Yukon Territory, Manitoba, Ontario, and the Northwest Territories; present a compilation of K-Ar ages; and discuss Precambrian activity in New Brunswick, the geochronology of rock from the Northwest Territories, and reconnaissance Nd studies of rocks from the Northwest Territories. (figs., tabs., refs.)

  7. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    1992-01-01

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Report 5 contains 24 papers from most regions of Canada, but particularly from British Columbia. The Geochronology Laboratory has, over the years, provided substantial U-Pb dating for the Cordilleran Division of the Geological Survey of Canada in Vancouver, and the results of a number of these studies are presented this year. A compilation of K-Ar ages is given. (figs., tabs., refs.)

  8. Isotope hydrology in Latin America

    Energy Technology Data Exchange (ETDEWEB)

    Payne, B R [International Atomic Energy Agency, Division of Research and Laboratories, Isotope Hydrology Section, Vienna (Austria)

    1972-07-01

    A wide variety of problems in hydrology have proved susceptible to the use of nuclear techniques. Conclusions may be drawn from the relative abundances of certain 'environmental isotopes', such as heavy stable isotopes of hydrogen and oxygen in water molecules, tritium, carbon-14 and silicon-32, in atmospheric, surface or ground water; origin and rate of flow, for example, may be deduced. Artificial radioisotopes may be used similarly as a logical extension to well-known tracer techniques using dyes and salts. Inherent in the use of such radiotracers are the advantages of very high detection sensitivity (and thus very low required concentrations and the elimination of density effects), and a choice of a variety of nuclides alien to the geohydrological system (and hence unique identification and low background). (author)

  9. Strange Isotope Ratios in Jupiter

    Science.gov (United States)

    Manuel, O.; Ragland, D.; Windler, K.; Zirbel, J.; Johannes, L.; Nolte, A.

    1998-05-01

    At the January AAS meeting, Dr. Daniel Goldin ordered the release of isotopic data from the 1995 Galileo probe into Jupiter. This probe took mass readings for mass numbers 2-150, which includes all of the noble gas isotopes. A certain few noble gas isotopes, specifically those at mass/charge = 21, 40, 78, 124, and 126, are difficult to distinguish from background, while interference causes some variation in signals for noble gas isotopes at mass/charge = 20, 22, 36, 38, 40, 80, 82, 83, 84 and 86. Some contamination was caused by incomplete adsorption of low mass hydrocarbons by Carbosieve, the material used in the concentration cells [Space Sci. Rev. 60, 120 (1992)]. Thus, preliminary results are most reliable in the high mass region that includes xenon. The Galileo Probe provided the first direct measurements from a planet with a chemical composition drastically different from Earth. Our preliminary analyses indicate that Jupiter contains Xe-X [Nature 240, 99 (1972)], which differs significantly from Earth's xenon. Xe-X and primordial He are tightly coupled on the microscopic scale of meteorite minerals [Science 195, 208 (1977); Meteoritics 15, 117 (1980)]. The presence today of Xe-X in the He-rich atmosphere of Jupiter suggests that the primordial linkage of Xe-X with He extended across the protosolar nebula, on a planetary scale [Comments Astrophys. 18, 335 (1997)]. Contamination by hydrocarbons and other gases does not necessarily remove light noble gases from further consideration. Currently, isolation of signals of these elements from interference continues and may result in the presentation of many other interesting observations at the conference.

  10. Titanium isotopic anomalies in meteorites

    International Nuclear Information System (INIS)

    Niemeyer, S.; Lugmair, G.W.

    1984-01-01

    High-precision analyses of Ti are reported for samples from a variety of meteorite classes. The expanded data base for Allende inclusions still shows Ti isotope anomalies in every inclusion. All the coarse-grained inclusions give quite similar patterns, but fine-grained inclusions show more variable, and sometimes larger, anomalies. One inclusion, 3675A, was analyzed because others identified it as a possible 'FUN' inclusion due to its mass-fractionated Mg. This designation is supported by the significantly more complex Ti isotopic pattern for 3675A compared to all our other Allende inclusions. Available data fail to suggest that any particular Allende mineral phase, including a chromite-carbon fraction from an acid residue, is especially rich in anomalous Ti. We also find anomalous Ti in a bulk sample of a C1 chondrite and in matrix separates from C2 chondrites. The excesses of 50 Ti are smaller than for Allende inclusions, and subtle differences in Ti isotopic patterns tentatively suggest that parent materials for C1-C2 matrix and Allende inclusions are not directly related. Analyses of chondrules from unequilibrated ordinary chondrites did not yield clear evidence for anomalous Ti, but some 'larger than usual' deficits at 50/46 give encouragement for future work in this direction. (author)

  11. Isotope exchange process and device

    International Nuclear Information System (INIS)

    Delvalle, Pierre.

    1974-01-01

    A process for enriching uranium in one of its isotopes is described. To do so, cascade isotopic exchanges are made by contact between U(III) and U(IV) in conditions avoiding the oxidation of U(III) in U(IV). A liquid phase containing an uranium compound and free of other group III to VIII metals of the periodic classification, in which uranium is present at a first valence is placed in contact with a second valence uranium compound, protected from any contact with a conducting solid and with an agent bringing free or release oxygen. The second phase is organic. The process includes a counter current isotopic exchange between an aqueous phase containing a U +4 salting-out agent and the uranium as U +3 ions and an organic phase containing the uranium at valence IV. This is followed by the extraction of U(IV) from the organic phase into the previously spent aqueous phase and the reduction of uranium from valence IV to valence III; finally by oxidation of U(III) of the aqueous phase into U(IV) and the transfer of U(IV) into the previously exhausted organic phase [fr

  12. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    Parrish, R.R.

    1990-01-01

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue cover methods for Rb-Sr and Sm-Nd isotopic analyses; 40 Ar- 39 Ar ages for the New Quebec Crater and for basaltic rocks; U-Pb ages for a differentiated mafic sill in the Ogilvie Mountains, plutonic rocks in the Contwoyto-Nose Lakes are, zircons from the Anton Complex, the Clinton-Colden gabbro-anorthosite intrusion, the Himag plutonic suite, the Campbell granite, the Central Gneiss Belt, Silurian granites, a metarhyolite, plagiogranite and gabbro, and the Wage shear zone; Rb-Sr ages for granitic rocks; K-Ar and Rb-Sr geochronology of granites; a compilation of K-Ar ages; ages of archean and proterozoic mylonites and pre-Misi granitoid domes; and reconnaissance geochronology of Baffin Island

  13. Neodymium isotopic variations in seawater

    International Nuclear Information System (INIS)

    Piepgras, D.J.; Wasserburg, G.J.

    1980-01-01

    New data for the direct measurement of the isotopic composition of neodymium in Atlantic Ocean seawater are compared with previous measurements of Pacific Ocean seawater and ferromanganese sediments from major ocean basins. Data for Atlantic seawater are in excellent agreement with Nd isotopic measurements made on Atlantic ferromanganese sediments and are distinctly different from the observed compositions of Pacific samples. These results clearly demonstrate the existence of distinctive differences in the isotopic composition of Nd in the waters of the major ocean basins and are characteristic of the ocean basin sampled. The average epsilonsub(N)sub(d)(0) values for the major oceans as determined by data from seawater and ferromanganese sediments are as follows: Atlantic Ocean, epsilonsub(N)sub(d)(0) approx. equal to - 12 +- 2; Indian Ocean, epsilonsub(N)sub(d)(0) approx. equal to - 8 +- 2; Pacific Ocean, epsilonsub(N)sub(d)(0) approx. equal to -3 +- 2. These values are considerably less than epsilonsub(N)sub(d)(0) value sources with oceanic mantle affinities indicating that the REE in the oceans are dominated by continental sources. The difference in the absolute abundance of 143 Nd between the Pacific and Atlantic Oceans corresponds to approx. 10 6 atoms 143 Nd per gram of seawater. The correspondence between the 143 Nd/ 144 Nd in seawater and in the associated sediments suggests the possible application of this approach to paleo-oceanography. (orig./HAE)

  14. A novel methodology to investigate isotopic biosignatures

    Science.gov (United States)

    Horner, T. J.; Lee, R. B. Y.; Henderson, G. M.; Rickaby, R. E. M.

    2012-04-01

    An enduring goal of trace metal isotopic studies of Earth History is to find isotopic 'fingerprints' of life or of life's individual physiochemical processes. Generally, such signatures are sought by relating an isotopic effect observed in controlled laboratory conditions or a well-characterized environment to a more complex system or the geological record. However, such an approach is ultimately limited because life exerts numerous isotopic fractionations on any one element so it is hard to dissect the resultant net fractionation into its individual components. Further, different organisms, often with the same apparent cellular function, can express different isotopic fractionation factors. We have used a novel method to investigate the isotopic fractionation associated with a single physiological process-enzyme specific isotopic fractionation. We selected Cd isotopes since only one biological use of Cd is known, CdCA (a Cd/Zn carbonic anhydrase from the coastal diatom T. Weissflogii). Thus, our investigation can also inform the long standing mystery as to why this generally toxic element appears to have a nutrient-like dissolved isotopic and concentration profile in the oceans. We used the pET-15b plasmid to insert the CdCA gene into the E. coli genome. There is no known biochemical function for Cd in E. coli, making it an ideal vector for studying distinct physiological processes within a single organism. The uptake of Cd and associated isotopic fractionation was determined for both normal cells and those expressing CdCA. It was found that whole cells always exhibited a preference for the light isotopes of Cd, regardless of the expression of CdCA; adsorption of Cd to cell surfaces was not seen to cause isotopic fractionation. However, the cleaning procedure employed exerted a strong control on the observed isotopic composition of cells. Using existing protein purification techniques, we measured the Cd isotopic composition of different subcellular fractions of E

  15. Deformation properties of lead isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tolokonnikov, S. V.; Borzov, I. N.; Lutostansky, Yu. S.; Saperstein, E. E., E-mail: saper43-7@mail.ru [National Research Center Kurchatov Institute (Russian Federation)

    2016-01-15

    The deformation properties of a long lead isotopic chain up to the neutron drip line are analyzed on the basis of the energy density functional (EDF) in the FaNDF{sup 0} Fayans form. The question of whether the ground state of neutron-deficient lead isotopes can have a stable deformation is studied in detail. The prediction of this deformation is contained in the results obtained on the basis of the HFB-17 and HFB-27 Skyrme EDF versions and reported on Internet. The present analysis reveals that this is at odds with experimental data on charge radii and magnetic moments of odd lead isotopes. The Fayans EDF version predicts a spherical ground state for all light lead isotopes, but some of them (for example, {sup 180}Pb and {sup 184}Pb) prove to be very soft—that is, close to the point of a phase transition to a deformed state. Also, the results obtained in our present study are compared with the predictions of some other Skyrme EDF versions, including SKM*, SLy4, SLy6, and UNE1. By and large, their predictions are closer to the results arising upon the application of the Fayans functional. For example, the SLy4 functional predicts, in just the same way as the FaNDF{sup 0} functional, a spherical shape for all nuclei of this region. The remaining three Skyrme EDF versions lead to a deformation of some light lead isotopes, but their number is substantially smaller than that in the case of the HFB-17 and HFB-27 functionals. Moreover, the respective deformation energy is substantially lower, which gives grounds to hope for the restoration of a spherical shape upon going beyond the mean-field approximation, which we use here. Also, the deformation properties of neutron-rich lead isotopes are studied up to the neutron drip line. Here, the results obtained with the FaNDF{sup 0} functional are compared with the predictions of the HFB-17, HFB-27, SKM*, and SLy4 Skyrme EDF versions. All of the EDF versions considered here predict the existence of a region where neutron

  16. Isotope analysis of closely adjacent minerals

    International Nuclear Information System (INIS)

    Smith, M.P.

    1990-01-01

    This patent describes a method of determining an indicator of at least one of hydrocarbon formation, migration, and accumulation during mineral development. It comprises: searching for a class of minerals in a mineral specimen comprising more than one class of minerals; identifying in the mineral specimen a target sample of the thus searched for class; directing thermally pyrolyzing laser beam radiation onto surface mineral substance of the target sample in the mineral specimen releasing surface mineral substance pyrolysate gases therefrom; and determining isotope composition essentially of the surface mineral substance from analyzing the pyrolysate gases released from the thus pyrolyzed target sample, the isotope composition including isotope(s) selected from the group consisting of carbon, hydrogen, and oxygen isotopes; determining an indicator of at least one of hydrocarbon formation, migration, and accumulation during mineral development of the target mineral from thus determined isotope composition of surface mineral substance pyrolysate

  17. Isotope exchange in oxide-containing catalyst

    Science.gov (United States)

    Brown, Kenneth G. (Inventor); Upchurch, Billy T. (Inventor); Hess, Robert V. (Inventor); Miller, Irvin M. (Inventor); Schryer, David R. (Inventor); Sidney, Barry D. (Inventor); Wood, George M. (Inventor); Hoyt, Ronald F. (Inventor)

    1989-01-01

    A method of exchanging rare-isotope oxygen for common-isotope oxygen in the top several layers of an oxide-containing catalyst is disclosed. A sample of an oxide-containing catalyst is exposed to a flowing stream of reducing gas in an inert carrier gas at a temperature suitable for the removal of the reactive common-isotope oxygen atoms from the surface layer or layers of the catalyst without damaging the catalyst structure. The reduction temperature must be higher than any at which the catalyst will subsequently operate. Sufficient reducing gas is used to allow removal of all the reactive common-isotope oxygen atoms in the top several layers of the catalyst. The catalyst is then reoxidized with the desired rare-isotope oxygen in sufficient quantity to replace all of the common-isotope oxygen that was removed.

  18. Stable Oxygen-18 and Deuterium Isotopes

    DEFF Research Database (Denmark)

    Müller, Sascha

    The application of stable Oxygen-18 (18O) and Deuterium (2H) isotopes, as a tracer for fluxes between different compartments of the water cycle was subject of the present PhD-thesis. During a three year period, temporal data from a wide range of water cycle constituents was collected from...... the Skjern River catchment, Denmark. The presented applications focused on studying the isotopic 'input signal' to the hydrosphere in the form of precipitation, the isotopic 'output signal' with its related dynamic processes at a coastal saltwater-freshwater interface (groundwater isotopes) and the temporal...... development within a given lowland headwater catchment (stream water isotopes). Based on our investigations on the precipitation isotopic composition a local meteoric water line (LMWL) was constructed and expressed as: δ2H=7.4 δ18O + 5.36‰. Moreover, we showed that under maritime temperature climate influence...

  19. Sulphur isotope variations in the atmosphere

    International Nuclear Information System (INIS)

    Newman, L.; Krouse, H.R.; Grinenko, V.A.

    1991-01-01

    The measurement of the isotope ratios of sulphur and oxygen can in principal be used to assess sulphur inputs into, transformation within, and removal from the atmosphere. Major inputs arise from both anthropogenic and biogenic activities. Transformations arise from oxidation, neutralization, and other chemical reactions. Advection causes dilution and the main removal processes are dry deposition (governed by gravitation and diffusion) and rain. The admixture of sources can be discerned from their isotopic signatures whereas transformations and removal can be followed from the isotopic fractionation that might occur. In this chapter, the atmospheric sulphur cycle and the associated chemistry are summarized. Also presented is information on natural isotopic variations and fundamental concepts relating to the use of isotopic data to delineate anthropogenic S in the atmosphere. Examples of successful applications of these concepts are given. Finally, consideration is given to the potential of using isotopically enriched sulphur to study transport and transformation of atmospheric S compounds. Refs, figs and tabs

  20. Laser photochemical separation of hydrogen isotopes

    International Nuclear Information System (INIS)

    Fowler, M.C.

    1979-01-01

    A method of separating isotopes of hydrogen utilizing isotopically selective photodissociation of organic acid is disclosed. Specifically acetic or formic acid containing compounds of deuterated nd hydrogenated acid is irradiated by radiation having a wavelength in the infrared spectrum between 9.2 to 10.8 microns to produce deuterium hydroxide and deuterium hydride respectively. Maintaining the acid at an elevated temperature significantly improves the yield of isotope separation

  1. Atomic masses of rare-earth isotopes

    International Nuclear Information System (INIS)

    Schmidt-Ott, W.D.; Kantus, R.; Runte, E.

    1981-01-01

    A survey is given of decay energies of rare-earth isotopes measured in electron-capture decay by relative Psub(K) ratios, ECsub(K)/β + , and EC/β + ratios. Atomic masses of A = 147 isotopes and of 146 Gd and 148 Dy were derived. The masses of these isotopes and of α-decaying precessors are compared with predictions of current mass formulae. The subshell closure at Z = 64 is shown for N = 82, and 84 isotones. (orig.)

  2. Normalization of oxygen and hydrogen isotope data

    Science.gov (United States)

    Coplen, T.B.

    1988-01-01

    To resolve confusion due to expression of isotopic data from different laboratories on non-corresponding scales, oxygen isotope analyses of all substances can be expressed relative to VSMOW or VPDB (Vienna Peedee belemnite) on scales normalized such that the ??18O of SLAP is -55.5% relative to VSMOW. H3+ contribution in hydrogen isotope ratio analysis can be easily determined using two gaseous reference samples that differ greatly in deuterium content. ?? 1988.

  3. Method for isotope separation by photodeflection

    International Nuclear Information System (INIS)

    Bernhardt, A.F.

    1977-01-01

    In the method of separating isotopes wherein a desired isotope species is selectively deflected out of a beam of mixed isotopes by irradiating the beam with a directed beam of light of narrowly defined frequency which is selectively absorbed by the desired species, the improvement comprising irradiating the deflected beam with light from other light sources whose frequencies are selected to cause the depopulation of any metastable excited states

  4. Isotope hydrology: A historical overview of achievements

    International Nuclear Information System (INIS)

    1997-01-01

    The IAEA's efforts in the water sector cover all aspects of the three main categories of isotope methodologies, such as the use of radioactive isotopes as tracers for site-specific investigations related to water movement; the use of sealed radioactive sources for in-situ measurement of hydrological field parameters; and the use of naturally occurring isotopic species for the assessment and study of water occurrence, genesis and flow pathways/dynamics at regional-scale hydrological systems

  5. Isotope separation by ionic cyclotron resonance

    International Nuclear Information System (INIS)

    Compant La Fontaine, A.; Gil, C.; Louvet, P.

    1986-10-01

    The principle of the process of isotopic separation by ionic cyclotron resonance is explained succinctly. The theoretical calculation of the isotopic effect is given as functions of the electric and magnetic fields in the frame of single particle approximation and of plasma collective theory. Then, the main parts of the demonstration device which is in operation at the CEA, are described here: the supraconducting magnetic field, the used diagnostics, the principle of the source and the collecting apparatus. Some experimental results are given for chromium. The application of the process to ponderal separation of metal isotopes, as chromium, nickel and molybdenum is discussed in view of production of medical, structural and irradiation isotopes

  6. Treatment and storage of hydrogen isotopes

    International Nuclear Information System (INIS)

    Jung, H. S.; Lee, H. S.; An, D. H.; Kim, K. R.; Lee, S. H.; Choi, H. J.; Back, S. W.; Kang, H. S.; Eom, K. Y.; Lee, M. S.

    2000-01-01

    Storage of gaseous hydrogen isotopes in a cylinder is a well-established technology. However, Immobilization in the solid form is preferred for long-term storage of radioactive isotope gas because of the concern for leakage of the gas. The experimental thermodynamic p-c-T data show that Ti and U soak up hydrogen isotope gas at a temperature of a few hundred .deg. C and modest pressures. It was found that more hydrogen is dissolved in the metal than deuterium at constant pressure. Thus, the lighter isotope tends to be enriched in the solid phase

  7. Copper isotope fractionation by desert shrubs

    International Nuclear Information System (INIS)

    Navarrete, Jesica U.; Viveros, Marian; Ellzey, Joanne T.; Borrok, David M.

    2011-01-01

    Copper has two naturally occurring stable isotopes of masses 63 and 65 which can undergo mass dependent fractionation during various biotic and abiotic chemical reactions. These interactions and their resulting Cu isotope fractionations can be used to determine the mechanisms involved in the cycling of Cu in natural systems. In this study, Cu isotope changes were investigated at the organismal level in the metal-accumulating desert plant, Prosopis pubescens. Initial results suggest that the lighter Cu isotope was preferentially incorporated into the leaves of the plant, which may suggest that Cu was actively transported via intracellular proteins. The roots and stems show a smaller degree of Cu isotope fractionation and the direction and magnitude of the fractionations was dependent upon the levels of Cu exposure. Based on this and previous work with bacteria and yeast, a trend is emerging that suggests the lighter Cu isotope is preferentially incorporated into biological components, while the heavier Cu isotope tends to become enriched in aqueous solutions. In bacteria, plants and animals, intracellular Cu concentrations are strictly regulated via dozens of enzymes that can bind, transport, and store Cu. Many of these enzymes reduce Cu(II) to Cu(I). These initial results seem to fit into a broader picture of Cu isotope cycling in natural systems where oxidation/reduction reactions are fundamental in controlling the distributions of Cu isotopes.

  8. Stable Isotope Group 1984 progress report

    International Nuclear Information System (INIS)

    Lyon, G.L.

    1985-04-01

    The work of the group in 1984 is described and includes studies in isotope geology, isotope hydrology, geochronology, isotope biology and mass spectrometer instrumentation. Geothermal studies have decreased compared to other years, but major data summaries were made for Wairakei and Ngawha. The hydrology of Whakarewarewa and Rotorua is being elucidated using water isotopes. Models of the subsurface flows at Kawerau and Ngawha are being made to relate fluid to mineral isotope compositions. A study of the δ 13 C and δ 34 S compositions of New Zealand oils has been started. Groups of oils of related origin are being defined, and compositions will be compared with those of potential source rocks. A method was developed for isotope analysis of sulphur in rocks. The isotopic composition of water is being used to identify and characterise groundwater aquifers in the Wairarapa and at Poverty Bay. Stable carbon isotopes have been used to identify food sources for invertebrates, and to show biochemical pathways in lactation by cows. The geochronology group is involved in major studies in Antarctica, using U-Pb, Rb-Sr and K-Ar methods. Rocks from North Victoria Land, Marie Byrd Land and the USARP mountains are being compared with possible correlatives in New Zealand and Argentina. Strontium isotope data is being applied to the origin of magmas in several regions of New Zealand. The K-Ar data is being stored on computer files. Fission track measurements are being applied to unravel uplift histories in Westland and Taranaki

  9. Sulfur and selenium isotope separation by distillation

    International Nuclear Information System (INIS)

    Mills, T. R.; McInteer, B. B.; Montoya, J. G.

    1988-01-01

    Sulfur and selenium isotopes are used for labeled compounds and as precursors for radioisotope production; however, both limited availability and high costs are problems. A new method is needed for large-scale separation of these isotopes. Experimental distillation columns were used to measure isotopic separations for sulfur and selenium compounds. The maximum total isotope separation of 32 S vs. 34 S were 1.127 for H 2 S, 1.048 for COS, 0.838 for SF 4 , and 1.058 for CH 3 SH. Relative volatilities of 32 S vs. 34 S are 1.0006 for COS and 0.9976 for SF 4 . There is a reverse isotope effect for carbon in COS. No isotopic separation was observed for dimethyl selenide. The lower mass selenium isotopes in H 2 Se are more volatile. Distillation is a promising method for separating sulfur isotopes on a production scale. Existing distillation technology produced separated isotopes with an effect similar to that found for sulfur in SF 4 . 8 refs., 2 tabs

  10. Sulfur and selenium isotope separation by distillation

    International Nuclear Information System (INIS)

    Mills, T.R.; McInteer, B.B.; Montoya, J.G.

    1989-01-01

    Sulfur and selenium isotopes are used for labeled compounds and as precursors for radioisotope production; however, both limited availability and high costs are problems. A new method is needed for large-scale separation of theses isotopes. Experimental distillation columns were used to measure isotopic separations for sulfur and selenium compounds. The maximum total isotope separations of 32 S vs. 34 S were 1.127 for H 2 S, 1.048 for COS, 0.838 for SF 4 , and 1.058 for CH 3 SH. Relative volatilities of 32 S and 34 S are 1.0006 for COS and 0.9976 for SF 4 . There is a reverse isotope effect for carbon in COS. No isotopic separation was observed for dimethyl selenide. The lower mass selenium isotopes in H 2 Se are more volatile. Distillation is a promising method for separating sulfur isotopes on a production scale. Existing distillation technology produces separated isotopes with an effect similar to that found for sulfur in SF 4 . (author). 8 refs.; 2 tabs

  11. On models in the geochemistry of isotopes

    International Nuclear Information System (INIS)

    Wetzel, K.

    1978-01-01

    Models are playing an increasing role in the deepening of our understanding of the laws of occurrence of stable and radioactive isotopes in nature. The properties of concrete global and regional models of the geochemistry of isotopes are derived from a general model characterizing the cycling of chemical elements and their isotopes in nature. The importance of global models as well as the relationships between global and regional models are considered. The introduction of a parameter describing the velocity of both mass and isotope transfer, taking into consideration the global resources, renders possible the linkage of global models with regional ones. (author)

  12. Lead isotope analyses of standard rock samples

    International Nuclear Information System (INIS)

    Koide, Yoshiyuki; Nakamura, Eizo

    1990-01-01

    New results on lead isotope compositions of standard rock samples and their analytical procedures are reported. Bromide form anion exchange chromatography technique was adopted for the chemical separation lead from rock samples. The lead contamination during whole analytical procedure was low enough to determine lead isotope composition of common natural rocks. Silica-gel activator method was applied for emission of lead ions in the mass spectrometer. Using the data reduction of 'unfractionated ratios', we obtained good reproducibility, precision and accuracy on lead isotope compositions of NBS SRM. Here we present new reliable lead isotope compositions of GSJ standard rock samples and USGS standard rock, BCR-1. (author)

  13. Equilibrium deuterium isotope effect of surprising magnitude

    International Nuclear Information System (INIS)

    Goldstein, M.J.; Pressman, E.J.

    1981-01-01

    Seemingly large deuterium isotope effects are reported for the preference of deuterium for the α-chloro site to the bridgehead or to the vinyl site in samples of anti-7-chlorobicyclo[4.3.2]undecatetraene-d 1 . Studies of molecular models did not provide a basis for these large equilibrium deuterium isotope effects. The possibility is proposed that these isotope effects only appear to be large for want of comparison with isotope effects measured for molecules that might provide even greater contrasts in local force fields

  14. Development of stable isotope manufacturing in Russia

    International Nuclear Information System (INIS)

    Pokidychev, A.; Pokidycheva, M.

    1999-01-01

    For the past 25 years, Russia has relied heavily on the electromagnetic separation process for the production of middle and heavy mass stable isotopes. The separation of most light isotopes had been centered in Georgia which, after the collapse of the USSR, left Russia without this capability. In the mid-1970s, development of centrifuge technology for the separation of stable isotopes was begun. Alternative techniques such as laser separation, physical-chemical methods, and ion cyclotron resonance have also been investigated. Economic considerations have played a major role in the development and current status of the stable isotope enrichment capabilities of Russia

  15. Trees, astronomy, ruins and isotopes

    International Nuclear Information System (INIS)

    Thwaites, R.N.

    1985-01-01

    The history of dendrochronology is traced from the discovery of the method to prove astronomic sun-spot cycles to its use in archaeology for dating purposes. The principles and problems of both dendrochronology and radiocarbon 14 C dating are described and the subsequent relationship of the two sciences in aiding the calibration of absolute dating methods using carbon isotopes is explained. The development of graphic calibration, which introduces a seemingly erratic curve, is discussed as regards its validity for accurate dating up to 50 000 years B.P. Whilst dendrochronology continues in other spheres as a science in its own right, the polemics surrounding valid radiocarbon calibration remain

  16. Isotopic diagnosis of peripheral thrombosis

    International Nuclear Information System (INIS)

    Cornu, Pierre; Scalet, Michel

    1975-01-01

    Radio-isotope diagnosis of peripheral venous thrombosis, using tracer doses of iodine-labelled fibrinogen, provides an important contribution to the solution of the worrying problem of pulmonary embolism due to latent phlebitis. This elegant and precise technique permits early diagnosis of venous thrombosis of the lower limbs at a subclinical stage. It has permitted determination of the frequency, both after surgery and after myocardial infarction, and above all, it provides an objective criterion for assessment of the efficacy of prophylactic measures proposed [fr

  17. Isotope hydrology in Latin America

    International Nuclear Information System (INIS)

    Payne, B.R.

    1976-01-01

    There are a broad range of nuclear techniques applicable to a variety of hydrological problems and these techniques are becoming recognized as an additional and, in some cases, indispensable tool available to the hydrologist in his quest to meet the increasing demands for water by agriculture, industry and community water supply. In Latin America we find examples of almost all the nuclear hydrological techniques. This article endeavours to give a summary account of the status of isotope hydrology in the region and the types of problems to which these techniques have been applied

  18. Reproducibility of isotope ratio measurements

    International Nuclear Information System (INIS)

    Elmore, D.

    1981-01-01

    The use of an accelerator as part of a mass spectrometer has improved the sensitivity for measuring low levels of long-lived radionuclides by several orders of magnitude. However, the complexity of a large tandem accelerator and beam transport system has made it difficult to match the precision of low energy mass spectrometry. Although uncertainties for accelerator measured isotope ratios as low as 1% have been obtained under favorable conditions, most errors quoted in the literature for natural samples are in the 5 to 20% range. These errors are dominated by statistics and generally the reproducibility is unknown since the samples are only measured once

  19. Organic synthesis with stable isotopes

    International Nuclear Information System (INIS)

    Daub, G.H.; Kerr, V.N.; Williams, D.L.; Whaley, T.W.

    1978-01-01

    Some general considerations concerning organic synthesis with stable isotopes are presented. Illustrative examples are described and discussed. The examples include DL-2-amino-3-methyl- 13 C-butanoic-3,4- 13 C 2 acid (DL-valine- 13 C 3 ); methyl oleate-1- 13 C; thymine-2,6- 13 C 2 ; 2-aminoethanesulfonic- 13 C acid (taurine- 13 C); D-glucose-6- 13 C; DL-2-amino-3-methylpentanoic-3,4- 13 C 2 acid (DL-isoleucine- 13 C 2 ); benzidine- 15 N 2 ; and 4-ethylsulfonyl-1-naphthalene-sulfonamide- 15 N

  20. Nuclear data for unstable isotopes

    International Nuclear Information System (INIS)

    Sorlin, O.

    1992-01-01

    Nuclear Physics and Astrophysics are both entrusted with the task of understanding nucleosynthesis and energy production in the stars. At high temperatures and densities present in explosive scenarii such as the early universe, cataclysmic binary stars (nova or accretion stars), and supernovae, the nucleosynthesis proceeds throughout unstable nuclei. In order to produce and to study the most exotic isotopes that are not accessible from stable beam - stable (or radioactive) target experiments, it is necessary to develop facilities that utilize Radioactive Nuclear Beams (RNB). The existing methods for producing unstable nuclei will be described in paragraph 2. A review of the major explosive stellar processes will be made through some selected examples using RNB

  1. Self diffusion in isotopic fluid

    International Nuclear Information System (INIS)

    Tankeshwar, K.

    1991-01-01

    Expressions for the second and fourth frequency sum rules of the velocity auto-correlation function have been obtained for an isotopic fluid. These expressions and Mori memory function formalism have been used to study the influence of the particle mass and mole fraction on the self diffusion coefficient. Our results confirm the weak mass dependence of the self diffusion. The influence of the mole fraction of the light particles on the self diffusion constant has been found to increase for the larger particle mass. (author). 17 refs, 1 fig., 2 tabs

  2. Exploring the isotopic niche: isotopic variance, physiological incorporation, and the temporal dynamics of foraging

    Directory of Open Access Journals (Sweden)

    Justin Douglas Yeakel

    2016-01-01

    Full Text Available Consumer foraging behaviors are dynamic, changing in response to prey availability, seasonality, competition, and even the consumer's physiological state. The isotopic composition of a consumer is a product of these factors as well as the isotopic `landscape' of its prey, i.e. the isotopic mixing space. Stable isotope mixing models are used to back-calculate the most likely proportional contribution of a set of prey to a consumer's diet based on their respective isotopic distributions, however they are disconnected from ecological process. Here we build a mechanistic framework that links the ecological and physiological processes of an individual consumer to the isotopic distribution that describes its diet, and ultimately to the isotopic composition of its own tissues, defined as its `isotopic niche’. By coupling these processes, we systematically investigate under what conditions the isotopic niche of a consumer changes as a function of both the geometric properties of its mixing space and foraging strategies that may be static or dynamic over time. Results of our derivations reveal general insight into the conditions impacting isotopic niche width as a function of consumer specialization on prey, as well as the consumer's ability to transition between diets over time. We show analytically that moderate specialization on isotopically unique prey can serve to maximize a consumer's isotopic niche width, while temporally dynamic diets will tend to result in peak isotopic variance during dietary transitions. We demonstrate the relevance of our theoretical findings by examining a marine system composed of nine invertebrate species commonly consumed by sea otters. In general, our analytical framework highlights the complex interplay of mixing space geometry and consumer dietary behavior in driving expansion and contraction of the isotopic niche. Because this approach is established on ecological mechanism, it is well-suited for enhancing the

  3. Radiogenic isotope geochemistry of sedimentary and aquatic systems

    International Nuclear Information System (INIS)

    Stille, P.; Shields, G.

    1997-01-01

    The following topics are discussed: Basic principles of isotopic geochemistry; weathering; isotopic geochemistry of river water; isotopic geochemistry in the environment; isotopic composition of seawater past and present (Sr, Nd, Pb, Os, Ce); isotope geochemistry of detrital and authigenic clay minerals in marine sediemnts (Rb-Sr, K-Ar, O); the Sm-N isotope system in detrital and authigenic argillaceous sediments. (SR), provided they are of exceptional interest and focused on a single topic. (orig./SR)

  4. Radiogenic isotope geochemistry of sedimentary and aquatic systems

    Energy Technology Data Exchange (ETDEWEB)

    Stille, P.; Shields, G. [Centre National de la Recherche Scientifique (CNRS), 67 - Strasbourg (France). Centre de Sedimentologie et Geochimie de la Surface

    1997-12-31

    The following topics are discussed: Basic principles of isotopic geochemistry; weathering; isotopic geochemistry of river water; isotopic geochemistry in the environment; isotopic composition of seawater past and present (Sr, Nd, Pb, Os, Ce); isotope geochemistry of detrital and authigenic clay minerals in marine sediemnts (Rb-Sr, K-Ar, O); the Sm-N isotope system in detrital and authigenic argillaceous sediments. (SR), provided they are of exceptional interest and focused on a single topic. (orig./SR)

  5. Isotope separations using chromatographic methods

    International Nuclear Information System (INIS)

    Leseticky, L.

    1985-01-01

    A survey is given of chromatographic separations of compounds only differing in isotope composition. Isotope effects on physical properties which allow chromatographic separation (vapour tension, adsorption heat, partition coefficient) are very small, with the exception of the simplest molecules. Therefore, separation factors only assume the value of several per cent. From this ensues the necessity of using columns which are specially and very carefully prepared and have a separation efficiency of the order of 10 4 theoretical plates. Briefly discussed is liquid chromatography on ion exchangers which with a varied degree of success was used for separating simple inorganic compounds or ions. Ion exchange chromatography of amino acids labelled with tritium, and chromatography of tritium labelled steroids also provided only a certain degree of separation. A detailed analysis is presented of gas chromatography separation of various deuterium and tritium labelled low-molecular compounds, to which a number of studies has been devoted in the literature. Very promising is the method of complexation gas chromatography based on the reversible formation of a complex of the ligand (the compound being separated) and the compound of the (transition) metal as the steady-state phase. (author)

  6. Isotope separation by rotating plasmas

    International Nuclear Information System (INIS)

    Nicoli, C.

    1982-02-01

    A steady-state model of a fully ionized plasma column in a concentric cylindrical electrodes structures is proposed to study the plasma separation properties of its singly ionized ionic species, composed of two isotopes of the element. In this model (a one-fluid model) rotation is imparted to the plasma column through the J (vector) x B (vector) interaction. Radial pressure balance is mainly between the radial component of the J (vector) x B (vector) force and the pressure gradient plus centrifugal force and the azimutal component of the J (vector) x B (vector) force is balanced purely by viscous force. A pressure tensor 31 describes the viscoys effect and the heat balance provides an equation for temperature. A uranium gas with is two main isotopes (U 235 and U 238 ) was used for the ionic component of the plasma. The computing code to solve the resulting, system of equations in tems of density, temperature, and velocity as functions of the radial independent variable was set up to yield solutions satisfying null velocity conditions on both boundaries (inner and outer electrodes). (M.A.F.) [pt

  7. Isotopic scintigraphy in kidney grafting

    International Nuclear Information System (INIS)

    Renfro, Richard.

    1976-01-01

    Isotopic explorations of kidney transplants were performed on sixty-six patients. Three scintigraphic techniques were used: labelled ferrous ascorbate scintigraphy, sequential 99m technetium DTPA scintigraphy and the 131 I hippuran nephrogram. The aim of this study is to analyse the results obtained under different pathological circumstances affecting the transplant, to discuss the advantages of the techniques and to propose a working procedure. The most reliable and accurate technique is the 131 I hippuran nephrogram combined with sequential 99mTc DTPA, by which renal vascularisation may be judged labelled ferrous ascorbate on the other hand is too insensitive. Although the information supplied is mostly contained in the scintigraphic images, the nephrographic curves and the blood radioactivity decay time and rad V/rad R ratio measurements are very helpful in the early diagnosis and differential diagnosis of complications affecting the transplant. The proper use of isotopic scintigraphy in kidney grafting should provide optimum conditions for better survival of the transplant at minimum risk to the patient [fr

  8. Isotopic variations in primitive meteorites

    International Nuclear Information System (INIS)

    Clayton, R.N.; Chicago Univ., IL; Chicago Univ., IL

    1981-01-01

    The presence of large internal 16 O variability in ordinary chondrites greatly extends the range of meteorite types in which this phenomenon has been observed. These results may lead to identification of major gas and dust reservoirs in the cloud from which the Solar System formed. The demonstration that live 107 Pd was present in the differentiated parent bodies of some iron meteorites supports the million year time scale between a major nucleosynthetic event and Solar System formation, as implied by the presence of live 26 Al in carbonaceous chondrites. However, the variability of radiogenic 26 Mg abundances in these meteorites makes it clear that the data cannot be interpreted simply in terms of time variations. Models of nucleosynthesis for elements from calcium to the iron peak should be aided by the new observations of abundances of titanium isotopes. Progress has been made in establishing the carrier phases of isotopically anomalous xenon and krypton. The apparent location of anomalous xenon and 14 N-rich nitrogen in identical carriers supports the notion that nucleosynthetic anomalies in nitrogen are also present in Allende. (author)

  9. Isotope scanning for tumor localization

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1961-09-15

    At the request of the Government of the United Arab Republic, the Agency provided the services of an expert for the establishment in the UAR of a tumor localization program using photoscanning techniques and appropriate radioactive tracers. Photoscanning is a recently developed technique whereby the differences in isotope concentrations are enhanced on the record, and this facilitates the interpretation of the record. A variety of brain tumors were located, using a suitable radioactive tracer (Hg-203 - labelled Neohydrin) obtained from the USA. In some other investigations, processes in the kidney were scanned. Further, radioactive gold was used to demonstrate the normal and pathological spleen and liver and these tests showed various types of space occupying lesions resulting from malignancy and the parasitic infections endemic to the area. While the localization of brain tumors by scanning techniques is extremely useful, it does not always establish the precise extent of the tumor which should be known at the time of surgery. Dr. Bender, therefore, thought it advisable to instruct personnel in the use of what is known as an in-vivo needle scintillation probe - a technique for the investigation of the isotope concentration in a particular tissue during operation. The necessary instrument was obtained for this purpose and demonstrations were given; one patient was examined in this way at the time of surgery at the University of Alexandria Hospital.

  10. Ion detectors for isotopic measurements

    Energy Technology Data Exchange (ETDEWEB)

    McCormick, A.

    1978-12-15

    Detector development over the past two decades has been such that this is now the least likely part of the mass spectrometry equipment to give rise to the sort of measurement errors to cause concern. It is now possible to choose from a number of different types of device which can provide more or less 100% efficiency in ion beam detection under all conceivable experimental conditions required for isotopic analysis, from measurement of large samples using the traditional Faraday cage to measurement of exceedingly small ion currents by ion counting techniques. There are even methods of distinguishing one type of ionic species from another in the detector, thus improving the accuracy when unwanted isobaric species might otherwise grossly distort the measurement. Notable contributions to detector development for nuclear measurements have been made by Dietz at the Knolls Atomic Power Laboratory, by Barnett at Oak Ridge and by Daly at Atomic Weapons Research Establishment (AWRE), Aldermaston. This paper describes the detection methods which are currently in use at AWRE for isotopic analysis of solid samples for routine applications as well as non-routine applications. Other methods are merely mentioned as a stimulus for discussion.

  11. Kinetic equation of heterogeneous catalytic isotope exchange

    Energy Technology Data Exchange (ETDEWEB)

    Trokhimets, A I [AN Belorusskoj SSR, Minsk. Inst. Fiziko-Organicheskoj Khimii

    1979-12-01

    A kinetic equation is derived for the bimolecular isotope exchange reaction between AXsub(n)sup(*) and BXsub(m)sup(o), all atoms of element X in each molecule being equivalent. The equation can be generalized for homogeneous and heterogeneous catalytic isotope exchange.

  12. Status and prospects of isotope separation industry

    International Nuclear Information System (INIS)

    Safutin, V.D.; Verbin, Yu.V.; Tolstoj, V.V.

    2000-01-01

    The stages of the separation industry in the USSR and Russia are demonstrated. The current status of the separation industry and state of the equipment of the isotope separation plants are noted. The developed program for the modernization of the uranium isotope separation involves the production of perspective gas centrifuges, the improvements in the works of gas centrifuge plants and construction materials [ru

  13. Using isotopes for global warming observation

    International Nuclear Information System (INIS)

    Namata, K.

    2002-01-01

    This paper, based on a literature review, discusses the main aspects of using isotopic techniques to obtain information about global warming. The rapid increase concentration of carbon dioxide (CO 2 ) and methane (CH 4 ) in the atmosphere will result in global warming by the greenhouse effect, and the isotopic techniques constitute an efficient tool to explain this complex environmental phenomenon. (author)

  14. Environmental isotopes investigation in groundwater of Challaghatta ...

    African Journals Online (AJOL)

    Administrator

    Radiogenic isotopes (3H and 14C) and stable isotope (18O) together with TDS, EC and salinity of water were used to ..... Tritium (3H). Relative dating of groundwater has been carried ... that falls to Earth has small amounts of tritium. During the.

  15. The isotopic dipole moment of HDO

    Energy Technology Data Exchange (ETDEWEB)

    Assafrao, Denise; Mohallem, Jose R [Laboratorio de Atomos e Moleculas Especiais, Departamento de Fisica, ICEx, Universidade Federal de Minas Gerais, CP 702, 30123-970, Belo Horizonte, MG (Brazil)

    2007-03-14

    An adiabatic variational approximation is used to study the monodeuterated water molecule, HDO, accounting for the isotopic effect. The isotopic dipole moment, pointing from D to H, is then calculated for the first time, yielding (1.5 {+-} 0.1) x 10{sup -3} Debye, being helpful in the interpretation of experiments. (fast track communication)

  16. Atomic lithium vapor laser isotope separation

    CERN Document Server

    Olivares, I E

    2002-01-01

    An atomic vapor laser isotope separation in lithium was performed using tunable diode lasers. The method permits also the separation of the isotopes between the sup 6 LiD sub 2 and the sup 7 LiD sub 1 lines using a self-made mass separator which includes a magnetic sector and an ion beam designed for lithium. (Author)

  17. Atomic lithium vapor laser isotope separation

    International Nuclear Information System (INIS)

    Olivares, I.E.; Rojas, C.

    2002-01-01

    An atomic vapor laser isotope separation in lithium was performed using tunable diode lasers. The method permits also the separation of the isotopes between the 6 LiD 2 and the 7 LiD 1 lines using a self-made mass separator which includes a magnetic sector and an ion beam designed for lithium. (Author)

  18. Applications of stable isotopes in clinical pharmacology

    NARCIS (Netherlands)

    Schellekens, Reinout C A; Stellaard, Frans; Woerdenbag, Herman J; Frijlink, Henderik W; Kosterink, Jos G W

    2011-01-01

    This review aims to present an overview of the application of stable isotope technology in clinical pharmacology. Three main categories of stable isotope technology can be distinguished in clinical pharmacology. Firstly, it is applied in the assessment of drug pharmacology to determine the

  19. Isotope and chemical tracers in groundwater hydrology

    International Nuclear Information System (INIS)

    Kendall, C.; Stewart, M.K.; Morgenstern, U.; Trompetter, V.

    1999-01-01

    The course sessions cover: session 1, Fundamentals of stable and radioactive isotopes; session 2, Stable oxygen and hydrogen isotopes in hydrology: background, examples, sampling strategy; session 3, Catchment studies using oxygen and hydrogen isotopes: background - the hydrologic water balance, evapotranspiration - the lion's share, runoff generation - new water/old water fractions, groundwater recharge - the crumbs; session 4, Isotopes in catchment hydrology: survey of applications, future developments; session 5, Applications of tritium in hydrology: background and measurement, interpretation, examples; session 6, Case studies using mixing models: Hutt Valley groundwater system, an extended mixing model for simulating tracer transport in the unsaturated zone; session 7, Groundwater dating using CFC concentrations: background, sampling and measurement, use and applications; session 8, Groundwater dating with carbon-14: background, sampling and measurement, use and applications; session 9, NZ case studies: Tauranga warm springs, North Canterbury Plains groundwater; session 10, Stable carbon and nitrogen isotopes: background and examples, biological applications of C-N-S isotopes; session 11, New developments in isotope hydrology: gas isotopes, compound specific applications, age dating of sediments etc; session 12, NZ case studies: North Canterbury Plains groundwater (continued), Waimea Plains groundwater. (author). refs., figs

  20. Absolute isotopic abundances of Ti in meteorites

    International Nuclear Information System (INIS)

    Niederer, F.R.; Papanastassiou, D.A.; Wasserburg, G.J.

    1985-01-01

    The absolute isotope abundance of Ti has been determined in Ca-Al-rich inclusions from the Allende and Leoville meteorites and in samples of whole meteorites. The absolute Ti isotope abundances differ by a significant mass dependent isotope fractionation transformation from the previously reported abundances, which were normalized for fractionation using 46 Ti/ 48 Ti. Therefore, the absolute compositions define distinct nucleosynthetic components from those previously identified or reflect the existence of significant mass dependent isotope fractionation in nature. We provide a general formalism for determining the possible isotope compositions of the exotic Ti from the measured composition, for different values of isotope fractionation in nature and for different mixing ratios of the exotic and normal components. The absolute Ti and Ca isotopic compositions still support the correlation of 50 Ti and 48 Ca effects in the FUN inclusions and imply contributions from neutron-rich equilibrium or quasi-equilibrium nucleosynthesis. The present identification of endemic effects at 46 Ti, for the absolute composition, implies a shortfall of an explosive-oxygen component or reflects significant isotope fractionation. Additional nucleosynthetic components are required by 47 Ti and 49 Ti effects. Components are also defined in which 48 Ti is enhanced. Results are given and discussed. (author)

  1. Isotope separation by selective photodissociation of glyoxal

    International Nuclear Information System (INIS)

    Marling, J.B.

    1976-01-01

    Dissociation products, mainly formaldehyde and carbon monoxide, enriched in a desired isotope of carbon, oxygen, or hydrogen are obtained by the selective photodissociation of glyoxal wherein glyoxal is subjected to electromagnetic radiation in a predetermined wavelength such that photon absorption excites and induces dissociation of only those molecules of glyoxal containing the desired isotope

  2. Method and apparatus for separating uranium isotopes

    International Nuclear Information System (INIS)

    Bernstein, E.R.

    1977-01-01

    A uranium compound in the solid phase (uranium borohydride four) is subjected to radiation of a first predetermined frequency that excites the uranium-235 isotope-bearing molecules but not the uranium-238 isotope-bearing molecules. The compound is simultaneously subjected to radiation of a second predetermined frequency which causes the excited uranium-235 isotope-bearing molecules to chemically decompose but which does not affect the uranium-238 isotope-bearing molecules. Sufficient heat is then applied to the irradiated compound in the solid phase to vaporize the non-decomposed uranium-238 isotope-bearing molecules but not the decomposed uranium-235 isotope-bearing molecules, thereby physically separating the uranium-235 isotope-bearing molecules from the uranium-238 isotope-bearing molecules. The uranium compound sample in the solid phase is deposited or grown in an elongated tube supported within a dewar vessel having a clear optical path tail section surrounded by a coolant. Two sources of radiation are focused on the uranium compound sample. A heating element is attached to the elongated tube to vaporize the irradiated compound

  3. Application of isotopes in traditional Chinese medicine

    International Nuclear Information System (INIS)

    Ye Ling; Liu Ning; Yang Yuanyou; Mo Shangwu

    2006-01-01

    Modernization of traditional Chinese medicine necessitates many new or advanced methods. Among these methods, isotopes are considered to be a convenient, fast and feasible method. The recent advance of isotope's application to traditional Chinese medicine is reviewed. In addition, their present status, problems and prospect are discussed. (authors)

  4. Gas phase thermal diffusion of stable isotopes

    International Nuclear Information System (INIS)

    Eck, C.F.

    1979-01-01

    The separation of stable isotopes at Mound Facility is reviewed from a historical perspective. The historical development of thermal diffusion from a laboratory process to a separation facility that handles all the noble gases is described. In addition, elementary thermal diffusion theory and elementary cascade theory are presented along with a brief review of the uses of stable isotopes

  5. isotopic characteristics of aquifers in sinai

    International Nuclear Information System (INIS)

    Al-Gamal, S.A.

    2004-01-01

    the environmental isotopes data (expressed as δ 2 d and δ 18 O) of different aquifers in sinai were treated using correlation and regression techniques. whereas, rain water isotopic data were treated using empirical orthogonal functions (EOF) techniques. environmental isotopes for different aquifers expressed in terms of O-18 and H-2, were taken to represent the isotopic characteristics. regression equations using the highly correlated variables of δ 2 d and δ 18 O were constructed for each aquifer. the latitudinal variations (of rainwater in sinai and selected climatic stations east mediterranean ) versus rainwater isotopic compositions were analyzed using the normalized variables. it was found that the latitudinal variations of the rainwater isotopic compositions ( δ 2 D, δ 18 O), vapor pressure, and surface temperature occurred in parallel and decreased with latitude. in the east mediterranean, empirical linear relationship between altitude and δ 2 D has indicted that the rate of change of δ 2 D with height is comparable with the dry lapse rate in the atmosphere.The obtained regression equations of environmental isotopes data have impacted on different slopes and different constants expressing the non-homogeneity in the isotopic composition of rainwater recharging the aquifers of sinai , due to the presence of different air masses

  6. Gas isotope separation method using plasma sheet

    International Nuclear Information System (INIS)

    Takayama, K.; Takagi, K.; Fukvi, R.

    1988-03-01

    A high frequency electric field is applied to a plasma sheet with a frequency equal to the cyclotronic frequency of the ions to be separated. Because of resonance the cyclotronic radius of the isotope has increased and the electric charge is eliminated by collision with a separator and the isotope is separated in neutral particles [fr

  7. Safeguards implications of laser isotope separation

    International Nuclear Information System (INIS)

    Moriarty, T.F.; Taylor, K.

    1993-10-01

    The purpose of this report is to describe and emphasise the safeguards and relevant features of atomic vapour laser isotope separation (AVLIS) and molecular laser isotope separation (MLIS), and to consider the issues that must be addressed before a safeguards approach at a commercial AVLIS or MLIS facility can be implemented. (Author)

  8. Isotope hydrology. Raigon aquifer hydrochemistry - Uruguay

    International Nuclear Information System (INIS)

    Plata Bedmar, A.; Dellepere, A.; Roma, M.T; Ramirez, M.; Garat, S.; Padros, D.; Caristo, R.; Lavanca, R.; Aranda, E.; Michelis, G.; Monroi, F.; Luaces, A.

    2001-01-01

    The purpose of this study is the Raigon Acuifer investigation by isotopic techniques as well as the dynamic behavior in the water resources. These techniques are based on the natural water isotope deuterium, oxygen-18, tritium and carbon-14 measurement. The hydrochemistry is used like a complementary tool

  9. Evaluating lead isotope data: further observations

    International Nuclear Information System (INIS)

    Budd, P.; Gale, D.; Pollard, A.M.; Thomas, R.G.; Williams, P.A.

    1993-01-01

    In this paper analytical data, relating to the lead isotope composition of mineral deposits in the Taurus mountain region of Turkey, is evaluated. The importance of lead isotope studies to the evidence as to the origin of prehistoric metal artefacts is discussed. (UK)

  10. Calculation of isotope selective excitation of uranium isotopes using spectral simulation method

    International Nuclear Information System (INIS)

    Al-Hassanieh, O.

    2009-06-01

    Isotope ratio enhancement factor and isotope selectivity of 235 U in five excitation schemes (I: 0→10069 cm - 1 →IP, II: 0 →10081 cm - 1 →IP, III: 0 →25349 cm - 1→ IP, IV: 0→28650 cm - 1 →IP, V: 0→16900 cm - 1 →34659 cm - 1 →IP), were computed by a spectral simulation approach. The effect of laser bandwidth and Doppler width on the isotope ratio enhancement factor and isotope selectivity of 235 U has been studied. The photoionization scheme V gives the highest isotope ratio enhancement factor. The main factors which effect the separation possibility are the isotope shift and the relative intensity of the transitions between hyperfine levels. The isotope ratio enhancement factor decreases exponentially by increasing the Doppler width and the laser bandwidth, where the effect of Doppler width is much greater than the effect of the laser bandwidth. (author)

  11. Second international conference on isotopes. Conference proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Hardy, C J [ed.

    1997-10-01

    The Second International Conference on Isotopes (2ICI) was hosted by the Australian Nuclear Association in Sydney, NSW, Australia. The Theme of the Second Conference: Isotopes for Industry, Health and a Better Environment recognizes that isotopes have been used in these fields successfully for many years and offer prospects for increasing use in the future. The worldwide interest in the use of research reactors and accelerators and in applications of stable and radioactive isotopes, isotopic techniques and radiation in industry, agriculture, medicine, environmental studies and research in general, was considered. Other radiation issues including radiation protection and safety were also addressed. International and national overviews and subject reviews invited from leading experts were included to introduce the program of technical sessions. The invited papers were supported by contributions accepted from participants for oral and poster presentation. A Technical Exhibition was held in association with the Conference. This volume contains the full text or extended abstracts of papers number 61- to number 114

  12. Isotope separation using vibrationally excited molecules

    International Nuclear Information System (INIS)

    Woodroffe, J.A.; Keck, J.C.

    1977-01-01

    A system for isotope separation or enrichment wherein molecules of a selected isotope type in a flow of molecules of plural isotope types are vibrationally excited and collided with a background gas to provide enhanced diffusivity for the molecules of the selected isotope type permitting their separate collection. The system typically is for the enrichment of uranium using a uranium hexafluoride gas in combination with a noble gas such as argon. The uranium hexafluoride molecules having a specific isotope of uranium are vibrationally excited by laser radiation. The vibrational energy is converted to a translation energy upon collision with a particle of the background gas and the added translation energy enhances the diffusivity of the selected hexafluoride molecules facilitating its condensation on collection surfaces provided for that purpose. This process is periodically interrupted and the cryogenic flow halted to permit evaporation of the collected molecules to provide a distinct, enriched flow

  13. Isotopes in hydrology of ground water

    International Nuclear Information System (INIS)

    Rodriguez, N.; C, O.

    1996-01-01

    Fundamental concepts on Radioactivity, Isotopes, Radioisotopes, Law of Nuclear Decay (Middle Life concept), Radioactivity units, Types of radiation, Absorption and dispersion of both Alfa and Beta particles and both gamma and X-rays attenuation are presented. A description on Environmental Isotopes (those that are presented in natural form in the environment and those that can't be controlled by the humans), both stables and unstable (radioisotopes) isotopes is made. Isotope hydrology applications in surface water investigations as: Stream flow measurements and Atmosphere - surface waters interrelationship is described. With relation to the groundwater investigations, different applications of the isotope hydrology, its theoretical base and its methodology are presented to each one of the substrates as: Unsaturated zone (soil cape), Saturated zone (aquifer cape), Surface waters - ground waters interrelationship (infiltration and recharge) and to hydrologic balance

  14. Isotope shift studies in gadolinium spectra

    International Nuclear Information System (INIS)

    Ahmad, S.A.; Saksena, G.D.; Venugopalan, A.

    1976-01-01

    Isotope shift studies have been carried out in the gadolinium spectrum using a recording Fabry-Perot spectrometer and gadolinium samples enriched in 156 Gd and 160 Gd isotopes. Isotope shifts Δsigma(156-160) have been recorded in 134 lines in the region 3930-4140 A. Some of these lines involve the recently identified even configuration 4f 8 5d6s of Gd I and the newly classified transition 4f 8 6s-4f 8 6p of Gd II. From the isotope shift measurements of lines involving the 4f 8 6s-4f 8 6p transition in Gd II, the isotope shift, ΔT(156-160)=87 mK, has been obtained for the 4f 8 6s configuration. Electronic configurations have been suggested for a number of energy levels and configuration mixing has been pointed out in certain cases. (Auth.)

  15. Rare Isotopes Physics in the Multimessenger Era

    Science.gov (United States)

    Schatz, Hendrik

    2018-06-01

    While these isotopes only exist for fractions of seconds, their properties shape the resulting cosmic distribution of elements and the astronomical observables including spectra, neutrinos, and gravitational waves. The long standing challenge in nuclear astrophysics of the production of the relevant isotopes in the laboratory is now overcome with a new generation of rare isotope accelerator facilities now coming online. One example is the FRIB facility under construction at Michigan State University for the US Department of Energy, Office of Science, Office of Nuclear Physics. These new capabilities in nuclear physics coincide with advances in astronomy directly related to the cosmic sites where these isotopes are created, in particular in time domain and gravitational wave astronomy. I will discuss the importance of rare isotope physics in interpreting multi-messenger observations and how advances in nuclear physics and astronomy when combined promise to lead us towards a comprehensive theory of the origin of the elements.

  16. Isotopic ratios in the solar system

    International Nuclear Information System (INIS)

    1985-01-01

    This colloquium is aimed at presentation of isotope ratio measurements in different objects of solar system and surrounding interstellar space and evaluation of what information on composition and structure of primitive solar nebula and on chemical evolution of interstellar space in this part of the galaxy can be deduced from it. Isotope ratio in solar system got from laboratory study of extraterrestrial materials is a subject of this colloquium. Then isotope ratio measured in solar wind, planets and comets. Measurements either are made in-situ by mass spectrometry of ions in solar wind or planetery atmosphere gases either are remote measurements of spectra emitted by giant planets and comets. At last, planetology and astrophysics implications are presented and reviewed. Consraints for solar system formation model can be deduced from isotope ratio measurement. Particularly, isotope anomalies are marks of the processes, which have influenced the primitive solar nebula contraction [fr

  17. Study of the isotopic contamination with the Grenoble isotope separator

    International Nuclear Information System (INIS)

    Boge, Marc

    1970-01-01

    To know the limits of enrichment of the Grenoble electromagnetic isotope separator, we have studied the scattering of ions on the residual gas, and the chromatism. With Neodymium (Nd + ≅ 500 μA, NdO + ≅ 120 μA, Nd 2+ ≅ 70 μA) the second magnet has been used to analyse the ions which passed through the first stage slit. Therefore, we have measured the scattering with and without charge exchange of Nd + and the dissociation of NdO + . The chromatism has been studied by means of an electrostatic analyser, as a third stage. The limits of enrichment are obtained for Argon, Uranium and Neodymium. (author) [fr

  18. Isotopic evolution of Mauna Loa volcano

    International Nuclear Information System (INIS)

    Kurz, M.D.; Kammer, D.P.

    1991-01-01

    In an effort to understand the temporal helium isotopic variations in Mauna Loa volcano, we have measured helium, strontium and lead isotopes in a suite of Mauna Loa lavas that span most of the subaerial eruptive history of the volcano. The lavas range in age from historical flows to Ninole basalt which are thought to be several hundred thousand years old. Most of the samples younger than 30 ka in age (Kau Basalt) are radiocarbon-dated flows, while the samples older than 30 ka are stratigraphically controlled (Kahuku and Ninole Basalt). The data reveal a striking change in the geochemistry of the lavas approximately 10 ka before present. The lavas older than 10 ka are characterized by high 3 He/ 4 He (≅ 16-20 times atmospheric), higher 206 Pb/ 204 Pb (≅ 18.2), and lower 87 Sr/ 86 Sr(≅ 0.70365) ratios than the younger Kau samples (having He, Pb and Sr ratios of approximately 8.5 x atmospheric, 18.1 and 0.70390, respectively). The historical lavas are distinct in having intermediate Sr and Pb isotopic compositions with 3 He/ 4 He ratios similar to the other young Kau basalt (≅ 8.5 x atmospheric). The isotopic variations are on a shorter time scale (100 to 10,000 years) than has previously been observed for Hawaiian volcanoes, and demonstrate the importance of geochronology and stratigraphy to geochemical studies. The data show consistency between all three isotope systems, which suggests that the variations are not related to magma chamber degassing processes, and that helium is not decoupled from the other isotopes. However, the complex temporal evolution suggests that three distinct mantle sources are required to explain the isotopic data. Most of the Mauna Loa isotopic variations could be explained by mixing between a plume type source, similar to Loihi, and an asthenospheric source with helium isotopic composition close to MORB and elevated Sr isotopic values. (orig./WL)

  19. Oxygen isotopic fractionation during bacterial sulfate reduction

    Science.gov (United States)

    Balci, N.; Turchyn, A. V.; Lyons, T.; Bruchert, V.; Schrag, D. P.; Wall, J.

    2006-12-01

    Sulfur isotope fractionation during bacterial sulfate reduction (BSR) is understood to depend on a variety of environmental parameters, such as sulfate concentration, temperature, cell specific sulfate reduction rates, and the carbon substrate. What controls oxygen isotope fractionation during BSR is less well understood. Some studies have suggested that carbon substrate is important, whereas others concluded that there is a stoichiometric relationship between the fractionations of sulfur and oxygen during BSR. Studies of oxygen fractionation are complicated by isotopic equilibration between sulfur intermediates, particularly sulfite, and water. This process can modify the isotopic composition of the extracellular sulfate pool (δ18OSO4 ). Given this, the challenge is to distinguish between this isotopic equilibration and fractionations linked to the kinetic effects of the intercellular enzymes and the incorporation of sulfate into the bacterial cell. The δ18OSO4 , in concert with the sulfur isotope composition of sulfate (δ34SSO4), could be a powerful tool for understanding the pathways and environmental controls of BSR in natural systems. We will present δ18OSO4 data measured from batch culture growth of 14 different species of sulfate reducing bacteria for which sulfur isotope data were previously published. A general observation is that δ18OSO4 shows little isotopic change (kinetic effect during BSR and/or equilibration between sulfur intermediates and the isotopically light water (~-5‰) of the growth medium. Our present batch culture data do not allow us to convincingly isolate the magnitude and the controlling parameters of the kinetic isotope effect for oxygen. However, ongoing growth of mutant bacteria missing enzymes critical in the different steps of BSR may assist in this mission.

  20. Isotope-committee reports 1999

    International Nuclear Information System (INIS)

    Alvarez, M.; McCarthy, G.

    2000-12-01

    In this compilation the use of radioactive substances in therapies and in vivo examinations during 1999 is presented. For each examination the nuclide, chemical form, way of administration, number of hospitals, total number of examinations, mean activity used, interval of mean activity for the different hospitals and maximum activity is presented. Some examinations may be found at several different places. This is due to diverse routines of reporting and the confused use of old and new classifications. A certain caution is recommended when interpreting the data. Of the compilation it becomes known that during 1999 approximately 109,000 examinations and 2900 therapies were performed. The isotope committees at two hospitals have not presented their statistics

  1. Medical isotope applications in Iceland

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1962-10-15

    About $ 12 000 worth of equipment and the services of an expert in the medical applications of radioisotopes were provided by IAEA to the Government of Iceland. The expert was primarily concerned with the establishment of a medical radioisotope laboratory at the State Hospital, Reykjavik. His specific tasks included the setting up of the equipment furnished by IAEA for radioactive measurements in medical work, the establishment of techniques for the routine uses of radioisotopes in medicine, and the training of personnel. The apparatus installed includes a well-type scintillation counter for small samples, a directional scintillation counter, and Geiger counters of different types. The laboratory is thus well equipped for nearly all the conventional applications of radioisotopes in medicine, except those involving very soft beta-ray emitting isotopes

  2. Transactinium isotope nuclear data - 1984

    International Nuclear Information System (INIS)

    Lorenz, A.

    1984-11-01

    Transactinium isotopes (Z>89) are important in the nuclear fuel cycle of both thermal and fast reactors, and have found increasing areas of applications in science and industry. The document contains the reports of the three working groups of the meeting, on the following: The status of experimental data; The status of evaluated data files; The status and needs for nuclear decay data of Transactinium nuclei. In all three reports both general and specific recommendations are given. Most important achievements, most pressing needs and the remaining data discrepancies are reviewed. The status of the knowledge of the decay data is presented in a table. A list of the review papers presented and of the contributed papers is also given

  3. A Canadian isotope success story

    International Nuclear Information System (INIS)

    Malkoske, G.

    1997-01-01

    This paper provides some historical background on the commercial production of radioisotopes in Canada, and the evolution of the present vendor, MDS Nordion. The chief isotopes are molybdenum 99, iodine 131, and cobalt 60. Cobalt 60 for medical sterilization and irradiation is considered to be a significant growing market. Food irradiation is believed to be a big marketing opportunity, although attempts to popularize it have so far met with limited success. Candu reactors supply the bulk of the world's 60 Co supply. Eighty percent of the world's 99 Mo supply for medical imaging comes from Canada, and is at present produced in NRU Reactor, which is to be replaced by two Maple reactors coming into production in 1999 and 2000

  4. Atomic vapor laser isotope separation

    International Nuclear Information System (INIS)

    Stern, R.C.; Paisner, J.A.

    1985-01-01

    Atomic vapor laser isotope separation (AVLIS) is a general and powerful technique. A major present application to the enrichment of uranium for light-water power reactor fuel has been under development for over 10 years. In June 1985 the Department of Energy announced the selection of AVLIS as the technology to meet the nation's future need for the internationally competitive production of uranium separative work. The economic basis for this decision is considered, with an indicated of the constraints placed on the process figures of merit and the process laser system. We then trace an atom through a generic AVLIS separator and give examples of the physical steps encountered, the models used to describe the process physics, the fundamental parameters involved, and the role of diagnostic laser measurements

  5. Periodicity of the stable isotopes

    CERN Document Server

    Boeyens, J C A

    2003-01-01

    It is demonstrated that all stable (non-radioactive) isotopes are formally interrelated as the products of systematically adding alpha particles to four elementary units. The region of stability against radioactive decay is shown to obey a general trend based on number theory and contains the periodic law of the elements as a special case. This general law restricts the number of what may be considered as natural elements to 100 and is based on a proton:neutron ratio that matches the golden ratio, characteristic of biological and crystal growth structures. Different forms of the periodic table inferred at other proton:neutron ratios indicate that the electronic configuration of atoms is variable and may be a function of environmental pressure. Cosmic consequences of this postulate are examined. (author)

  6. Measurement of isotope abundance variations in nature by gravimetric spiking isotope dilution analysis (GS-IDA).

    Science.gov (United States)

    Chew, Gina; Walczyk, Thomas

    2013-04-02

    Subtle variations in the isotopic composition of elements carry unique information about physical and chemical processes in nature and are now exploited widely in diverse areas of research. Reliable measurement of natural isotope abundance variations is among the biggest challenges in inorganic mass spectrometry as they are highly sensitive to methodological bias. For decades, double spiking of the sample with a mix of two stable isotopes has been considered the reference technique for measuring such variations both by multicollector-inductively coupled plasma mass spectrometry (MC-ICPMS) and multicollector-thermal ionization mass spectrometry (MC-TIMS). However, this technique can only be applied to elements having at least four stable isotopes. Here we present a novel approach that requires measurement of three isotope signals only and which is more robust than the conventional double spiking technique. This became possible by gravimetric mixing of the sample with an isotopic spike in different proportions and by applying principles of isotope dilution for data analysis (GS-IDA). The potential and principle use of the technique is demonstrated for Mg in human urine using MC-TIMS for isotopic analysis. Mg is an element inaccessible to double spiking methods as it consists of three stable isotopes only and shows great potential for metabolically induced isotope effects waiting to be explored.

  7. Isotope separation by photoselective dissociative electron

    International Nuclear Information System (INIS)

    Stevens, C.G.

    1978-01-01

    A method of separating isotopes based on photoselective electron capture dissociation of molecules having an electron capture cross section dependence on the vibrational state of the molecule is described. A molecular isotope source material is irradiated to selectively excite those molecules containing a desired isotope to a predetermined vibrational state having associated therewith an electron capture energy region substantially non-overlapping with the electron capture energy ranges associated with the lowest vibration states of the molecules. The isotope source is also subjected to electrons having an energy corresponding to the non-overlapping electron capture region whereby the selectively excited molecules preferentially capture electrons and dissociate into negative ions and neutrals. The desired isotope may be in the negative ion product or in the neutral product depending upon the mechanism of dissociation of the particular isotope source used. The dissociation product enriched in the desired isotope is then separated from the reaction system by conventional means. Specifically, 235 UF 6 is separated from a UF 6 mixture by selective excitation followed by dissociative electron capture into 235 UF 5 - and F

  8. Isotope exchange reaction on solid breeder materials

    International Nuclear Information System (INIS)

    Baba, A.; Nishikawa, M.; Eguchi, T.; Kawagoe, T.

    2000-01-01

    Lithium ceramic materials such as Li 2 O, LiAlO 2 , Li 2 ZrO 3 , Li 2 TiO 3 and Li 4 SiO 4 are considered to be as candidate for the tritium breeding material in a deuterium-tritium (D-T) fusion reactor. In the recent blanket designs, helium gas with hydrogen or deuterium is planned to be used as the blanket purge gas to reduce tritium inventory and promote tritium release from the breeding material. In addition, the rate of isotope exchange reaction between hydrogen isotopes in the purge gas and tritium on the surface of the breeding material is necessary to analyze the tritium release behavior from the breeding materials. However, the rate of isotope exchange reactions between hydrogen isotopes in the purge gas and tritium on the surface of those materials has not been quantified until recently. Recently, the present authors quantified the rate of isotope exchange reaction on Li 2 O and Li 2 ZrO 3 . The overall mass transfer coefficients representing the isotope exchange reaction between H 2 and D 2 O on breeding materials or the same between D 2 and H 2 O are experimentally obtained in this study. Comparison to isotope exchange reaction rates on various breeding materials is also performed in this study. Discussions about the effects of temperature, concentration of hydrogen in the purge gas or flow rate of the purge gas on the conversion of tritiated water to tritium gas are also performed

  9. Isotopic tracing of perchlorate in the environment

    Science.gov (United States)

    Sturchio, Neil C.; Böhlke, John Karl; Gu, Baohua; Hatzinger, Paul B.; Jackson, W. Andrew; Baskaran, Mark

    2012-01-01

    Isotopic measurements can be used for tracing the sources and behavior of environmental contaminants. Perchlorate (ClO 4 − ) has been detected widely in groundwater, soils, fertilizers, plants, milk, and human urine since 1997, when improved analytical methods for analyzing ClO 4 −concentration became available for routine use. Perchlorate ingestion poses a risk to human health because of its interference with thyroidal hormone production. Consequently, methods for isotopic analysis of ClO 4 − have been developed and applied to assist evaluation of the origin and migration of this common contaminant. Isotopic data are now available for stable isotopes of oxygen and chlorine, as well as 36Cl isotopic abundances, in ClO 4 − samples from a variety of natural and synthetic sources. These isotopic data provide a basis for distinguishing sources of ClO 4 − found in the environment, and for understanding the origin of natural ClO 4 − . In addition, the isotope effects of microbial ClO 4 − reduction have been measured in laboratory and field experiments, providing a tool for assessing ClO 4 − attenuation in the environment. Isotopic data have been used successfully in some areas for identifying major sources of ClO 4 − contamination in drinking water supplies. Questions about the origin and global biogeochemical cycle of natural ClO 4 − remain to be addressed; such work would benefit from the development of methods for preparation and isotopic analysis of ClO 4 − in samples with low concentrations and complex matrices.

  10. Plutonium isotope ratios in polychaete worms

    International Nuclear Information System (INIS)

    Beasley, T.M.; Fowler, S.W.

    1976-01-01

    Reference is made to recent reports that suggest that terrestrial and aquatic organisms may preferentially take up 238 Pu compared with sup(239+240)Pu. It is stated that although kinetic isotope effects are known to occur in biological systems for low mass number elements, such as H, C and N, such effects are generally discounted with higher mass numbers, and differences in the biological 'uptake' of isotopes of high mass number elements, such as those of Pu, are normally attributable to differences in the chemical or physical forms of the isotopes or to different quantities of isotopes available to organisms. This has been applied to explain differential Pu isotope behaviour in animals under controlled laboratory conditions, but it is not certain that it can be applied to explain anomalies of Pu isotope behaviour in organisms contaminated by nuclear test debris or by wastes from nuclear fuel reprocessing plants. Geochemical weathering may also have an effect. Described here are experiments in which it was found that deposit feeding marine worms living in sediments contaminated in different ways with Pu isotopes did not show preferential accumulation of 238 Pu. The worms had been exposed to different chemical and physical forms of the isotopes, including exposure to laboratory-labelled sediment, sediment collected from a former weapons test site, and sediment contaminated by wastes from a nuclear fuel reprocessing plant. The worms were allowed to accumulate Pu for times of 5 to 40 days. Isotope ratios were determined by α-spectrometric techniques. It is considered that the results are important for environmental samples where Pu activity levels are low. (U.K.)

  11. Beneficial uses and production of isotopes

    International Nuclear Information System (INIS)

    2000-01-01

    Radioactive and stable isotopes are widely used in many sectors including medicine, industry and research. Practically all countries in the world are using isotopes in one way or another. In many cases, isotopes have no substitute and in most of their applications they are more effective and cheaper than alternative techniques or processes. The production of isotopes is less widespread, but more than fifty countries have isotope production or separation facilities operated for domestic supply, and sometimes for international markets. In spite of the importance of isotopes in economic and social terms, comprehensive statistical data on volumes or values of isotope production and uses are not readily available. This lack of information led the NEA to include the topic in its programme of work. The study carried out by the NEA, in co-operation with the International Atomic Energy Agency (IAEA), aimed at collecting and analysing information on various aspects of isotope production and uses in order to highlight key issues and provide findings and recommendations of relevance, in particular, for governmental bodies involved. This report provides data collected in 1999, reviewed and analysed by a group of experts nominated by Member countries. The participating experts and the NEA and IAEA Secretariats endeavored to present consistent and comprehensive information on isotope uses and production in the world. It is recognised, however, that the data and analyses included in the report are by no means exhaustive. The views expressed in the document are those of the participating experts and do not necessarily represent those of the countries concerned. The report is published under the responsibility of the Secretary-General of the OECD. (author)

  12. Magnesium isotopic composition of the mantle

    Science.gov (United States)

    Teng, F.; Li, W.; Ke, S.; Marty, B.; Huang, S.; Dauphas, N.; Wu, F.; Helz, R. L.

    2009-12-01

    Studies of Mg isotopic composition of the Earth not only are important for understanding its geochemistry but also can shed light on the accretion history of the Earth as well as the evolution of the Earth-Moon system. However, to date, the Mg isotopic composition of the Earth is still poorly constrained and highly debated. There is uncertainty in the magnitude of Mg isotope fractionation at mantle temperatures and whether the Earth has a chondritic Mg isotopic composition or not. To constrain further the Mg isotopic composition of the mantle and investigate the behavior of Mg isotopes during igneous differentiation, we report >200 high-precision (δ26Mg French Polynesian volcanoes (Society island and Cook Austral chain); 3) olivine grains from Hawaiian volcanoes (Kilauea, Koolau and Loihi) and 4) peridotite xenoliths from Australia, China, France, Tanzania and USA. Global oceanic basalts and peridotite xenoliths have a limited (<0.2 ‰) variation in Mg isotopic composition, with an average δ26Mg = -0.25 relative to DSM3. Olivines from Hawaiian lavas have δ26Mg ranging from -0.43 to +0.03, with most having compositions identical to basalts and peridotites. Therefore, the mantle’s δ26Mg value is estimated to be ~ -0.25 ± 0.1 (2SD), different from that reported by Wiechert and Halliday (2007; δ26Mg = ~ 0) but similar to more recent studies (δ26Mg = -0.27 to -0.33) (Teng et al. 2007; Handler et al. 2009; Yang et al., 2009). Moreover, we suggest the Earth, as represented by the mantle, has a Mg isotopic composition similar to chondrites (δ26Mg = ~-0.33). The need for a model such as that of Wiechert and Halliday (2007) that involves sorting of chondrules and calcium-aluminum-rich inclusions in the proto planetary disc is thus not required to explain the Mg isotopic composition of the Earth.

  13. Titanium Isotopes Provide Clues to Lunar Origin

    Science.gov (United States)

    Taylor, G. J.

    2012-05-01

    The idea that the Moon formed as the result of the giant impact of a Mars-sized impactor with the still-growing Earth explains two central facts about the Earth-Moon system: its total angular momentum (Earth's spin and the Moon's orbital motion), and the sizes of the metallic cores of the Earth (large) and Moon (tiny). This gives cosmochemists some confidence in the hypothesis, but they would greatly appreciate additional compositional tests. One undisputed point is the identical abundance of the three oxygen isotopes in Earth and Moon. Junjun Zhang and colleagues at the University of Chicago (USA) and the University of Bern (Switzerland) have added another isotopic system to the cosmochemical testing tool kit, titanium isotopes. They find that the ratio of titanium-50 to titanium-47 is identical in Earth and Moon to within four parts per million. In contrast, other solar system materials, such as carbonaceous chondrites, vary by considerably more than this-- up to 150 times as much. The identical oxygen and titanium isotopic compositions in Earth and Moon are surprising in light of what we think we know about planet formation and formation of the Moon after a giant impact. The variations in oxygen and titanium isotopes among meteorite types suggest that it is unlikely that the Moon-forming giant impactor would have had the same isotopic composition as the Earth. Simulations show that the Moon ends up constructed mostly (40-75%) from the impactor materials. Thus, the Moon ought to have different isotopic composition than does Earth. The isotopes might have exchanged in the complicated, messy proto-lunar disk (as has been suggested for oxygen isotopes), making them the same. However, Zhang and colleagues suggest that this exchange is unlikely for a refractory element like titanium. Could the impact simulations be greatly overestimating the contributions from the impactor? Was the mixing of building-block materials throughout the inner solar system much less than

  14. Beneficial uses and production of isotopes

    CERN Document Server

    2001-01-01

    Isotopes, radioactive and stable, are used worldwide in various applications related to medical diagnosis or care, industry and scientific research. More than fifty countries have isotope production or separation facilities operated for domestic supply, and sometimes for international markets. This publication provides up-to-date information on the current status of, and trends in, isotope uses and production. It also presents key issues, conclusions and recommendations, which will be of interest to policy makers in governmental bodies, scientists and industrial actors in the field.

  15. Isotopic enrichment in a plasma centrifuge

    International Nuclear Information System (INIS)

    Del Bosco, E.; Dallaqua, R.S.; Ludwig, G.O.; Bittencourt, J.A.

    1986-05-01

    A rotating fully ionized plasma column was produced in a vacuum-arc centrifuge. The apparatus is described and new results for the rotational velocity and isotope enrichment of carbon and metal plasmas are shown. The ion rotation velocity is derived from electrostatic probes measurents and from the azimuthal displacement of the material deposited behind of a narrow slit. The isotope enrichment is measured with a modified quadrupole mass spectrometer, which determines, in situ, the relative abundance of the isotopes at the end of the plasm column at various radil positions. (Author) [pt

  16. The first steps of isotope hydrology

    International Nuclear Information System (INIS)

    Moser, H.

    1995-01-01

    The author narrated on his personal experience of the past forty years of the development of isotope hydrology as an independent scientific branch. He started with the basic research work of for example Dansgaard and Libby and went on to the recent world-wide recording and interpreting isotopic data network. The IAEA organisation has accompanied the scientific development in an exemplary manner and, thus brought forward the isotope hydrological research activities to the high standard reached presently. This is documented by the great number of publications promoted by the IAEA throughout this time. 4 figs, 24 refs

  17. Kinetic coefficients in isotopically disordered crystals

    International Nuclear Information System (INIS)

    Zhernov, Arkadii P; Inyushkin, Alexander V

    2002-01-01

    Peculiarities of the behavior of kinetic coefficients, like thermal conductivity, electric conductivity, and thermoelectric power, in isotopically disordered materials are reviewed in detail. New experimental and theoretical results on the isotope effects in the thermal conductivity of diamond, Ge, and Si semiconductors are presented. The suppression effect of phonon-drag thermopower in the isotopically disordered Ge crystals is discussed. The influence of dynamic and static crystal lattice deformations on the electric conductivity of metals as well as on the ordinary phonon spectrum deformations is considered. (reviews of topical problems)

  18. Iron isotope systematics of the Skaergaard intrusion

    DEFF Research Database (Denmark)

    Lesher, Charles; Lundstrom, C.C.; Barfod, Gry

    crystallization on non-traditional stable isotope systems, particularly iron. FeTi oxide minerals (titanomagnetite and ilmenite) appear after ~60% of the magma had solidified. This was a significant event affecting the liquid line of descent and potentially accompanied by iron isotope fractionation. Here we...... report the results of a broad study of the iron isotope compositions of gabbros within the layered and upper border series of the Skaergaard intrusion, pegmatite and granophyre associated with these gabbroic rocks, and the sandwich horizon thought to represent the product of extreme differentiation and...

  19. Hafnium isotope stratigraphy of ferromanganese crusts

    Science.gov (United States)

    Lee; Halliday; Hein; Burton; Christensen; Gunther

    1999-08-13

    A Cenozoic record of hafnium isotopic compositions of central Pacific deep water has been obtained from two ferromanganese crusts. The crusts are separated by more than 3000 kilometers but display similar secular variations. Significant fluctuations in hafnium isotopic composition occurred in the Eocene and Oligocene, possibly related to direct advection from the Indian and Atlantic oceans. Hafnium isotopic compositions have remained approximately uniform for the past 20 million years, probably reflecting increased isolation of the central Pacific. The mechanisms responsible for the increase in (87)Sr/(86)Sr in seawater through the Cenozoic apparently had no effect on central Pacific deep-water hafnium.

  20. SAIL--stereo-array isotope labeling.

    Science.gov (United States)

    Kainosho, Masatsune; Güntert, Peter

    2009-11-01

    Optimal stereospecific and regiospecific labeling of proteins with stable isotopes enhances the nuclear magnetic resonance (NMR) method for the determination of the three-dimensional protein structures in solution. Stereo-array isotope labeling (SAIL) offers sharpened lines, spectral simplification without loss of information and the ability to rapidly collect and automatically evaluate the structural restraints required to solve a high-quality solution structure for proteins up to twice as large as before. This review gives an overview of stable isotope labeling methods for NMR spectroscopy with proteins and provides an in-depth treatment of the SAIL technology.