WorldWideScience

Sample records for self-help books cds

  1. Positive Psychology for Overcoming Symptoms of Depression: A Pilot Study Exploring the Efficacy of a Positive Psychology Self-Help Book versus a CBT Self-Help Book.

    Science.gov (United States)

    Hanson, Katie

    2018-04-25

    Depression is an extremely common mental health disorder, with prevalence rates rising. Low-intensity interventions are frequently used to help meet the demand for treatment. Bibliotherapy, for example, is often prescribed via books on prescription schemes (for example 'Reading Well' in England) to those with mild to moderate symptomology. Bibliotherapy can effectively reduce symptoms of depression (Naylor et al., 2010). However, the majority of self-help books are based on cognitive behavioural therapy (CBT), which may not be suitable for all patients. Research supports the use of positive psychology interventions for the reduction of depression symptoms (Bolier et al., 2013) and as such self-help books from this perspective should be empirically tested. This study aimed to test the efficacy of 'Positive Psychology for Overcoming Depression' (Akhtar, 2012), a self-help book for depression that is based on the principles of positive psychology, in comparison with a CBT self-help book that is currently prescribed in England as part of the Reading Well books on prescription scheme. Participants (n = 115) who were not receiving treatment, but had symptoms of depression, read the positive psychology or the CBT self-help book for 8 weeks. Depression and well-being were measured at baseline, post-test and 1-month follow-up. Results suggest that both groups experienced a reduction in depression and an increase in well-being, with no differences noted between the two books. Future directions are discussed in terms of dissemination, to those with mild to moderate symptoms of depression, via books on prescription schemes.

  2. TRANSLATION OF SELF-HELP BOOKS: TRANSLATION PROBLEMS IN RHONDA BYRNE'S "THE SECRET"

    OpenAIRE

    Furlan, Ana

    2013-01-01

    Self-help books are becoming very popular nowadays and have to be translated in other languages in order to be accessible to a wider audience from other countries. All self-help books share the same goal: to help the readers find solutions to their problems. They are written with a specific purpose and have special characteristics, which have to be considered when translating them. This graduation thesis focuses on the translation of self-help books in general and gives an analysis of som...

  3. Agreement among readers on what is relevant in self-help psychology books.

    Science.gov (United States)

    Forest, James J; Del Ben, Kevin; Toews, Stuart B

    2003-12-01

    It was hypothesized that text marking in self-help psychology books would indicate that readers agree on which pages and lines contain relevant information. Previously owned copies of two self-help book titles (n=48, n=38), all with marked text, were collected from second-hand book stores and scored for line and page marking. Chi-squares for goodness-of-fit yielded significant differences between observed and chance agreement in marking behavior. Intraclass and KR-20 correlations were significantly different from zero, suggesting that readers agreed on what information was relevant and irrelevant. Actual users of self-help books may have similar standards because of cultural values, social group relations, or common problem experiences.

  4. Salivary Cortisol Levels and Depressive Symptomatology in Consumers and Nonconsumers of Self-Help Books: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Catherine Raymond

    2016-01-01

    Full Text Available The self-help industry generates billions of dollars yearly in North America. Despite the popularity of this movement, there has been surprisingly little research assessing the characteristics of self-help books consumers, and whether this consumption is associated with physiological and/or psychological markers of stress. The goal of this pilot study was to perform the first psychoneuroendocrine analysis of consumers of self-help books in comparison to nonconsumers. We tested diurnal and reactive salivary cortisol levels, personality, and depressive symptoms in 32 consumers and nonconsumers of self-help books. In an explorative secondary analysis, we also split consumers of self-help books as a function of their preference for problem-focused versus growth-oriented self-help books. The results showed that while consumers of growth-oriented self-help books presented increased cortisol reactivity to a psychosocial stressor compared to other groups, consumers of problem-focused self-help books presented higher depressive symptomatology. The results of this pilot study show that consumers with preference for either problem-focused or growth-oriented self-help books present different physiological and psychological markers of stress when compared to nonconsumers of self-help books. This preliminary study underlines the need for additional research on this issue in order to determine the impact the self-help book industry may have on consumers’ stress.

  5. Salivary Cortisol Levels and Depressive Symptomatology in Consumers and Nonconsumers of Self-Help Books: A Pilot Study.

    Science.gov (United States)

    Raymond, Catherine; Marin, Marie-France; Hand, Anne; Sindi, Shireen; Juster, Robert-Paul; Lupien, Sonia J

    2016-01-01

    The self-help industry generates billions of dollars yearly in North America. Despite the popularity of this movement, there has been surprisingly little research assessing the characteristics of self-help books consumers, and whether this consumption is associated with physiological and/or psychological markers of stress. The goal of this pilot study was to perform the first psychoneuroendocrine analysis of consumers of self-help books in comparison to nonconsumers. We tested diurnal and reactive salivary cortisol levels, personality, and depressive symptoms in 32 consumers and nonconsumers of self-help books. In an explorative secondary analysis, we also split consumers of self-help books as a function of their preference for problem-focused versus growth-oriented self-help books. The results showed that while consumers of growth-oriented self-help books presented increased cortisol reactivity to a psychosocial stressor compared to other groups, consumers of problem-focused self-help books presented higher depressive symptomatology. The results of this pilot study show that consumers with preference for either problem-focused or growth-oriented self-help books present different physiological and psychological markers of stress when compared to nonconsumers of self-help books. This preliminary study underlines the need for additional research on this issue in order to determine the impact the self-help book industry may have on consumers' stress.

  6. The Self-Help Book in the Therapeutic Ontosphere: A Postmodern Paradox

    Directory of Open Access Journals (Sweden)

    Jean Collingsworth

    2014-10-01

    Full Text Available he self-help book is a prominent cultural and commercial phenomenon in the therapeutic ontosphere which permeates contemporary life. The generic term 'ontosphere' is here co-opted from IT to describe a notional social space in which influential conceptualisations and shared assumptions about personal values and enti-tlements operate without interrogation in the demotic apprehension of "reality". It thus complements the established critical terms 'discourse' and 'episteme'. In the therapeutic ontosphere the normal vicissitudes of life are increasingly interpreted as personal catastrophes. As new issues of concern are defined, it is assumed that an individual will need help to deal with them and live successfully. Advice-giving has become big business and the self-help book is now an important post-modern commodity. However a paradox emerges when the content and ideology of this apparently postmodern artifact is examined. In its topical eclecticism the genre is indeed unaligned with those traditional 'grand narratives' and collective value systems which the postmodern critical project has sought to discredit. It endorses relativism, celebrates reflexivity and valorizes many kinds of 'personal truth'. Moreover readers are encouraged towards self-renovation through a process of 'bricolage' which involves selecting advice from a diverse ethical menu along-side which many 'little narratives' of localized lived experience are presented as supportive exemplars. However in asserting the pragmatic power of individual instrumentality in an episteme which has seen the critical decentering of the human subject, the self-help book perpetuates the liberal-humanist notion of an essential personal identity whose stable core is axiomatic in traditional ethical advice. And the heroic journey of self-actualization is surely the grandest of grand narratives: the monomyth. Thus the telic self-help book presents the critical theorist with something of a paradox.

  7. Do grief self-help books convey contemporary perspectives on grieving?

    Science.gov (United States)

    Dennis, Michael Robert

    2012-01-01

    Grief therapy and psychology literatures of the modern Western world conceptualized bereavement and grief as processes to be "worked through" so that other relationships could be pursued. In the last decade or so, however, grief theorists have endorsed the value of attaining new meaning(s) and continuing bonds with our lost loved ones instead of "moving on from," "letting go of" or "achieving closure from" them. This article tracks the evolution of thought pertaining to this shift and examines its relevance to grief self-help books that may offer Americans guidance in the ways of grieving.

  8. Self-help books: bibliotherapy for happiness Libros de autoayuda: Biblioterapia para la felicidad

    Directory of Open Access Journals (Sweden)

    Vanina Andrea Papalini

    2010-11-01

    Full Text Available The aim of this article is to specify several functions of bibliotherapies, focusing the case of self-help books. By the analysis of a sample of 60 books, we propose a number of parameters to classify self-help as a specific discursive genre. That characterisation involves theme, composition structures and literary style, all typical of the genre. The examination of self-help discursive devices enables to understand their performance on discomforms in subjectivty.  Sef-help books are answers imbuid both in hegemonic ideology and in common sense that characterize this period. In this way, its historical developement has had different stages recognizables by the explicit objectives of the books, the foundations of their efficacy and the fields to which their influence is restrincted. The systematization of this evolution –that this article presents- makes easier to understand the eclectisism of this contemporary phenomenom.
    En este artículo, analizo las funciones de las biblioterapias, ocupándome de un caso particular: los libros de autoayuda. A partir del análisis de un corpus de 60 libros, propongo un conjunto de parámetros que permitan clasificar a esta literatura como un género específico, definiendo el tema, el tipo de composición y el estilo que le son propios. El examen de su dispositivo discursivo permite comprender mejor su actuación en los malestares de la subjetividad.
    Los libros de autoayuda son respuestas cifradas en la ideología hegemónica y el sentido común de la época. Como tales, su desarrollo histórico reconoce distintas etapas identificadas según los objetivos prácticos que los textos persiguen, el discurso con el que legitiman su eficacia y el área a la que circunscriben su acción. La sistematización de esta evolución facilita la comprensión del ecléctico fenómeno contemporáneo.

  9. A self-help book is better than sleep hygiene advice for insomnia: a randomized controlled comparative study.

    Science.gov (United States)

    Bjorvatn, Bjørn; Fiske, Eldbjørg; Pallesen, Ståle

    2011-12-01

    The objective was to compare the effects of two types of written material for insomnia in a randomized trial with follow-up after three months. Insomniacs were recruited through newspaper advertisements to a web-based survey with validated questionnaires about sleep, anxiety, depression, and use of sleep medications. A self-help book focusing on cognitive behavioral therapy for insomnia was compared to standard sleep hygiene advice; 77 and 78 participants were randomized to self-help book or sleep hygiene advice, respectively. The response rate was 81.9%. The self-help book gave significantly better scores on the sleep questionnaires compared to sleep hygiene advice. The proportion using sleep medications was reduced in the self-help book group, whereas it was increased in the sleep hygiene group. Compared to pre-treatment, the self-help book improved scores on the sleep (effect sizes 0.61-0.62) and depression (effect size 0.18) scales, whereas the sleep hygiene advice improved scores on some sleep scales (effect sizes 0.24-0.28), but worsened another (effect size -0.36). In addition, sleep hygiene advice increased the number of days per week where they took sleep medications (effect size -0.50). To conclude, in this randomized controlled trial, the self-help book improved sleep and reduced the proportion using sleep medications compared to sleep hygiene advice. The self-help book is an efficient low-threshold intervention, which is cheap and easily available for patients suffering from insomnia. Sleep hygiene advice also improved sleep at follow-up, but increased sleep medication use. Thus, caution is warranted when sleep hygiene advice are given as a single treatment. © 2011 The Authors. Scandinavian Journal of Psychology © 2011 The Scandinavian Psychological Associations.

  10. Usefulness of a guide book for patients to self-help during radiotherapy for anxiety before radiotherapy

    International Nuclear Information System (INIS)

    Hoshino, Naoko; Yamada, Nami; Morita, Kozo.

    1995-01-01

    From May through August 1993, 'a guide book for patients to self-help during radiotherapy' prepared at our department was given 80 patients before radiotherapy and the usefulness of this book for understanding of radiotherapy and reduction of anxiety for radiotherapy was investigated. In 83% of patients could read it through, and in 67% of these patients anxiety for treatment reduced. It is necessary that medical staffs make it clear more often, to let them understand this book more correctly. (author)

  11. Discourse Characteristics of Self-Help Books: The Example of The 7 Habits of Highly Effective People by Stephen R. Covey

    OpenAIRE

    Nerat, Tamara

    2017-01-01

    The main purpose of the thesis was to explore the discourse characteristics in self-help books on the example of a popular classic of this genre. The aim was a discourse analysis of the self-help manual The 7 Habits of Highly Effective People (1989) by Stephen R. Covey. The book falls under the self-help category and includes typical features which are common for the genre. The thesis presents the distinguishing characteristics and shows the conventions which make it a typical representative ...

  12. Self-Help Groups and Professional Helpers.

    Science.gov (United States)

    Balgopal, Pallassana R.; And Others

    1986-01-01

    Suggests innovative solutions for mutual benefits for self-help groups and the professionals. Through a derivative paradigm the role of the professional helper within self-help groups is presented. (Author/BL)

  13. Sociological perspectives on self-help groups

    DEFF Research Database (Denmark)

    Adamsen, L; Rasmussen, J M

    2001-01-01

    and significance of self-help groups. FINDINGS: New empirical sociological evidence shows that health care professionals - nurses, psychologists, social workers - have become an integrated part and thus essential actors in self-help groups within as well as outside the framework of the formal health care system...... that it is necessary to introduce new aspects and themes for discussion in the health care debate and the work that goes beyond the predominantly individual orientated treatment and care function....

  14. Taking care of business: self-help and sleep medicine in american corporate culture.

    Science.gov (United States)

    Brown, Megan

    2004-01-01

    This article argues that corporate management in the United States has expanded its scope beyond office walls and encompasses many aspects of workers' daily lives. One new element of corporate training is the micromanagement of sleep; self-help books, newspaper reports, magazine articles, and consulting firms currently advise workers and supervisors on optimizing productivity by cultivating certain sleep habits. Although consultants and self-help books make specific recommendations about sleep, most medical research is inconclusive about sleep's benefits for human performance. Using the ideas of Michel Foucault and Gilles Deleuze as a philosophical backdrop, this article examines the complex and often contradictory links between self-help, medicine, and corporate governance.

  15. Women Empowerment Through Self-Help Groups

    NARCIS (Netherlands)

    Alemu, Sintayehu Hailu; Kempen, Van Luuk; Ruben, Ruerd

    2018-01-01

    This paper deals with the impact of self-help groups (SHGs) in apple production on empowering women in the Chencha district of Southern Ethiopia. Impact is traced on the basis of a cross-sectional survey among SHG members and nonmembers, using propensity score matching. Apart from the attitudinal

  16. A Feminist Analysis of Self-Help Bestsellers for Improving Relationships: A Decade Review.

    Science.gov (United States)

    Zimmerman, Toni Schindler; Holm, Kristen E.; Starrels, Marjorie E.

    2001-01-01

    Content analysis was conducted of the top eleven relationship self help books on the New York Times Bestseller List over ten years to determine the degree to which they support a feminist approach to therapy. Results indicated the number of feminist and nonfeminist approach books is about equal and that bestsellers have become less feminist…

  17. Does self-help increase rates of help seeking for student mental health problems by minimizing stigma as a barrier?

    Science.gov (United States)

    Levin, Michael E; Krafft, Jennifer; Levin, Crissa

    2018-01-01

    This study examined whether self-help (books, websites, mobile apps) increases help seeking for mental health problems among college students by minimizing stigma as a barrier. A survey was conducted with 200 college students reporting elevated distress from February to April 2017. Intentions to use self-help were low, but a significant portion of students unwilling to see mental health professionals intended to use self-help. Greater self-stigma related to lower intentions to seek professional help, but was unrelated to seeking self-help. Similarly, students who only used self-help in the past reported higher self-stigma than those who sought professional treatment in the past. Although stigma was not a barrier for self-help, alternate barriers were identified. Offering self-help may increase rates of students receiving help for mental health problems, possibly by offering an alternative for students unwilling to seek in-person therapy due to stigma concerns.

  18. What to do about depression? Self-help recommendations of the public.

    Science.gov (United States)

    Holzinger, Anita; Matschinger, Herbert; Angermeyer, Matthias

    2012-07-01

    While help-seeking and treatment preferences for depression have been assessed in a number of population studies, little is known about the public's self-help beliefs. To explore public beliefs about self-help actions to be taken in case of depression. In spring 2009, a population-based survey was conducted by telephone in the city of Vienna. A fully structured interview was carried out, which began with the presentation of a vignette describing a case of depression. Subsequently, respondents were asked to indicate to what extent they would recommend various self-help actions. Among the self-help options proposed, confiding in a close friend or someone in the family were most frequently recommended. Apart from that, a variety of interpersonal actions (socializing with others, joining a self-help group), psychological methods (thinking positively), lifestyle changes (engaging in sport, listening to music, going on vacation, reading a good book) and dietary methods (eating healthy food) were endorsed by over half of respondents. While women were more ready to recommend self-help actions, the better educated were less enthusiastic about them. As only some of the self-help measures endorsed by the public are evidence based, more research is needed before promulgating their use.

  19. Nurturing a Self-Help Group

    Directory of Open Access Journals (Sweden)

    Marsha A. Schubert

    2015-04-01

    Full Text Available In April 1987, the parent of a child who was both learning disabled and intellectually gifted and talented and a professional educator (the author founded Parents of Gifted and Learning-Disabled Students of Northern Virginia, a self-help group for people who were dealing with the challenges posed by such children. The article begins with a background explaining the need for such a group followed by a history of the group and a description of how it functioned. It then details ways in which the author and the group interacted over the course of 5 years. A major component of this interaction was the members’ partnering in a research study with the author—a process now known as participatory action research (PAR—and the outcomes of that partnership.

  20. Tanker self-help spill recovery systems

    Energy Technology Data Exchange (ETDEWEB)

    Smedley, J B; Wainwright, J G; Ehman, T K

    1991-12-01

    An investigation was conducted of the circumstances in which oil spills occur from tankers at sea by analyzing available historical oil spill data. A data base of marine oil spills greater than 134 tonnes occurring from 1974 and June 1990, included in an appendix, was among the information analyzed. The analysis showed that marine oil spills of 5,000 tonnes and greater account for 39.4% of the accidents yet 94.7% of the total spilled quantity; 84% of those spills occur in vessels of 20,000 deadweight tonnes and larger. Of spills over 5,000 tonnes, 78.5% occur outside of harbor or pier areas where spill response equipment may not be readily available. Over 50% of spills are caused by groundings or collisions where the vessel crew might be able to respond in mitigating and controlling the outflow of oil. The review suggested that tanker self-help systems warrant serious consideration. Potential self-help systems are described, ranging from additives such as bioremediation, dispersants, and solidifiers to equipment such as portable pumps, booms, and skimmers. Candidate systems were examined in terms of their safety, ease of operation, practicability, and effectiveness. Their possible performance was then assessed for the case of major marine oil spills that have occurred in Canadian waters. Four systems are identified as potential candidates for further evaluation and possible implementation: internal oil transfer, hydrostatic loading, external oil lightering, and contingency planning. A system design is evaluated and its benefits and possible implementation are outlined, based on integration of the preferred attributes of the above four options. Recommendations for implementation are also provided. 28 refs., 6 figs., 33 tabs.

  1. [Performance of self-help groups and their economic evaluation].

    Science.gov (United States)

    Engelhardt, H D; Trojan, A; Nickel, S

    2009-01-01

    Hoffmann von Fallersleben is quoted with the sentence "Self-help is worthwhile, because it does not demand anything from others". This sounds catchy; it is, however, wrong: Self-help groups ask for support, particularly for financial resources for the work of either individual, highly organized self-help associations or for general support of self-help groups via local contact and information centers ("contact points for self-help groups"). With this request for economic "investments" in self-help, the question arises whether this is profitable for the country, the local authority or the social health insurance. In principle, the initial answer to this is: yes, the work of self-help groups is worthwhile for a single person, but also for the larger community, as various kinds of services are provided by self-help groups and organizations. Despite many surveys of members or co-operation partners which show positive effects of self-help groups, the question remains whether services of self-help groups can be measured and economically evaluated. The socio- political question regarding funding is closely connected to the idea of an economic evaluation of self-help groups. The aim of this article is to summarize and discuss which empiric approaches and findings are available on this subject. The monetary value for the work done per member of self-help groups and year lies between approximately 700 and 900 EUR.

  2. The self-help literature and the power of the mind

    Directory of Open Access Journals (Sweden)

    Monica Bernardo Schettini Marques

    2015-06-01

    Full Text Available The aim of this article is to offer a better understanding of the self-help literature, perceiving its appeals and meanings to the public. Two special moments in the history of self-help books are analyzed: the productions of New Thought authors and contemporary mentalists publications. We pay attention to the recurrence of the old topics of the American movement in the latest production, realizing that the idea of mind power, which was in the basis of the movement, remains strong and connected to individualism and the demands of contemporary society.

  3. Translation of Culture-Specific Items in Self-Help Literature: A Study on Domestication and Foreignization Strategies

    Directory of Open Access Journals (Sweden)

    Volga Yılmaz-Gümüş

    2012-05-01

    Full Text Available The last two decades have witnessed a boom in self-help materials in both global and local markets. This self-help trend, growing rapidly in our modern day, should be an area of interest for Translation Studies as an increasing number of self-help materials have been translated particularly from English every year. Self-help books involve a great deal of references to the material and social culture of the original country. One of the key issues in the translation of self-help books is the choice between foreignizing and domesticating these culture-specific items. This paper aims to discuss the procedures used for the translation of culture-specific items with regard to the particular function that these books assume in the target society. The analysis on the example of Outliers, a self-help book of sorts written by Malcolm Gladwell, has shown that the translator mostly adopted foreignizing strategies in translating the text into Turkish. The study also discusses whether these foreignizing strategies contribute to the fulfillment of target-text function, which is to provide quick-fix remedies to people struggling with modern-day challenges and demands.

  4. Neurodharma Self-Help: Personalized Science Communication as Brain Management.

    Science.gov (United States)

    Eklöf, Jenny

    2017-09-01

    Over the past ten to fifteen years, medical interventions, therapeutic approaches and scientific studies involving mindfulness meditation have gained traction in areas such as clinical psychology, psychotherapy, and neuroscience. Simultaneously, mindfulness has had a very strong public appeal. This article examines some of the ways in which the medical and scientific meaning of mindfulness is communicated in public and to the public. In particular, it shows how experts in the field of mindfulness neuroscience seek to communicate to the public at large the imperative of brain fitness for the promotion of health, wellbeing and happiness. The study identifies claims being made in popular outlets that, by and large, bypass traditional mass media, such as self-help books, websites and online videos. By treating this material as a form of personalized science communication, this article contributes to the body of literature that understands science communication as a continuum and the boundary between science and popularized science as the outcome of human negotiations. The study finds that processes of personalization help to build bridges between scientific findings and their supposed application, that they infuse science with subjective meaning, and turn expert communication with the public into a moral vocation.

  5. Love your job Make work work for you with help from classic self-help thinkers

    CERN Document Server

    Ideas, Infinite

    2012-01-01

    Love your job is a practical collection of tips and techniques that will bring you success at work. It brings together some of the greatest ideas on work and careers from self-help classics: Napoleon Hill's Think and grow rich; Benjamin Franklin's The way to wealth; George S.Clason's The richest man in Babylon, books that inspired generations of readers with simple and effective ideas that continue to resonate today. The wise lessons from these books have been interpreted here using twenty-first century case studies and modern careers and motivational advice. These 50 short, entertaining chapt

  6. THE ECONOMIC ROLE OF SELF-HELP GROUP

    OpenAIRE

    Dr. S. Selvendran

    2018-01-01

    “All for all” principle behind self-help group (SHG) concept. It is mainly concerned with poor people and it is for the people, by the people and of the people gandhian sarvodaya contained with this.

  7. Online self-help forums on cannabis: A content assessment.

    Science.gov (United States)

    Greiner, Christian; Chatton, Anne; Khazaal, Yasser

    2017-10-01

    To investigate online self-help forums related to cannabis users who were searching for help on the Internet. We analyzed the content of 717 postings by 328 users in three online forums in terms of fields of interest and self-help mechanisms. Only English-language forums that were free of charge and without registration were investigated. The main self-help mechanisms were disclosure and symptoms, with relatively few posts concerning legal issues and social perceptions. The forums differed significantly in all fields of interest and self-help mechanisms except for social network and financial and vocational issues. Highly involved users more commonly posted on topics related to diagnosis, etiology/research, and provision of information and less commonly on those related to gratitude. Correlation analysis showed a moderate negative correlation between emotional support and illness-related aspects and between emotional support and exchange of information. Cannabis forums share similarities with other mental health forums. Posts differ according to user involvement and the specific orientation of the forum. The Internet offers a viable source of self-help and social support for cannabis users, which has potential clinical implications in terms of referring clients to specific forums. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Role of Self-help Group in Substance Addiction Recovery

    Science.gov (United States)

    Das, Prangya Paramita Priyadarshini

    2012-11-01

    Background: The Narcotics Anonymous (NA)/Alcoholic Anonymous(AA) is based on the philosophy of self-help, where the former addicts and recovering addicts share experiences, provide emotional support and do active monitoring through mentoring. In mentoring, a former addict with longer duration of drug-free life acts as a guide to the newly recovering addict. Objective: The objective was to study the effect of involvement in self help group upon addictís level of depression, functional social support, and anxiety. Method: The size of the sample was 60. 30 addicts were taken from rehabilitation centre and 30 were taken from self-help groups. ANOVA was used to analyze the result. Result: In all the criteria it was found that there exists a significant impact of Self-help group. Conclusion: Self-help group provide clients with a social network of individuals with similar problems and experiences, since most of these individuals may be isolated from society due to the social stigma attached to their addictions. The transition from being help recipients to being helpers enables recovering addicts to build their self-confidence and feelings of being wanted and desired in society, which facilitates their self-confidence and positive self-esteem.

  9. The Self-help Online against Suicidal thoughts (SOS) trial

    DEFF Research Database (Denmark)

    Mühlmann, Charlotte; Madsen, Trine; Hjorthøj, Carsten Rygaard

    2017-01-01

    -list assignment for 32 weeks. The primary outcomes are frequency and intensity of suicidal thoughts. Secondary outcome measures include depressive symptoms, hopelessness, worrying, quality of life, costs related to health care utilization and production loss. Number of deliberate self-harm episodes, suicides......BACKGROUND: Suicidal thoughts are common, causing distress for millions of people all over the world. However, people with suicidal thoughts might not access support due to financial restraints, stigma or a lack of available treatment offers. Self-help programs provided online could overcome...... these barriers, and previous efforts show promising results in terms of reducing suicidal thoughts. This study aims to examine the effectiveness of an online self-help intervention in reducing suicidal thoughts among people at risk of suicide. The Danish Self-help Online against Suicidal thoughts (SOS) trial...

  10. CERN Document Server (CDS): Introduction

    CERN Multimedia

    CERN. Geneva; Costa, Flavio

    2017-01-01

    A short online tutorial introducing the CERN Document Server (CDS). Basic functionality description, the notion of Revisions and the CDS test environment. Links: CDS Production environment CDS Test environment  

  11. 50 WOMEN SELF HELP INITIATIVES: A PARADIGMATIC SHIFT IN ...

    African Journals Online (AJOL)

    of significant positive relationship between women self help projects and rural ... portable water, light, good health, basic education, clean environment as well as ... These concerned ... endowed with natural resources like: granite, gmelina, lime stone, rubber, .... conducted in Central Senatorial District of Cross River State.

  12. Print-based self-help interventions for smoking cessation.

    Science.gov (United States)

    Hartmann-Boyce, Jamie; Lancaster, Tim; Stead, Lindsay F

    2014-06-03

    Many smokers give up smoking on their own, but materials giving advice and information may help them and increase the number who quit successfully. The aims of this review were to determine: the effectiveness of different forms of print-based self-help materials, compared with no treatment and with other minimal contact strategies; the effectiveness of adjuncts to print-based self help, such as computer-generated feedback, telephone hotlines and pharmacotherapy; and the effectiveness of approaches tailored to the individual compared with non-tailored materials. We searched the Cochrane Tobacco Addiction Group trials register. Date of the most recent search April 2014. We included randomized trials of smoking cessation with follow-up of at least six months, where at least one arm tested a print-based self-help intervention. We defined self help as structured programming for smokers trying to quit without intensive contact with a therapist. We extracted data in duplicate on the participants, the nature of the self-help materials, the amount of face-to-face contact given to intervention and to control conditions, outcome measures, method of randomization, and completeness of follow-up.The main outcome measure was abstinence from smoking after at least six months follow-up in people smoking at baseline. We used the most rigorous definition of abstinence in each trial, and biochemically validated rates when available. Where appropriate, we performed meta-analysis using a fixed-effect model. We identified 74 trials which met the inclusion criteria. Many study reports did not include sufficient detail to judge risk of bias for some domains. Twenty-eight studies (38%) were judged at high risk of bias for one or more domains but the overall risk of bias across all included studies was judged to be moderate, and unlikely to alter the conclusions.Thirty-four trials evaluated the effect of standard, non-tailored self-help materials. Pooling 11 of these trials in which there

  13. Cyber-support: an analysis of online self-help forums (online self-help forums in bipolar disorder).

    Science.gov (United States)

    Bauer, Rita; Bauer, Michael; Spiessl, Hermann; Kagerbauer, Tanja

    2013-06-01

    The Internet is becoming increasingly important in psychiatry and psychotherapy. The objective of this study was to evaluate if and how online self-help forums are used by patients with bipolar disorders, their relatives and treating professionals. A total of 2400 postings in two online forums were analysed qualitatively and quantitatively. "Disclosure", "friendship" and "online-group cohesion" were the main self-help mechanisms. The topics most discussed were "social network", "symptoms of the illness" and "medication". Factor analyses revealed three factors concerning self-help mechanisms: "group cohesion", "emotional support" and "exchange of information", as well as three factors concerning fields of interest: "illness-related aspects", "social aspects" and "financial and legal issues". We infer that the main interest in participating in online forums for patients with bipolar disorders and their relatives is to share emotions and to discuss their daily struggles with the illness. Our study also reveals that social networking is very important for patients coping with bipolar disorders. Psycho-educative programmes should focus on those aspects.

  14. The Evolution of Hmong Self-Help Organizations in Minnesota

    Directory of Open Access Journals (Sweden)

    Shoua Yang

    2012-01-01

    Full Text Available The Hmong have several types of self-help organizations, classified accordingly to their purposes, to assist the Hmong to adapt to life in American culture. The central research question of this modest exploratory study relates to how these organizations haveevolved over the years in terms of their programming focus and funding strategies. To answer this question, a qualitative approach is used to guide the collection and analysis of data. The study was conducted in the St. Paul/Minneapolis region from 2007 to 2012,where a large population of Hmong refugees has settled since the mid-1970s and where these organizations were founded.

  15. An organizational typology for self-help groups.

    Science.gov (United States)

    Schubert, M A; Borkman, T J

    1991-10-01

    Those investigating the nature and functioning of self-help groups have been handicapped by the lack of a conceptual framework to bridge the diversity among such groups as well as to clarify the boundaries between consumer-owned and professionally owned groups. This paper describes a typology that classifies local units of these groups in terms of differences and similarities in their organizational structures. Rooted in organizational theory, it has two dimensions: external dependence upon resources and internal extent of experiential authority. Using it, the authors identified five types of groups, referred to as Unaffiliated, Federated, Affiliated, Hybrid, and Managed. The typology was validated with actual groups.

  16. Guided self-help cognitive behavioural therapy for depression in primary care: a randomised controlled trial.

    Directory of Open Access Journals (Sweden)

    Christopher Williams

    Full Text Available BACKGROUND: Access to Cognitive behavioural therapy (CBT for depression is limited. One solution is CBT self-help books. Trial Objectives: To assess the impact of a guided self-help CBT book (GSH-CBT on mood, compared to treatment as usual (TAU. HYPOTHESES: GSH-CBT will have improved mood and knowledge of the causes and treatment of depression compared to the control receiving TAUGuided self-help will be acceptable to patients and staff. METHODS AND FINDINGS: PARTICIPANTS: Adults attending seven general practices in Glasgow, UK with a BDI-II score of ≥14. 141 randomised to GSH-CBT and 140 to TAU. INTERVENTIONS: RCT comparing 'Overcoming Depression: A Five Areas Approach' book plus 3-4 short face to face support appointments totalling up to 2 hours of guided support, compared with general practitioner TAU. PRIMARY OUTCOME: The BDI (II score at 4 months. Numbers analysed: 281 at baseline, 203 at 4 months (primary outcome, 117 at 12 months. OUTCOME: Mean BDI-II scores were lower in the GSH-CBT group at 4 months by 5.3 points (2.6 to 7.9, p<0.001. At 4 and 12 months there were also significantly higher proportions of participants achieving a 50% reduction in BDI-II in the GSH-CBT arm. The mean support was 2 sessions with 42.7 minutes for session 1, 41.4 minutes for session 2 and 40.2 minutes of support for session 3. Adverse effects/Harms: Significantly less deterioration in mood in GSH-CBT (2.0% compared to 9.8% in the TAU group for BDI-II category change. LIMITATIONS: Weaknesses: Our follow-up rate of 72.2% at 4 months is better than predicted but is poorer at 12 months (41.6%. In the GSH-CBT arm, around 50% of people attended 2 or fewer sessions. 22% failed to take up treatment. CONCLUSIONS: GSH-CBT is substantially more effective than TAU. TRIAL REGISTRATION: Controlled-Trials.com ISRCTN13475030.

  17. Safe Haven CDS Premiums

    DEFF Research Database (Denmark)

    Klingler, Sven; Lando, David

    Credit Default Swaps can be used to lower capital requirements of dealer banks who enter into uncollateralized derivatives positions with sovereigns. We show in a model that the regulatory incentive to obtain capital relief makes CDS contracts valuable to dealer banks and empirically that...... support that CDS contracts are used for capital relief....

  18. Stomacare nurses and their share in the work with self-help groups of patiens.

    OpenAIRE

    ŠŤASTNÁ, Olga

    2010-01-01

    Stoma nurses and their contribution to work with self-help groups of patients. The diploma thesis dealt with the cooperation of stoma nurses with self-help groups of stoma patients in ten regions of the Czech Republic. The aim was to find out if stoma nurses recognize the importance of self-help groups for stoma patients, how their work contributes to self-help groups, if stoma nurses cooperate with self-help groups and if they inform stoma patients about the existence of self-help groups. An...

  19. Online self-help for suicidal thoughts: 3-month follow-up results and participant evaluation

    Directory of Open Access Journals (Sweden)

    Bregje A.J. van Spijker

    2015-09-01

    Conclusions: Effects of online self-help for suicidal thoughts can be maintained for up to three months. Participant evaluation indicated that online self-help for suicidal thoughts is acceptable, but there is also room for improvement.

  20. Up from Dependency: A New National Public Assistance Strategy. Supplement 3: A Self-Help Catalog.

    Science.gov (United States)

    Kotler, Martin; And Others

    Self-help among low-income people is vitally important. In no area is self-help more important than in overcoming poverty's burdens and energizing the escape from poverty. This document comprises an inventory of self-help and mutual-help programs that feature active involvement of members of the low-income population. The programs in this…

  1. Responding to local needs. Self-help groups.

    Science.gov (United States)

    Jayaseelan, J

    1993-01-01

    Pink Triangle, the only community-based group in Malaysia which works with men who have sex with men, took initial steps in August 1992 to establish a self-help project for people who are HIV-seropositive. Supporting people who are HIV-positive and fighting for their rights is new in Malaysia. The group has thus far been publicized through its public education events, hospitals, and other nongovernmental organizations. For the first time, information is being published specifically by and for people living with HIV/AIDS. The project also has a phone line to allow people to speak anonymously with someone who shares their experience. Many callers are men who have sex with men in the social context of intense prejudice and discrimination. Afraid to openly acknowledge their sexuality with strangers, the callers have yet to accede to meeting each other face-to-face in a group setting. The author notes in closing that Pink Triangle must be realistic about what can be achieved in Malaysia and allow the group to develop according to people's needs and not on the basis of a model imported from outside of the country.

  2. SELF HELP GROUPS (SHGS: MICRO FINANCE IN INDIA

    Directory of Open Access Journals (Sweden)

    Shivam SAKSHI

    2018-05-01

    Full Text Available Micro finance in India has developed in decades from an idea to implementation to many success stories to an overall success. The early dawn of the idea of micro financing was to provide the capital to the population which was considered the bottom of socio economic pyramid so as to carry out the small household business and this idea has gradually grown up to become the way to help improve the socio standards of the poor people. India is the country of villages, more than 70% of the nation’s population resides in the rural areas of the country and 60% of this rural population depends on agriculture for living. In such situation the micro financing can play a vital role in making the rural people’s life easy. In a developing country like India with a lot of people residing in rural areas, micro finance is undoubtedly the best implementation. Self Help Groups of India has emerged as the world’s largest and most successful network of Community Based Organisations. The main goal of an SHG is to elevate the living conditions of the rural poor with a maximum emphasize on women. The present paper’s objective is to explain the situation of micro finance in India and to explain the main channel of micro finance in India which is SHGs and the details of the SHGs.

  3. The City as a Self-Help Book : The Psychology of Urban Promises

    NARCIS (Netherlands)

    Ordonhas Viseu Cardoso, R.; Meijers, E.J.; van Ham, M.; Burger, MJ; de Vos, D.W.

    Despite the many negative aspects of life in cities, urban promises of economic prosperity, freedom and happiness have fuelled the imagination of generations of migrants, who have flocked to cities in search of a better life, invariably exaggerating the opportunities and neglected the potential

  4. The City as a Self-Help Book: The Psychology of Urban Promises

    NARCIS (Netherlands)

    R.V. Cardoso (Rodrigo); E.J. Meijers (Evert); M. van Ham (Maarten); M.J. Burger (Martijn); D. de Vos (Duco)

    2017-01-01

    textabstractDespite the many negative aspects of life in cities, urban promises of economic prosperity, freedom and happiness have fuelled the imagination of generations of migrants, who have flocked to cities in search of a better life, invariably exaggerating the opportunities and neglected the

  5. Do Grief Self-Help Books Convey Contemporary Perspectives on Grieving?

    Science.gov (United States)

    Dennis, Michael Robert

    2012-01-01

    Grief therapy and psychology literatures of the modern Western world conceptualized bereavement and grief as processes to be "worked through" so that other relationships could be pursued. In the last decade or so, however, grief theorists have endorsed the value of attaining new meaning(s) and continuing bonds with our lost loved ones instead of…

  6. Guided self-help for the treatment of pediatric obesity.

    Science.gov (United States)

    Boutelle, Kerri N; Norman, Gregory J; Rock, Cheryl L; Rhee, Kyung E; Crow, Scott J

    2013-05-01

    Clinic-based programs for childhood obesity are not available to a large proportion of the population. The purpose of this study was to evaluate the efficacy of a guided self-help treatment of pediatric obesity (GSH-PO) compared with a delayed treatment control and to evaluate the impact of GSH-PO 6-months posttreatment. Fifty overweight or obese 8- to 12-year-old children and their parents were randomly assigned to immediate treatment or to delayed treatment. The GSH-PO includes 12 visits over 5 months and addresses key components included in more intensive clinic-based programs. Children and parents in the immediate treatment arm were assessed at time 1 (T1), participated in GSH-PO between T1 and T2, and completed their 6-month posttreatment assessment at T3. Children and parents in the delayed treatment arm were assessed at T1, participated in GSH-PO between T2 and T3, and completed their 6-month posttreatment assessment at T4. The main outcome measures were BMI, BMI z score, and percentage overweight (%OW). Children in the immediate treatment GSH-PO arm decreased their BMI significantly more than did the delayed treatment arm (BMI group × time = -1.39; P < .001). Similar results were found for BMI z score and %OW. At the 6-month posttreatment assessment, changes resulting from GSH-PO were maintained for BMI z score and %OW but not BMI (BMI time effect = -0.06, not significant; BMI z score time effect = -0.10, P < .001; %OW time effect = -4.86, P < .05). The GSH-PO showed initial efficacy in decreasing BMI for children in this study. Additional efficacy and translational studies are needed to additionally evaluate GSH-PO.

  7. Clinical Decision Support (CDS) Inventory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Clinical Decision Support (CDS) Inventory contains descriptions of past and present CDS projects across the Federal Government. It includes Federal projects,...

  8. Self-help groups and mental health/substance use agencies: the benefits of organizational exchange.

    Science.gov (United States)

    Powell, Thomas; Perron, Brian Edward

    2010-02-01

    Self-help groups benefit clients by linking them to people who have "been there" and are successfully coping with their situations. Mental health/substance use agencies can increase access to evidence-based benefits of self-help groups by engaging them in organizational exchanges. Organizational theories are used to frame beneficial exchanges with self-help groups. Adaptational theory is used to frame exchanges with self-help groups and various service agency subunits, e.g., board, practitioner, and client units. Institutional theory is used to frame joint agency/self-help initiatives to promote community acceptance of self-help groups, which in turn may enhance the credibility of the professional agency.

  9. Efficacy of a Multicomponent Positive Psychology Self-Help Intervention: Study Protocol of a Randomized Controlled Trial

    Science.gov (United States)

    Drossaert, Constance HC; Pieterse, Marcel E; Walburg, Jan A; Bohlmeijer, Ernst T

    2015-01-01

    Background Positive psychology interventions have been found to enhance well-being and decrease clinical symptomatology. However, it is still unknown how flourishing can also be increased. Although multicomponent interventions seem to be necessary for this purpose, different formats can be used. A cost-effective approach could be a positive psychology-based self-help book with tailored email support to reach large target groups and to prevent dropout. Objective This study will evaluate the efficacy of a comprehensive multicomponent self-help intervention with or without email support on well-being and flourishing, and will seek to determine the working mechanisms underlying the intervention. Methods In this 3-armed, parallel, randomized controlled trial, 396 participants with low or moderate levels of well-being and without clinical symptomatology will be randomly assigned to (1) a self-help book condition with weekly email support, (2) a self-help book condition without email support but with a weekly information email, or (3) a waiting list control condition. Online measurements will be assessed at baseline, at post-test (3 months after baseline), and at 6 and 12 months after baseline. Results The primary outcomes are well-being and flourishing (ie, high levels of well-being). Secondary outcomes are the well-being components included in the intervention: positive emotion, use of strengths, optimism, self-compassion, resilience, and positive relations. Other measures include depressive and anxiety symptoms, personality traits, direct medical and non-medical costs, life-events, and client satisfaction. Conclusions This study will add knowledge to the efficacy and cost-effectiveness of a multicomponent positive psychology intervention. We will also explore who can benefit most from this intervention. If the intervention is found to be effective, our results will be especially relevant for public mental health services, governments, and primary care. Trial

  10. Self-help initiatives and rural development in Ibesikpo community of ...

    African Journals Online (AJOL)

    This study investigates the impact of self-help initiatives on rural development in Ibesikpo community of Akwa Ibom State, Nigeria. Self help initiatives were defined in terms of provision of employment, education and health-care. A sample size of 369 rural dwellers was drawn and data were analyzed using simple regression ...

  11. Cyber-Porn Dependence: Voices of Distress in an Italian Internet Self-Help Community

    Science.gov (United States)

    Cavaglion, Gabriel

    2009-01-01

    This study analyzes narratives of cyber-porn users and defines major patterns of distress as self-reported by contributors to a self-help group in the Internet. It applies narrative analysis methodology to 2000 messages sent by 302 members of an Italian self-help Internet community for cyber-porn dependents ("noallapornodipendenza").…

  12. Solution-Focused Self-Help for Improving University Students' Well-Being

    Science.gov (United States)

    Pakrosnis, Rytis; Cepukiene, Viktorija

    2015-01-01

    Along with positive developments in psychology, the self-help movement is becoming widespread, based on the belief that people are capable of growing and achieving positive change with only minimal help. This article addresses the potential of a solution-focused self-help tool to improve university students' well-being by comparing its outcome to…

  13. [Drug Addiction Self-Help Recovery scale (DASH-scale): an approach to the measurement of recovery from drug addiction in self-help program among drug addicts].

    Science.gov (United States)

    Shimane, Takuya; Misago, Chizuru

    2004-12-01

    The purpose of the study was to develop a scale for measuring the recovery in self-help program for drug addicts. Our study sites were fourteen self-help groups for drug addicts called "DARC: Drug Addiction Rehabilitation Center". DARC activities were based on Narcotics Anonymous types of self-help program. The 25-items DASH-scale questionnaire was developed using data, which were obtained through in-depth interview among DARC staff. A cross-sectional study among recovering addicts participating in "DARC" activities was implemented from Jan 2004 to Feb 2004. 164 subjects were responded to our questionnaire. Factor analysis was carried out and items with weaker or split loadings were removed. Factor analysis of DASH-scale results produced a surprisingly clean four-factor solution. 19-items were left to form the final DASH-scale; regular life-style (6 items), acceptance of drug addiction (5 items), sympathy with member (5 items), reborn (3 items). The internal consistency (Cronbach's Alpha) of these scales was very high (0.87). Low but significant concurrent correlations were observed between the DASH-scale and the Rosenberg Self-Esteem Scale (0.22), Purpose in Life Test (0.35). Discriminant validity of the DASH-scale was supported by significant increase with exposed period of self-help program. Evidence supports the DASH-scale was possible to measure recovery in self-help program.

  14. Self-help conferences for people who stutter: a qualitative investigation.

    Science.gov (United States)

    Trichon, Mitchell; Tetnowski, John

    2011-12-01

    Self-help activities for people who stutter (PWS) have been gaining in popularity; however, there is a scarcity of evidence to support their utility in stuttering management. The purpose of this investigation was to understand the lived experience of individuals who attended a self-help conference(s) for PWS from the perspective of a PWS to learn its potential utility in stuttering management. The investigator used Interpretive Phenomenological Analysis (IPA) to systematically collect authentic data of this social phenomenon. Twelve participants were recruited from a self-help conference and the self-help community of PWS. Semi-structured interviews were conducted 4-18 months after each participant's last conference. Interviews were transcribed and analyzed. Themes were explained in investigator narratives and illustrated through participants' quotes. Interpreted themes of the experience of having attended a self-help conference(s) for PWS included: socializing opportunities with other PWS, affiliation, redefining oneself and post-conference disclosures. A conclusion of the study was that the experience of having attended a self-help conference(s) for PWS helped to minimize negative impact that stuttering can have on daily functioning. It appears that self-help conferences were perceived as a safer or "stutter-friendly" environment and promoted social interaction, relationship building, and community building through planned and unplanned activities. Another conclusion was that the experience of having attended self-help conferences for PWS helped participants to communicate more easily. Reported increases in social activity and an "openness" about stuttering, suggest self-help conferences' utility in stuttering management. These findings are supported by other studies about successful stuttering management and self-help activities for PWS. They have helped attendees who stutter to communicate more easily and suggest a reduction in the negative impact that

  15. [Utilization of self-help groups and psychotherapy after psychosomatic-psychotherapeutic in-patient treatment].

    Science.gov (United States)

    Höflich, Anke; Matzat, Jürgen; Meyer, Friedhelm; Knickenberg, Rudolf J; Bleichner, Franz; Merkle, Wolfgang; Reimer, Christian; Franke, Wolfram; Beutel, Manfred E

    2007-05-01

    Until now little is known about the role of participation in self-help groups alone or combined with psychotherapy in post-in-patient care. In the present study 2933 patients were questioned about their experience of self-help groups and psychotherapy after discharge from a clinic for psychosomatic medicine and psychotherapy. Nearly 8 % of them utilized self-help groups (mostly combined with out-patient psychotherapy), and altogether 68 % out-patient psychotherapy following in-patient treatment. Patients without out-patient treatment were psychologically less burdened and had better resources than participants of self-help groups or psychotherapy. Self-help group members differed from patients in out-patient psychotherapy by expressing a more positive opinion of groupwork and higher openness to new experiences. Additionly, they had discussed the topic of self-help groups more frequently with their therapists. This may be a starting-point for promoting more self-help activities of patients in the future.

  16. CDS User survey

    CERN Multimedia

    CERN Document Service

    2011-01-01

      The CERN Document Server is launching a user survey in order to collect information relative to its search engine, submission interfaces, collaborative features and content organisation. With the view of re-shaping its collections and interfaces and to better integrate with the new INSPIRE platform that serves all HEP literature, CERN Document Server team invites you to take part in the survey. Your input is essential to provide us with useful information before setting up the new service and improve your interactions with CDS. Thanks for participating !  

  17. Safe-haven CDS Premia

    DEFF Research Database (Denmark)

    Klingler, Sven; Lando, David

    We argue that Credit Default Swap (CDS) premia for safe-haven sovereigns, like Germany and the United States, are driven to a large extent by regulatory requirements under which derivatives dealing banks have an incentive to buy CDS to hedge counterparty credit risk of their counterparties. We...

  18. Efficacy of a Self-Help Treatment for At-Risk and Pathological Gamblers.

    Science.gov (United States)

    Boudreault, Catherine; Giroux, Isabelle; Jacques, Christian; Goulet, Annie; Simoneau, Hélène; Ladouceur, Robert

    2018-06-01

    Available evidence suggests that self-help treatments may reduce problem gambling severity but inconsistencies of results across clinical trials leave the extent of their benefits unclear. Moreover, no self-help treatment has yet been validated within a French Canadian setting. The current study therefore assesses the efficacy of a French language self-help treatment including three motivational telephone interviews spread over an 11-week period and a cognitive-behavioral self-help workbook. At-risk and pathological gamblers were randomly assigned to the treatment group (n = 31) or the waiting list (n = 31). Relative to the waiting list, the treatment group showed a statistically significant reduction in the number of DSM-5 gambling disorder criteria met, gambling habits, and gambling consequences at Week 11. Perceived self-efficacy and life satisfaction also significantly improved after 11 weeks for the treatment group, but not for the waiting list group. At Week 11, 13% of participants had dropped out of the study. All significant changes reported for the treatment group were maintained throughout 1, 6 and 12-month follow-ups. Results support the efficacy of the self-help treatment to reduce problem gambling severity, gambling behaviour and to improve overall functioning among a sample of French Canadian problem gamblers over short, medium and long term. Findings from this study lend support to the appropriateness of self-help treatments for problem gamblers and help clarify inconsistencies found in the literature. The low dropout rate is discussed with respect to the advantages of the self-help format. Clinical and methodological implications of the results are put forth.

  19. Cambridge English First 2 audio CDs : authentic examination papers

    CERN Document Server

    2016-01-01

    Four authentic Cambridge English Language Assessment examination papers for the Cambridge English: First (FCE) exam. These examination papers for the Cambridge English: First (FCE) exam provide the most authentic exam preparation available, allowing candidates to familiarise themselves with the content and format of the exam and to practise useful exam techniques. The Audio CDs contain the recorded material to allow thorough preparation for the Listening paper and are designed to be used with the Student's Book. A Student's Book with or without answers and a Student's Book with answers and downloadable Audio are available separately. These tests are also available as Cambridge English: First Tests 5-8 on Testbank.org.uk

  20. Efficacy of a behavioral self-help treatment with or without therapist guidance for co-morbid and primary insomnia--a randomized controlled trial.

    Science.gov (United States)

    Jernelöv, Susanna; Lekander, Mats; Blom, Kerstin; Rydh, Sara; Ljótsson, Brjánn; Axelsson, John; Kaldo, Viktor

    2012-01-22

    Cognitive behavioral therapy is treatment of choice for insomnia, but availability is scarce. Self-help can increase availability at low cost, but evidence for its efficacy is limited, especially for the typical insomnia patient with co-morbid problems. We hypothesized that a cognitive behaviorally based self-help book is effective to treat insomnia in individuals, also with co-morbid problems, and that the effect is enhanced by adding brief therapist telephone support. Volunteer sample; 133 media-recruited adults with insomnia. History of sleep difficulties (mean [SD]) 11.8 [12.0] years. 92.5% had co-morbid problems (e.g. allergy, pain, and depression). Parallel randomized (block-randomization, n ≥ 21) controlled "open label" trial; three groups-bibliotherapy with (n = 44) and without (n = 45) therapist support, and waiting list control (n = 44). Assessments before and after treatment, and at three-month follow-up. Intervention was six weeks of bibliotherapeutic self-help, with established cognitive behavioral methods including sleep restriction, stimulus control, and cognitive restructuring. Therapist support was a 15-minute structured telephone call scheduled weekly. Main outcome measures were sleep diary data, and the Insomnia Severity Index. Intention-to-treat analyses of 133 participants showed significant improvements in both self-help groups from pre to post treatment compared to waiting list. For example, treatment with and without support gave shorter sleep onset latency (improvement minutes [95% Confidence Interval], 35.4 [24.2 to 46.6], and 20.6 [10.6 to 30.6] respectively), and support gave a higher remission rate (defined as ISI score below 8; 61.4%), than bibliotherapy alone (24.4%, p's < .001). Improvements were not seen in the control group (sleep onset latency 4.6 minutes shorter [-1.5 to 10.7], and remission rate 2.3%). Self-help groups maintained gains at three-month follow-up. Participants receiving self-help for insomnia benefited markedly

  1. Self-Help for Depression via E-mail: A Randomised Controlled Trial of Effects on Depression and Self-Help Behaviour.

    Directory of Open Access Journals (Sweden)

    Amy J Morgan

    Full Text Available Self-help or self-management strategies are commonly used to deal with depression, but not all are thought to be helpful. A previous study found that sub-threshold depression symptoms were improved by an e-mail intervention that encouraged the use of evidence-based self-help strategies.To investigate whether these e-mails were effective for adults with a range of depression symptomatology including major depression.The study was a parallel-group randomised controlled trial. Adult participants with any level of depressive symptoms were recruited over the internet from the United Kingdom, Australia, Canada, Ireland, New Zealand and the United States. Participants were randomised to receive a series of e-mails either promoting the use of evidence-based self-help strategies or containing depression information as a control. E-mails were sent automatically twice a week for six weeks. Depression symptoms were assessed with the self-rated Patient Health Questionnaire depression scale (PHQ-9.1736 participants with a wide range of symptom severity were recruited and assigned to active (n = 862 and control (n = 874 groups. However, there was a significant attrition rate, with 66.9% lost to follow-up at post-intervention. Both groups showed large improvements in depression symptoms overall, with no significant difference in improvement at the end of the study (mean difference in improvement 0.35 points, 95% CI: -0.57 to 1.28, d = 0.11, 95% CI: -0.06 to 0.27, although there was a small effect at the study mid-point. Results were similar for the sub-group of participants with major depression. The active group showed small to moderate improvements in self-help behaviour (d = 0.40, 95% CI: 0.23 to 0.56.These results suggest that the e-mails were able to increase participants' use of evidence-based self-help, but that this did not improve depression more than an attention control.NCT01399502.

  2. Turkish Migrant Women with Recurrent Depression: Results from Community-based Self-help Groups.

    Science.gov (United States)

    Siller, Heidi; Renner, Walter; Juen, Barbara

    2017-01-01

    The study focuses on psychosocial functioning of female Turkish immigrants in Austria with recurrent depressive disorder participating in self-help groups. Self-help groups guided by group leaders of Turkish descent should increase autonomy in participants, providing the opportunity to follow their ethnic health beliefs. Turkish immigrant women (n = 43) with recurrent depressive disorder participated in self-help groups over four months. Qualitative data of participants and group leaders, containing interviews, group protocols and supervision protocols of group leaders were analyzed using the qualitative content analysis for effects on psychosocial function, such as interaction with others, illness beliefs and benefit from self-help group. Women reported feelings of being neglected and violated by their husbands. They stated that they had gained strength and had emancipated themselves from their husbands. Self-help groups functioned as social resources and support for changes in participants' lives. Further interventions should integrate the functional value of depressive symptoms and focus on social support systems and social networks.

  3. Strasbourg Astronomical Data Center (CDS

    Directory of Open Access Journals (Sweden)

    F Genova

    2013-01-01

    Full Text Available The Centre de Donnees astronomiques de Strasbourg (CDS, created in 1972, has been a pioneer in the dissemination of digital scientific data. Ensuring sustainability for several decades has been a major issue because science and technology evolve continuously and the data flow increases endlessly. The paper briefly describes CDS activities, major services, and its R&D strategy to take advantage of new technologies. The next frontiers for CDS are the new Web 2.0/3.0 paradigm and, at a more general level, global interoperability of astronomical on-line resources in the Virtual Observatory framework.

  4. High effectiveness of self-help programs after drug addiction therapy

    Directory of Open Access Journals (Sweden)

    Kristensen Øistein

    2006-08-01

    Full Text Available Abstract Background The self-help groups Alcoholics Anonymous (AA and Narcotics Anonymous (NA are very well established. AA and NA employ a 12-step program and are found in most large cities around the world. Although many have argued that these organizations are valuable, substantial scepticism remains as to whether they are actually effective. Few treatment facilities give clear recommendations to facilitate participation, and the use of these groups has been disputed. The purpose of this study was to examine whether the use of self-help groups after addiction treatment is associated with higher rates of abstinence. Methods One hundred and fourteen patients, 59 with alcohol dependency and 55 with multiple drug dependency, who started in self-help groups after addiction treatment, were examined two years later using a questionnaire. Return rate was 66%. Six (5% of the patients were dead. Results Intention-to-treat-analysis showed that 38% still participated in self-help programs two years after treatment. Among the regular participants, 81% had been abstinent over the previous 6 months, compared with only 26% of the non-participants. Logistic regression analysis showed OR = 12.6, 95% CI (4.1–38.3, p Conclusion The study has several methodological problems; in particular, correlation does not necessarily indicate causality. These problems are discussed and we conclude that the probability of a positive effect is sufficient to recommend participation in self-help groups as a supplement to drug addiction treatment. Previous publication This article is based on a study originally published in Norwegian: Kristensen O, Vederhus JK: Self-help programs in drug addiction therapy. Tidsskr Nor Laegeforen 2005, 125:2798–2801.

  5. A controlled trial of an expert system and self-help manual intervention based on the stages of change versus standard self-help materials in smoking cessation.

    Science.gov (United States)

    Aveyard, Paul; Griffin, Carl; Lawrence, Terry; Cheng, K K

    2003-03-01

    To examine the population impact and effectiveness of the Pro-Change smoking cessation course based on the Transtheoretical Model (TTM) compared to standard self-help smoking cessation literature. Randomized controlled trial. Sixty-five West Midlands general practices. Randomly sampled patients recorded as smokers by their general practitioners received an invitation letter and 2471 current smokers agreed. Responders were randomized to one of four interventions. The control group received standard self-help literature. In the Manual intervention group, participants received the Pro-Change system, a self-help workbook and three questionnaires at 3-monthly intervals, which generated individually tailored feedback. In the Phone intervention group, participants received the Manual intervention plus three telephone calls. In the Nurse intervention group, participants received the Manual intervention plus three visits to the practice nurse. Biochemically confirmed point prevalence of being quit and 6-month sustained abstinence, 12 months after study commencement. A total of 9.1% of registered current smokers participated, of whom 83.0% were not ready to quit. Less than half of participants returned questionnaires to generate second and third individualized feedback. Telephone calls reached 75% of those scheduled, but few participants visited the nurse. There were small differences between the three Pro-Change arms. The odds ratio (95% confidence intervals) for all Pro-Change arms combined versus the control arm were 1.50 (0.85-2.67) and 1.53 (0.76-3.10), for point prevalence and 6-month abstinence, respectively. This constitutes 2.1% of the TTM group versus 1.4% of the control group achieving confirmed 6-month sustained abstinence. There was no statistically significant benefit of the intervention apparent in this trial and the high relapse of quitters means that any population impact is small.

  6. Cognitive Behavioral Guided Self-Help for the Treatment of Recurrent Binge Eating

    Science.gov (United States)

    Striegel-Moore, Ruth H.; Wilson, G. Terence; DeBar, Lynn; Perrin, Nancy; Lynch, Frances; Rosselli, Francine; Kraemer, Helena C.

    2010-01-01

    Objective: Despite proven efficacy of cognitive behavioral therapy (CBT) for treating eating disorders with binge eating as the core symptom, few patients receive CBT in clinical practice. Our blended efficacy-effectiveness study sought to evaluate whether a manual-based guided self-help form of CBT (CBT-GSH), delivered in 8 sessions in a health…

  7. Comparison of Six- and Eight-Session Cognitive Guided Self-Help for Bulimia Nervosa

    Science.gov (United States)

    Furber, Gareth; Steele, Anna; Wade, Tracey D.

    2004-01-01

    A previous case-series evaluation of a six-session guided self-help (GSH) approach with 15 people with bulimia nervosa (BN) showed significant reductions across all measures, including binge eating, self-induced vomiting, weight concern, shape concern and dietary restraint. However, the reduction of binge eating and self-induced vomiting was…

  8. Intrapersonal Resources and the Effectiveness of Self-Help Groups for Bereaved Older Adults.

    Science.gov (United States)

    Caserta, Michael S.; Lund, Dale A.

    1993-01-01

    Examined relative impact of 3 intrapersonal resources (self-esteem, competencies, and life satisfaction) and duration of self-help group intervention on levels of depression and grief over time among 295 recently widowed adults. Found that, in general, resources examined had greater direct influence on outcomes than did intervention. (Author/NB)

  9. Beyond the therapeutic: A Habermasian view of self-help groups' place in the public sphere.

    Science.gov (United States)

    Chaudhary, Sarah; Avis, Mark; Munn-Giddings, Carol

    2013-02-01

    Self-help groups in the United Kingdom continue to grow in number and address virtually every conceivable health condition, but they remain the subject of very little theoretical analysis. The literature to date has predominantly focused on their therapeutic effects on individual members. And yet they are widely presumed to fulfil a broader civic role and to encourage democratic citizenship. The article uses Habermas' model of the public sphere as an analytical tool with which to reconsider the literature on self-help groups in order to increase our knowledge of their civic functions. In doing this it also aims to illustrate the continuing relevance of Habermas' work to our understanding of issues in health and social care. We consider, within the context of current health policies and practices, the extent to which self-help groups with a range of different forms and functions operate according to the principles of communicative rationality that Habermas deemed key to democratic legitimacy. We conclude that self-help groups' civic role is more complex than is usually presumed and that various factors including groups' leadership, organisational structure and links with public agencies can affect their efficacy within the public sphere.

  10. Online Counseling: Prioritizing Psychoeducation, Self-Help, and Mutual Help for Counseling Psychology Research and Practice

    Science.gov (United States)

    Chang, Tai

    2005-01-01

    This reaction article extends the research and practice recommendations for online counseling from the Major Contribution to the November 2005 issue of "The Counseling Psychologist" by prioritizing research and practice in online psychoeducation, self-help, and mutual help. Research suggests that tens of millions of Americans use the Internet for…

  11. 76 FR 77548 - Notice of Submission of Proposed Information Collection to OMB Self-Help Homeownership...

    Science.gov (United States)

    2011-12-13

    ... Proposed Information Collection to OMB Self-Help Homeownership Opportunity Program (SHOP) AGENCY: Office of... proposal. SHOP provides for funds to purchase home sites and develop/improve infrastructure to support sweat equity and volunteer-based homeownership programs for low-income persons and families. This...

  12. Self-Help Training System for Nursing Students to Learn Patient Transfer Skills

    Science.gov (United States)

    Huang, Zhifeng; Nagata, Ayanori; Kanai-Pak, Masako; Maeda, Jukai; Kitajima, Yasuko; Nakamura, Mitsuhiro; Aida, Kyoko; Kuwahara, Noriaki; Ogata, Taiki; Ota, Jun

    2014-01-01

    This paper describes the construction and evaluation of a self-help skill training system for assisting student nurses in learning skills involving the transfer of patients from beds to wheelchairs. We have proposed a feedback method that is based on a checklist and video demonstrations. To help trainees efficiently check their performance and…

  13. Effects of a Guided Internet-Delivered Self-Help Intervention for Adolescents With Chronic Pain.

    NARCIS (Netherlands)

    Voerman, J.S.; Remerie, S.; Westendorp, T.; Timman, R.; Busschbach, J.J.V.; Passchier, J.; de Klerk, C.

    2015-01-01

    Cognitive-behavioral therapy (CBT) is effective in reducing the frequency and intensity of chronic pain in adolescents. However, CBT seems not to be considered acceptable by all adolescents. The main aim of our study was therefore to evaluate the effects of guided Internet-delivered self-help for

  14. 77 FR 71609 - Self-Help Homeownership Opportunity Program (SHOP) Grant Monitoring

    Science.gov (United States)

    2012-12-03

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5603-N-89] Self-Help Homeownership Opportunity Program (SHOP) Grant Monitoring AGENCY: Office of the Chief Information Officer, HUD. ACTION... electronic submission of responses. This notice also lists the following information: Title of Proposed: Self...

  15. A Preliminary Investigation of Toughlove: Assertiveness and Support in a Parents' Self-Help Group.

    Science.gov (United States)

    Klug, Wayne

    This study examined Toughlove, the controversial self-help organization for parents and out-of-control adolescents. Six small group Toughlove meetings containing an average of 8 members for each were observed, and questionnaires were completed by 75 Toughlove parents from 8 states. Variables examined include the roles of empathy, assertiveness…

  16. [Self-help groups--a fashion trend or objective requirement?].

    Science.gov (United States)

    Horvat, M; Gospocić, G; Gospocić, S

    1989-01-01

    The role and the significance of the self-help groups in the modern medicine are described. The authors propose that the medical profession should actively support the formation and the activity of such groups with the aim to improve the quality of life of many groups of patients.

  17. Predictors of dropout from internet-based self-help cognitive behavioral therapy for insomnia.

    Science.gov (United States)

    Yeung, Wing-Fai; Chung, Ka-Fai; Ho, Fiona Yan-Yee; Ho, Lai-Ming

    2015-10-01

    Dropout from self-help cognitive-behavioral therapy for insomnia (CBT-I) potentially diminishes therapeutic effect and poses clinical concern. We analyzed the characteristics of subjects who did not complete a 6-week internet-based CBT-I program. Receiver operator characteristics (ROC) analysis was used to identify potential variables and cutoff for predicting dropout among 207 participants with self-report insomnia 3 or more nights per week for at least 3 months randomly assigned to self-help CBT-I with telephone support (n = 103) and self-help CBT-I (n = 104). Seventy-two participants (34.4%) did not complete all 6 sessions, while 42 of the 72 (56.9%) dropped out prior to the fourth session. Significant predictors of non-completion are total sleep time (TST) ≥ 6.82 h, Hospital Anxiety and Depression Scale depression score ≥ 9 and Insomnia Severity Index score dropout. Longer TST and less severe insomnia predict dropout in this study of self-help CBT-I, in contrast to shorter TST as a predictor in 2 studies of face-to-face CBT-I, while greater severity of depression predicts dropout in both this study and a study of face-to-face CBT-I. Strategies for minimizing dropout from internet-based CBT-I are discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Money and violence : financial self-help groups in a South African township

    NARCIS (Netherlands)

    Bähre, Erik

    2007-01-01

    This ethnography is about the way in which Xhosa migrants in the townships of Cape Town, South Africa, collectively manage their money in financial self-help groups, also known as financial mutuals. This is an umbrella term for a myriad of collective financial arrangements that are mostly informal.

  19. Effectiveness of E-self-help interventions for curbing adult problem drinking: A meta-analysis.

    NARCIS (Netherlands)

    Riper, H.; Spek, V.; Boon, B.; Conijn, B.; Kramer, J.; Martin-Abello, K.; Smit, H.F.E.

    2011-01-01

    Background: Self-help interventions without professional contact to curb adult problem drinking in the community are increasingly being delivered via the Internet. Objective: The objective of this meta-analysis was to assess the overall effectiveness of these eHealth interventions. Methods: In all,

  20. Brief Online Self-help Exercises for Postnatal Women to Improve Mood: A Pilot Study.

    Science.gov (United States)

    Ayers, Susan; Fitzgerald, Gemima; Thompson, Susan

    2015-11-01

    Giving birth and adjusting to a new baby can be difficult and stressful for new mothers. Negative mood may occur during this time and can affect women, their parenting and the infant's development. This pilot study evaluated a brief online self-help intervention designed to promote positive mood in mothers of babies and toddlers. Women in the UK who had given birth within the previous 18 months were randomly allocated to the online self-help intervention (n = 40) or active comparison group exercise (n = 40) which was matched for time and structure. Mood was measured before and after the intervention. Acceptability was examined at the end of the trial. The self-help intervention was acceptable to the majority of women and significantly increased positive mood compared to the comparison condition. This effect persisted after controlling for self-esteem, anxiety and depression. These results suggest that a simple self-help intervention focused on changing beliefs about oneself as a mother can have an immediate impact on women's mood. Further research is need to see whether these improvements continue long-term and what processes underlie these improvements.

  1. Padres Maltratadores: Grupos de Autoayuda (Abusive Parents: Self-Help Groups).

    Science.gov (United States)

    Intebi, Irene V.; Groisman, Adriana E.

    1991-01-01

    Causes of child abuse by parents are discussed. A therapy program in Buenos Aires (Argentina) for abusive parents is described. The program utilizes self-help groups as part of the therapeutic plan and has found them to be promising. Referral, types of interactions with the groups, and short-, medium-, and long-term objectives are discussed. (BRM)

  2. Efficacy of a behavioral self-help treatment with or without therapist guidance for co-morbid and primary insomnia -a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Jernelöv Susanna

    2012-01-01

    Full Text Available Abstract Background Cognitive behavioral therapy is treatment of choice for insomnia, but availability is scarce. Self-help can increase availability at low cost, but evidence for its efficacy is limited, especially for the typical insomnia patient with co-morbid problems. We hypothesized that a cognitive behaviorally based self-help book is effective to treat insomnia in individuals, also with co-morbid problems, and that the effect is enhanced by adding brief therapist telephone support. Methods Volunteer sample; 133 media-recruited adults with insomnia. History of sleep difficulties (mean [SD] 11.8 [12.0] years. 92.5% had co-morbid problems (e.g. allergy, pain, and depression. Parallel randomized (block-randomization, n ≥ 21 controlled "open label" trial; three groups-bibliotherapy with (n = 44 and without (n = 45 therapist support, and waiting list control (n = 44. Assessments before and after treatment, and at three-month follow-up. Intervention was six weeks of bibliotherapeutic self-help, with established cognitive behavioral methods including sleep restriction, stimulus control, and cognitive restructuring. Therapist support was a 15-minute structured telephone call scheduled weekly. Main outcome measures were sleep diary data, and the Insomnia Severity Index. Results Intention-to-treat analyses of 133 participants showed significant improvements in both self-help groups from pre to post treatment compared to waiting list. For example, treatment with and without support gave shorter sleep onset latency (improvement minutes [95% Confidence Interval], 35.4 [24.2 to 46.6], and 20.6 [10.6 to 30.6] respectively, and support gave a higher remission rate (defined as ISI score below 8; 61.4%, than bibliotherapy alone (24.4%, p's Conclusions Participants receiving self-help for insomnia benefited markedly. Self-help, especially if therapist-supported, has considerable potential to be as effective as individual treatment at lower cost, also for

  3. Enhancing inpatient psychotherapeutic treatment with online self-help: study protocol for a randomized controlled trial.

    Science.gov (United States)

    Zwerenz, Rüdiger; Becker, Jan; Knickenberg, Rudolf J; Hagen, Karin; Dreier, Michael; Wölfling, Klaus; Beutel, Manfred E

    2015-03-17

    Depression is one of the most debilitating and costly mental disorders. There is increasing evidence for the efficacy of online self-help in alleviating depression. Knowledge regarding the options of combining online self-help with inpatient psychotherapy is still limited. Therefore, we plan to evaluate an evidence-based self-help program (deprexis®; Gaia AG, Hamburg, Germany) to improve the efficacy of inpatient psychotherapy and to maintain treatment effects in the aftercare period. Depressed patients (n = 240) with private internet access aged between 18 and 65 are recruited during psychosomatic inpatient treatment. Participants are randomized to an intervention or control group at the beginning of inpatient treatment. The intervention group (n = 120) is offered an online self-help program with 12 weekly tasks, beginning during the inpatient treatment. The control group (n = 120) obtains access to an online platform with weekly updated information on depression for the same duration. Assessments are conducted at the beginning (T0) and the end of inpatient treatment (T1), at the end of intervention (T2) and 6 months after randomization (T3). The primary outcome is the depression score measured by the Beck Depression Inventory-II at T2. Secondary outcome measures include anxiety, self-esteem, quality of life, dysfunctional cognitions and work ability. We expect the intervention group to benefit from additional online self-help during inpatient psychotherapy and to maintain the benefits during follow-up. This could be an important approach to develop future concepts of inpatient psychotherapy. ClinicalTrials.gov Identifier: NCT02196896 (registered on 16 July 2014).

  4. Self-help interventions for depressive disorders and depressive symptoms: a systematic review

    Directory of Open Access Journals (Sweden)

    Jorm Anthony F

    2008-08-01

    Full Text Available Abstract Background Research suggests that depressive disorders exist on a continuum, with subthreshold symptoms causing considerable population burden and increasing individual risk of developing major depressive disorder. An alternative strategy to professional treatment of subthreshold depression is population promotion of effective self-help interventions that can be easily applied by an individual without professional guidance. The evidence for self-help interventions for depressive symptoms is reviewed in the present work, with the aim of identifying promising interventions that could inform future health promotion campaigns or stimulate further research. Methods A literature search for randomised controlled trials investigating self-help interventions for depressive disorders or depressive symptoms was performed using PubMed, PsycINFO and the Cochrane Database of Systematic Reviews. Reference lists and citations of included studies were also checked. Studies were grouped into those involving participants with depressive disorders or a high level of depressive symptoms, or non-clinically depressed participants not selected for depression. A number of exclusion criteria were applied, including trials with small sample sizes and where the intervention was adjunctive to antidepressants or psychotherapy. Results The majority of interventions searched had no relevant evidence to review. Of the 38 interventions reviewed, the ones with the best evidence of efficacy in depressive disorders were S-adenosylmethionine, St John's wort, bibliotherapy, computerised interventions, distraction, relaxation training, exercise, pleasant activities, sleep deprivation, and light therapy. A number of other interventions showed promise but had received less research attention. Research in non-clinical samples indicated immediate beneficial effects on depressed mood for distraction, exercise, humour, music, negative air ionisation, and singing; while potential

  5. Effectiveness of self-help psychological interventions for treating and preventing postpartum depression: a meta-analysis.

    Science.gov (United States)

    Lin, Ping-Zhen; Xue, Jiao-Mei; Yang, Bei; Li, Meng; Cao, Feng-Lin

    2018-04-04

    Previous studies have reported different effect sizes for self-help interventions designed to reduce postpartum depression symptoms; therefore, a comprehensive quantitative review of the research was required. A meta-analysis was conducted to examine the effectiveness of self-help interventions designed to treat and prevent postpartum depression, and identified nine relevant randomized controlled trials. Differences in depressive symptoms between self-help interventions and control conditions, changes in depressive symptoms following self-help interventions, and differences in postintervention recovery and improvement rates between self-help interventions and control conditions were assessed in separate analyses. In treatment trials, depression scores continued to decrease from baseline to posttreatment and follow-up assessment in treatment subgroups. Changes in treatment subgroups' depression scores from baseline to postintervention assessment were greater relative to those observed in prevention subgroups. Self-help interventions produced larger overall effects on postpartum depression, relative to those observed in control conditions, in posttreatment (Hedges' g = 0.51) and follow-up (Hedges' g = 0.32) assessments; and self-help interventions were significantly more effective, relative to control conditions, in promoting recovery from postpartum depression. Effectiveness in preventing depression did not differ significantly between self-help interventions and control conditions.The findings suggested that self-help interventions designed to treat postpartum depression reduced levels of depressive symptoms effectively and decreased the risk of postpartum depression.

  6. Enriching The Metadata On CDS

    CERN Document Server

    Chhibber, Nalin

    2014-01-01

    The project report revolves around the open source software package called Invenio. It provides the tools for management of digital assets in a repository and drives CERN Document Server. Primary objective is to enhance the existing metadata in CDS with data from other libraries. An implicit part of this task is to manage disambiguation (within incoming data), removal of multiple entries and handle replications between new and existing records. All such elements and their corresponding changes are integrated within Invenio to make the upgraded metadata available on the CDS. Latter part of the report discuss some changes related to the Invenio code-base itself.

  7. Quality of life changes in an alcoholics anonymous self-help group

    Directory of Open Access Journals (Sweden)

    INDRĖ DIRGĖLIENĖ

    2017-09-01

    Full Text Available The issue of alcohol addiction is one of the most pressing in contemporary society as it causes an effect in the context of poverty, violence and suicidal behaviour. After the restoration of Lithuania‘s Independence a new helping profession such as social worker appeared: they were expected to provide professional help to people in order to help them find inner motivation for positive socialization or re-socialization. The issue of alcohol addiction/dependence was first viewed systemically, with the understanding of the need for systemic help: social, psychological, spiritual and medical. Long-term rehabilitation centres have been created and self-help groups formed: those of Alcoholics Anonymous (AA, Al-anon (self – help groups for friends and families who have relatives suffering from alcohol and ACA (Adult Children of Alcoholics self-help group. The article analyzes the quality of life changes in an Alcoholics Anonymous self-help group. Qualitative survey data are presented in this article. Six life stories of people attending Alcoholics Anonymous (AA self-help groups are provided. The age of the participants ranges from 31 to 58. The main criterion to participate in the research is: people who have or have had problems because of alcohol usage and who are Alcoholics Anonymous self-help group (AA participants that have reached Step 12. This means they are ready to spread the message about recovering from this abuse to people who suffer from it. Deep analysis interview has been used to collect the data. Interview notional blocks are: 1 childhood experiences; 2 addiction to alcohol period and crisis; 3 changes of life quality when attending AA groups. The study data have been provided using content analysis through the deduction method. The theoretical basis is a systematic approach to a person in the course of his life‘ spiritual concepts and stages of recovery (May, 2004; Linn, Linn, 2003; Kubler-Ross, 2008 and the theory of integrated

  8. Internet-based guided self-help for posttraumatic stress disorder (PTSD): Randomized controlled trial.

    Science.gov (United States)

    Lewis, Catrin E; Farewell, Daniel; Groves, Vicky; Kitchiner, Neil J; Roberts, Neil P; Vick, Tracey; Bisson, Jonathan I

    2017-06-01

    There are numerous barriers that limit access to evidence-based treatment for posttraumatic stress disorder (PTSD). Internet-based guided self-help is a treatment option that may help widen access to effective intervention, but the approach has not been sufficiently explored for the treatment of PTSD. Forty two adults with DSM-5 PTSD of mild to moderate severity were randomly allocated to internet-based self-help with up to 3 h of therapist assistance, or to a delayed treatment control group. The internet-based program included eight modules that focused on psychoeducation, grounding, relaxation, behavioural activation, real-life and imaginal exposure, cognitive therapy, and relapse prevention. The primary outcome measure was reduction in clinician-rated traumatic stress symptoms using the clinician administered PTSD scale for DSM-V (CAPS-5). Secondary outcomes were self-reported PTSD symptoms, depression, anxiety, alcohol use, perceived social support, and functional impairment. Posttreatment, the internet-based guided self-help group had significantly lower clinician assessed PTSD symptoms than the delayed treatment control group (between-group effect size Cohen's d = 1.86). The difference was maintained at 1-month follow-up and dissipated once both groups had received treatment. Similar patterns of difference between the two groups were found for depression, anxiety, and functional impairment. The average contact with treating clinicians was 2½ h. Internet-based trauma-focused guided self-help for PTSD is a promising treatment option that requires far less therapist time than current first line face-to-face psychological therapy. © 2017 Wiley Periodicals, Inc.

  9. Role of Self-help Groups in Promoting Inclusion and Rights of Persons with Disabilities

    Directory of Open Access Journals (Sweden)

    K P Kumaran

    2011-10-01

    Full Text Available Purpose:This study examined the role of self help groups in addressing some of the problems faced by persons with disabilities such as social exclusion, discrimination, lack of awareness about their rights and privileges, and absence of livelihood programmes.Method: One hundred persons with disabilities were randomly drawn for the study from 50 self help groups in 2 districts that were covered under a popular poverty alleviation programme implemented by the state of Andhra Pradesh  in India.  An interview schedule was used to collect information.Results: Before joining the group, some of the persons with disabilities were mostly confined to their houses, and viewed as less productive and incapable of leading a ‘normal’ life. After joining the groups, they came out of their seclusion and started to work together for their collective welfare and development. They gained knowledge about their rights and privileges and started income generation activities with the help of loans made available to them.  They gained better acceptance within their families, but attitudes of their communities was slower to change. A feeling that “disability is not inability” seemed to have been internalized among the members of the groups.Conclusion: Self-help groups can be very effective in helping persons with disabilities to come out of their isolation and in promoting their participation and inclusion in societal mainstream.Key Words: Self-help group, persons with disabilitiesdoi 10.5463/DCID.v22i2.78

  10. Self-help group and the quality of life of patients with multiple sclerosis - Pilot study

    Directory of Open Access Journals (Sweden)

    Anna Eliášová

    2015-12-01

    Full Text Available Aim: The goal of the pilot study was to compare the quality of life of patients with multiple sclerosis in the Presov region with or without the support of a self-help group. Design: The character of this pilot study on patients with MS was related to the use of self-help groups and their impact on the assessment of the quality of life of the respondents, with the help of a questionnaire (WHOQOL-BREF. Methods: The research was carried out in the Prešov region with the help of the standardized WHOQOL-BREF questionnaire. Ninety-one patients with MS participated in the pilot study (46 respondents attended a self-help group and 35 did not. Results: The groups, when compared, aided by the statistically evaluated WHOQOL-BREF domains, were found to show significant differences in their evaluation of quality of life in three domains: domain one: physical health; domain two: surviving; domain three: social relations. Better scores were achieved in these domains by those who attended a group. In the physical sphere, we noticed significant differences in sleep quality, and sexual satisfaction (p < 0.001, while in social and economic areas, there were significant differences in satisfaction with personal relationships (p < 0.001, and economic circumstances (p < 0.01, self-contentment (p < 0.01, and coping with negative feelings (p < 0.05. Conclusion: Patients with multiple sclerosis can live normal lives provided they are supported by their families, friends, health care professionals, and self-help groups.

  11. Developing a self-help guide for traumatised university students in Iraq

    OpenAIRE

    Jaber, Saad Sabet

    2012-01-01

    Background: Iraqi people have been experiencing traumatic events continually for several decades. Consequently, high prevalence rates of trauma-related symptoms have been documented. In contrast, there is a clear lack in mental health services available for traumatised people. This study aimed to screen for PTSD, depression, and anxiety, assess related variables (e.g. coping strategies, posttraumatic cognitions, and social support), and develop a self-help guide (SHG) for traumatised universi...

  12. Is technology assisted guided self-help successful in treating female adolescents with bulimia nervosa?

    Science.gov (United States)

    Wagner, Gudrun; Wagner, Gudrun; Penelo, Eva; Nobis, Gerald; Mayerhofer, Anna; Schau, Johanna; Spitzer, Marion; Imgart, Hartmut; Karwautz, Andreas

    2013-01-01

    This study aims to evaluate the long-term outcome of new technology assisted guided self-help in adolescents with bulimia nervosa (BN). One hundred and twenty-six patients with BN (29 adolescents and 97 adults) were randomly allocated to a cognitive behavioural therapy-based self-help program delivered by the Internet or bibliotherapy, both accompanied by e-mail guidance. Outcomes were assessed at baseline, month 4, 7 and 18 including remission rates and eating disorder associated psychopathology. In all, 44% of adolescents vs. 38.7% of adults were in remission at month 7, and 55% of adolescents vs. 62.5% of adults were in remission at follow-up. Objective binge eating and compensatory behaviour improved significantly over time in both groups, with the highest decrease during the first 4 months. A significant decrease over time and no group differences have been found in almost all EDI-2 subscales. E-mail guided self-help (delivered via the Internet or bibliotherapy) is equally effective for adolescents as for adults with BN, and can be recommended as an initial step of treatment for this younger age group.

  13. The structure of social exchange in self-help support groups: development of a measure.

    Science.gov (United States)

    Brown, Louis D; Tang, Xiaohui; Hollman, Ruth L

    2014-03-01

    Self-help support groups are indigenous community resources designed to help people manage a variety of personal challenges, from alcohol abuse to xeroderma pigmentosum. The social exchanges that occur during group meetings are central to understanding how people benefit from participation. This paper examines the different types of social exchange behaviors that occur during meetings, using two studies to develop empirically distinct scales that reliably measure theoretically important types of exchange. Resource theory informed the initial measurement development efforts. Exploratory factor analyses from the first study led to revisions in the factor structure of the social exchange scales. The revised measure captured the exchange of emotional support, experiential information, humor, unwanted behaviors, and exchanges outside meetings. Confirmatory factor analyses from a follow-up study with a different sample of self-help support groups provided good model fit, suggesting the revised structure accurately represented the data. Further, the scales demonstrated good convergent and discriminant validity with related constructs. Future research can use the scales to identify aspects of social exchange that are most important in improving health outcomes among self-help support group participants. Groups can use the scales in practice to celebrate strengths and address weaknesses in their social exchange dynamics.

  14. A comparison of online versus workbook delivery of a self-help positive parenting program.

    Science.gov (United States)

    Sanders, Matthew R; Dittman, Cassandra K; Farruggia, Susan P; Keown, Louise J

    2014-06-01

    A noninferiority randomized trial design compared the efficacy of two self-help variants of the Triple P-Positive Parenting Program: an online version and a self-help workbook. We randomly assigned families of 193 children displaying early onset disruptive behavior difficulties to the online (N = 97) or workbook (N = 96) interventions. Parents completed questionnaire measures of child behavior, parenting, child maltreatment risk, personal adjustment and relationship quality at pre- and post-intervention and again at 6-month follow up. The short-term intervention effects of the Triple P Online program were not inferior to the workbook on the primary outcomes of disruptive child behavior and dysfunctional parenting as reported by both mothers and fathers. Both interventions were associated with significant and clinically meaningful declines from pre- to post-intervention in levels of disruptive child behavior, dysfunctional parenting styles, risk of child maltreatment, and inter-parental conflict on both mother and father report measures. Intervention effects were largely maintained at 6-month follow up, thus supporting the use of self-help parenting programs within a comprehensive population-based system of parenting support to reduce child maltreatment and behavioral problems in children.

  15. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >gnl|CMER|CME069C hypothetical protein MQSGSSEERVSSHMEARDSAPTASSMPSLRLTATATATATAR...LTYAHVSRPRPPAHLPRSDAYGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACDGSPSASTTSSSTATAR...PTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEADHPPQVHRQGSDVSHINHTTKKLLSLWLLARPTATVKATVKVLRSDARRCGPDLSTTAEQARCNCREQCRSRTHR

  16. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KGSWTFYIMLLASFRIFFGLGLSLSPMESWTIMNVVHAGVTFIVFHWIKGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSRKFLICVVVFLYLAAVHSTPFERQFFFVHAVNLIAFLVVFVAKLPFMHGVRIFGINR ... cds gnl|CMER >gnl|CMER|CMQ020C hypothetical protein, conserved MQSGHGETRFDVGVEWLRA

  17. Optimal Financing with CDS Markets

    NARCIS (Netherlands)

    Matta, R.

    2013-01-01

    One could argue that CDSs improve risk sharing, hence credit supply and financing terms for firms. Accordingly, one would expect risky borrowers to benefit the most from CDS insurance. This is in contrast, however, with recent empirical evidence (Ashcraft and Santos (2009) and Hirtle (2009)). This

  18. Internet-delivered or mailed self-help treatment for insomnia?: a randomized waiting-list controlled trial

    NARCIS (Netherlands)

    Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

    2012-01-01

    Cognitive Behavioral Therapy (CBT) is effective in reducing insomnia complaints, but the effects of self-help CBT have been inconsistent. The aim of this study was to determine the effectiveness of self-help for insomnia delivered in either electronic or paper-and-pencil format compared to a

  19. Baseline depression levels do not affect efficacy of cognitive-behavioral self-help treatment for insomnia

    NARCIS (Netherlands)

    Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

    2013-01-01

    Background: Cognitive-behavioral therapy can effectively treat insomnia (CBT-I). Randomized controlled trials have shown efficacy of self-help CBT-I, but unclear is whether excluding depressive patients boosted treatment effects. Method: We administered unsupported self-help CBT-I to insomnia

  20. Baseline depression levels do not affect efficacy of cognitive-behavioral self-help treatment for insomnia

    NARCIS (Netherlands)

    Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

    2013-01-01

    Background Cognitive-behavioral therapy can effectively treat insomnia (CBT-I). Randomized controlled trials have shown efficacy of self-help CBT-I, but unclear is whether excluding depressive patients boosted treatment effects. Method We administered unsupported self-help CBT-I to insomnia patients

  1. INTERBED: internet-based guided self-help for overweight and obese patients with full or subsyndromal binge eating disorder. A multicenter randomized controlled trial

    Directory of Open Access Journals (Sweden)

    de Zwaan Martina

    2012-11-01

    Full Text Available Abstract Background Binge eating disorder (BED is a prevalent clinical eating disorder associated with increased psychopathology, psychiatric comorbidity, overweight and obesity, and increased health care costs. Since its inclusion in the DSM-IV, a few randomized controlled trials (RCTs have suggested efficacy of book-based self-help interventions in the treatment of this disorder. However, evidence from larger RCTs is needed. Delivery of self-help through new technologies such as the internet should be investigated in particular, as these approaches have the potential to be more interactive and thus more attractive to patients than book-based approaches. This study will evaluate the efficacy of an internet-based guided self-help program (GSH-I and cognitive-behavioral therapy (CBT, which has been proven in several studies to be the gold standard treatment for BED, in a prospective multicenter randomized trial. Methods The study assumes the noninferiority of GSH-I compared to CBT. Both treatments lasted 4 months, and maintenance of outcome will be assessed 6 and 18 months after the end of treatment. A total of 175 patients with BED and a body mass index between 27 and 40 kg/m2 were randomized at 7 centers in Germany and Switzerland. A 20% attrition rate was assumed. As in most BED treatment trials, the difference in the number of binge eating days over the past 28 days is the primary outcome variable. Secondary outcome measures include the specific eating disorder psychopathology, general psychopathology, body weight, quality of life, and self-esteem. Predictors and moderators of treatment outcome will be determined, and the cost-effectiveness of both treatment conditions will be evaluated. Results The methodology for the INTERBED study has been detailed. Conclusions Although there is evidence that CBT is the first-line treatment for BED, it is not widely available. As BED is still a recent diagnostic category, many cases likely remain

  2. Implementing 'self-help friendliness' in German hospitals: a longitudinal study.

    Science.gov (United States)

    Trojan, Alf; Nickel, Stefan; Kofahl, Christopher

    2016-06-01

    In Germany, the term 'self-help friendliness' (SHF) describes a strategy to institutionalize co-operation of healthcare institutions with mutual aid or self-help groups of chronically ill patients. After a short explanation of the SHF concept and its development, we will present findings from a longitudinal study on the implementation of SHF in three German hospitals. Specifically, we wanted to know (i) to what degree SHF had been put into practice after the initial development phase in the pilot hospitals, (ii) whether it was possible to maintain the level of implementation of SHF in the course of at least 1 year and (iii) which opinions exist about the inclusion of SHF criteria in quality management systems. With only minor restrictions, the findings provide support for the usefulness, practicability, sustainability and transferability of SHF. Limitations of our empirical study are the small number of hospitals, the above average motivation of their staff, the small response rate in the staff-survey and the inability to get enough data from members of self-help groups. The research instrument for measuring SHF was adequate and fulfils the most important scientific quality criteria in a German context. We conclude that the implementation of SHF leads to more patient-centredness in healthcare institutions and thus improves satisfaction, self-management, coping and health literacy of patients. SHF is considered as an adequate approach for reorienting healthcare institutions in the sense of the Ottawa Charta, and particularly suitable for health promoting hospitals. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  3. A REVIEW OF SELF HELP GROUPS: ISSUE AND CHALLENGES IN INDIA

    OpenAIRE

    Anoop Dixit *, Dr. S. K. Sharma

    2017-01-01

    Basic purpose of this study is to review the challenges and issues faced by SHGs in India. It was found that SHG’s facilitated the members to become self dependent for solving their social & economic problems and enhances the social status of members by virtue of their being members to the group. Self help groups are small informal association of the poor created at the grass root level for the purpose of enabling members to reap economic benefits out of mutual help solidarity and joint respo...

  4. The effectiveness of self help technologies for emotional problems in adolescents: a systematic review

    Directory of Open Access Journals (Sweden)

    Bower Peter

    2008-07-01

    Full Text Available Abstract Background Adolescence is a transition period that involves physiological, psychological, and social changes. Emotional problems such as symptoms of anxiety and depression may develop due to these changes. Although many of these problems may not meet diagnostic thresholds, they may develop into more severe disorders and may impact on functioning. However, there are barriers that may make it difficult for adolescents to receive help from health professionals for such problems, one of which is the limited availability of formal psychological therapy. One way of increasing access to help for such problems is through self help technology (i.e. delivery of psychological help through information technology or paper based formats. Although there is a significant evidence base concerning self help in adults, the evidence base is much weaker in adolescents. This study aims to examine the effectiveness of self help technology for the treatment of emotional problems in adolescents by conducting a systematic review of randomized and quasi-experimental evidence. Methods Five major electronic databases were searched: Medline, PsycInfo, Embase, Cochrane Controlled Trials Register and CINAHL. In addition, nine journals were handsearched and the reference lists of all studies were examined for any additional studies. Fourteen studies were identified. Effect sizes were calculated across 3 outcome measures: attitude towards self (e.g. self esteem; social cognition (e.g. self efficacy; and emotional symptoms (i.e. depression and anxiety symptoms. Results Meta analysis showed small, non-significant effect size for attitude towards self (ES = -0.14, 95% CI = -0.72 to 0.43, a medium, non-significant effect size for social cognition (ES = -0.49, 95% CI = -1.23 to 0.25 and a medium, non-significant effect size for emotional symptoms (ES = -0.47, 95% CI = -1.00 to 0.07. However, these findings must be considered preliminary, because of the small number of

  5. Self-help on-line: an outcome evaluation of breast cancer bulletin boards.

    Science.gov (United States)

    Lieberman, Morton A; Goldstein, Benjamin A

    2005-11-01

    Many breast cancer patients find help from on-line self-help groups, consisting of self-directed, asynchronous, bulletin boards. These have yet to be empirically evaluated. Upon joining a group and 6 months later, new members (N=114) to breast cancer bulletin boards completed measures of depression (CES-D), growth (PTGI) and psychosocial wellbeing (FACT-B). Improvement was statistically significant on all three measures. This serves as a first validation of Internet bulletin boards as a source of support and help for breast cancer patients. These boards are of particular interest because they are free, accessible and support comes from peers and not from professional facilitators.

  6. Self-help cognitive-behavioral therapy for insomnia: a meta-analysis of randomized controlled trials.

    Science.gov (United States)

    Ho, Fiona Yan-Yee; Chung, Ka-Fai; Yeung, Wing-Fai; Ng, Tommy H; Kwan, Ka-Shing; Yung, Kam-Ping; Cheng, Sammy K

    2015-02-01

    Self-help cognitive-behavioral therapy (CBT) is an increasingly popular treatment option for insomnia. The objective of this meta-analysis was to compile an up-to-date evaluation on the efficacy, adherence, acceptability and dropout rate of self-help CBT for insomnia. We systematically searched six key electronic databases up until May 2013. Two researchers independently selected relevant publications, extracted data, and evaluated methodological quality according to the Cochrane criteria. Twenty randomized controlled trials were included; 10 of which were published after the last review up until January 2007. Meta-analysis of self-help CBT vs. waiting-list, routine care or no treatment was performed. Results showed that self-help CBT improved sleep, sleep-related cognitions and anxiety and depressive symptoms. Effect sizes for sleep-diary-derived sleep efficiency, sleep onset latency, and wake after sleep onset at immediate posttreatment were 0.80, 0.66, and 0.55, respectively. The average dropout rate of self-help CBT at immediate posttreatment was 14.5%, which was not significantly different from the 16.7% in therapist-administered CBT. Subgroup analyses supported the added benefit of telephone consultation. In conclusion, self-help CBT is efficacious and acceptable as an entry level of a stepped care model for insomnia. In places where face-to-face treatments are unavailable or too costly, self-help CBT can be considered as a compromise. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. How to implement the Science Fair Self-Help Development Program in schools

    Energy Technology Data Exchange (ETDEWEB)

    Menicucci, D.

    1994-01-01

    This manual is intended to act as a working guide for setting up a Science Fair Volunteer Support Committee at your school. The Science Fair Volunteer Support Committee, or SFVSC, is the key component of the Science Fair Self-Help program, which was developed by Sandia National Laboratories and is designed to support a school`s science activities. The SFVSC is a team of parents and community volunteers who work in concert with a school`s teaching staff to assist and manage all areas of a school Science and Engineering Fair. The main advantage of creating such a committee is that it frees the science teachers from the organizational aspects of the fair and lets them concentrate on their job of teaching science. This manual is based on information gained through a Self-Help Development pilot program that was developed by Sandia National Laboratories during the 1991--92 school year at three Albuquerque, NM, middle schools. The manual describes the techniques that were successful in the pilot program and discusses how these techniques might be implemented in other schools. This manual also discusses problems that may be encountered, including suggestions for how they might be resolved.

  8. Internet-Based Self-Help Intervention for ICD-11 Adjustment Disorder: Preliminary Findings.

    Science.gov (United States)

    Eimontas, Jonas; Rimsaite, Zivile; Gegieckaite, Goda; Zelviene, Paulina; Kazlauskas, Evaldas

    2018-06-01

    Adjustment disorder is one of the most diagnosed mental disorders. However, there is a lack of studies of specialized internet-based psychosocial interventions for adjustment disorder. We aimed to analyze the outcomes of an internet-based unguided self-help psychosocial intervention BADI for adjustment disorder in a two armed randomized controlled trial with a waiting list control group. In total 284 adult participants were randomized in this study. We measured adjustment disorder as a primary outcome, and psychological well-being as a secondary outcome at pre-intervention (T1) and one month after the intervention (T2). We found medium effect size of the intervention for the completer sample on adjustment disorder symptoms. Intervention was effective for those participants who used it at least one time in 30-day period. Our results revealed the potential of unguided internet-based self-help intervention for adjustment disorder. However, high dropout rates in the study limits the generalization of the outcomes of the intervention only to completers.

  9. Communal normalization in an online self-help group for adolescents with a mentally ill parent.

    Science.gov (United States)

    Trondsen, Marianne V; Tjora, Aksel

    2014-10-01

    Although implications of parental mental illness are well documented, most children of mentally ill parents are left to manage their family situation with limited information and support. We explored the role of a Norwegian online self-help group for adolescents (aged 15 to 18) with a mentally ill parent. Through in-depth interviews with 13 participants, we found that the online self-help group provided "communal normalization" by which participants, through communication in the forum, made sense of everyday experiences and emotions arising from having a mentally ill parent. We identified three main aspects of this process-recognizability, openness, and agency-all of which were important for the adolescents' efforts to obtain support, to be supportive, and to handle everyday life situations better. Communal normalization might provide resources for significantly improving the participants' life situations, and could demonstrate similar potential for users in other situations characterized by stigma, loneliness, silence, and health worries. © The Author(s) 2014.

  10. Sleep education with self-help treatment and sleep health promotion for mental and physical wellness in Japan

    OpenAIRE

    Tanaka, Hideki; Tamura, Norihisa

    2015-01-01

    The purpose of this article was to provide an overview of the effects of the sleep education with self-help treatment for student, teacher, and local resident and sleep health promotion for mental and physical wellness for elderly with actual examples of public health from the community and schools. Sleep education with self-help treatment in schools revealed that delayed or irregular sleep/wake patterns were significantly improved. Also, it was effective for improving sleep-onset latency, sl...

  11. Behavior change through automated e-mails: mediation analysis of self-help strategy use for depressive symptoms.

    Science.gov (United States)

    Morgan, Amy J; Mackinnon, Andrew J; Jorm, Anthony F

    2013-02-01

    To evaluate whether automated e-mails promoting effective self-help strategies for depressive symptoms were effective in changing self-help behavior, and whether this improved depression outcomes. 568 adults with sub-threshold depression participated in a randomized controlled trial and provided complete data. A series of 12 e-mails promoting the use of evidence-based self-help strategies was compared with e-mails providing non-directive depression information. Depression symptoms were assessed with the Patient Health Questionnaire depression scale (PHQ-9) and use of self-help strategies was assessed at baseline and post-intervention. We hypothesized that those receiving the self-help e-mails would increase their use of evidence-based self-help and this would be associated with improvements in depression. Mediation analyses were conducted using a non-parametric bootstrapping procedure. Total use of the self-help strategies promoted in the e-mails significantly mediated the effect of the intervention on depressive symptoms (B = -0.75, SE = 0.16, 95% CI: -1.06 to -0.48). The direct effect of the intervention on depressive symptoms was much smaller and not significant when the mediation path was included. The majority of the individual strategies also had a significant indirect effect on depressive symptoms. In adults with sub-threshold depression, automated e-mails based on behavior change principles can successfully increase use of self-help strategies, leading to a reduction in depressive symptoms. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. A configurable CDS for the production laboratory

    CERN Document Server

    Meek, Irish

    2003-01-01

    Various aspects of a configurable chromatography data system (CDS) for the production laboratory are discussed. The Atlas CDS can be configured extensively to fit the production laboratory work flow and meet the needs of analysts. The CDS can also be configured to automatically create a sample sequence with the required number of injections and download methods to the dedicated instrument. The Atlas Quick Start wizard offers uses quick way of generating a sequence from a predefined template and starting a run. (Edited abstract).

  13. Health education in self-help groups to promote healthy lifestyles

    Directory of Open Access Journals (Sweden)

    Bruno López de la Vega

    2012-12-01

    Full Text Available In this review we discuss the formation of self-help groups (GAM in order to help to counteract diseases, illnesses or conditions assertively, effective and above all positive, this in order to integrate health education in its multidisciplinary approach to create GAM that provide viable alternatives to modify unhealthy lifestyles or unhealthy. It is important the introduction of health education in the creation and sustenance of the same, as it provides a different perspective on the implementation of plans, programs and projects open to meet learning needs and changes in lifestyle with the help of support networks and psycho-emotional aspects intervention, which aims to achieve stability at individual and collective level.

  14. Self-help groups for former patients: relations with mental health professionals.

    Science.gov (United States)

    Emerick, R E

    1990-04-01

    Data from a national survey of 104 self-help groups for former mental patients were examined to assess actual and potential partnerships between these groups and mental health professionals. The groups' level of interaction with and attitudes toward professionals varied with the structure, affiliation, and service model of the groups. The majority were moderate "supportive" groups in which partnerships with professionals could occur but were problematic. Less common were radical "separatist" groups, with which professional partnerships were almost guaranteed to fail, and conservative "partnership" groups, with which partnerships were likely to succeed. Strong antipsychiatric attitudes throughout the mental patient movement suggest that mental health professionals who approach former-patient groups with narrow clinical conceptions of mental illness are likely to fail in establishing partnerships.

  15. Self-help countermeasure strategies for populations living within contaminated areas of Belarus, Russia and Ukraine

    International Nuclear Information System (INIS)

    Beresford, N.A.; Voigt, G.; Wright, S.M.; Howard, B.J.; Barnett, C.L.; Prister, B.; Balonov, M.; Ratnikov, A.; Travnikova, I.; Gillett, A.G.; Mehli, H.; Skuterud, L.; Lepicard, S.; Semiochkina, N.; Perepeliantnikova, L.; Goncharova, N.; Arkhipov, A.N.

    2001-01-01

    Countermeasures have been effectively employed within intensive agricultural systems in areas of the Former Soviet Union (FSU) affected by the Chernobyl accident. However, ingestion doses continue to be elevated in some areas as a result of few foodstuffs which are collected from the wild or produced by the household. Forest fungi and berries, and milk from privately owned cattle are the most notable contributors to 137 Cs intakes amongst these foodstuffs. In this paper we consider advice which would help affected populations to both understand the importance of these exposure routes and to reduce their exposure. In addition to the potential radiological benefits, self-help schemes are highly cost-effective and likely to have a positive psychological influence on populations living within contaminated areas of the FSU. Evidence to suggest that the transfer of radiocaesium to cow milk is considerably higher in the FSU than within western Europe and North America is discussed

  16. Reducing Anxiety Using Self-Help Virtual Reality Cognitive Behavioral Therapy.

    Science.gov (United States)

    Piercey, C Darren; Charlton, Kate; Callewaert, Carl

    2012-04-01

    Virtual reality (VR) software has been used successfully for the treatment of various phobias and anxieties. The delivery of this software is often performed using expensive head-mounted VR displays with a therapist present to manipulate the VR scenario. The purpose of this study was to determine the effectiveness of self-help VR software delivered using red/blue anaglyph glasses, for the treatment of spider phobia. Participants used the software on their own without having a researcher or therapist present. The software provided instruction on the use of progressive muscle relaxation in conjunction with VR exposure therapy. Exposure therapy is the gold standard treatment for anxiety and phobia. For VR exposure therapy to be effective, the environment must produce a real fear response. Participants' physiological responses indicate that the VR software successfully produced a fear response. Self-report questionnaires indicated that the participants' level of fear for spiders decreased after taking part in four sessions.

  17. Primary care in the village. An approach to village self-help health programmes.

    Science.gov (United States)

    Suyadi, A; Sadjimin, T; Rohde, J E

    1977-07-01

    The health clinic run in Kalirandu, Indonesia, by Foster Parents Plan, a private philanthropic welfare organization is described. In 1974 the Plan was serving 3000 families through 4 clinics, providing general curative services, pre- and postnatal services, family planning, dental care, and referral to the local urban hospital where needed. Each clinic treated about 100 patients per day at a cost of $1 per client family per month. However, few inocculations were given and few preventive health checks were requested. When the number of Plan families grew to 9500 while the population of the served communities grew to 400,000 with no increase in clinic budget, a different approach was tried. Instead of serving only the families helped direactly by the Plan, a total community service was developed. Plan personnel began to encourage use of the government health clinics. A rural health insurance system was developed which entitles the families to preventive health services. Plan medical staff and the local health center trained volunteers from Kalirandu in the use of a few simple medicines. The volunteers were selected by the village headmen and generally have elementary school education and a position of responsibility. This health "kader" works without payment and has 10-15 families living near him for whom he is responsible. At the time of writing there were over 500 kaders trained. Inservice courses are conducted to keep them up-to-date. An acceptors club was formed to motivate use of family planning. Seeking a more active role in village life, the acceptors club then took on child nutrition as a project, weighing children and reminding mothers of inoculations. The self-help momentum is spreading to housing and better farming practices, which is providing more vegetable gardens and better sources of Vitamin A. It is emphasized that this type of group responsibility cannot be imposed from outside. It is community leaders within that provide the motivation for self-help

  18. 41 CFR 102-75.595 - What responsibilities do landholding agencies have concerning properties to be used for self-help...

    Science.gov (United States)

    2010-07-01

    ... landholding agencies have concerning properties to be used for self-help housing or housing assistance use... Real Property Disposal Property for Providing Self-Help Housing Or Housing Assistance § 102-75.595 What responsibilities do landholding agencies have concerning properties to be used for self-help housing or housing...

  19. Development and preliminary testing of a web-based, self-help application for disaster-affected families.

    Science.gov (United States)

    Yuen, Erica K; Gros, Kirstin; Welsh, Kyleen E; McCauley, Jenna; Resnick, Heidi S; Danielson, Carla K; Price, Matthew; Ruggiero, Kenneth J

    2016-09-01

    Technology-based self-help interventions have the potential to increase access to evidence-based mental healthcare, especially for families affected by natural disasters. However, development of these interventions is a complex process and poses unique challenges. Usability testing, which assesses the ability of individuals to use an application successfully, can have a significant impact on the quality of a self-help intervention. This article describes (a) the development of a novel web-based multi-module self-help intervention for disaster-affected adolescents and their parents and (b) a mixed-methods formal usability study to evaluate user response. A total of 24 adolescents were observed, videotaped, and interviewed as they used the depressed mood component of the self-help intervention. Quantitative results indicated an above-average user experience, and qualitative analysis identified 120 unique usability issues. We discuss the challenges of developing self-help applications, including design considerations and the value of usability testing in technology-based interventions, as well as our plan for widespread dissemination. © The Author(s) 2015.

  20. [Classification of gamblers from self-help groups using cluster analysis].

    Science.gov (United States)

    Meyer, G

    1991-01-01

    In an empirically based classification by cluster analysis of 437 gamblers from self-help groups five distinct homogeneous subgroups were determined on the basis of such characteristics as frequency of gambling of various kinds, function of gambling and sensation during gambling, symptoms of pathological gambling as well as personality characteristics. These can be characterized as: Pathological slot-machine gamblers with 1) an emotionally instable, depressive-aggressive personality structure and 2) an emotionally instable, depressive personality structure; 3) pathological gamblers on German-style slot-machines and 4) pathological gamblers on classical games of chance--both without conspicuous personality, and 5) gamblers on German-style slot-machines under a subjective strain. On the whole, the distinctions are due to psychological variables, the social data hardly differ. A comparison of the subgroups on the basis of variables regarding the course and result of treatment shows that the pathological gamblers with a conspicuous personality structure more often failed to reach, the goal of abstinence set by "Gamblers Anonymous" and instead report about an improvement of their gambling behaviour. On the other hand, the gamblers on German-style slot-machines who were under a subjective strain more often found it easier to stop gambling completely. The results of the cluster analysis are compared with clinical diagnostic classifications of gamblers who received out-patient or in-patient treatment as well as with empirical classifications of addicts, and first hypotheses of a differential therapy indication are being discussed.

  1. Health Care and Women's Empowerment: The role of Self Help Groups

    Directory of Open Access Journals (Sweden)

    S Chakravarty

    2012-02-01

    Full Text Available Over the last couple of decades the concept of Self Help Groups (SHGs and its potential as an effective tool to alleviate poverty and empower women has garnered considerable interest worldwide. Considering the importance given by policy makers across various nations to the group approach while conceptualizing, formulating and implementing any scheme or programme for the welfare of marginalized and underprivileged sections of the society (especially women, we identified the need to critically examine and explore the role of SHGs in the empowerment of women with a special emphasis on health status. To date, the functioning of SHGs has essentially been viewed only from an economic perspective. The existing approach puts encourages the economic development of women, with SHGs a mechanism to achieving this. However, how these economic benefits are being translated into the change in women’s status, particularly their health status, remains unexplored and ultimately unaddressed. This working research paper attempts to review the scope and limitations of SHGs in improving women’s health and empowerment based upon empirical work undertaken in the Jharkhand state of India. Our paper also explores the extent to which SHGs can be involved in attaining better health status for women, and thereby point the way for further research.   

  2. Effectiveness of complementary and self-help treatments for anxiety disorders.

    Science.gov (United States)

    Jorm, Anthony F; Christensen, Helen; Griffiths, Kathleen M; Parslow, Ruth A; Rodgers, Bryan; Blewitt, Kelly A

    2004-10-04

    To review the evidence for the effectiveness of complementary and self-help treatments for anxiety disorders. Systematic literature search using PubMed, PsycLit, and the Cochrane Library. 108 treatments were identified and grouped under the categories of medicines and homoeopathic remedies, physical treatments, lifestyle, and dietary changes. We give a description of the 34 treatments (for which evidence was found in the literature searched), the rationale behind the treatments, a review of studies on effectiveness, and the level of evidence for the effectiveness studies. The treatments with the best evidence of effectiveness are kava (for generalised anxiety), exercise (for generalised anxiety), relaxation training (for generalised anxiety, panic disorder, dental phobia and test anxiety) and bibliotherapy (for specific phobias). There is more limited evidence to support the effectiveness of acupuncture, music, autogenic training and meditation for generalised anxiety; for inositol in the treatment of panic disorder and obsessive-compulsive disorder; and for alcohol avoidance by people with alcohol-use disorders to reduce a range of anxiety disorders.

  3. The Angst of Youth in Post-Industrial Japan: A Narrative Self-help Approach

    Directory of Open Access Journals (Sweden)

    Rie Kido

    2016-07-01

    Full Text Available This paper explores the experience of angst (ikizurasa among youth in long- term unemployment in post-industrial Japan, and proposes a model for supporting them. Currently, the dominant model for unemployment support consists of activation policies, which assume that users can identify their problems and clarify their needs in job seeking. However, for youth in situations of long-term unemployment, the effectiveness of these policies is limited. This paper argues that indirect support which focuses on (reconstructing human relationships through sharing narratives is a more effective way to help such youth mitigate their angst. In-depth interviews with two participants in a Self-Help Group for youth affected by long-term unemployment, as well as participant observations of the group, reveal how a narrative approach allowed participants to build new senses of self founded in realities shared by others. The analysis shows how these developments were crucial to helping the participants to find employment that suited their situations and needs.

  4. The Role of Motivation in Family-Based Guided Self-Help Treatment for Pediatric Obesity

    Science.gov (United States)

    Norman, Gregory J.; Crow, Scott J.; Rock, Cheryl L.; Boutelle, Kerri N.

    2014-01-01

    Abstract Background: Identifying factors associated with effective treatment for childhood obesity is important to improving weight loss outcomes. The current study investigated whether child or parent motivation throughout the course of treatment predicted reductions in BMI. Methods: Fifty 8- to 12-year-old children with overweight and obesity (BMI percentiles 85–98%) and their parents participated in a guided self-help weight loss program, which included 12 brief sessions across 5 months. Parents and interventionists reported on child and parent motivation level at each session. Multilevel slopes-as-outcome models were used to examine growth trajectories for both child and parent BMI across sessions. Results: Greater interventionist-rated child motivation predicted greater reductions in child BMI; parent motivation did not. However, interventionist-rated parent motivation predicted greater reductions in parent BMI, and its impact on BMI became more pronounced over the course of treatment, such that sustained motivation was more important than initial motivation. Children who were older, Latino, or who had lower initial BMIs had slower reductions in BMI. Conclusions: This study suggests that motivation may be an important predictor of reduced BMI in child obesity treatment, with sustained motivation being more important than initial motivation. In particular, interventionist-rated, but not parent-rated, motivation is a robust predictor of child and parent BMI outcomes. Future research may evaluate whether motivational interventions can enhance outcome, with particular attention to improving outcomes for Latino children. PMID:25181608

  5. Effectiveness of online self-help for suicidal thoughts: results of a randomised controlled trial.

    Directory of Open Access Journals (Sweden)

    Bregje A J van Spijker

    Full Text Available Many people with suicidal thoughts do not receive treatment. The Internet can be used to reach more people in need of support.To test the effectiveness of unguided online self-help to reduce suicidal thoughts.236 adults with mild to moderate suicidal thoughts were randomised to the intervention (n=116 or a waitlist control group (n=120. Assessments took place at baseline, and 2, 4 and 6 weeks later. Primary outcome was suicidal thoughts. Secondary outcomes were depressive symptoms, anxiety, hopelessness, worry, and health status.The intervention group showed a small significant effect in reducing suicidal thoughts (d=0.28. Effects were more pronounced for those with a history of repeated suicide attempts. There was also a significant reduction in worry (d=0.33. All other secondary outcomes showed small but non-significant improvements.Although effect sizes were small, the reach of the internet could enable this intervention to help many people reduce their suicidal thoughts.Netherlands Trial Register NTR1689.

  6. Self-help organisations as patient representatives in health care and policy decision-making.

    Science.gov (United States)

    Rojatz, Daniela; Forster, Rudolf

    2017-10-01

    A crucial question about participation is who is legitimised, willing and capable of representing particular collectives. Social insurance health care systems tend to focus on representation by patient organisations. Self-help organisations (SHOs), as one type of 'health consumer and patient organisation', often take over this role. Research findings indicate that participation by SHOs is accompanied by high expectations, but also by concerns about the risks of instrumental abuse, overload and professionalisation. However, there is a dearth of in-depth knowledge about both potential and risks of participating for the SHO. To tackle this research gap, a qualitative study design was used to investigate fifteen SHOs in Austria. Data were generated by expert interviews with SHO representatives and documentary analysis of SHO websites. Content analysis was applied. SHOs in Austria advocate for patients' interests, participate in invited spaces and have various forms of cooperative relations with the health care system. Thereby, they draw on the experiential knowledge of their members without, however, systematising it. Experiences with professionalisation and instrumental use are ambiguous, whereas overload is prevalent. SHOs need resources for reflection in order to define their position visà- vis the health system and to realise their potential as patient representatives. Deepening co-operation with the health care system might lead to new participatory practices acknowledging differences in culture and the resources of both sides. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Privacy-Preserving Self-Helped Medical Diagnosis Scheme Based on Secure Two-Party Computation in Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Yi Sun

    2014-01-01

    Full Text Available With the continuing growth of wireless sensor networks in pervasive medical care, people pay more and more attention to privacy in medical monitoring, diagnosis, treatment, and patient care. On one hand, we expect the public health institutions to provide us with better service. On the other hand, we would not like to leak our personal health information to them. In order to balance this contradiction, in this paper we design a privacy-preserving self-helped medical diagnosis scheme based on secure two-party computation in wireless sensor networks so that patients can privately diagnose themselves by inputting a health card into a self-helped medical diagnosis ATM to obtain a diagnostic report just like drawing money from a bank ATM without revealing patients’ health information and doctors’ diagnostic skill. It makes secure self-helped disease diagnosis feasible and greatly benefits patients as well as relieving the heavy pressure of public health institutions.

  8. Weekly brief phone support in self-help cognitive behavioral therapy for insomnia disorder: Relevance to adherence and efficacy.

    Science.gov (United States)

    Ho, Fiona Yan-Yee; Chung, Ka-Fai; Yeung, Wing-Fai; Ng, Tommy Ho-Yee; Cheng, Sammy Kin-Wing

    2014-12-01

    Self-help cognitive-behavioral therapy for insomnia (CBT-I) is an acceptable, low-intensity treatment in a stepped care model for insomnia. We tested the application of self-help CBT-I in a Chinese population. 312 participants with self-report of insomnia associated with distress or daytime impairment 3 or more nights per week for at least 3 months were randomized to self-help CBT-I with telephone support (SHS), self-help CBT-I (SH) and waiting-list (WL). The program was Internet-based with treatment materials delivered once per week, and lasted for 6 consecutive weeks, while the telephone support was limited to 15 min weekly. Mixed-effects analyses found significant group by time interaction in sleep and sleep-related cognitions at immediate and 4-week posttreatment. Post-hoc pairwise comparison with WL revealed that both SHS and SH had significantly higher sleep efficiency at immediate (p = .004 and p = .03, respectively) and 4-week posttreatment (p = .002 and p = .02, respectively) and lower insomnia and dysfunctional beliefs scores. The SHS group had additional improvements in sleep onset latency and sleep quality. Benefits with self-help CBT-I were maintained at 12-week posttreatment, but attrition rate was about 35%. Internet-based self-help CBT-I was effective and acceptable for treating insomnia in the Chinese population. A brief telephone support further enhanced the efficacy. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Book Review: Book review

    Science.gov (United States)

    Manohar, C. S.

    2015-02-01

    The subject of the theory of vibrations has carried an aesthetic appeal to generations of engineering students for its richness of ideas, and for the intellectual challenges it offers. Also, the diverse range of its applications (covering civil, mechanical, automotive, and aerospace structures) has provided obvious motivations for its study. For most students, the subject provides, perhaps, the first encounter in substantial application of mathematical tools (differential equations, calculus of variations, Fourier/Laplace transforms, and matrix algebra) to engineering problems. The intimate relationship that the subject of mechanics has with mathematics strikes home probably for the first time. While teaching this subject, the instructor is spoilt for choice in selecting a text book and so are the students who wish to pursue a self-study of the subject. Many luminaries in the field have offered their own exposition of the subject: starting from the classics of Rayleigh, Timoshenko, Den Hartog, Bishop and Johnson, and the works of more recent vintage (e.g., the books by Meirovich, Clough, and Penzien, and works with computational flavour, such as, those by Bathe and Petyt), several works easily come to one's mind. Given this milieu, it requires a distinctive conviction to write a new book on this subject. And, here we have a book, written by a practitioner, which aims to deal with fundamental aspects of vibrations of engineering systems. The scepticism that this reviewer had on the need for having one more such book vanished as he browsed through the book and read selectively a few sections. The author's gift for elegant explanations is immediately noticeable even in such a preliminary reading. After a more careful reading, the reviewer has found this book to be insightful and he considers the book to be a welcome addition to the family of books on vibration engineering. The author has struck a fine balance between physical explanations, mathematical niceties

  10. Analysis of syntax and word use to predict successful participation in guided self-help for anxiety and depression

    DEFF Research Database (Denmark)

    Zinken, Jörg; Zinken, Katarzyna; Wilson, J. Clare

    2010-01-01

    This study investigated whether an analysis of narrative style (word use and cross-clausal syntax) of patients with symptoms of generalised anxiety and depression disorders can help predict the likelihood of successful participation in guided self-help. Texts by 97 people who had made contact...... with a primary care mental health service were analysed. Outcome measures were completion of the guided self-help programme, and change in symptoms assessed by a standardised scale (CORE-OM). Regression analyses indicated that some aspects of participants' syntax helped to predict completion of the programme...

  11. Dynamic Modeling of CDS Index Tranche Spreads

    DEFF Research Database (Denmark)

    Dorn, Jochen

    This paper provides a Market Model which implies a dynamics for standardized CDS index tranche spreads, i.e. tranches which securitise CDS index series and dispose of predefined subordination. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling...... options on structured credit derivatives. With the upcoming regulation of the CDS market in perspective, the model presented here is also an attempt to face the effects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke...... tenors/tranche subordination to market data obtained by more liquid Index Tranche Options with standard characteristics....

  12. Guided Self-Help Treatment for Recurrent Binge Eating: Replication and Extension

    Science.gov (United States)

    DeBar, Lynn L.; Striegel-Moore, Ruth H.; Wilson, G. Terence; Perrin, Nancy; Yarborough, Bobbi Jo; Dickerson, John; Lynch, Frances; Rosselli, Francine; Kraemer, Helena C.

    2014-01-01

    Objective The aim of this study was to replicate and extend results of a previous blended efficacy and effectiveness trial of a low-intensity, manual-based guided self-help form of cognitive-behavioral therapy (CBT-GSH) for the treatment of binge eating disorders in a large health maintenance organization (HMO) and to compare them with usual care. Methods To extend earlier findings, the investigators modified earlier recruitment and assessment approaches and conducted a randomized clinical trial to better reflect procedures that may be reasonably carried out in real-world practices. The intervention was delivered by master’s-level interventionists to 160 female members of a health maintenance organization who met diagnostic criteria for recurrent binge eating. Data collected at baseline, immediately posttreatment, and at six- and 12-month follow-ups were used in intent-to-treat analyses. Results At the 12-month follow-up, CBT-GSH resulted in greater remission from binge eating (35%, N=26) than usual care (14%, N=10) (number needed to treat=5). The CBT-GSH group also demonstrated greater improvements in dietary restraint (d=.71) and eating, shape, and weight concerns (d=1.10, 1.24, and .98, respectively) but not weight change. Conclusions Replication of the pattern of previous findings suggests that CBT-GSH is a robust treatment for patients with recurrent binge eating. The magnitude of changes was significantly smaller than in the original study, however, suggesting that patients recruited and assessed with less intensive procedures may respond differently from their counterparts enrolled in trials requiring more comprehensive procedures. PMID:21459987

  13. Cognitive-Behavioral Guided Self-Help for the Treatment of Recurrent Binge Eating

    Science.gov (United States)

    Striegel-Moore, Ruth H.; Wilson, G. Terence; DeBar, Lynn; Perrin, Nancy; Lynch, Frances; Rosselli, Francine; Kraemer, Helena C.

    2010-01-01

    Objective Despite proven efficacy of cognitive-behavioral therapy (CBT) for treating eating disorders with binge eating as the core symptom, few patients receive CBT in clinical practice. Our blended efficacy-effectiveness study sought to evaluate whether a manual-based guided self-help form of CBT (CBT-GSH), delivered in 8 sessions in a Health Maintenance Organization setting over a 12-week period by masters level interventionists, is more effective than treatment as usual (TAU). Method In all, 123 individuals (mean age = 37.2, 91.9% female, 96.7% non-Hispanic White) were randomized, including 10.6% with bulimia nervosa (BN), 48% with Binge Eating Disorder (BED), and 41.4% with recurrent binge eating in the absence of BN or BED. Baseline, post-treatment, and 6- and 12 month follow-up data were used in intent-to-treat analyses. At 12-month follow-up, CBT-GSH resulted in greater abstinence from binge eating (64.2%) than TAU (44.6%, Number Needed to Treat = 5), as measured by the Eating Disorder Examination (EDE, Fairburn & Cooper, 1993). Secondary outcomes reflected greater improvements in the CBT-GSH group in dietary restraint (d = .30), eating-, shape-, and weight concern (d’s = .54, 1.01, .49) (measured by the EDE-Questionnaire, respectively, Fairburn & Beglin, 2008), depression (d = .56) (Beck Depression Inventory, Beck, Steer, & Garbin, 1988), and social adjustment (d = .58) (Work and Social Adjustment Scale, Mundt, Marks, Shear, & Greist, 2002), but not weight change. Conclusions CBT-GSH is a viable first-line treatment option for the majority of patients with recurrent binge eating who do not meet diagnostic criteria for BN or anorexia nervosa. PMID:20515207

  14. Outpatient Tinnitus Clinic, Self-Help Web Platform, or Mobile Application to Recruit Tinnitus Study Samples?

    Directory of Open Access Journals (Sweden)

    Thomas Probst

    2017-04-01

    Full Text Available For understanding the heterogeneity of tinnitus, large samples are required. However, investigations on how samples recruited by different methods differ from each other are lacking. In the present study, three large samples each recruited by different means were compared: N = 5017 individuals registered at a self-help web platform for tinnitus (crowdsourcing platform Tinnitus Talk, N = 867 users of a smart mobile application for tinnitus (crowdsensing platform TrackYourTinnitus, and N = 3786 patients contacting an outpatient tinnitus clinic (Tinnitus Center of the University Hospital Regensburg. The three samples were compared regarding age, gender, and duration of tinnitus (month or years perceiving tinnitus; subjective report using chi-squared tests. The three samples significantly differed from each other in age, gender and tinnitus duration (p < 0.05. Users of the TrackYourTinnitus crowdsensing platform were younger, users of the Tinnitus Talk crowdsourcing platform had more often female gender, and users of both newer technologies (crowdsourcing and crowdsensing had more frequently acute/subacute tinnitus (<3 months and 4–6 months as well as a very long tinnitus duration (>20 years. The implications of these findings for clinical research are that newer technologies such as crowdsourcing and crowdsensing platforms offer the possibility to reach individuals hard to get in contact with at an outpatient tinnitus clinic. Depending on the aims and the inclusion/exclusion criteria of a given study, different recruiting strategies (clinic and/or newer technologies offer different advantages and disadvantages. In general, the representativeness of study results might be increased when tinnitus study samples are recruited in the clinic as well as via crowdsourcing and crowdsensing.

  15. Mental health orientation for self-help group members: A feasibility study

    Directory of Open Access Journals (Sweden)

    Basavaraj Shrinivasa

    2017-01-01

    Full Text Available Background: Treatment gap for mental health care in low- and middle-income (LAMI countries is very large, and building workforce using the locally available resources is very much essential in reducing this gap. The current study is a preliminary work toward this direction. Materials and Methods: A single group pre- and post-design was considered for assessing the feasibility of Mental Health Orientation (MHO Program for Self-Help Group members. Assessment of participants' MHO using Orientation Towards Mental Illness (OMI scale was undertaken at three levels: baseline assessment before the intervention, after completing 2 days orientation program, and 6 weeks later. Results: Analysis of data resulted in statistically significant mean scores in the domains of areas of causation (F[1.41, 40.7] = 21.7, P< 0.000, ηp2 = 0.428, perception of abnormality (F[1.27, 36.8] = 15.8, P< 0.000, ηp2 = 0.353, treatment (F[1.42, 41.3] = 34.8, P< 0.000, ηp2 = 0.546, and after effect (F[1.36,39.4] = 26.7, P< 0.000, ηp2 = 0.480. Although the overall mean scores of all the domains of OMI were found to be statistically significantly different, there was no significant difference in the mean scores between post and follow-up assessments on areas of causation (μd = 1.27, P = 0.440 and treatment (μd = 1.00, P = 0.156. Conclusion: Overall, the findings of our study demonstrate that brief MHO program can exert a beneficial effect on bringing about significant change in the orientation of the participants toward mental illness but need to be refreshed over time to make the impact of the program stay longer.

  16. Parental guided self-help family based treatment for adolescents with anorexia nervosa: A feasibility study.

    Science.gov (United States)

    Lock, James; Darcy, Alison; Fitzpatrick, Kathleen Kara; Vierhile, Molly; Sadeh-Sharvit, Shiri

    2017-09-01

    Family-based treatment (FBT) is an evidence-based treatment for adolescent anorexia nervosa (AN), but many families cannot access it. This study evaluated feasibility, acceptability, and preliminary treatment effects of a parental guided self-help (GSH) version of FBT for adolescent AN. This was a case-series design. Parents of medically stable adolescents (11-18 years) with DSM-5 AN were recruited over 12 months. Parents received online training in parental GSH FBT and 12 20-30 min GSH sessions by phone or online over 6 months. Recruitment, dropout, changes in weight, and eating-related psychopathology were assessed. Analyses used mixed modeling that included all data for all participants. Of the 19 families that participated, most were white (94%) and from intact families (88%). Baseline median BMI (mBMI) percent was 85.01% (SD = 4.31). Participants' mBMI percent increased to 97.31% (SD ± 7.48) at the end of treatment (EOT) (ES = 2.06; CI= 0.13-3.99). Eating-related psychopathology improved by EOT (ES = 0.58; CI=.04-1.21). Dropout rate was 21% during treatment and 33% during follow-up. Parental GSH-FBT is feasible and acceptable to families willing to undertake online treatment. Follow-up data was only available for nine families (47%); thus further systematic evaluation is required before reaching conclusions about the efficacy of this approach. © 2017 Wiley Periodicals, Inc.

  17. Sitting with others: mental health self-help groups in northern Ghana

    Directory of Open Access Journals (Sweden)

    Cohen Alex

    2012-03-01

    Full Text Available Abstract Background Over the past four decades, there has been increasing interest in Self-Help Groups, by mental health services users and caregivers, alike. Research in high-income countries suggests that participation in SHGs is associated with decreased use of inpatient facilities, improved social functioning among service users, and decreased caregiver burden. The formation of SHGs has become an important component of mental health programmes operated by non-governmental organisations (NGOs in low-income countries. However, there has been relatively little research examining the benefits of SHGs in this context. Methods Qualitative research with 18 SHGs, five local non-governmental organisations, community mental health nurses, administrators in Ghana Health Services, and discussions with BasicNeeds staff. Results SHGs have the potential to serve as key components of community mental health programmes in low-resource settings. The strongest evidence concerns how SHGs provide a range of supports, e.g., social, financial, and practical, to service users and caregivers. The groups also appear to foster greater acceptance of service users by their families and by communities at large. Membership in SHGs appears to be associated with more consistent treatment and better outcomes for those who are ill. Discussion This study highlights the need for longitudinal qualitative and quantitative evaluations of the effect of SHGs on clinical, social and economic outcomes of service users and their carers. Conclusions The organisation of SHGs appears to be associated with positive outcomes for service users and caregivers. However, there is a need to better understand how SHGs operate and the challenges they face.

  18. What do we know about speculation in the CDS market?

    NARCIS (Netherlands)

    L. Norden (Lars); K. Radoeva (Kristina)

    2012-01-01

    textabstractWe measure speculation in the CDS market and investigate its determinants. The CDS volume on a firm that exceeds its outstanding debt (= naked CDS) indicates speculation since hedging can be ruled out. Using weekly CDS trading volume data for actively traded U.S. firms during 2008-2012,

  19. The Self-help Online against Suicidal thoughts (SOS) trial : Study protocol for a randomized controlled trial

    NARCIS (Netherlands)

    Mühlmann, Charlotte; Madsen, Trine; Hjorthøj, Carsten; Kerkhof, Ad; Nordentoft, Merete; Erlangsen, Annette

    2017-01-01

    Background: Suicidal thoughts are common, causing distress for millions of people all over the world. However, people with suicidal thoughts might not access support due to financial restraints, stigma or a lack of available treatment offers. Self-help programs provided online could overcome these

  20. Development and Pilot Testing of an Internet-Based Self-Help Intervention for Depression for Indian Users.

    Science.gov (United States)

    Mehrotra, Seema; Sudhir, Paulomi; Rao, Girish; Thirthalli, Jagadisha; Srikanth, T K

    2018-03-22

    There is a dearth of published research on uptake and utility of mental health apps in India, despite a rising global trend in the application of technology in the field of mental health. We describe the development and pilot testing of a self-help intervention for depression, PUSH-D (Practice and Use Self-Help for Depression) for urban Indians. This guided self-help app, with essential and optional zone sections, was developed to provide a comprehensive coverage of therapeutic strategies drawn from cognitive behavior therapy, interpersonal therapy, supportive psychotherapy, and positive psychology. Pilot testing was carried out using a single group pre-, post- and follow-up design in 78 eligible participants. Participants were typically young adults with major depression or dysthymia and significant impairment in functioning. Almost two-thirds of the participants had never sought professional mental health help. Significant reductions in depression and improvement in the functioning and well-being were notedon standardized measures in participants completing all 10 essential zone sections. These gains were maintained at follow-up. The results were similar for partial completers, who completed fiveout of the 10 essential sections. PUSH-D is one of the first indigenously developed self-help apps for depression and it shows promise in reducing the treatment gap for depression in India.

  1. 76 FR 67759 - Announcement of Funding Awards for the Self-Help Homeownership Opportunity Program (SHOP) for...

    Science.gov (United States)

    2011-11-02

    ... required. The SHOP funds together with the sweat equity and volunteer labor contributions significantly... Awards for the Self-Help Homeownership Opportunity Program (SHOP) for Fiscal Year 2011 AGENCY: Office of... Opportunity Program (SHOP). This announcement contains the consolidated names and addresses of this year's...

  2. 76 FR 48876 - Announcement of Funding Awards for the Self-Help Homeownership Opportunity Program (SHOP) for...

    Science.gov (United States)

    2011-08-09

    ... labor is also required. The SHOP funds together with the sweat equity and volunteer labor contributions... Awards for the Self-Help Homeownership Opportunity Program (SHOP) for Fiscal Year 2010 AGENCY: Office of... Opportunity Program (SHOP). This announcement contains the consolidated names and addresses of this year's...

  3. Short-term effectiveness of web-based guided self-help for phobic outpatients: Randomized controlled trial.

    NARCIS (Netherlands)

    Kok, R.N.; van Straten, A.; Beekman, A.T.F.; Cuijpers, P.

    2014-01-01

    Background: Internet-based guided self-help has been successfully used in the general population, but it is unknown whether this method can be effectively used in outpatient clinics for patients waiting for face-to-face psychotherapy for phobias. Objective: The aim was to assess the clinical

  4. Effectiveness of a web-based self-help smoking cessation intervention: protocol of a randomised controlled trial

    NARCIS (Netherlands)

    Kramer, J.; Willemsen, M.C.; Conijn, B.; van Emst, A.J.; Brunsting, S.; Riper, H.

    2009-01-01

    BACKGROUND: Cigarette smoking is a major risk factor for many chronic and fatal illnesses. Stopping smoking directly reduces those risks. The aim of this study is to investigate the effectiveness of a web-based interactive self-help programme for smoking cessation, known as the StopSite, by

  5. Effectiveness of a web-based self-help smoking cessation intervention: protocol of a randomised controlled trial

    Directory of Open Access Journals (Sweden)

    Brunsting Suzanne

    2009-01-01

    Full Text Available Abstract Background Cigarette smoking is a major risk factor for many chronic and fatal illnesses. Stopping smoking directly reduces those risks. The aim of this study is to investigate the effectiveness of a web-based interactive self-help programme for smoking cessation, known as the StopSite, by comparing it to an online self-help guide. Both interventions were based on cognitive-behavioural and self-control principles, but the former provided exercises, feedback and interactive features such as one-to-one chatrooms and a user forum, which facilitated mutual support and experience sharing. Methods and design We conducted a randomised controlled trial to compare the interactive intervention with the self-help guide. The primary outcome measure was prolonged abstinence from smoking. Secondary outcomes were point-prevalence abstinence, number of cigarettes smoked, and incidence of quit attempts reported at follow-up assessments. Follow-up assessments took place three and six months after a one-month grace period for starting the intervention after baseline. Analyses were based on intention-to-treat principles using a conservative imputation method for missing data, whereby non-responders were classified as smokers. Discussion The trial should add to the body of knowledge on the effectiveness of web-based self-help smoking cessation interventions. Effective web-based programmes can potentially help large numbers of smokers to quit, thus having a major public health impact. Trial registration ISRCTN74423766

  6. Can Addiction-Related Self-Help/Mutual Aid Groups Lower Demand for Professional Substance Abuse Treatment?

    Science.gov (United States)

    Humphreys, Keith

    1998-01-01

    Discusses the potential of self-help/mutual-aid groups as a way to reduce the demand for professional substance-abuse treatment and proposes a model that combines the two approaches for cost-effective and therapeutically effective networks of services. (SLD)

  7. Development and Pilot Testing of an Internet-Based Self-Help Intervention for Depression for Indian Users

    Directory of Open Access Journals (Sweden)

    Seema Mehrotra

    2018-03-01

    Full Text Available There is a dearth of published research on uptake and utility of mental health apps in India, despite a rising global trend in the application of technology in the field of mental health. We describe the development and pilot testing of a self-help intervention for depression, PUSH-D (Practice and Use Self-Help for Depression for urban Indians. This guided self-help app, with essential and optional zone sections, was developed to provide a comprehensive coverage of therapeutic strategies drawn from cognitive behavior therapy, interpersonal therapy, supportive psychotherapy, and positive psychology. Pilot testing was carried out using a single group pre-, post- and follow-up design in 78 eligible participants. Participants were typically young adults with major depression or dysthymia and significant impairment in functioning. Almost two-thirds of the participants had never sought professional mental health help. Significant reductions in depression and improvement in the functioning and well-being were notedon standardized measures in participants completing all 10 essential zone sections. These gains were maintained at follow-up. The results were similar for partial completers, who completed fiveout of the 10 essential sections. PUSH-D is one of the first indigenously developed self-help apps for depression and it shows promise in reducing the treatment gap for depression in India.

  8. Cultural Adaptation of a Cognitive Behavior Therapy Guided Self-Help Program for Mexican American Women with Binge Eating Disorders

    Science.gov (United States)

    Shea, Munyi; Cachelin, Fary; Uribe, Luz; Striegel, Ruth H.; Thompson, Douglas; Wilson, G. Terence

    2012-01-01

    Data on the compatibility of evidence-based treatment in ethnic minority groups are limited. This study utilized focus group interviews to elicit Mexican American women's (N = 12) feedback on a cognitive behavior therapy guided self-help program for binge eating disorders. Findings revealed 6 themes to be considered during the cultural adaptation…

  9. Internet based self-help therapy versus waitlist control group for persons with anxiety disorders: A randomised feasibility study

    DEFF Research Database (Denmark)

    Fenger, Morten Munthe; Lindschou, Jane; Gluud, Christian

    ) FearFighter or B) waitlist control group. Participants are persons with a diagnosis of social phobia, agora phobia, phobia or panic disorder. The intervention with FearFighter is a nine step cognitive behavioural self-help therapy program delivered over the internet over nine weeks. Participants...

  10. Guided self-help for mental health disorders in children and young people with chronic neurological conditions: A qualitative evaluation.

    Science.gov (United States)

    Bennett, Sophie D; Coughtrey, Anna E; Heyman, Isobel; Greally, Suzanna; Clarkson, Harriet; Bhattacharyya, Tuhina; Lewis, Corah; Varadkar, Sophia; Shafran, Roz

    2018-03-09

    Children with neurological conditions such as epilepsy are at high risk of developing mental health disorders. Guided self-help can be used to increase access to psychological therapies. When developing and evaluating interventions, it is important to obtain the views of service-users about their acceptability. A telephone-guided self-help intervention was used to treat common mental health difficulties in children and young people with neurological conditions. The intervention was not adapted in content to account for chronic illness. This study therefore reports on qualitative interviews with participants to determine the acceptability of the intervention. Semi-structured interviews were conducted with 27 participants (25 parents and 2 young people) who had undertaken a telephone-delivered guided self-help intervention for common mental health difficulties in the context of a paediatric neurological condition. Transcripts were analysed thematically using the framework approach. Thirteen themes were extracted, organised into three main domains, which covered: the practicalities of telephone guided self-help treatment; the outcomes of the intervention; and the extent to which adaptation was needed for chronic illness. Most families found the intervention helpful in working towards their specific goals and noticed changes for the child and/or parents and family. Participants had a positive experience of the intervention and the majority of parents found the standard intervention with individualised goals sufficient to meet the young person's mental health needs. Copyright © 2018 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.

  11. HDR-Clinical Data Service (CDS)

    Data.gov (United States)

    Department of Veterans Affairs — CDS is a SOAP/REST web service interface that supports Create, Retrieve, Update, and Delete (CRUD) operations against HDR data stores over secure Hypertext Transfer...

  12. Improving the Formatting Tools of CDS Invenio

    CERN Document Server

    Caffaro, J; Pu Faltings, Pearl

    2006-01-01

    CDS Invenio is the web-based integrated digital library system developed at CERN. It is a strategical tool that supports the archival and open dissemination of documents produced by CERN researchers. This paper reports on my Master’s thesis work done on BibFormat, a module in CDS Invenio, which formats documents metadata. The goal of this project was to implement a completely new formatting module for CDS Invenio. In this report a strong emphasis is put on the user-centered design of the new BibFormat. The bibliographic formatting process and its requirements are discussed. The task analysis and its resulting interaction model are detailed. The document also shows the implemented user interface of BibFormat and gives the results of the user evaluation of this interface. Finally the results of a small usability study of the formats included in CDS Invenio are discussed.

  13. How does social comparison within a self-help group influence adjustment to chronic illness? A longitudinal study.

    Science.gov (United States)

    Dibb, Bridget; Yardley, Lucy

    2006-09-01

    Despite the growing popularity of self-help groups for people with chronic illness, there has been surprisingly little research into how these may support adjustment to illness. This study investigated the role that social comparison, occurring within a self-help group, may play in adjustment to chronic illness. A model of adjustment based on control process theory and response shift theory was tested to determine whether social comparisons predicted adjustment after controlling for the catalyst for adjustment (disease severity) and antecedents (demographic and psychological factors). A sample of 301 people with Ménière's disease who were members of the Ménière's Society UK completed questionnaires at baseline and 10-month follow-up assessing adjustment, defined for this study as functional and goal-oriented quality of life. At baseline, they also completed measures of the predictor variables i.e. the antecedents (age, sex, living circumstances, duration of self-help group membership, self-esteem, optimism and perceived control over illness), the catalyst (severity of vertigo, tinnitus, hearing loss and fullness in the ear) and mechanisms of social comparison within the self-help group. The social comparison variables included the extent to which self-help group resources were used, and whether reading about other members' experiences induced positive or negative feelings. Cross-sectional results showed that positive social comparison was indeed associated with better adjustment after controlling for all the other baseline variables, while negative social comparison was associated with worse adjustment. However, greater levels of social comparison at baseline were associated with a deteriorating quality of life over the 10-month follow-up period. Alternative explanations for these findings are discussed.

  14. A randomised controlled trial of face to face versus pure online self-help cognitive behavioural treatment for perfectionism.

    Science.gov (United States)

    Egan, Sarah J; van Noort, Emily; Chee, Abby; Kane, Robert T; Hoiles, Kimberley J; Shafran, Roz; Wade, Tracey D

    2014-12-01

    Previous research has shown cognitive-behavioural treatment (CBT) to be effective in reducing perfectionism. The present study investigated the efficacy of two formats of CBT for perfectionism (CBT-P), face-to-face and pure online self-help, in reducing perfectionism and associated psychological symptoms. Participants were randomly allocated to face-to-face CBT-P (n = 18), pure online self-help CBT-P (n = 16), or a waitlist control period (n = 18). There was no significant change for the waitlist group on any of the outcome measures at the end of treatment. Both the face-to-face and pure online self-help groups reported significant reductions at the end of treatment for the perfectionism variables which were maintained at the 6-month follow-up. The face-to-face group also reported significant reductions over this time in depression, anxiety, and stress, and a significant pre-post increase in self-esteem, all of which were maintained at the 6-month follow-up. In contrast, the pure online self-help group showed no significant changes on these outcomes. The face-to-face group was statistically superior to the pure online self-help group at follow-up on the perfectionism measures, concern over mistakes and personal standards. The results show promising evidence for CBT for perfectionism, especially when offered face to face, where sustained benefit across a broad range of outcomes can be expected. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.

  15. Books Received

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Books Received. Articles in Resonance – Journal of Science Education. Volume 1 Issue 1 January 1996 pp 118-118 Books Received. Books Received · More Details Fulltext PDF. Volume 1 Issue 2 February 1996 pp 120-120 Books Received. Books Received.

  16. A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

    International Nuclear Information System (INIS)

    Padmaja, S.; Jayakumar, S.; Balaji, R.; Vaideki, K.

    2016-01-01

    Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

  17. A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

    Energy Technology Data Exchange (ETDEWEB)

    Padmaja, S. [Thin film centre, PSG College of Technology, Coimbatore (India); Jayakumar, S., E-mail: s_jayakumar_99@yahoo.com [Department of Physics, PSG Institute of Technology and Applied Research, Coimbatore (India); Balaji, R.; Vaideki, K. [Thin film centre, PSG College of Technology, Coimbatore (India)

    2016-08-15

    Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

  18. Can Parents Treat their Anxious Child using CBT? A Brief Report of a Self-Help Program

    DEFF Research Database (Denmark)

    Esbjørn, Barbara Hoff; Christiansen, Bianca Munkebo; Walczak, Monika Anna

    2016-01-01

    Objective: We developed and tested a self-help program with minimal therapist involvement for parents of anxious children. Method: The program focused on transfer of control from therapist to parents of children with moderate anxiety, and consisted of two therapist-led workshops, a Facebook group......, and Cool Kids manuals for parents and children. The sample consisted of 20 families, and 17 completed treatment. Results: After treatment, intent-to-treat analyses indicated that 65% of the children were free of all anxiety disorders. The corresponding figure for completers was 76.5%. Conclusion: Our...... results suggest that parent-based self-help groups focusing on transfer of control may be a cost-effective way of providing treatment to children with moderate anxiety...

  19. Efficacy of a self-help manual in increasing resilience in carers of adults with depression in Thailand

    OpenAIRE

    McCann, Terence V.; Songprakun, Wallapa; Stephenson, John

    2016-01-01

    Caring for a person with a mental illness can have adverse effects on caregivers; however, little is known about how best to help such caregivers. The aim of the present study was to examine the efficacy of a cognitive behaviour therapy-guided self-help manual in increasing resilience in caregivers of individuals with depression, in comparison to caregivers who receive routine support only. A randomized, controlled trial was conducted, following CONSORT guidelines, with 54 caregivers allocate...

  20. Efficacy of a self-help manual in increasing resilience in carers of adults with depression in Thailand.

    Science.gov (United States)

    McCann, Terence V; Songprakun, Wallapa; Stephenson, John

    2016-02-01

    Caring for a person with a mental illness can have adverse effects on caregivers; however, little is known about how best to help such caregivers. The aim of the present study was to examine the efficacy of a cognitive behaviour therapy-guided self-help manual in increasing resilience in caregivers of individuals with depression, in comparison to caregivers who receive routine support only. A randomized, controlled trial was conducted, following CONSORT guidelines, with 54 caregivers allocated to parallel intervention (self-help manual) (n = 27) or control (standard support) (n = 27) groups. Resilience was assessed at baseline, post-test (week 8), and follow up (week 12). Intention-to-treat analyses were undertaken. Repeated-measures ANOVA indicated a significant difference in resilience scores between the three time points, showing a large effect. Pairwise comparisons between intervention and control groups indicated resilience to be significantly different between baseline and post-test, and between baseline and follow up, but not between post-test and follow up. Overall, the intervention group showed a slightly greater increase in resilience over time than the control group; however, the time-group interaction was not significant. Guided self-help is helpful in improving caregivers' resilience and could be used as an adjunct to the limited support provided to carers by mental health nurses and other clinicians. © 2016 Australian College of Mental Health Nurses Inc.

  1. Book Review: Book review

    Science.gov (United States)

    Wang, Christina Yan

    2017-02-01

    The world class Ni-Cu-PGE sulfide deposits associated with the Sudbury Igneous Complex (SIC) are quite unique on earth in the sense that the energy source and origin were triggered by a large meteorite impact event. The ore deposits in the SIC make up one of the largest Ni-Cu-PGE sulfide deposit camps in the world and have now been mined for over 100 years. This is the first complete reference book that focuses entirely on the SIC and covers the fields of economic geology, petrology, geochemistry and geophysics. The purpose of this book is to explore the linkage between sulfide and silicate magmas generated by the 1.85 Ga Sudbury impact event and to unite an understanding of the process of crustal melt sheet evolution with the formation of the magmatic sulfide mineralization. The author, Peter Lightfoot, has been based in Sudbury for 25 years. As a top scientist on magmatic Ni-Cu-PGE sulfide deposits and a Chief Geologist with the Brownfield Exploration group at Vale Base Metals, Peter has been positioned to develop and assemble the ideas presented in this book, which are perfectly balanced between industry and academia.

  2. Book Review: Book review

    Science.gov (United States)

    Wegener, Daan

    Writing a biography of a complex personality and mastermind like Albert Einstein is a daunting task for any historian of science. Yet the sheer temptation of writing his biography has apparently helped to overcome scholarly scruples, as biographies of Einstein have appeared quite regularly on the market. One of them is Einstein: his Life and Universe by journalist Walter Isaacson. It is a best-seller, which is one of the reasons the book deserves a critical evaluation. Isaacson is a man of considerable repute: he has been the chairman of CNN and managing editor of Time magazine. Isaacson's Einstein is written in a style that is accessible to a wide audience. Scholars who are already familiar with Einstein's physics may still enjoy the parts of the book that deal with the relation between Einstein and the press. Indeed, the breadth of its scope is the book's major merit, as it connects the personal, scientific, public and political dimensions of Einstein's life. In this review, I discuss Isaacson's treatment of these dimensions one-by-one.

  3. Book Review: Book review

    Science.gov (United States)

    Martínez, Alberto A.

    The title Einstein's Generation immediately suggests names such as Ehrenfest, Ritz, Kaufmann, Born, Laue, and Laub. Staley's book discusses these individuals, but it actually has a broader scope. Both the title and the subtitle are not quite appropriate. A much more fitting title would be Michelson, Electrons, and the Rise of "Modern" Physics. The emphasis on Albert Michelson is evident in the Index: almost four columns on him, compared to just one and a half on Einstein. Likewise, "Einstein's generation" includes, for Staley, many other physicists who were quite older than Einstein, such as Lorentz, Planck, Poincaré, and Minkowski. The book exhibits a composite character because it includes and expands upon four articles that Staley had published earlier on Michelson, relativity, and the co-creation of modern and classical physics. Hence the book is partly a bridging work; it ambitiously connects areas in the history of physics, from the 1880s until 1911. Staley identifies how diverse interests produced crossfertilization, and how various disciplinary boundaries were crossed. He wants to discuss material culture, experiment, and theory, all on the same footing. Every page of the introduction seems to quadruple the scope; he writes about individuals and communities, consolidation and diversification, power and weakness, memory and neglect, the cultural and the material, the classical and the modern, and the absolute and the relative.

  4. The role of psychological flexibility in a self-help acceptance and commitment therapy intervention for psychological distress in a randomized controlled trial.

    NARCIS (Netherlands)

    Fledderus, M.; Bohlmeijer, Ernst Thomas; Fox, Gerardus J.A.; Schreurs, Karlein Maria Gertrudis; Spinhoven, Philip

    2013-01-01

    This study examined the role of psychological flexibility, as a risk factor and as a process of change, in a self-help Acceptance and Commitment Therapy (ACT) intervention for adults with mild to moderate depression and anxiety. Participants were randomized to the self-help programme with e-mail

  5. Book Review: Book review

    Science.gov (United States)

    da Costa, Newton C. A.; Krause, Décio

    This book contains a representative selection of Erhard Scheibe's writings on the philosophy of physics. It encompasses eight sections, with 38 papers, distributed as follows: (I) Between Rationalism and Empiricism (five papers from 1969 to 1994); (II) The Philosophy of the Physicists (five papers from 1988 to 1995); (III) Reconstruction (four papers, from 1979 to 1988); (IV) Laws of Nature (five papers, from 1989 to 1998); (V) Reduction (five papers from 1973 to 1995); (VI) Foundations of Quantum Mechanics (six papers from 1985 to 1993); (VII) Spacetime, Invariance, Covariance (four papers from 1982 to 1994), and (VIII) Mathematics and Physics (four papers from 1977 to 1997).

  6. Effectiveness of a Web-Based Guided Self-help Intervention for Outpatients With a Depressive Disorder: Short-term Results From a Randomized Controlled Trial.

    Science.gov (United States)

    Kenter, Robin Maria Francisca; Cuijpers, Pim; Beekman, Aartjan; van Straten, Annemieke

    2016-03-31

    4 sessions completed) results were also not significant (b=1.154, 95% CI -1.978 to 7.637). Between-group differences were small and not significant for all secondary outcomes. Adherence to the intervention was low. Only 36% (49/136) received an adequate dosage of the intervention (≥4 of 5 sessions). The overall treatment satisfaction was moderate. Internet-based problem solving therapy is not more effective in reducing symptoms of depression than receiving an unguided self-help book during the waitlist period at outpatient mental health clinics. The effect sizes are much smaller than those found in earlier research in the general population, and the low rates of adherence indicate that the acceptability of the intervention at this stage of treatment for depressed outpatients is low. However, taking into account that there is much evidence for the efficacy of Internet-based treatments, it is too early to draw firm conclusions about the effectiveness of these treatments in outpatient clinics as a whole. Netherlands Trial Register NTR2824; http://www.trialregister.nl/trialreg/admin/rctview.asp?TC=2824 (Archived by WebCite at http://www.webcitation/ 6g3WEuiqH).

  7. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION LICENSING... FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING FACTOR ...

  8. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement protein..., putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative ...

  9. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1a320 1 85 35 119 3e-17 ... gb|AAK39926.1| plastidal 30S ribosomal prot...ein S15 [Guillardia theta] pir||G90099 ... plastidal 30S ribosomal protein S15 [imported] - ... ... ... Guillardia theta nucleomorph ref|NP_113370.1| plastidal ... 30S ribosomal protein S15 [Guillardia t

  10. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1e79I 1 47 1 47 1e-07 ... pdb|1E79|I Chain I, Bovine F1-Atpase Inhibite...d By Dccd ... (Dicyclohexylcarbodiimide) pdb|1H8E|I Chain I, ... (Adp.Alf4)2(Adp.So4) Bovine F1-Atpase

  11. Arabidopsis CDS blastp result: AK068433 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068433 J013156D16 At1g20620.2 catalase 3 (SEN2) almost identical to catalase 3 SP...:Q42547, GI:3123188 from [Arabidopsis thaliana]; identical to catalase 3 (SEN2) mRNA, partial cds GI:3158369 1e-63 ...

  12. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1sg6B 30 343 72 371 7e-54 ... dbj|BAD07382.1| putative 2-epi-5-epi-valiolone synthase [Actinopla...nes sp. A40644] ... Length = 300 ... Query: 89 ... SRRFCVVDDSVWAIYGEKLKAYFDERNIASK

  13. Mental and Emotional Self-Help Technology Apps: Cross-Sectional Study of Theory, Technology, and Mental Health Behaviors.

    Science.gov (United States)

    Crookston, Benjamin T; West, Joshua H; Hall, P Cougar; Dahle, Kaitana Martinez; Heaton, Thomas L; Beck, Robin N; Muralidharan, Chandni

    2017-10-17

    Mental and emotional self-help apps have emerged as potential mental illness prevention and treatment tools. The health behavior theory mechanisms by which these apps influence mental health-related behavior change have not been thoroughly examined. The objective of this study was to examine the association between theoretical behavior change mechanisms and use of mental and emotional self-help apps and whether the use of such apps is associated with mental health behaviors. This study utilized a cross-sectional survey of 150 users of mental or emotional health apps in the past 6 months. Survey questions included theory-based items, app engagement and likeability items, and behavior change items. Stata version 14 was used to calculate all statistics. Descriptive statistics were calculated for each of the demographic, theory, engagement, and behavior variables. Multiple regression analysis was used to identify factors associated with reported changes in theory and separately for reported changes in actual behavior after controlling for potentially confounding variables. Participants reported that app use increased their motivation, desire to set goals, confidence, control, and intentions to be mentally and emotionally healthy. Engagement (Ptheory items, whereas perceived behavior change was positively associated with theory (Ptheory items. Future efforts should consider the value of impacting key theoretical constructs when designing mental and emotional health apps. As apps are evaluated and additional theory-based apps are created, cost-effective self-help apps may become common preventative and treatment tools in the mental health field. ©Benjamin T Crookston, Joshua H West, P Cougar Hall, Kaitana Martinez Dahle, Thomas L Heaton, Robin N Beck, Chandni Muralidharan. Originally published in JMIR Mental Health (http://mental.jmir.org), 17.10.2017.

  14. Internet-based self-help group with and without online-moderation as post-rehabilitation support

    OpenAIRE

    Pirsich, Carolin (geb. Ubben)

    2011-01-01

    After having received an in-patient-treatment in a psychosomatic rehabilitation, chronic mentally ill patients need to cope with their diseases on a long term base. They are confronted with the task to sustain and develop the acquired coping strategies as well as to integrate them into their everyday life. To support these efforts, rehabilitation clinics recommend follow-up care (e.g. through self-help groups). The project “Online discussion group Seehof” was designed for the rehabilitation c...

  15. Internet-based self-help therapy with FearFighter™ versus no intervention for anxiety disorders in adults

    DEFF Research Database (Denmark)

    Fenger, Morten; Lindschou, Jane; Gluud, Christian

    2016-01-01

    BACKGROUND: Internet-based self-help psychotherapy (IBT) could be an important alternative or supplement to ordinary face-to-face therapy. The findings of randomised controlled trials indicate that the effects of various IBT programmes for anxiety disorders seem better than no intervention...... and in some instances are equivalent to usual therapy. In Denmark, IBT is part of future treatment plans in mental health care services, but the verification level of the current clinical scientific knowledge is insufficient. The objective of this trial is feasibility assessment of benefits and harms...

  16. Complementary medicine, self-help, and lifestyle interventions for obsessive compulsive disorder (OCD) and the OCD spectrum: a systematic review.

    Science.gov (United States)

    Sarris, Jerome; Camfield, David; Berk, Michael

    2012-05-01

    In Obsessive Compulsive Disorder (OCD) current standard pharmacotherapies may be of limited efficacy. Non-conventional interventions such as Complementary and Alternative Medicine (CAM), self-help techniques, and lifestyle interventions are commonly used by sufferers of OCD, however to date no systematic review of this specific area exists. We conducted a systematic review of studies using CAM, self-help, and lifestyle interventions for treatment of OCD and trichotillomania (TTM). PubMed, PsycINFO, China Academic Journals Full-text Database, The Cochrane Library and CINAHL were searched (up to Jan 11th 2011), for controlled clinical trials using non-conventional interventions for OCD. A quality analysis using a purpose-designed scale and an estimation of effect sizes (Cohen's d) where data was available, were also calculated. The literature search revealed 14 studies that met inclusion criteria. Methodological quality of nutraceutical studies (nutrients and herbal medicines) were rated as high (mean 8.6/10), whereas mind-body or self-help studies were poorer (mean 6.1/10). In OCD, tentative evidentiary support from methodologically weak studies was found for mindfulness meditation (d=0.63), electroacupuncture (d=1.16), and kundalini yoga (d=1.61). Better designed studies using the nutrient glycine (d=1.10), and traditional herbal medicines milk thistle (insufficient data for calculating d) and borage (d=1.67) also revealed positive results. A rigorous study showed that N-acetylcysteine (d=1.31) was effective in TTM, while self-help technique "movement decoupling" also demonstrated efficacy (d=0.94). Mixed evidence was found for myo-inositol (mean d=0.98). Controlled studies suggest that St John's wort, EPA, and meridian-tapping are ineffective in treating OCD. While several studies were positive, these were un-replicated and commonly used small samples. This precludes firm confidence in the strength of clinical effect. Preliminary evidence however is encouraging

  17. moriam Books

    African Journals Online (AJOL)

    This slim, plastic covered, 'pocket' book comprises a total of 144 pages. It is written in text book form with a user- friendly indexing system. The book has a number of special features: • It is brief, contains core material, yet does not omit discussion on problems of definition and classification. • It straddles both ICD 10 and DSM ...

  18. Internet-based guided self-help for university students with anxiety, depression and stress: a randomized controlled clinical trial.

    Science.gov (United States)

    Day, Victor; McGrath, Patrick J; Wojtowicz, Magdalena

    2013-07-01

    Anxiety, depression and stress, often co-occurring, are the psychological problems for which university students most often seek help. Moreover there are many distressed students who cannot, or choose not to, access professional help. The present study evaluated the efficacy of an internet-based guided self-help program for moderate anxiety, depression and stress. The program was based on standard cognitive behavior therapy principles and included 5 core modules, some of which involved options for focusing on anxiety and/or depression and/or stress. Trained student coaches provided encouragement and advice about using the program via e-mail or brief weekly phone calls. Sixty-six distressed university students were randomly assigned to either Immediate Access or a 6-week Delayed Access condition. Sixty-one percent of Immediate Access participants completed all 5 core modules, and 80% of all participants completed the second assessment. On the Depression, Anxiety and Stress Scales-21, Immediate Access participants reported significantly greater reductions in depression (ηp(2)=. 07), anxiety (ηp(2)=. 08) and stress (ηp(2)=. 12) in comparison to participants waiting to do the program, and these improvements were maintained at a six month follow-up. The results suggest that the provision of individually-adaptable, internet-based, self-help programs can reduce psychological distress in university students. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Culturally Adapted Cognitive Behavioral Guided Self-Help for Binge Eating: A Feasibility Study with Mexican Americans

    Science.gov (United States)

    Cachelin, Fary M.; Shea, Munyi; Phimphasone, Phoutdavone; Wilson, G. Terence; Thompson, Douglas R.; Striegel, Ruth H.

    2014-01-01

    Objective was to test feasibility and preliminary efficacy of a culturally adapted cognitive-behavioral self-help program to treat binge eating and related problems in Mexican Americans. Participants were 31 women recruited from the Los Angeles area and diagnosed with binge eating disorder, recurrent binge eating or bulimia nervosa. Participants completed a culturally adapted version of a CBT-based self-help program with 8 guidance sessions over a 3-month period. Treatment efficacy was evaluated in terms of binge eating, psychological functioning, and weight loss. Intent-to-treat analyses revealed 35.5% abstinence from binge eating at post-treatment and 38.7% diagnostic remission. Results indicated significant pre-treatment to post-treatment improvement on distress level, BMI, eating disorder psychopathology, and self-esteem. Satisfaction with the program was high. Findings demonstrate that the program is acceptable, feasible, and efficacious in reducing binge eating and associated symptoms for Mexican American women. Study provides “proof of concept” for implementation of culturally adapted forms of evidence-based programs. PMID:25045955

  20. A neoliberalisation of civil society? Self-help groups and the labouring class poor in rural South India.

    Science.gov (United States)

    Pattenden, Jonathan

    2010-01-01

    This paper notes the prominence of self-help groups (SHGs) within current anti-poverty policy in India, and analyses the impacts of government- and NGO-backed SHGs in rural North Karnataka. It argues that self-help groups represent a partial neoliberalisation of civil society in that they address poverty through low-cost methods that do not challenge the existing distribution of power and resources between the dominant class and the labouring class poor. It finds that intra-group savings and loans and external loans/subsidies can provide marginal economic and political gains for members of the dominant class and those members of the labouring classes whose insecure employment patterns currently provide above poverty line consumption levels, but provide neither material nor political gains for the labouring class poor. Target-oriented SHG catalysts are inattentive to how the social relations of production reproduce poverty and tend to overlook class relations and socio-economic and political differentiation within and outside of groups, which are subject to interference by dominant class local politicians and landowners.

  1. Self-help/mutual aid as active citizenship associations: a case-study of the chronically ill in Italy.

    Science.gov (United States)

    Giarelli, Guido; Spina, Elena

    2014-12-01

    Contrary to the most widespread conception that considers self-help/mutual aid as a component of the 'third sector', an approach is proposed which assumes, on the basis of the specific nature of the social bond and of the social action that characterizes it, it can be more properly considered as part of the 'new civil society' as it has been configured during the time in Western societies. This implies its location in the public non-state and non-systemic space that it has been created in the specific form of associations of citizenship. An interuniversity research project is then presented which, using this approach, studied the case of self-help/mutual aid associations for the chronically ill in Italy, offering some of the findings regarding the origin, structural characteristics, geographical distribution and activities of these associations in order to at least partially verify the heuristic value of this approach and its implications for the processes of reform of the health systems. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Handheld Devices and Video Modeling to Enhance the Learning of Self-Help Skills in Adolescents With Autism Spectrum Disorder.

    Science.gov (United States)

    Campbell, Joseph E; Morgan, Michele; Barnett, Veronica; Spreat, Scott

    2015-04-01

    The viewing of videos is a much-studied intervention to teach self-help, social, and vocational skills. Many of the studies to date looked at video modeling using televisions, computers, and other large screens. This study looked at the use of video modeling on portable handheld devices to teach hand washing to three adolescent students with an autism spectrum disorder. Three students participated in this 4-week study conducted by occupational therapists. Baseline data were obtained for the first student for 1 week, the second for 2 weeks, and the third for 3 weeks; videos were introduced when the participants each finished the baseline phase. Given the cognitive and motor needs of the participants, the occupational therapist set the player so that the participants only had to press the play button to start the video playing. The participants were able to hold the players and view at distances that were most appropriate for their individual needs and preferences. The results suggest that video modeling on a handheld device improves the acquisition of self-help skills.

  3. The implementation of computerized cognitive behavioural therapies in a service user-led, third sector self help clinic.

    Science.gov (United States)

    Cavanagh, Kate; Seccombe, Nick; Lidbetter, Nicky

    2011-07-01

    The efficacy and effectiveness of a computerized cognitive behavioural therapy (CCBT) package, Beating the Blues, has been demonstrated in a large randomized controlled trial and several pragmatic studies in the National Health Service (NHS). The current study tests the generalizability of this finding to the implementation of CCBT in a service user-led, third sector Self Help Clinic. 510 referrals for the Beating the Blues program were received over a 16 month period in routine care. The Patient Health Questionnaire Depression (PHQ-9) and Anxiety (GAD-7) Scales were administered pre-treatment and during each treatment session. The 10-item Clinical Outcomes in Routine Evaluation-Outcome Measure (CORE-OM), Work and Social Adjustment Scale and Patient Experience Questionnaire were also administered pre-treatment and immediately on completing treatment. More than two-thirds of referrals were suitable for treatment and completed a baseline assessment; 84% of these started the Beating the Blues program. Two-hundred and twenty-six people meeting caseness criteria at baseline completed at least two sessions of CCBT. Of these, 50% met recovery criteria at their final point of measurement. Completer and intention-to-treat analysis also demonstrated statistically and clinically significant improvements on key outcome measures. CCBT can be effectively implemented in a service user-led, third sector Self Help Clinic, increasing access to psychological therapies to meet local needs for tier two interventions for depression and anxiety.

  4. DETERMINANTS OF WOMEN’S PARTICIPATION IN SELF HELP GROUP LED MICRO-FINANCING OF FARMS IN ISUIKWUATO LOCAL GOVERNMENT AREA OF ABIA STATE, NIGERIA

    Directory of Open Access Journals (Sweden)

    Chidozie Onyedikachi ANYIRO

    2014-10-01

    Full Text Available This research analyzed determinants of women’s participation in self help group-led micro-financing of farms in Isuikwuato Local Government Area of Abia State, Nigeria. The specific objectives were to; determine the level of women’s participation in self help group led micro financing of farms; determine the factors that influence women’s participation in self help group micro financing of farms; identify constraints of women participation in self help group micro financing of farms in the study area. Multistage random sampling technique was employed in collecting data from one hundred and twenty (120 members of women self help group using structured questionnaire. The data were analyzed using descriptive statistics, likert scale type and probit regression analysis. The research revealed that the women (respondents actively participated in self help group meetings ( = 3.07, financial and material contributions (= 3.33, self help group project (= 3.36 and recruitment of fresh members (= 3.16, because their calculated means were greater than the critical midpoint mean score (3.0. The study also showed that the women did not participate in committee membership ( = 2.54 and holding of official executive position (= 2.53 in self help group since the midpoint score (3.0 was greater than their calculated mean values. The result of probit regression analysis showed that women’s participation in self help group led micro financing of farms was influenced by household size, years of membership experience, access to credit, primary occupation, mode of entry and annual contribution. The model predicted 94.69 per cent of the sample correctly and posted a log likelihood value of -33.54958, a pseudo R2value of 0.3013 and a goodness of fit chi-square value of 32.10 which is statistically significant at 1.0% level. Meanwhile irregular monthly contribution and loan default were the major constraints of women’s participation in self help group led micro

  5. To Receive from the Rich or the Poor: Effects on the Recipient’s Self Esteem and Subsequent Self-Help Behavior.

    Science.gov (United States)

    A 2 (aid vs. no aid) x 2 (high vs. low resource potential donor) factorial design tested the effects of aid and donor resources on recipient self ...to self - esteem inherent in aid and subsequent self -help is discussed in terms of self - esteem theory. (Modified author abstract)...perceptions and subsequent self -help behavior. The results were characterized by interactions between the two factors. The relationship between threat

  6. Delivering Acceptance and Commitment Therapy for Weight Self-Stigma through Guided Self-Help: Results from an Open Pilot Trial

    OpenAIRE

    Levin, Michael E.; Potts, Sarah; Haeger, Jack; Lillis, Jason

    2017-01-01

    Weight self-stigma is a promising target for innovative interventions seeking to improve outcomes among overweight/obese individuals. Preliminary research suggests acceptance and commitment therapy (ACT) may be an effective approach for reducing weight self-stigma, but a guided self-help version of this intervention may improve broad dissemination. This pilot open trial sought to evaluate the potential acceptability and efficacy of a guided self-help ACT intervention, included coaching and a ...

  7. Preliminary evaluation of a "formulation-driven cognitive behavioral guided self-help (fCBT-GSH)" for crisis and transitional case management clients.

    Science.gov (United States)

    Naeem, Farooq; Johal, Rupinder K; Mckenna, Claire; Calancie, Olivia; Munshi, Tariq; Hassan, Tariq; Nasar, Amina; Ayub, Muhammad

    2017-01-01

    Cognitive behavioral therapy (CBT) is found to be effective for common mental disorders and has been delivered in self-help and guided self-help formats. Crisis and transitional case management (TCM) services play a vital role in managing clients in acute mental health crises. It is, therefore, an appropriate setting to try CBT in guided self-help format. This was a preliminary evaluation of a formulation-driven cognitive behavioral guided self-help. Thirty-six (36) consenting participants with a diagnosis of nonpsychotic illness, attending crisis and the TCM services in Kingston, Canada, were recruited in this study. They were randomly assigned to the guided self-help plus treatment as usual (TAU) (treatment group) or to TAU alone (control group). The intervention was delivered over 8-12 weeks. Assessments were completed at baseline and 3 months after baseline. The primary outcome was a reduction in general psychopathology, and this was done using Clinical Outcomes in Routine Evaluation - Outcome Measure. The secondary outcomes included a reduction in depression, measured using the Hospital Anxiety and Depression Scale, and reduction in disability, measured using the World Health Organization Disability Assessment Schedule 2.0. Participants in the treatment group showed statistically significant improvement in overall psychopathology ( P crisis and TCM clients and can be effective in improving mental health, when compared with TAU. This is the first report of a trial of guided self-help for clients attending crisis and TCM services.

  8. Effectiveness and economic evaluation of self-help educational materials for the prevention of smoking relapse: randomised controlled trial.

    Science.gov (United States)

    Blyth, Annie; Maskrey, Vivienne; Notley, Caitlin; Barton, Garry R; Brown, Tracey J; Aveyard, Paul; Holland, Richard; Bachmann, Max O; Sutton, Stephen; Leonardi-Bee, Jo; Brandon, Thomas H; Song, Fujian

    2015-07-01

    Most people who quit smoking successfully for a short period will return to smoking again in 12 months. A previous exploratory meta-analysis indicated that self-help booklets may be effective for smoking relapse prevention in unaided quitters. This study aimed to evaluate the effectiveness of a set of self-help educational booklets to prevent smoking relapse in people who had stopped smoking with the aid of behavioural support. This is an open, randomised controlled trial and qualitative process evaluation. Trial participants were randomly allocated to one of two groups, using a simple randomisation process without attempts to stratify by participant characteristics. The participant allocation was 'concealed' because the recruitment of quitters occurred before the random allocation. Short-term quitters were recruited from NHS Stop Smoking Clinics, and self-help educational materials were posted to study participants at home. A total of 1407 carbon monoxide (CO)-validated quitters at 4 weeks after quit date in NHS Stop Smoking Clinics. The trial excluded pregnant women and quitters who were not able to read the educational materials in English. Participants in the experimental group (n = 703) received a set of eight revised Forever Free booklets, and participants in the control group (n = 704) received a single leaflet that is currently given to NHS patients. Follow-up telephone interviews were conducted 3 and 12 months after quit date. The primary outcome was prolonged, CO-verified abstinence from months 4 to 12 during which time no more than five cigarettes were smoked. The secondary outcomes included self-reported abstinence during the previous 7 days at 3 and 12 months, CO-verified abstinence at 12 months, costs (NHS and NHS and participant medication costs perspectives) and quality-adjusted life-years. Logistic regression analyses were conducted to investigate effect-modifying variables. A simultaneous qualitative process evaluation was conducted to help

  9. book reviews

    African Journals Online (AJOL)

    book reviews. Self-testing in ... This book is a useful tool for registrar trainees and practising psy- chiatrists alike. ... sultation service and is a Professor of Psychiatry at Harvard. Medical ... It is recommended as a study aid and provides the ideal ...

  10. Book Review

    African Journals Online (AJOL)

    user

    2004-12-02

    Dec 2, 2004 ... Book Review. World Health Organization 2003. Price Not Available. ISBN 9241545755. This is a paperback book updating three earlier WHO publications namely: • General Surgery at the District Hospital,. • Surgery at the District Hospital,. • Obstetric/Gynecology, Orthopedics/Traumatology, and Anesthesia ...

  11. Book Reviews.

    Science.gov (United States)

    Powicke, J. C.; And Others

    1986-01-01

    Reviews of 10 recent books and one new journal ("Catalyst: A Journal of Policy Debate") are provided. Topics of the books reviewed include: economics in modern Britain, world economics, the mixed economy, Milton Friedman's thought, British industry, economic issues, and London as a financial center. (JDH)

  12. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2011-01-01

    Full Text Available Phillip M. Morse and Herman Feshbach, Professors of Physics at the MIT, published their biblical-sized textbook ‘Methods of Theoretical Physics’ with McGraw-Hill in May 1953. At 1978 pages and published in two books, it is an intimidating twin tome that should still be atop the reading lists or the bookshelves of every mathematical physicist. What material is covered in this book? In the most concise of terms, this book is devoted to the study of differential equations and associated boundary conditions that describe physical fields. The thirteen chapters address what circumstances warrant the use of which differential equations, and most often addresses the question of coordinate system transformations, for example, how do Green's functions for Laplace's Equation transform under different coordinate systems? Under what circumstances the solutions can be expected to be separable? Many examples are covered to illustrate these points. Why is this book relevant to Software Programmers? This book is part of the background that any scientific programmer is likely to need in dealing with physical fields. This book was written before personal computers became ubiquitous, however it is still an outstanding effort to tie the methods of solving differential equations governing fields together in one book. The book never received a second edition, however, it was reprinted to an outstanding standard by Feshbach Publishing since 2004, run by the children of Herman Feshbach. Their website is feshbachpublishing.com. The majority of this review is a mini-commentary of the book showing what is covered in a very terse fashion, which may be useful as a summary even for those who have already read the full text. I then give a brief analysis of the approach to mathematical physics taken by the book. Finally, I will discuss who will benefit from reading this magnificent treatise, nearly 60 years after it was first published.

  13. C. pneumoniae CdsL regulates CdsN ATPase activity, and disruption with a peptide mimetic prevents bacterial invasion

    Directory of Open Access Journals (Sweden)

    Chris Blair Stone

    2011-02-01

    Full Text Available Chlamydiae are obligate intracellular pathogens that likely require type III secretion (T3S to invade cells and replicate intracellulary within a cytoplasmic vacuole called an inclusion body. C. pneumoniae possess a YscL ortholog, CdsL, that has been shown to interact with the T3S ATPase (CdsN. In this report we demonstrate that CdsL down-regulates CdsN enzymatic activity in a dose-dependent manner. Using PepScan epitope mapping we identified two separate binding domains to which CdsL binds viz. CdsN 221-229 and CdsN265-270. We confirmed the binding domains using a pull-down assay and showed that GST-CdsN221-270, which encompasses these peptides, co-purified with His-CdsL. Next, we used orthology modeling based on the crystal structure of a T3S ATPase ortholog from E. coli, EscN, to map the binding domains on the predicted three dimensional structure of CdsN. The CdsL binding domains mapped to the catalytic domain of the ATPase, one in the central channel of the ATPase hexamer and one on the outer face. Since peptide mimetics have been used to disrupt essential protein interactions of the chlamydial T3S system and inhibit T3S-mediated invasion of HeLa cells, we hypothesized that if CdsL – CdsN binding is essential for regulating T3S then a CdsN peptide mimetic could be used to potentially block T3S and Chlamydial invasion. Treatment of EBs with a CdsN peptide mimetic inhibited C. pneumoniae invasion into HeLa cells in a dose-dependent fashion. This report represents the first use of Pepscan technology to identify binding domains for specific T3S proteins viz. CdsL on the ATPase, CdsN, and demonstrates that peptide mimetics can be used as anti-virulence factors to block bacterial invasion.

  14. BOOK MANAGERS CHOICE BOOKS RECEIVED

    African Journals Online (AJOL)

    The receipt of these books is acknowledged, and this listing must be regarded as sufficient return for the courtesy of the sender. Books that appear to be of particular interest will be reviewed as space permits. The SAMJ does not publish unsolicited reviews. ABO-incompatible Kidney Transplantation... By Kota. Takahashi.

  15. Short-term effectiveness of web-based guided self-help for phobic outpatients: randomized controlled trial.

    Science.gov (United States)

    Kok, Robin N; van Straten, Annemieke; Beekman, Aartjan T F; Cuijpers, Pim

    2014-09-29

    Internet-based guided self-help has been successfully used in the general population, but it is unknown whether this method can be effectively used in outpatient clinics for patients waiting for face-to-face psychotherapy for phobias. The aim was to assess the clinical effectiveness of Phobias Under Control, an Internet-based intervention based on exposure therapy with weekly guidance. We conducted a randomized controlled trial, recruiting 212 outpatients scheduled to receive face-to-face psychotherapy for any type of phobia at an outpatient clinic. Participants suffering from at least 1 DSM-IV or ICD-10 classified phobia (social phobia, agoraphobia with or without panic disorder, and/or specific phobia as ascertained by a telephone interview at baseline) were randomly allocated to either a 5-week Internet-based guided self-help program based on exposure therapy with weekly student support followed by face-to-face psychotherapy (n=105) or a wait-list control group followed by face-to-face psychotherapy (n=107). Primary outcome was the Fear Questionnaire (FQ). Secondary outcomes were the Beck Anxiety Inventory (BAI) and Center of Epidemiological Studies-Depression scale (CES-D). Assessments took place by telephone at baseline (T0) and on the Internet at posttest (T1, self-assessment at 5 weeks after baseline). Missing data at T1 were imputed. At posttest, analysis of covariance on the intention-to-treat sample showed significant but small effect sizes between intervention and control groups on the FQ (d=0.35, P=.02), CES-D (d=0.34, P=.03), and a nonsignificant effect size on the BAI (d=0.28. P=.05). Although initial acceptance was good, high nonresponse was observed, with 86 of 212 participants (40.5%) lost to follow-up at T1 and only 14 of 105 (13.3%) intervention participants finishing all 5 weeks. Phobias Under Control is modestly effective in lowering phobic and depressive symptoms in a relatively short period and may be clinically beneficial when implemented in

  16. Evaluation of social-cognitive versus stage-matched, self-help physical activity interventions at the workplace.

    Science.gov (United States)

    Griffin-Blake, C Shannon; DeJoy, David M

    2006-01-01

    To compare the effectiveness of stage-matched vs. social-cognitive physical activity interventions in a work setting. Both interventions were designed as minimal-contact, self-help programs suitable for large-scale application. Randomized trial. Participants were randomized into one of the two intervention groups at baseline; the follow-up assessment was conducted 1 month later. A large, public university in the southeastern region of the United States. Employees from two academic colleges within the participating institution were eligible to participate: 366 employees completed the baseline assessment; 208 of these completed both assessments (baseline and follow-up) and met the compliance criteria. Printed, self-help exercise booklets (12 to 16 pages in length) either (1) matched to the individual's stage of motivational readiness for exercise adoption at baseline or (2) derived from social-cognitive theory but not matched by stage. Standard questionnaires were administered to assess stage of motivational readiness for physical activity; physical activity participation; and exercise-related processes of change, decisional balance, self-efficacy, outcome expectancy, and goal satisfaction. The two interventions were equally effective in moving participants to higher levels of motivational readiness for regular physical activity. Among participants not already in maintenance at baseline, 34.9% in the stage-matched condition progressed, while 33.9% in the social-cognitive group did so (chi2 = not significant). Analyses of variance showed that the two treatment groups did not differ in terms of physical activity participation, cognitive and behavioral process use, decisional balance, or the other psychological constructs. For both treatment groups, cognitive process use remained high across all stages, while behavioral process use increased at the higher stages. The pros component of decisional balance did not vary across stage, whereas cons decreased significantly

  17. Orange Book

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Approved Drug Products with Therapeutic Equivalence (Orange Book or OB) is a list of drugs approved under Section 505 of the Federal Food, Drug and Cosmetic Act...

  18. Book review

    African Journals Online (AJOL)

    feminist scholarly circles, who acted as editors, consulting editors, project co- ... The organization of the book posed numerous difficulties to the editors, ... informs the reader, Mvemve was "keen to have Western science confirm the efficacy.

  19. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2012-01-01

    Full Text Available The second edition of Computational Physics by Rubin Landau, Manuel Paez and Cristian C. Bordeianu (published by Wiley hit bookshelves in 2007, and is steadily making its way into physics classrooms across the United States. Your reviewer first encountered the book at the Stanford Campus Book Store, where it is presumably being put to good use by students and faculty. The first edition was published in 1997 with Landau and Paez as authors [Computational Physics, 1st edn, Wiley, New York, 1997]. Rubin Landau is a very experienced computational physicist and staff member of the Oregon State University in Corvallis, where he directs the Computational Physics for Undergraduates course and teaches using this book. Landau is an incredibly active teacher to put it mildly – the code for the book is supplied in an accompanying DVD and he also posts applets and video lectures for his courses on his web page (http://www.physics.orst.edu/~rubin/.

  20. Book Review

    African Journals Online (AJOL)

    Bernt Lindtjorn

    Book Review. Water Resources Management in Ethiopia: Implications for the Nile Basin. ... general to specific issues within the Ethiopian context. ... properly made with regard to water source, ... of those of Tanzania, Kenya, Burundi, Rwanda,.

  1. Cognitive-behavioural group therapy versus guided self-help for compulsive buying disorder: a preliminary study.

    Science.gov (United States)

    Müller, A; Arikian, A; de Zwaan, M; Mitchell, J E

    2013-01-01

    Compulsive buying (CB) is defined as extreme preoccupation with buying/shopping and frequent buying that causes substantial negative psychological, social, occupational and financial consequences. There exists preliminary evidence that group cognitive-behavioural therapy (CBT) is effective in the treatment of CB. The present pilot study made a first attempt to compare group CBT for CB with telephone-guided self-help (GSH). Fifty-six patients were allocated randomly to one of the three conditions: (1) group CBT (n = 22); (2) GSH (n = 20); and (3) a waiting list condition (n = 14). The results indicate that face-to-face group CBT is superior not only to the waiting list condition but also to GSH. Patients who received GSH tended to have more success in overcoming CB compared with the waiting list controls. Given the sample size, the results must be considered as preliminary and further research is needed to address the topic whether GSH also could be a helpful intervention in reducing CB. Copyright © 2011 John Wiley & Sons, Ltd.

  2. Systematic Transcreation of Self-Help Smoking Cessation Materials for Hispanic/Latino Smokers: Improving Cultural Relevance and Acceptability.

    Science.gov (United States)

    Piñeiro, Bárbara; Díaz, Diana R; Monsalve, Luis M; Martínez, Úrsula; Meade, Cathy D; Meltzer, Lauren R; Brandon, Karen O; Unrod, Marina; Brandon, Thomas H; Simmons, Vani N

    2018-01-01

    Smoking-related illnesses are the leading causes of death among Hispanics/Latinos. Yet, there are few smoking cessation interventions targeted for this population. The goal of this study was to "transcreate" an existing, previously validated, English language self-help smoking cessation intervention, titled Forever Free ® : Stop Smoking for Good, for Spanish-speaking smokers. Rather than simply translating the materials, our transcreation process involved culturally adapting the intervention to enhance acceptability and receptivity of the information. We utilized a multiphase qualitative approach (focus groups and learner verification interviews) to develop a linguistically and culturally relevant intervention for the diverse sub-ethnic groups of Hispanic/Latino smokers. Focus group findings indicated a need to underscore several additional cultural characteristics and themes such as the need to address familism and unique stressors faced by immigrants and to provide information regarding nicotine replacement therapy. Learner verification findings indicated a need to further emphasize financial and social benefits of quitting smoking and to discuss how family and friends can support the quit attempt. These steps led to the development of a Spanish-language smoking cessation intervention titled, Libre del cigarillo, por mi familia y por mí: Guía para dejar de fumar, that is currently being tested in a national randomized controlled trial.

  3. A Pilot Randomized Controlled Trial of a Guided Self-Help Intervention to Manage Chronic Orofacial Pain.

    Science.gov (United States)

    Goldthorpe, Joanna; Lovell, Karina; Peters, Sarah; McGowan, Linda; Nemeth, Imola; Roberts, Christopher; Aggarwal, Vishal R

    2017-01-01

    To conduct a pilot trial to test the feasibility of a guided self-help intervention for chronic orofacial pain. A pilot randomized controlled trial was conducted to compare the intervention with usual treatment. A total of 37 patients with chronic orofacial pain were randomized into either the intervention group (n = 19) or the usual treatment (control) group (n = 18). Validated outcome measures were used to measure the potential effectiveness of the intervention over a number of domains: physical and mental functioning (Short Form 36 [SF-36]); anxiety and depression (Hospital Anxiety and Depression Scale [HADS]); pain intensity and interference with life (Brief Pain Inventory [BPI]); disability (Manchester Orofacial Pain Disability Scale [MOPDS]); and illness behavior (Revised Illness Perceptions Questionnaire [IPQr]). Bootstrap confidence intervals were computed for the treatment effect (ES) posttreatment and at 3 months follow-up and adjusted for baseline values of the outcome measure by using analysis of covariance. At posttreatment and the 3-month follow-up, 11 participants in the intervention group and 7 in the control group failed to complete outcome measures. The intervention was acceptable and could be feasibly delivered face to face or over the telephone. Although the pilot trial was not powered to draw conclusions about the effectiveness, it showed significant (P orofacial pain. It showed potential effectiveness on outcome domains related to functioning and illness perception. Further research is needed to understand the cost effectiveness of the intervention for chronic orofacial pain.

  4. Self Help Groups (SHGs and Women’s Development: A Case Study of the Varanasi District, India

    Directory of Open Access Journals (Sweden)

    Tripti Kumari

    2015-03-01

    Full Text Available Development is a multi-dimensional process that affects society in multiple ways. It is well documented that women constitute about half of the world’s population but their share in the economy and other development spheres remain neglected. In addition, this large section of population (including Indian women have been suffering from various disadvantages - lack of accessibility to resources, non-recognition of their economic contribution within the family and society. In order to resolve these emerging challenges, Government of India (GOI has implemented various programmes and policies since Independence. Among these programmes, Self Help Groups (SHGs may be considered as a significant initiative of the government as well as the non-governmental organisations (NGOs. These are based on the principle of democratic process of development. The democratic institution provides a platform to the socially and economically deprived sections and encourages them for economic participation. Since the 1970s, SHGs have been working in many states of India and contributing to the development processes. The present paper is an attempt to analyse the contribution of SHGs in women’s development in the district of Varanasi in Uttar Pradesh. The impact of these groups on women’s development has been analysed by Gender Development Index (GDI, which focused on the male-female differences in terms of longevity of life, knowledge and economic betterment.

  5. [Self-determined but with professional leadership? On the effectiveness and definition of self-help groups].

    Science.gov (United States)

    Klytta, C; Wilz, G

    2007-02-01

    Because the effectiveness of self-help groups (SHGs) has not been proven yet and also since multi-focus reviews on SHGs are rare, the present article offers an overview of the current state of research. Possible reasons for the conflicting results in the literature are also investigated. An extensive literature search was done to review studies which used longitudinal design and control groups to measure the effectiveness of SHGs and so-called "support groups". Positive effects in comparison to the control groups were proven in four out of seven of the studies. In the remaining three studies the outcomes between the groups were the same. Considering the naturalistic designs of the studies, these results clearly indicate that SHGs are indeed effective. An insufficient consideration of the heterogeneity of the groups is held responsible for the difficulties associated with previous research on the topic, especially as far as the differentiation between SHGs and professionally led groups is concerned. The definition excludes professional leadership but, in fact, professional involvement in SHGs up to their leadership is the rule. The following suggestions have been derived from this literature analysis: uniform classifications for SHGs and professionally-led support groups should be established in order to make it possible to provide a clear distinction between these types of groups as well as to indicate the extent of professional involvement in them. A plea is made for a generally stronger consideration of organisational differences in the research of SHGs.

  6. Book Review

    Science.gov (United States)

    Clevers, Jan G. P. W.

    2018-05-01

    This book provides a comprehensive and timely overview on all aspects of hyperspectral remote sensing combined with various applications. As such, it is an excellent book of reference for both students and professionals active in the field of optical remote sensing. It deals with all aspects of retrieving quantitative information on biophysical properties of the Earth's surface, the data corrections needed and the range of analysis approaches available.

  7. Book Reviews

    OpenAIRE

    Matić, Ninoslav; Motik, Boris; Šribar, Julijan; Bažant, Alen; Kos, Mladen; Glavinić, Vlado

    1996-01-01

    The PC System Architecture Series of books from MindShare, one of the leading technical training companies in the hardware industry, includes the following titles: ISA System Architecture, EISA System Architecture, 486 System Architecture, Pentium Processor System Architecture, Plug&Play System Architecture, Power PC System Architecture, PCI System Architecture, PCMCIA SystemArchitecture. Each of them is a powerful reference book for one particular type of chip or hardware, with the character...

  8. Guided self-help concreteness training as an intervention for major depression in primary care: a Phase II randomized controlled trial

    DEFF Research Database (Denmark)

    Watkins, E R; Taylor, R S; Baeyens, C

    2012-01-01

    major depression in primary care, although the effect was not significantly different from an existing active treatment (RT) matched for structural and common factors. Because of its relative brevity and distinct format, it may have value as an additional innovative approach to increase......Background The development of widely accessible, effective psychological interventions for depression is a priority. This randomized trial provides the first controlled data on an innovative cognitive bias modification (CBM) training guided self-help intervention for depression. Method One hundred...... and twenty-one consecutively recruited participants meeting criteria for current major depression were randomly allocated to treatment as usual (TAU) or to TAU plus concreteness training (CNT) guided self-help or to TAU plus relaxation training (RT) guided self-help. CNT involved repeated practice at mental...

  9. Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using ...

    African Journals Online (AJOL)

    Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using culture supernatants of Escherichia coli ATCC 8739, Bacillus subtilis ATCC 6633 and Lactobacillus ... The process of extracellular and fast biosynthesis may help in the development of an easy and eco-friendly route for the synthesis of CdS nanoparticles.

  10. Regime-dependent determinants of Euro area sovereign CDS spreads

    NARCIS (Netherlands)

    Blommestein, H.J.; Eijffinger, Sylvester; Qian, Zongxin

    We study the determinants of sovereign CDS spreads of five Euro area countries (Greece, Ireland, Italy, Portugal, and Spain) after the collapse of Lehman Brothers. We find that global and/or European Monetary Union (EMU)-wide factors are the main drivers of changes in the sovereign CDS spreads in

  11. Preliminary evaluation of a “formulation-driven cognitive behavioral guided self-help (fCBT-GSH” for crisis and transitional case management clients

    Directory of Open Access Journals (Sweden)

    Naeem F

    2017-03-01

    Full Text Available Farooq Naeem,1,2 Rupinder K Johal,1 Claire Mckenna,1 Olivia Calancie,1 Tariq Munshi,1,2 Tariq Hassan,1 Amina Nasar,3 Muhammad Ayub1 1Department of Psychiatry, Queen’s University, Kingston, ON, Canada; 2Addiction and Mental Health Services – Kingston, Frontenac, Lennox & Addington (AMHS-KFLA, Kingston, ON, Canada; 3Services Institute of Medical Sciences, Lahore, Pakistan Background: Cognitive behavioral therapy (CBT is found to be effective for common mental disorders and has been delivered in self-help and guided self-help formats. Crisis and transitional case management (TCM services play a vital role in managing clients in acute mental health crises. It is, therefore, an appropriate setting to try CBT in guided self-help format.Methods: This was a preliminary evaluation of a formulation-driven cognitive behavioral guided self-help. Thirty-six (36 consenting participants with a diagnosis of nonpsychotic illness, attending crisis and the TCM services in Kingston, Canada, were recruited in this study. They were randomly assigned to the guided self-help plus treatment as usual (TAU (treatment group or to TAU alone (control group. The intervention was delivered over 8–12 weeks. Assessments were completed at baseline and 3 months after baseline. The primary outcome was a reduction in general psychopathology, and this was done using Clinical Outcomes in Routine Evaluation – Outcome Measure. The secondary outcomes included a reduction in depression, measured using the Hospital Anxiety and Depression Scale, and reduction in disability, measured using the World Health Organization Disability Assessment Schedule 2.0.Findings: Participants in the treatment group showed statistically significant improvement in overall psychopathology (P<0.005, anxiety and depression (P<0.005, and disability (P<0.005 at the end of the trial compared with TAU group. Conclusion: A formulation-driven cognitive behavioral guided self-help was feasible for the crisis

  12. BOOK MANAGER'S CHOICE BOOKS RECEIVED

    African Journals Online (AJOL)

    progression from qualitative to quantitative methods. He begins with an ethnography of concepts of mental illness held by care providers from both the ... research methods for the southern African context. I heartily recommend this book.

  13. Electronic book – paperless book

    Directory of Open Access Journals (Sweden)

    Mateja Ločniškar-Fidler

    2003-01-01

    Full Text Available The article presents the electronic book, which is accessible on the Internet, with particularities and drawbacks that the present and future users and librarians may encounter.It also presents devices (such as scanners and hand-helds and software required for reading and designing electronic books, as well as the details we should pay attention to when buying and using the above mentioned devices. Some of the most significant web pages dedicated to the selling and promoting of electronic books are also presented. The protection of authors’ works, distributed via the Internet and digital media, is gaining importance. In September 1999, Slovenia also joined the international agreement on the protection of copyrights. It is expected that electronic books will gradually become part of the collection of all types of libraries. Therefore, libraries will need appropriate technical equipment as well as trained personnel for the usage of this new medium.

  14. Biosynthesis of CdS nanoparticles in banana peel extract.

    Science.gov (United States)

    Zhou, Guang Ju; Li, Shuo Hao; Zhang, Yu Cang; Fu, Yun Zhi

    2014-06-01

    Cadmium sulfide (CdS) nanoparticles (NPs) were synthesized by using banana peel extract as a convenient, non-toxic, eco-friendly 'green' capping agent. Cadmium nitrate and sodium sulfide are main reagents. A variety of CdS NPs are prepared through changing reaction conditions (banana extracts, the amount of banana peel extract, solution pH, concentration and reactive temperature). The prepared CdS colloid displays strong fluorescence spectrum. X-ray diffraction analysis demonstrates the successful formation of CdS NPs. Fourier transform infra-red (FTIR) spectrogram indicates the involvement of carboxyl, amine and hydroxyl groups in the formation of CdS NPs. Transmission electron microscope (TEM) result reveals that the average size of the NPs is around 1.48 nm.

  15. A four-year experience with a Web-based self-help intervention for depressive symptoms in Mexico

    Directory of Open Access Journals (Sweden)

    María Asunción Lara

    2014-06-01

    Full Text Available OBJECTIVE: To describe a four-year descriptive, naturalistic study monitoring the use of HDep (Help for Depression or Ayuda para depression (ADepin Spanish, an open-access/free Web-based, psycho-education, cognitive-behavioral intervention program produced in Mexico consisting of seven self-help modules that include feedback-generating assessments of depressive symptoms, vignettes, recorded messages, a relaxation exercise, a personal workbook, blogs, and user discussion forums. METHODS: Data were collected on all individuals who entered the HDep site since the program's launching in 2009. Those who entered the site two or more times and also registered as "users" or "participants." The user data consisted of 1 user profiles; 2 scores for the CES-D (Center for Epidemiological Studies Depression Scale, for users who completed the feedback-generating assessments of depressive symptoms; 3 user evaluations of the usefulness of HDep; and 4 transcripts of HDep discussion forum posts. The raw user data were obtained through Moodle (Modular Object-Oriented Dynamic Learning Environment, a free software e-learning platform and analyzed quantitatively (using SPSS and qualitatively (using ATLAS.ti. RESULTS: A total of 28 078 individuals accessed HDep and 17 318 of those (61.6% qualified as users. Of all users, 84.4% were women, 64.6% used the workbook, and 60.9% entered the discussion forums (of whom 16.3% added a post. Depressive symptoms (CES-D score ≥ 16 were observed in 97.1% of the users who completed the feedback-generating assessment (n = 16 564. User retention dropped across the seven modules (from 12 366 users for Module 1 to 626 for Module 7. However, all seven modules were rated very high for "helpfulness/usefulness," with mean scores all above 4 on a 1 - 5 scale. The HDep discussion forums showed a rich social interaction. Predictors of entering at least one module (based on stepwise logistic regression analysis included being a woman, being

  16. Book reviews

    Directory of Open Access Journals (Sweden)

    Tore Ahlbäck

    2011-05-01

    Full Text Available Four book reviews are included in this issue of Approaching Religion:The Process of Buddhist-Christian Dialogue (2009 by Paul O. Ingram is reviewed by Dr Teuvo Laitila. The book deals with contemporary dialogues between Buddhists and Christians, mainly in the West, by applying a three-part perspective denoted conceptual, engaged and internal.Producing Islamic Knowledge. Transmission and Dissemination in Western Europe (2010 by Martin van Bruinessen and Stefano Allievi is reviewed by Dr Jeanette Jouili. The book investigates into Islamic knowledge production taking place in the contemporary European context, from a theoretical as well as from a richly varied empirical perspective.Grounding Religion. A Field Guide to the Study of Religion and Ecology (2011 by Whitney A. Bauman, Richard R. Bohannon II and Kevin J. O’Brien is reviewed by MA Laura Wickström. The book provides an introduction to the field of religion and ecology with special emphasis on interreligious co-operation.Mirakel, mysterier och moraliteter. Från puritanism till New Age – en religionshistorisk studie av Helen Shucman och A Course in Miracles (2010 is reviewed by Dr Tore Ahlbäck. The book is a doctoral thesis analysing the history of creation behind the highly influential spiritual guide A Course in Miracles (1965–72 and its originator Helen Shucman.

  17. Economic evaluation of cognitive behavioral therapy and Internet-based guided self-help for binge-eating disorder.

    Science.gov (United States)

    König, Hans-Helmut; Bleibler, Florian; Friederich, Hans-Christoph; Herpertz, Stephan; Lam, Tony; Mayr, Andreas; Schmidt, Frauke; Svaldi, Jennifer; Zipfel, Stephan; Brettschneider, Christian; Hilbert, Anja; de Zwaan, Martina; Egger, Nina

    2018-02-01

    To determine the cost-effectiveness of individual face-to-face cognitive behavioral therapy (CBT) compared to therapist guided Internet-based self-help (GSH-I) in overweight or obese adults with binge-eating disorder (BED). Analysis was conducted alongside the multicenter randomized controlled INTERBED trial. CBT (n = 76) consisted of up to 20 individual therapy sessions over 4 months. GSH-I (n = 71) consisted of 11 modules combining behavioral interventions, exercises including a self-monitoring food diary, psychoeducation, and 2 face-to-face coaching sessions over 4 months. Assessments at baseline, after 4 months (post-treatment), as well as 6 and 18 months after the end of treatment included health care utilization and sick leave days to calculate direct and indirect costs. Binge-free days (BFD) were calculated as effect measure based on the German version of the Eating Disorder Examination. The incremental cost-effectiveness ratio (ICER) was determined, and net benefit regressions, adjusted for comorbidities and baseline differences, were used to derive cost-effectiveness acceptability curves. After controlling for baseline differences, CBT was associated with non-significantly more costs (+€2,539) and BFDs (+40.1) compared with GSH-I during the 22-month observation period, resulting in an adjusted ICER of €63 per additional BFD. CBTs probability of being cost-effective increased above 80% only if societal willingness to pay (WTP) was ≥€250 per BFD. We did not find clear evidence for one of the treatments being more cost-effective. CBT tends to be more effective but also more costly. If the societal WTP for an additional BFD is low, then our results suggest that GSH-I should rather be adopted. © 2018 Wiley Periodicals, Inc.

  18. Randomized Controlled Trial Comparing Smartphone Assisted Versus Traditional Guided Self-Help for Adults with Binge Eating

    Science.gov (United States)

    Hildebrandt, Tom; Michaelides, Andreas; Mackinnon, Dianna; Greif, Rebecca; DeBar, Lynn; Sysko, Robyn

    2017-01-01

    Objective Guided self-help treatments based on cognitive-behavior therapy (CBT-GSH) are efficacious for binge eating. With limited availability of CBT-GSH in the community, mobile technology offers a means to increase use of these interventions. The purpose of this study was to test the initial efficacy of Noom Monitor, a smartphone application designed to facilitate CBT-GSH (CBT-GSH+Noom), on study retention, adherence, and eating disorder symptoms compared to traditional CBT-GSH. Method Sixty-six men and women with DSM-5 binge eating disorder (BED) or bulimia nervosa (BN) were randomized to receive 8 sessions of CBT-GSH + Noom (n = 33) or CBT-GSH (n = 33) over 12 weeks. Primary symptom outcomes were Eating Disorder Examination objective bulimic episodes (OBEs), subjective bulimic episodes (SBEs), and compensatory behaviors. Assessments were collected at 0, 4, 8, 12, 24, and 36 weeks. Behavioral outcomes were modeled using zero-inflated negative-binomial latent growth curve models with intent-to-treat. Results There was a significant effect of treatment on change in OBEs (β =−0.84, 95%CI = −1.49, −0.19) favoring CBT-GSH + Noom. Remission rates were not statistically different between treatments for OBEs (βlogit =−0.73, 95%CI = −1.86, 3.27; CBT-GSH + Noom = 17/27, 63.0% vs. CBT-GSH 11/27, 40.7%, NNT = 4.5), but CBT-GSH + Noom participants reported greater meal and snack adherence and regular meal adherence mediated treatment effects on OBEs. The treatments did not differ at the 6-month follow-up. Discussion Smartphone applications for the treatment binge eating appear to have advantages for adherence, a critical component of treatment dissemination. PMID:28960384

  19. Promoting household water treatment through women's self help groups in Rural India: assessing impact on drinking water quality and equity.

    Directory of Open Access Journals (Sweden)

    Matthew C Freeman

    Full Text Available Household water treatment, including boiling, chlorination and filtration, has been shown effective in improving drinking water quality and preventing diarrheal disease among vulnerable populations. We used a case-control study design to evaluate the extent to which the commercial promotion of household water filters through microfinance institutions to women's self-help group (SHG members improved access to safe drinking water. This pilot program achieved a 9.8% adoption rate among women targeted for adoption. Data from surveys and assays of fecal contamination (thermotolerant coliforms, TTC of drinking water samples (source and household were analyzed from 281 filter adopters and 247 non-adopters exposed to the program; 251 non-SHG members were also surveyed. While adopters were more likely than non-adopters to have children under 5 years, they were also more educated, less poor, more likely to have access to improved water supplies, and more likely to have previously used a water filter. Adopters had lower levels of fecal contamination of household drinking water than non-adopters, even among those non-adopters who treated their water by boiling or using traditional ceramic filters. Nevertheless, one-third of water samples from adopter households exceeded 100 TTC/100ml (high risk, and more than a quarter of the filters had no stored treated water available when visited by an investigator, raising concerns about correct, consistent use. In addition, the poorest adopters were less likely to see improvements in their water quality. Comparisons of SHG and non-SHG members suggest similar demographic characteristics, indicating SHG members are an appropriate target group for this promotion campaign. However, in order to increase the potential for health gains, future programs will need to increase uptake, particularly among the poorest households who are most susceptible to disease morbidity and mortality, and focus on strategies to improve the

  20. Internet-based self-help treatment for depression in multiple sclerosis: study protocol of a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Boeschoten Rosa E

    2012-09-01

    Full Text Available Abstract Background Depression in MS patients is frequent but often not treated adequately. An important underlying factor may be physical limitations that preclude face-to-face contact. Internet-based treatment showed to be effective for depressive symptoms in general and could thus be a promising tool for treatment in MS. Methods/design Here, we present a study protocol to investigate the effectiveness of a 5 week Internet-based self-help problem solving treatment (PST for depressive symptoms in MS patients in a randomized controlled trial. We aim to include 166 MS patients with moderate to severe depressive symptoms who will be randomly assigned to an Internet-based intervention (with or without supportive text-messages or waiting list control group. The primary outcome is the change in depressive symptoms defined by a change in the sum score on the Beck Depression Inventory (BDI-II. Secondary outcomes will include measures of anxiety, fatigue, cognitive functioning, physical and psychological impact of MS, quality of life, problem solving skills, social support, mastery, satisfaction and compliance rate. Assessments will take place at baseline (T0, within a week after the intervention (T1, at four months (T2 and at ten months follow-up (T3: only the intervention group. The control group will be measured at the same moments in time. Analysis will be based on the intention-to-treat principle. Discussion If shown to be effective, Internet-based PST will offer new possibilities to reach and treat MS patients with depressive symptoms and to improve the quality of care. Trial Registration The Dutch Cochrane Center, NTR2772

  1. Randomized controlled trial comparing smartphone assisted versus traditional guided self-help for adults with binge eating.

    Science.gov (United States)

    Hildebrandt, Tom; Michaelides, Andreas; Mackinnon, Dianna; Greif, Rebecca; DeBar, Lynn; Sysko, Robyn

    2017-11-01

    Guided self-help treatments based on cognitive-behavior therapy (CBT-GSH) are efficacious for binge eating. With limited availability of CBT-GSH in the community, mobile technology offers a means to increase use of these interventions. The purpose of this study was to test the initial efficacy of Noom Monitor, a smartphone application designed to facilitate CBT-GSH (CBT-GSH + Noom), on study retention, adherence, and eating disorder symptoms compared to traditional CBT-GSH. Sixty-six men and women with DSM-5 binge-eating disorder (BED) or bulimia nervosa (BN) were randomized to receive eight sessions of CBT-GSH + Noom (n = 33) or CBT-GSH (n = 33) over 12 weeks. Primary symptom outcomes were eating disorder examination objective bulimic episodes (OBEs), subjective bulimic episodes (SBEs), and compensatory behaviors. Assessments were collected at 0, 4, 8, 12, 24, and 36 weeks. Behavioral outcomes were modeled using zero-inflated negative-binomial latent growth curve models with intent-to-treat. There was a significant effect of treatment on change in OBEs (β = -0.84, 95% CI = -1.49, -0.19) favoring CBT-GSH + Noom. Remission rates were not statistically different between treatments for OBEs (β logit  = -0.73, 95% CI = -1.86, 3.27; CBT-GSH-Noom = 17/27, 63.0% vs. CBT-GSH 11/27, 40.7%, NNT = 4.5), but CBT-GSH-Noom participants reported greater meal and snack adherence and regular meal adherence mediated treatment effects on OBEs. The treatments did not differ at the 6-month follow-up. Smartphone applications for the treatment binge eating appear to have advantages for adherence, a critical component of treatment dissemination. © 2017 Wiley Periodicals, Inc.

  2. Promoting Household Water Treatment through Women's Self Help Groups in Rural India: Assessing Impact on Drinking Water Quality and Equity

    Science.gov (United States)

    Freeman, Matthew C.; Trinies, Victoria; Boisson, Sophie; Mak, Gregory; Clasen, Thomas

    2012-01-01

    Household water treatment, including boiling, chlorination and filtration, has been shown effective in improving drinking water quality and preventing diarrheal disease among vulnerable populations. We used a case-control study design to evaluate the extent to which the commercial promotion of household water filters through microfinance institutions to women's self-help group (SHG) members improved access to safe drinking water. This pilot program achieved a 9.8% adoption rate among women targeted for adoption. Data from surveys and assays of fecal contamination (thermotolerant coliforms, TTC) of drinking water samples (source and household) were analyzed from 281 filter adopters and 247 non-adopters exposed to the program; 251 non-SHG members were also surveyed. While adopters were more likely than non-adopters to have children under 5 years, they were also more educated, less poor, more likely to have access to improved water supplies, and more likely to have previously used a water filter. Adopters had lower levels of fecal contamination of household drinking water than non-adopters, even among those non-adopters who treated their water by boiling or using traditional ceramic filters. Nevertheless, one-third of water samples from adopter households exceeded 100 TTC/100ml (high risk), and more than a quarter of the filters had no stored treated water available when visited by an investigator, raising concerns about correct, consistent use. In addition, the poorest adopters were less likely to see improvements in their water quality. Comparisons of SHG and non-SHG members suggest similar demographic characteristics, indicating SHG members are an appropriate target group for this promotion campaign. However, in order to increase the potential for health gains, future programs will need to increase uptake, particularly among the poorest households who are most susceptible to disease morbidity and mortality, and focus on strategies to improve the correct, consistent

  3. The Feasibility, Acceptability, and Efficacy of Delivering Internet-Based Self-Help and Guided Self-Help Interventions for Generalized Anxiety Disorder to Indian University Students: Design of a Randomized Controlled Trial.

    Science.gov (United States)

    Kanuri, Nitya; Newman, Michelle G; Ruzek, Josef I; Kuhn, Eric; Manjula, M; Jones, Megan; Thomas, Neil; Abbott, Jo-Anne M; Sharma, Smita; Taylor, C Barr

    2015-12-11

    Generalized anxiety disorder (GAD) is one of the most common mental disorders among university students; however, many students go untreated due to treatment costs, stigma concerns, and limited access to trained mental health professionals. These barriers are heightened in universities in India, where there are scant mental health care services and severe stigma surrounding help seeking. To evaluate the feasibility, acceptability, and efficacy of Internet-based, or "online," cognitive behavioral therapy (CBT)-based unguided and guided self-help interventions (using the programs GAD Online and Lantern, respectively) to reduce GAD symptoms in students with clinical and subthreshold GAD and, ultimately, reduce the prevalence and incidence of GAD among the student population. Students will be recruited via 3 colleges in Hyderabad, India, and referred for a campus-wide online screening. Self-report data will be collected entirely online. A total of 300 qualifying students will be randomized in a 1:1:1 ratio to receive GAD Online, Lantern, or to be in a wait-list control condition, stratified by clinical and subthreshold GAD symptomatology. Students will complete a postintervention assessment after 3 months and a follow-up assessment 6 months later, at which point students in the wait-list control condition will receive one of the programs. The primary outcome is GAD symptom severity at 3 months postintervention. Secondary outcomes include GAD caseness at 9 months, other anxiety and depression symptoms, self-efficacy, and functional measures (eg, sleep, social functioning) at 3 and 9 months, respectively. Primary analyses will be differences between each of the intervention groups and the wait-list control group, analyzed on an intention-to-treat (ITT) basis using mixed-design ANOVA. The study commenced in February 2015. The sample was recruited over a 3-week period at each college. The trial is expected to end in December 2015. This trial will be the first to evaluate

  4. The Feasibility, Acceptability, and Efficacy of Delivering Internet-Based Self-Help and Guided Self-Help Interventions for Generalized Anxiety Disorder to Indian University Students: Design of a Randomized Controlled Trial

    Science.gov (United States)

    Newman, Michelle G; Ruzek, Josef I; Kuhn, Eric; Manjula, M; Jones, Megan; Thomas, Neil; Abbott, Jo-Anne M; Sharma, Smita; Taylor, C. Barr

    2015-01-01

    Background Generalized anxiety disorder (GAD) is one of the most common mental disorders among university students; however, many students go untreated due to treatment costs, stigma concerns, and limited access to trained mental health professionals. These barriers are heightened in universities in India, where there are scant mental health care services and severe stigma surrounding help seeking. Objective To evaluate the feasibility, acceptability, and efficacy of Internet-based, or “online,” cognitive behavioral therapy (CBT)-based unguided and guided self-help interventions (using the programs GAD Online and Lantern, respectively) to reduce GAD symptoms in students with clinical and subthreshold GAD and, ultimately, reduce the prevalence and incidence of GAD among the student population. Methods Students will be recruited via 3 colleges in Hyderabad, India, and referred for a campus-wide online screening. Self-report data will be collected entirely online. A total of 300 qualifying students will be randomized in a 1:1:1 ratio to receive GAD Online, Lantern, or to be in a wait-list control condition, stratified by clinical and subthreshold GAD symptomatology. Students will complete a postintervention assessment after 3 months and a follow-up assessment 6 months later, at which point students in the wait-list control condition will receive one of the programs. The primary outcome is GAD symptom severity at 3 months postintervention. Secondary outcomes include GAD caseness at 9 months, other anxiety and depression symptoms, self-efficacy, and functional measures (eg, sleep, social functioning) at 3 and 9 months, respectively. Primary analyses will be differences between each of the intervention groups and the wait-list control group, analyzed on an intention-to-treat (ITT) basis using mixed-design ANOVA. Results The study commenced in February 2015. The sample was recruited over a 3-week period at each college. The trial is expected to end in December 2015

  5. Internet-delivered cognitive-behavioural therapy v. conventional guided self-help for bulimia nervosa: long-term evaluation of a randomised controlled trial.

    Science.gov (United States)

    Wagner, Gudrun; Penelo, Eva; Wanner, Christian; Gwinner, Paulina; Trofaier, Marie-Louise; Imgart, Hartmut; Waldherr, Karin; Wöber-Bingöl, Ciçek; Karwautz, Andreas F K

    2013-02-01

    Cognitive-behavioural therapy (CBT)-based guided self-help is recommended as a first step in the treatment of bulimia nervosa. To evaluate in a randomised controlled trial (Clinicaltrials.gov registration number: NCT00461071) the long-term effectiveness of internet-based guided self-help (INT-GSH) compared with conventional guided bibliotherapy (BIB-GSH) in females with bulimia nervosa. A total of 155 participants were randomly assigned to INT-GSH or BIB-GSH for 7 months. Outcomes were assessed at baseline, month 4, month 7 and month 18. The greatest improvement was reported after 4 months with a continued reduction in eating disorder symptomatology reported at month 7 and 18. After 18 months, 14.6% (n = 7/48) of the participants in the INT-GSH group and 25% (n = 7/28) in the BIB-GSH group were abstinent from binge eating and compensatory measures, 43.8% (n = 21/48) and 39.2% (n = 11/28) respectively were in remission. No differences regarding outcome between the two groups were found. Internet-based guided self-help for bulimia nervosa was not superior compared with bibliotherapy, the gold standard of self-help. Improvements remain stable in the long term.

  6. Internet-Based Self-Help with Therapist Feedback and in Vivo Group Exposure for Social Phobia: A Randomized Controlled Trial

    Science.gov (United States)

    Andersson, Gerhard; Carlbring, Per; Holmstrom, Annelie; Sparthan, Elisabeth; Furmark, Tomas; Nilsson-Ihrfelt, Elisabeth; Buhrman, Monica; Ekselius, Lisa

    2006-01-01

    Sixty-four individuals with social phobia (social anxiety disorder) were assigned to a multimodal cognitive-behavioral treatment package or to a waiting list control group. Treatment consisted of a 9-week, Internet-delivered, self-help program that was combined with 2 group exposure sessions in real life and minimal therapist contact via e-mail.…

  7. A Randomized Controlled Trial of a Novel Self-Help Technique for Impulse Control Disorders: A Study on Nail-Biting

    Science.gov (United States)

    Moritz, Steffen; Treszl, Andras; Rufer, Michael

    2011-01-01

    Nail-biting is currently classified as an impulse control disorder not otherwise specified. Although seldom targeted as a primary symptom, nail-biting is often associated with somatic complications and decreased quality of life. The present study assessed the effectiveness of an innovative self-help technique, titled decoupling (DC). DC aims at…

  8. RISKS, VULNERABILITY AND DETERMINANTS OF WOMEN FARMERS’ PARTICIPATION IN SELF-HELP-GROUP (SHG-LED MICROFINANCING IN ISUIKWUATO, ABIA STATE, NIGERIA

    Directory of Open Access Journals (Sweden)

    Christopher Ogbonna EMEROLE

    2014-10-01

    Full Text Available This study on risks, vulnerability and determinants of women farmers’ participation in Self-Help-Group led micro financing was carried out in Isuikwuato local Government Area (LGA of Abia State in Nigeria. Two-stage random sampling and purposive sampling techniques were adopted in selecting communities and respondents. Socio- economic and some farm operation variables were analyzed descriptively and others regressed on discrete decision of women participating or not participating in Self-Help- group (SHG financing. Fire outbreak, ill health, theft, soil erosion and attack of farm products by pests and diseases were perceived (in this descending order as risks/natural disasters confronting the farmers. Previously owed debts, Ease of membership to groups, Age of the woman, Household size, and use of cultural/formal insurance over perceived risks were factors that influenced participation of women farmers in self-help-group micro financing. To ease the burden of inaccessibility to formal farm credit among women farmers, we recommended that relatively younger women should be encouraged to join older women in such mutual self-help groups to reap benefits accruable from the groups especially being able to manage their farms and households with less stress.

  9. Using a transdiagnostic, psychodynamic online self-help intervention to maintain inpatient psychosomatic treatment effects: Study protocol of a feasibility study

    Directory of Open Access Journals (Sweden)

    Jan Becker

    2016-09-01

    Conclusion: We expect insight into the usefulness and acceptance of an online self-help intervention used to maintain inpatient treatment effects. Furthermore, we await both groups to benefit from the participation in the intervention. Pre- post and between subject differences will be used as estimate effect sizes to calculate the necessary sample size for a larger efficacy trial.

  10. Multimodal Guided Self-Help Exercise Program to Prevent Speech, Swallowing, and Shoulder Problems Among Head and Neck Cancer Patients : A Feasibility Study

    NARCIS (Netherlands)

    Cnossen, Ingrid C.; van Uden-Kraan, Cornelia F.; Rinkel, Rico N. P. M.; Aalders, IJke J.; de Goede, Cees J. T.; de Bree, Remco; Doornaert, Patricia; Rietveld, Derek H. F.; Langendijk, Johannes A.; Witte, Birgit I.; Leemans, C. Rene; Verdonck-de Leeuw, Irma M.

    Background: During a 6-week course of (chemo) radiation many head and neck cancer patients have to endure radiotherapy-induced toxicity, negatively affecting patients' quality of life. Pretreatment counseling combined with self-help exercises could be provided to inform patients and possibly prevent

  11. Multimodal guided self-help exercise program to prevent speech, swallowing, and shoulder problems among head and neck cancer patients: a feasibility study.

    NARCIS (Netherlands)

    Cnossen, I.C.; van Uden-Kraan, C.F.; Rinkel, R.N.; Aalders, I.J.; de Goede, C.J.T.; de Bree, R.; Doornaert, P.; Rietveld, D.H.F.; Langendijk, J.A.; Witte, B.I.; Leemans, C.R.; de Leeuw, I.M.

    2014-01-01

    Background: During a 6-week course of (chemo)radiation many head and neck cancer patients have to endure radiotherapy-induced toxicity, negatively affecting patients' quality of life. Pretreatment counseling combined with self-help exercises could be provided to inform patients and possibly prevent

  12. Technical training: CERN Document Server (CDS), Inspire and Library Services

    CERN Multimedia

    IT & GS Departments

    2012-01-01

    A new training course, “CERN Document Server (CDS), Inspire and Library Services”, is available since the beginning of the year. The training course is given by members of CERN’s CDS Team (IT-CIS group) and the Library Services (GIS SIS group) and is intended for all members of personnel of CERN. This course will present CDS and inspirehep.net and the content, scope and scientific information available in or with CDS, as much as the classification and organization of the documents. It is intended to give you the training needed to know how to use CDS most efficiently and in particular covers: the main characteristics and advanced features for the search of documents (scientific, multimedia, etc). the collaborative tools : baskets, alerts, comments, evaluation, etc. the submission of documents in CDS and examples of workflows. An important part of the training is composed of various exercises, designed to acquire practical ability to work with CDS in cases similar to re...

  13. Self-help and help-seeking for communication disability in Ghana: implications for the development of communication disability rehabilitation services.

    Science.gov (United States)

    Wylie, Karen; McAllister, Lindy; Davidson, Bronwyn; Marshall, Julie; Amponsah, Clement; Bampoe, Josephine Ohenewa

    2017-12-29

    In low and middle-income countries, such as Ghana, communication disability is poorly recognised and rehabilitation services for people with communication disability are limited. As rehabilitation services for communication disability develop, and the profession of speech-language pathology grows, it is important to consider how services can most appropriately respond to the needs and preferences of the community. Understanding the ways in which people currently self-help and seek help for communication disability is central to developing services that build on existing local practices and are relevant to the community. A qualitative descriptive survey was used to explore likely self-help and help-seeking behaviours for communication disability, in Accra, Ghana. The survey required participants to describe responses to hypothetical scenarios related to communication disability. A mix of theoretical sampling and convenience sampling was used. Qualitative content analysis was used to analyse data and develop categories and subcategories of reported self-help behaviours and sources of help and advice for communication disability. One hundred and thirty-six participants completed the survey. Results indicated that community members would be likely to engage in a variety self-help strategies in response to communication disability. These included working directly with a person with a communication disability to attempt to remediate a communication impairment, altering physical and communication environments, changing attitudes or care practices, educating themselves about the communication disability, providing resources, and responding in spiritual ways. Participants indicated that they would seek help for communication disability across a range of sectors - including the Western healthcare, religious, and traditional sectors. Understanding existing community actions to self-help and help-seek may allow emerging communication rehabilitation services, including the

  14. An Internet-based self-help intervention for people with HIV and depressive symptoms: study protocol for a randomized controlled trial.

    Science.gov (United States)

    van Luenen, Sanne; Kraaij, Vivian; Spinhoven, Philip; Garnefski, Nadia

    2016-03-31

    Many people living with HIV suffer from depressive symptoms. In a previous pilot study, self-help cognitive behavioral therapy (in booklet format) was found to be effective in treating depressive symptoms in people with HIV. We developed an online self-help program in Dutch and English (based on the booklet) for people with HIV and depressive symptoms. Besides the main question regarding the effectiveness of the program aimed at lowering depressive symptoms, sub-questions will focus on the moderators of treatment success (for which patients is the program especially beneficial?) and the mechanisms of change underlying the treatment outcome (which mediators affect the outcome of treatment?). In this paper, the protocol of the study will be described. The effectiveness of the program will be investigated by comparing the intervention group with a waiting list-control group in a randomized controlled design, by including a pretest and three post-tests. The self-help program contains four main components: activation, relaxation, changing maladaptive cognitions, and goal attainment. Participants with mild to moderate depressive symptoms will work on the program for 6 to 10 weeks, during which a coach will provide motivational support by telephone once a week. Participants in the control condition will receive weekly minimal support from a coach for 8 weeks, and after the second post-test, they can gain access to the self-help program. Depressive symptoms and possible mediators (e.g., activation, cognitive coping, self-efficacy, and goal adjustment) will be assessed by self-report three times during the intervention/waiting period and at the pretest and first post-test. The proposed study aims to evaluate the effectiveness of an online self-help intervention for people with HIV and depressive symptoms. If the intervention is shown to be effective, the program will be implemented. Consequently, many patients with HIV could be reached, and their psychological care may be

  15. Behavioral and Nondirective Guided Self-Help for Parents of Children with Externalizing Behavior: Mediating Mechanisms in a Head-To-Head Comparison.

    Science.gov (United States)

    Katzmann, Josepha; Hautmann, Christopher; Greimel, Lisa; Imort, Stephanie; Pinior, Julia; Scholz, Kristin; Döpfner, Manfred

    2017-05-01

    Parent training (PT) delivered as a guided self-help intervention may be a cost- and time-effective intervention in the treatment of children with externalizing disorders. In face-to-face PT, parenting strategies have repeatedly been identified as mediating mechanisms for the decrease of children's problem behavior. Few studies have examined possible mediating effects in guided self-help interventions for parents. The present study aimed to investigate possible mediating variables of a behaviorally oriented guided self-help program for parents of children with externalizing problems compared to a nondirective intervention in a clinical sample. A sample of 110 parents of children with externalizing disorders (80 % boys) were randomized to either a behaviorally oriented or a nondirective guided self-help program. Four putative mediating variables were examined simultaneously in a multiple mediation model using structural equation modelling. The outcomes were child symptoms of ADHD and ODD as well as child externalizing problems, assessed at posttreatment. Analyses showed a significant indirect effect for dysfunctional parental attributions in favor of the group receiving the behavioral program, and significant effects of the behavioral program on positive and negative parenting and parental self-efficacy, compared to the nondirective intervention. Our results indicate that a decrease of dysfunctional parental attributions leads to a decrease of child externalizing problems when parents take part in a behaviorally oriented guided self-help program. However, none of the putative mediating variables could explain the decrease in child externalizing behavior problems in the nondirective group. A change in dysfunctional parental attributions should be considered as a possible mediator in the context of PT.

  16. Book reviews

    NARCIS (Netherlands)

    NN,

    2004-01-01

    Since the publication of the first edition of this book, important developments in biotechnology and mushroom production made a new, revised version necessary. As it is written for the mushroom industry, it emphasizes on nutritional, medical, and cultivating aspects of edible and medicinal fungi. A

  17. Book Reviews

    OpenAIRE

    Matthews, Alan; Goldin, Ian; Colman, David; Bickerton, Thomas W.; Beghin, John C.; Croci-Angelini, Elisabetta

    1992-01-01

    Books reviewed include: Principles of Agricultural Economics by D. Colman and T. Young; World Agriculture: Toward 2000 by Nikos Alexandratos; Food Subsidies in Developing Countries: Costs, Benefits and Policy Options; Elasticities in International Agricultural Trade by Colin A. Carter and W. H. Gardiner; Macroeconomics, Agriculture and Exchange Rates; Government and Agriculture in Western Europe, 1880-1988 by M. Tracy

  18. Book review

    NARCIS (Netherlands)

    NN,

    2003-01-01

    This book is entirely dedicated to the functional role of fungi in all kind of ecosystems, and it attempts to show how the world would function if fungi were not there. It is conceived as an introduction to the subject for students in mycology and ecology. The introductory chapters deal with

  19. Book reviews

    African Journals Online (AJOL)

    publication of the Ethiopian atlas (see below). There is no serious competition for this book for the countries it covers, but I suspect it will become invaluable for many strictly East African birders too, given the high degree of overlap, the improved illustrations and the coverage of some potential vagrants to the south.

  20. BOOK REVIEWS

    African Journals Online (AJOL)

    This is a story of the marvel of human life from conception to birth. Although the book was designed for young readers, it is suitable for use by anybody who wishes to know about our conception, development and birth. It can be appreciated at several levels. Firstly, it is a fascinating story, told simply and with wise.

  1. Book review

    African Journals Online (AJOL)

    Book review. * Professor of Higher Education Studies, Centre for Higher and Adult Education, University of Stellenbosch. Email: mfourie@sun.ac.za. Worldwide, the composition of the student population in higher education has over the past two decades changed dramatically. With larger numbers of previously underserved.

  2. Book Review

    DEFF Research Database (Denmark)

    Pace, Michelle

    2016-01-01

    At the turn of the millennium, a new phenomenon emerged: conservatives, who just decades before had rejected the expanding human rights culture, began to embrace human rights in order to advance their political goals. In this book, Nicola Perugini and Neve Gordon account for how human rights--gen...

  3. BOOKS JBOEKE

    African Journals Online (AJOL)

    This book is about the poor in South Africa and how to achieve some redistribution ... nature of the zero-sum-game economic wars and plunder- ing ofthe 16th - 18th ..... no course in basic neurosciences taught to the level where this would be ...

  4. Book Reviews.

    Science.gov (United States)

    Coates, Elizabeth; And Others

    1993-01-01

    Reviews three books: (1) "Jeux Populaires Traditionnels pour les Enfants d'aujourd'hui" (Traditional Popular Games for Today's Children) (Jacqueline Theriault and Denise Garon); "Early Childhood Education" (B. Persky and L. Golubchick, editors); and "Playing to Learn: The Young Child, Teacher and the Classroom" (Weininger and Daniel). (AC)

  5. Book Review

    African Journals Online (AJOL)

    Angela

    The book in review tells many tales of looting, rape and murder of prominent. Nuba figures as well as ordinary Nuba folk. As the government is increasing pressure on them, the Nuba are proving to be more resilient than ever to ensure their posterity. The picture that dominates the front cover may easily be overlooked by.

  6. Book review

    African Journals Online (AJOL)

    The book ends with a section on the most sought-after bird of. Ethiopia, a brief discussion of the best sites where to find them, and a complete, indexed list of the country's birds. The keen combination of text, maps, lists and superb pictures makes 'Birding Ethiopia' an outstanding birding site guide that deserves a place on ...

  7. Thin book

    DEFF Research Database (Denmark)

    En lille bog om teater og organisationer, med bidrag fra 19 teoretikere og praktikere, der deltog i en "Thin Book Summit" i Danmark i 2005. Bogen bidrager med en state-of-the-art antologi om forskellige former for samarbejde imellem teater og organisationer. Bogen fokuserer både på muligheder og...

  8. Book review

    Directory of Open Access Journals (Sweden)

    EC Thomas

    1978-11-01

    Full Text Available This book appears to the present reviewer to be, if not the, at least a definitive volume for students of work motivation, whether organizational behaviourists or practising managers. This field has grown rapidly as the main focus of Organizational Psychology since Vroom's (1964 enunciation of a tenable theory of work motivation and satisfaction.

  9. Book review

    African Journals Online (AJOL)

    Book review. * Dr Birgit Schreiber is the Director of the Centre for Student Support Services at the University of the. Western Cape, Cape Town, South Africa. Email: bschreiber@uwc.ac.za. Manuel Castells (2001), who is regarded as one of the most influential social scientists commenting on the role of higher education in ...

  10. Electronic Books

    Science.gov (United States)

    Clyde, Laurel A.

    2005-01-01

    Terje Hillesund points out that "information technology and especially the Internet have profoundly changed the ways of publishing." Recently, the book publishing industry has started to catch up, making digitized texts--including multimedia texts--available for sale through online bookstores, and in some cases, available for free downloading.…

  11. Book review

    NARCIS (Netherlands)

    NN,

    2003-01-01

    The Mycena specialist Robich, known from many publications, created his magnum opus with the present book, which, according to the title, covers all species known from Europe. Although many of his observations are based on southern European collections, his studies extended to other parts of Europe

  12. Banning Books.

    Science.gov (United States)

    Trede, Mildred

    1991-01-01

    The "Game of Decisions" is presented to encourage students to consider the consequences of banning books and/or ideas. The game involves story writing, creating probability graphs, writing a letter protesting censorship from a chosen historical period, and examining a controversial science issue. Three thesis statements for generating group…

  13. Books received

    African Journals Online (AJOL)

    Books. Outcomes into Clinical Practice. Ed. by Tony Delamothe. Pp. xii + 164. Illustrated. London: BMJ. 1994. ISBN 0-7279-0888-X. At a recent conference which attracted a range of health professionals from the private and public sectors and examined South Africa's current and future health options, an eminent Australian ...

  14. Digital books.

    Science.gov (United States)

    Wink, Diane M

    2011-01-01

    In this bimonthly series, the author examines how nurse educators can use the Internet and Web-based computer technologies such as search, communication, and collaborative writing tools; social networking and social bookmarking sites; virtual worlds; and Web-based teaching and learning programs. This article describes digital books.

  15. Book review

    African Journals Online (AJOL)

    contributions to the authoritative bibliography of the scholarly writings on the literatures of the English - speaking world. As he states in the preface to the book, Abodunrin's aim in doing this is to make a compendium of reviews of. "scholarly writing on all aspects of African literature in English'' available to students, teachers ...

  16. Book notice

    NARCIS (Netherlands)

    Adema, Frits

    1999-01-01

    FOCKO WEBERLING & WILHELM TROLL: Die Infloreszenzen Band II, Teil 2, Monotele und polytele Synfloreszenzen. Gustav Fischer Verlag, Jena, Germany, 1998. 483 pp., illus. ISBN 3-437-35436-1. Price: DEM 238. A new volume in the monumental series of books on inflorescences in the tradition of Troll’s

  17. Book review

    African Journals Online (AJOL)

    The work under review is Jack Mapanje's third volume of verse after Of Chameleons ... with which the new book opens, 'The Following Dawn the Boots', talks about the first ... 'St Margaret Chitherow of York', the poet acknowledges that his host country too has ... primary audience and learn to adjust his sights accordingly.

  18. Book fair

    CERN Multimedia

    2006-01-01

    The Swiss academic publishing house 'Presses Polytechniques Universitaires Romandes'will be presenting its most recent scientific and technical publications at a book fair in the lobby of the Main Building (60) from 10 a.m. to 4 p.m. on Thursday 28 September 2006.

  19. BOOK REVIEW

    African Journals Online (AJOL)

    as middlemen between writers and readers through lack of creativity and aggressiveness. Authors are not used to promote the sales of their books, and there is no attempt on the part of the publisher to take advantage of such forms of popular advertisement as newspapers, radio and television. Besides, there is a general ...

  20. book review

    African Journals Online (AJOL)

    organisational structures and institutional policy. A number of universities in Africa have started to conduct student engagement/student experience surveys. This volume provides the theoretical underpinning for it while outlining how these theories were arrived at in the first place. However, a potential weak point of the book ...

  1. Book Reviews

    OpenAIRE

    Barlow, Colin; Harvey, D. R.; Lane, S.

    1988-01-01

    Books Reviewed: The Economics of Oil Palm; Agricultural Policy Formation in the European Community: The Birth of Milk Quotas and CAP Reform by M. Petit, M. de Benedictis, D. Britton, M. de Groot, W. Henrichsmeyer, and F. Lechi; Agriculture's Future: America's Food System by T. L. Wallace

  2. Example book

    International Nuclear Information System (INIS)

    Donnat, Ph.; Treimany, C.; Gouedard, C.; Morice, O.

    1998-06-01

    This document presents some examples which were used for debugging the code. It seemed useful to write these examples onto a book to be sure the code would not regret; to give warranties for the code's functionality; to propose some examples to illustrate the possibilities and the limits of Miro. (author)

  3. Book Reviews.

    Science.gov (United States)

    Joyner, Christopher C.; And Others

    1986-01-01

    Scholarly reviews of nine books are presented. Topics include nuclear deterrence, urban planning in France, human rights in the Republic of China, the United States' support of Israel, U. S. military policy, an analysis of Rousseau's social contract, political influences on the U. S. presidency, the state and political theory, and the loss of…

  4. Positive Psychological Wellbeing Is Required for Online Self-Help Acceptance and Commitment Therapy for Chronic Pain to be Effective.

    Science.gov (United States)

    Trompetter, Hester R; Bohlmeijer, Ernst T; Lamers, Sanne M A; Schreurs, Karlein M G

    2016-01-01

    -based self-help ACT may not be allocated to chronic pain sufferers experiencing low levels of mental resilience resources such as self-acceptance, goals in life, and environmental mastery. Other subgroups are identified that potentially need specific tailoring of (web-based) ACT. Emotional and psychological wellbeing should receive much more attention in subsequent studies on chronic pain and illness.

  5. Internet-Based Guided Self-Help for Vaginal Penetration Difficulties: Results of a Randomized Controlled Pilot Trial.

    Science.gov (United States)

    Zarski, Anna-Carlotta; Berking, Matthias; Fackiner, Christina; Rosenau, Christian; Ebert, David Daniel

    2017-02-01

    Difficulties with vaginal penetration can severely affect a woman's desire to have sexual intercourse, her sexual and general well-being, or her partnership. However, treatment opportunities for vaginismus are scarce. To evaluate the efficacy of an internet-based guided self-help intervention for vaginismus in a randomized controlled pilot trial. Seventy-seven women with vaginismus (primary inclusion criterion = no intercourse ≥ 6 months) were randomly assigned to an intervention group (IG) and a waitlist control group (WCG). The intervention consisted of 10 sessions involving psychoeducation, relaxation exercises, sensate focus, and gradual exposure with dilators. Participants received written feedback on completed sessions from an eCoach. The primary outcome was successful sexual intercourse. Secondary outcomes were non-intercourse penetration, fear of coitus, sexual functioning, and dyadic coping. Self-reported assessments were scheduled at baseline, 10 weeks, and 6 months. More participants (10 of 40, 34.48%) in the IG had intercourse compared with those in the WCG (6 of 37, 20.69%) at least once at 10 weeks or 6 months (odds ratio = 2.02). The difference was not significant (χ 2 1  = 1.38, P = .38), but in the IG, there was a significant increase in intercourse penetration from baseline to 6 months (d = 0.65). No such increase was found in the WCG (d = 0.21). There were significant between-group effects concerning non-intercourse penetration (self-insertion of a finger or dilator or insertion by the partner) in favor of the IG. Fear of coitus and dyadic coping significantly decreased in the IG. Overall satisfaction with the training was high. This randomized controlled trial showed promising effects of an internet-based intervention by increasing participants' ability to have intercourse and non-intercourse penetration while experiencing high treatment satisfaction. The WCG also showed improvement, although participants had vaginismus for an average

  6. Positive psychological wellbeing is required for online self-help Acceptance & Commitment Therapy for chronic pain to be effective.

    Directory of Open Access Journals (Sweden)

    Hester R. Trompetter

    2016-03-01

    suggest that web-based self-help ACT may not be allocated to chronic pain sufferers experiencing low levels of mental resilience resources such as self-acceptance, goals in life, and environmental mastery. Other subgroups are identified that potentially need specific tailoring of (web-based ACT. Emotional and psychological wellbeing should receive much more attention in subsequent studies on chronic pain and illness.

  7. TiO2-CdS Nanocomposites: Effect of CdS Oxidation on the Photocatalytic Activity

    Directory of Open Access Journals (Sweden)

    A. Hamdi

    2016-01-01

    Full Text Available Nanocomposites TiO2-CdS with different relative contents of CdS (molar ratios Cd/Ti = 0.02, 0.03, 0.05, 0.1, 0.2, and 0.5 were studied. The structural, photophysical, and chemical properties were investigated using XRD, Raman spectroscopy, XPS, GSDR, and LIL. XRD and Raman results confirmed the presence of TiO2 and CdS with intensities dependent on the ratio Cd/Ti. The presence of CdSO4 was detected by XPS at the surface of all TiO2-CdS composites. The relative amount of sulphate was dependent on the CdS loading. Luminescence time-resolved spectra clearly proved the existence of an excitation transfer process from CdS to TiO2 through the luminescence emission from TiO2 after excitation of CdS at λexc=410 nm, where no direct excitation of TiO2 occurs. Photodegradation of a series of aromatic carboxylic acids—benzoic, salicylic, 4-bromobenzoic, 3-phenylpropionic, and veratric acids—showed a great enhancement in the photocatalytic efficiency of the TiO2-CdS composites, which is due, mainly, to the effect of the charge carriers’ increased lifetime. In addition, it was shown that the oxidation of CdS to CdSO4 did not result in the deactivation of the photocatalytic properties and even contributed to enhance the degradation efficiency.

  8. Book Review:

    Science.gov (United States)

    Chrusciel, P. T.

    2006-06-01

    Most of us sometimes have to face a student asking: 'What do I need to get started on this'. (In my case 'this' would typically be a topic in general relativity.) After thinking about it for quite a while, and consulting candidate texts again and again, a few days later I usually end up saying: read this chapter in book I (but without going too much detail), then that chapter in book II (but ignore all those comments), then the first few sections of this review paper (but do not try to work out equations NN to NNN), and then come back to see me. In the unlikely event that the student comes back without changing the topic, there follows quite a bit of explaining on a blackboard over the following weeks. From now on I will say: get acquainted with the material covered by this book. As far as Isham's book is concerned, 'this' in the student's question above can stand for any topic in theoretical physics which touches upon differential geometry (and I can only think of very few which do not). Said plainly: this book contains most of the introductory material necessary to get started in general relativity, or those branches of mathematical physics which require differential geometry. A student who has mastered the notions presented in the book will have a solid basis to continue into specialized topics. I am not aware of any other book which would be as useful as this one in terms of the spectrum of topics covered, stopping at the right place to get sufficient introductory insight. According to the publisher, these lecture notes are the content of an introductory course on differential geometry which is taken by first-year theoretical physics PhD students, or by students attending the one-year MSc course 'Quantum Fields and Fundamental Forces' at Imperial College, London. The volume is divided into six chapters: An Introduction to Topology Differential Manifolds Vector Fields and n-Forms Lie Groups Fibre Bundles Connections in a Bundle. It is a sad reflection on current

  9. Book Reviews

    Science.gov (United States)

    Horner, Joseph L.

    1987-04-01

    Progress in the fields of integrated optics and fiber optics is continuing at a rapid pace. Recognizing this trend, the goal of the author is to provide an introductory textbook on time-harmonic electromagnetic theory, with an emphasis on optical rather than microwave technologies. The book is appropriate for an upper-level undergraduate or graduate course. Each chapter includes examples of problems. The book focuses on several areas of prime importance to intergrated optics. These include dielectric waveguide analysis, couple-mode thoery, Bragg scattering, and prism coupling There is very little coverage of active components such as electro-optic modulators and switches. The author assumes the reader has a working knowledge of vector calculus and is familiar with Maxwell's equations.

  10. Book Review

    Directory of Open Access Journals (Sweden)

    Salvatore Filippone

    2014-01-01

    Full Text Available The book by Arjen Markus is a veritable tour de force among the possibilities opened up by the latest incarnation of Fortran, the longest-lived programming language on the planet and still one of the favourites by scientific programmers. It is not an introduction to the syntax and semantics of the latest language standard: it is more of a gourmet cookbook showing off a wide range of examples of what the new features allow a daring programmer to do.

  11. Book reviews

    OpenAIRE

    NN

    2004-01-01

    Since the publication of the first edition of this book, important developments in biotechnology and mushroom production made a new, revised version necessary. As it is written for the mushroom industry, it emphasizes on nutritional, medical, and cultivating aspects of edible and medicinal fungi. A short introduction deals with a definition of fungi and the world of fungi, including edible and poisonous species, and the relation between fungi and man. Two chapters deal with edible and medicin...

  12. Book Reviews

    OpenAIRE

    Redactie KITLV

    2004-01-01

    -Bill Maurer, Mimi Sheller, Consuming the Caribbean: From Arawaks to Zombies. New York: Routledge, 2003. ix + 252 pp. -Norman E. Whitten, Jr., Richard Price ,The root of roots: Or, how Afro-American anthropology got its start. Chicago: Prickly Paradigm Press/University of Chicago Press, 2003. 91 pp., Sally Price (eds) -Holly Snyder, Paolo Bernardini ,The Jews and the expansion of Europe to the West, 1450-1800. New York: Berghahn Books, 2001. xv + 567 pp., Norman Fiering (eds) -Bridget Brereto...

  13. Book Reviews

    OpenAIRE

    Elena Mancusi-Materi

    2002-01-01

    Book reviews: Helmore, K. and N. Singh, Sustainable Livelihoods – Building on the Wealth of the poor (reviewed by Elena Mancusi-Materi); Scoones, I (ed.), Dinamics and Diversity: Soil fertility and farming livelihoods in africa (reviewed by Elena Mancusi-Materi); Uphoff, N. (ed.), Agroecological Innovations – Increasing Food Production with Pariciatory Development (reviewed by Elena Mancusi-Materi); Marten, G.G., Human Ecology, Basic Concepts for Sustianable Development (reviewed by Siobhán K...

  14. Book Review:

    Science.gov (United States)

    Folacci, Antoine; Jensen, Bruce

    2003-12-01

    Thanks to its impressive success in the second half of the 20th century, both in high-energy physics and in critical phenomena, quantum field theory has enjoyed an abundant literature. We therefore greet yet another book on this subject with caution: what can a monograph on quantum field theory bring now that is new, either conceptually or pedagogically? But when it is written by a physicist such as Bryce DeWitt, who has made his own contribution to the collection of field theory books with The Global Approach to Quantum Field Theory, all suspicion is naturally abandoned. One knows in advance that this book can only lead to a genuine enrichment of the literature. DeWitt has made a formidable contribution to various areas of physics: general relativity, the interpretation of quantum mechanics, and most of all the quantization of non-Abelian gauge theories and quantum gravity. In addition, his pedagogical publications, especially the Les Houches schools of 1963 and 1983 [1, 2], have had a great impact on quantum field theory. All this makes the reader keen to pick up his new work and a deeper reading confirms the reviewer's initial enthusiasm. We must begin by alerting the potential readers of this book that it cannot be compared to any other book in the field (unless of course we are talking about references [1] and [2], of which the book under review is an extension and reworking). This uniqueness applies to both the scientific content and the way the ideas are presented. A quick description of this book and a brief explanation of its title should convince the reader of the book's unique quality. For DeWitt, a central concept of field theory is that of `space of histories'. For a field varphii defined on a given spacetime M, the set of all varphii(x) for all x in all charts of M defines its history. It is the space Phi of all possible histories (dynamically allowed or not) of the fields defined on M which is called the `space of histories' by DeWitt. If only

  15. Summer Student Project: Collecting and disseminating CDS KPIs

    CERN Document Server

    Alvarez Perez, Carmen

    2010-01-01

    CDS (CERN Document Server) stores over 900,000 bibliographic records, including 360,000 fulltext documents, of interest to people working in particle physics and related areas. My project consisted on extracting KPIs (Key Performance Indicators) from it and feeding them to a central IT KPI system. To achieve this, I learned the CDS-Invenio open source digital library software, and worked with its statistic module.

  16. [Social participation and activities of daily living of patients with inflammatory rheumatic diseases : support by self-help, exercise therapy and new media].

    Science.gov (United States)

    Mattukat, K; Thyrolf, A

    2014-02-01

    Rheumatic patients are at risk of social isolation and physical inactivity which can have a significant impact on physical and mental health. Only every seventh patient is organized in a self-help group (SHG), most of them in the German League Against Rheumatism (GLAR). Members of a SHG are socially and physically more active and take part in exercise therapy (ET) more often. Depending on the study, the utilization of ET ranges from 25 % to 71 %. The functional training as the most attended offer of the GLAR showed positive effects at the physical and psychological levels. To motivate difficult to reach patients to engage in self-help and regular exercise, further development of exercise programs with individually tailored intensive strength and endurance elements as well as the increased use of new media seems promising. The Internet provides various opportunities for networking and social participation especially for severely impaired and temporally less flexible patients.

  17. A guided self-help intervention targeting psychological distress among head and neck cancer and lung cancer patients: motivation to start, experiences and perceived outcomes.

    Science.gov (United States)

    Krebber, Anne-Marie H; van Uden-Kraan, Cornelia F; Melissant, Heleen C; Cuijpers, Pim; van Straten, Annemieke; Becker-Commissaris, Annemarie; Leemans, C René; Verdonck-de Leeuw, Irma M

    2017-01-01

    Recent results of a randomized clinical trial showed that a guided self-help intervention (based on problem-solving therapy) targeting psychological distress among head and neck cancer and lung cancer patients is effective. This study qualitatively explored motivation to start, experiences with and perceived outcomes of this intervention. Data were collected from semi-structured interviews of 16 patients. All interviews were audio-recorded and transcribed verbatim. Data were analyzed individually by two coders and coded into key issues and themes. Patients participated in the intervention for intrinsic (e.g. to help oneself) and for extrinsic reasons (e.g. being asked by a care professional or to help improve health care). Participants indicated positive and negative experiences with the intervention. Several participants appreciated participating as being a pleasant way to work on oneself, while others described participating as too confrontational. Some expressed their disappointment as they felt the intervention had brought them nothing or indicated that they felt worse temporarily, but most participants perceived positive outcomes of the intervention (e.g. feeling less distressed and having learned what matters in life). Cancer patients have various reasons to start a guided self-help intervention. Participants appreciated the guided self-help as intervention to address psychological distress, but there were also concerns. Most participants reported the intervention to be beneficial. The results suggest the need to identify patients who might benefit most from guided self-help targeting psychological distress and that interventions should be further tailored to individual cancer patients' requirements.

  18. Snow Control - An RCT protocol for a web-based self-help therapy to reduce cocaine consumption in problematic cocaine users

    Directory of Open Access Journals (Sweden)

    Sullivan Robin

    2011-09-01

    Full Text Available Abstract Background Cocaine use has increased in most European countries, including Switzerland, and many states worldwide. The international literature has described treatment models that target the general population. In addition to supplying informative measures at the level of primary and secondary prevention, the literature also offers web-based self-help tools for problematic substance users, which is in line with tertiary prevention. Such programs, however, have been primarily tested on individuals with problematic alcohol and cannabis consumption, but not on cocaine-dependent individuals. Methods/Design This paper presents the protocol of a randomised clinical trial to test the effectiveness of a web-based self-help therapy to reduce cocaine use in problematic cocaine users. The primary outcome is severity of cocaine dependence. Secondary outcome measures include cocaine craving, consumption of cocaine and other substances of abuse in the past month, and changes in depression characteristics. The therapy group will receive a 6-week self-help therapy to reduce cocaine consumption based on methods of Cognitive Behavioural Therapy, principles of Motivational Interviewing and self-control practices. The control group will be presented weekly psycho-educative information with a quiz. The predictive validity of participant characteristics on treatment retention and outcome will be explored. Discussion To the best of our knowledge, this will be the first randomised clinical trial to test the effectiveness of online self-help therapy to reduce or abstain from cocaine use. It will also investigate predictors of outcome and retention. This trial is registered at Current Controlled Trials and is traceable as NTR-ISRCTN93702927.

  19. Long-Term Results of a Web-Based Guided Self-Help Intervention for Employees With Depressive Symptoms: Randomized Controlled Trial

    OpenAIRE

    Geraedts, Anna S; Kleiboer, Annet M; Twisk, Jos; Wiezer, Noortje M; van Mechelen, Willem; Cuijpers, Pim

    2014-01-01

    Background Depressive disorders are highly prevalent in the working population and are associated with excessive costs. The evidence for effective worker-directed interventions for employees with depressive symptoms is limited. Treating employees with depressive symptoms via the Internet before they report sick from work could be beneficial and cost saving. Objective In this study, we tested the effectiveness over the period of 1 year of a Web-based guided self-help intervention, called Happy...

  20. Effectiveness of a guided self-help manual in strengthening resilience in people diagnosed with moderate depression and their family caregivers in Thailand: a randomised controlled trial

    OpenAIRE

    McCann, Terence; Songprakun, Wallapa; Stephenson, John

    2017-01-01

    The growing incidence of depression in developing countries, such as Thailand, is placing increasing pressure on public mental health services, and those living in rural areas have limited access to mental health services and specialised support. Resilience is integral to the recovery of people with depression and to caregivers. This parallel group randomised controlled trial evaluated the effectiveness of a guided self-help manual in improving resilience in adults diagnosed with moderate dep...

  1. Book Review:

    Science.gov (United States)

    Vespignani, A.

    2004-09-01

    Networks have been recently recognized as playing a central role in understanding a wide range of systems spanning diverse scientific domains such as physics and biology, economics, computer science and information technology. Specific examples run from the structure of the Internet and the World Wide Web to the interconnections of finance agents and ecological food webs. These networked systems are generally made by many components whose microscopic interactions give rise to global structures characterized by emergent collective behaviour and complex topological properties. In this context the statistical physics approach finds a natural application since it attempts to explain the various large-scale statistical properties of networks in terms of local interactions governing the dynamical evolution of the constituent elements of the system. It is not by chance then that many of the seminal papers in the field have been published in the physics literature, and have nevertheless made a considerable impact on other disciplines. Indeed, a truly interdisciplinary approach is required in order to understand each specific system of interest, leading to a very interesting cross-fertilization between different scientific areas defining the emergence of a new research field sometimes called network science. The book of Dorogovtsev and Mendes is the first comprehensive monograph on this new scientific field. It provides a thorough presentation of the forefront research activities in the area of complex networks, with an extensive sampling of the disciplines involved and the kinds of problems that form the subject of inquiry. The book starts with a short introduction to graphs and network theory that introduces the tools and mathematical background needed for the rest of the book. The following part is devoted to an extensive presentation of the empirical analysis of real-world networks. While for obvious reasons of space the authors cannot analyse in every detail all the

  2. Book Review:

    Science.gov (United States)

    Arimondo, Ennio

    2004-07-01

    For many years the Institute of Physics has published books on hot topics based on a collection of reprints from different journals, including some remarks by the editors of each volume. The book on Optical Angular Momentum, edited by L Allen, S M Barnett and M J Padgett, is a recent addition to the series. It reproduces forty four papers originally published in different journals and in a few cases it provides direct access to works not easily accessible to a web navigator. The collection covers nearly a hundred years of progress in physics, starting from an historic 1909 paper by Poynting, and ending with a 2002 paper by Padgett, Barnett and coworkers on the measurement of the orbital angular momentum of a single photon. The field of optical angular momentum has expanded greatly, creating an interdisciplinary attraction for researchers operating in quantum optics, atomic physics, solid state physics, biophysics and quantum information theory. The development of laser optics, especially the control of single mode sources, has made possible the specific design of optical radiation modes with a high degree of control on the light angular momentum. The editors of this book are important figures in the field of angular momentum, having contributed to key progress in the area. L Allen published an historical paper in 1999, he and M J Padgett (together with M Babiker) produced few years ago a long review article which is today still the most complete basic introduction to the angular momentum of light, while S M Barnett has contributed several high quality papers to the progress of this area of physics. The editors' choice provides an excellent overview to all readers, with papers classified into eight different topics, covering the basic principles of the light and spin and orbital angular momentum, the laboratory tools for creating laser beams carrying orbital angular momentum, the optical forces and torques created by laser beams carrying angular momentum on

  3. Predictors for good therapeutic outcome and drop-out in technology assisted guided self-help in the treatment of bulimia nervosa and bulimia like phenotype.

    Science.gov (United States)

    Wagner, Gudrun; Penelo, Eva; Nobis, Gerald; Mayrhofer, Anna; Wanner, Christian; Schau, Johanna; Spitzer, Marion; Gwinner, Paulina; Trofaier, Marie-Louise; Imgart, Hartmut; Fernandez-Aranda, Fernando; Karwautz, Andreas

    2015-03-01

    Technology assisted guided self-help has been proven to be effective in the treatment of bulimia nervosa (BN). The aim of this study was to determine predictors of good long-term outcome as well as drop-out, in order to identify patients for whom these interventions are most suitable. One hundred and fifty six patients with BN were assigned to either 7 months internet-based guided self-help (INT-GSH) or to conventional guided bibliotherapy (BIB-GSH), both guided by e-mail support. Evaluations were taken at baseline, after 4, 7, and 18 months. As potential predictors, psychiatric comorbidity, personality features, and eating disorder psychopathology were considered. Higher motivation, lower frequency of binge eating, and lower body dissatisfaction at baseline predicted good outcome after the end of treatment. Lower frequency of binge eating predicted good outcome at long-term follow-up. Factors prediciting drop-out were higher depression and lower self-directedness at baseline. Technology assisted self-help can be recommended for patients with a high motivation to change, lower binge-eating frequency and lower depression scores. Copyright © 2014 John Wiley & Sons, Ltd and Eating Disorders Association.

  4. Acceptability and feasibility of self-help Cognitive Remediation Therapy for anorexia nervosa delivered in collaboration with carers: a qualitative preliminary evaluation study.

    Science.gov (United States)

    Lang, Katie; Treasure, Janet; Tchanturia, Kate

    2015-02-28

    Anorexia nervosa (AN) is an eating disorder without a recommended first-line treatment. Cognitive Remediation Therapy (CRT) is showing great promise in helping patients reduce cognitive inflexibility and excessive detail focus, thinking styles that could make engaging in psychological therapies difficult. CRT has shown to be effective, feasible and acceptable in both individual and group formats, and positive qualitative data has been gathered from both service users and clinicians. The aim of the current study was to assess the use of CRT as a self-help treatment for individuals with AN delivered in collaboration with carers. Six families underwent a six-week self-help CRT intervention. Feedback was gathered from qualitative interviews and analysed using thematic analysis. Neuropsychological outcomes were also collected. Participant feedback regarding the intervention was generally positive, with participants describing a number of benefits such as it creating a space for families to spend time together outside of the eating disorder, acting as a 'gateway' for more emotional work and helping participants to gain insight into their cognitive profiles. These preliminary findings suggest that self-help CRT delivered in collaboration with carers is an acceptable form of treatment, and adds to the growing literature supporting CRT for AN. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  5. The effects of an Internet based self-help course for reducing panic symptoms - Don't Panic Online: study protocol for a randomised controlled trial

    Directory of Open Access Journals (Sweden)

    Kramer Jeannet

    2011-03-01

    Full Text Available Abstract Background Internet based self-help for panic disorder (PD has proven to be effective. However, studies so far have focussed on treating a full-blown disorder. Panic symptoms that do not meet DSM-IV criteria are more prevalent than the full-blown disorder and patients with sub-clinical panic symptoms are at risk of developing PD. This study is a randomised controlled trial aimed to evaluate an Internet based self-help intervention for sub-clinical and mild PD compared to a waiting list control group. Methods Participants with mild or sub-clinical PD (N = 128 will be recruited in the general population. Severity of panic and anxiety symptoms are the primary outcome measures. Secondary outcomes include depressive symptoms, quality of life, loss of production and health care consumption. Assessments will take place on the Internet at baseline and three months after baseline. Discussion Results will indicate the effectiveness of Internet based self-help for sub-clinical and mild PD. Strengths of this design are the external validity and the fact that it is almost completely conducted online. Trial registration Netherlands Trial Register (NTR: NTR1639 The Netherlands Trial Register is part of the Dutch Cochrane Centre.

  6. A randomized controlled trial of a smoking cessation self-help intervention for dual users of tobacco cigarettes and E-cigarettes: Intervention development and research design.

    Science.gov (United States)

    Meltzer, Lauren R; Simmons, Vani N; Sutton, Steven K; Drobes, David J; Quinn, Gwendolyn P; Meade, Cathy D; Unrod, Marina; Brandon, Karen O; Harrell, Paul T; Eissenberg, Thomas; Bullen, Christopher R; Brandon, Thomas H

    2017-09-01

    Electronic Nicotine Delivery Systems, also called electronic cigarettes or e-cigarettes, have been available for over a decade and use has been increasing dramatically. The primary reported reasons for use are to aid smoking cessation or reduction, yet a significant proportion appear to be long-term users of both products ("dual users"). Dual users may be motivated to quit smoking and might benefit from a behavioral intervention for smoking cessation. This paper describes the intervention development, as well as the design, methods, and data analysis plans for an ongoing randomized controlled trial (RCT). Formative research and learner verification were conducted to create a usable, understandable, and acceptable self-help intervention targeting dual users. The efficacy is being tested in an RCT with current dual users (N=2900) recruited nationally and randomized to one of three conditions. The Assessment Only (ASSESS) group only completes assessments. The Generic Self-Help (GENERIC) group receives non-targeted smoking cessation booklets and supplemental materials sent monthly over 18months. The e-cigarette Targeted Self-Help (eTARGET) group receives the newly developed intervention (targeted booklets and supplemental materials) sent over the same period. All participants complete self-report surveys every 3months over 2years. The primary study outcome is self-reported 7-day point prevalence abstinence. Cost-effectiveness metrics for the GENERIC and eTARGET interventions will also be calculated. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. The role of self-help in the treatment of mild anxiety disorders in young people: an evidence-based review

    Directory of Open Access Journals (Sweden)

    Bradford S

    2012-02-01

    Full Text Available Debra Rickwood1,2, Sally Bradford31Faculty of Health, University of Canberra, Canberra, ACT, Australia; 2headspace: National Youth Mental Health Foundation, North Melbourne, VIC, Australia; 3Faculty of Health, University of Canberra, Canberra, ACT, AustraliaAbstract: Anxiety disorders are the most common mental health problems experienced by young people, and even mild anxiety can significantly limit social, emotional, and cognitive development into adulthood. It is, therefore, essential that anxiety is treated as early and effectively as possible. Young people are unlikely, however, to seek professional treatment for their problems, increasing their chance of serious long-term problems such as impaired peer relations and low self-esteem. The barriers young people face to accessing services are well documented, and self-help resources may provide an alternative option to respond to early manifestations of anxiety disorders. This article reviews the potential benefits of self-help treatments for anxiety and the evidence for their effectiveness. Despite using inclusive review criteria, only six relevant studies were found. The results of these studies show that there is some evidence for the use of self-help interventions for anxiety in young people, but like the research with adult populations, the overall quality of the studies is poor and there is need for further and more rigorous research.Keywords: adolescent, young adult, children, mental disorder, self-administered, bibliotherapy, therapist-guided

  8. Effects of sleep management with self-help treatment for the Japanese elderly with chronic insomnia: a quasi-experimental study.

    Science.gov (United States)

    Tamura, Norihisa; Tanaka, Hideki

    2017-08-01

    This study aimed to determine whether sleep management with self-help treatment is more effective in improving insomnia, compared to a waiting-list control. A total of 51 participants with insomnia, aged ≥60 years, were assigned to two groups: the treatment group or waiting-list control group. Intervention included sleep education, group work, moderately intense exercise, and self-help treatment using a sleep diary for 2 weeks. Participants completed the Insomnia Severity Index (ISI-J) and sleep diaries wearing an activity recorder pre- and post-treatment. The treatment group showed a significant improvement in the ISI-J with a fairly large effect size (Cohen's d: within = 0.78, between = 0.70), whereas the waiting-list control group did not. Sleep diary and activity recorder data showed small to moderate effect sizes in the treatment group. Thus, sleep management with self-help treatment was superior to a waiting-list control for insomnia severity in the targeted elderly population.

  9. A review of technology-assisted self-help and minimal contact therapies for drug and alcohol abuse and smoking addiction: is human contact necessary for therapeutic efficacy?

    Science.gov (United States)

    Newman, Michelle G; Szkodny, Lauren E; Llera, Sandra J; Przeworski, Amy

    2011-02-01

    Technology-based self-help and minimal contact therapies have been proposed as effective and low-cost interventions for addictive disorders, such as nicotine, alcohol, and drug abuse and addiction. The present article reviews the literature published before 2010 on computerized treatments for drug and alcohol abuse and dependence and smoking addiction. Treatment studies are examined by disorder as well as amount of therapist contact, ranging from self-administered therapy and predominantly self-help interventions to minimal contact therapy where the therapist is actively involved in treatment but to a lesser degree than traditional therapy and predominantly therapist-administered treatments involving regular contact with a therapist for a typical number of sessions. In the treatment of substance use and abuse it is concluded that self-administered and predominantly self-help computer-based cognitive and behavioral interventions are efficacious, but some therapist contact is important for greater and more sustained reductions in addictive behavior. Copyright © 2010 Elsevier Ltd. All rights reserved.

  10. Comparing two books and establishing probably efficacious treatment for low sexual desire.

    Science.gov (United States)

    Balzer, Alexandra M; Mintz, Laurie B

    2015-04-01

    Using a sample of 45 women, this study compared the effectiveness of a previously studied (Mintz, Balzer, Zhao, & Bush, 2012) bibliotherapy intervention (Mintz, 2009), a similar self-help book (Hall, 2004), and a wait-list control (WLC) group. To examine intervention effectiveness, between and within group standardized effect sizes (interpreted with Cohen's, 1988 benchmarks .20 = small, .50 = medium, .80+ = large) and their confidence limits are used. In comparison to the WLC group, both interventions yielded large between-group posttest effect sizes on a measure of sexual desire. Additionally, large between-group posttest effect sizes were found for sexual satisfaction and lubrication among those reading the Mintz book. When examining within-group pretest to posttest effect sizes, medium to large effects were found for desire, lubrication, and orgasm for both books and for satisfaction and arousal for those reading the Mintz book. When directly comparing the books, all between-group posttest effect sizes were likely obtained by chance. It is concluded that both books are equally effective in terms of the outcome of desire, but whether or not there is differential efficacy in terms of other domains of sexual functioning is equivocal. Tentative evidence is provided for the longer term effectiveness of both books in enhancing desire. Arguing for applying criteria for empirically supported treatments to self-help, results are purported to establish the Mintz book as probably efficacious and to comprise a first step in this designation for the Hall book. (c) 2015 APA, all rights reserved).

  11. Book Review

    Directory of Open Access Journals (Sweden)

    Adrian Brown

    2011-01-01

    Full Text Available “Numerical Methods for Special Functions” by Gil, Seguar and Temme is a collection of methods and approaches for finding the most efficient and accurate ways of computing values of functions that have no general definition. “Numerical Methods for Special Functions” might appear at first glance to be a boring and perhaps dry subject for non-mathematicians, and indeed it is a little difficult to approach without being an expert in the area, but if you do find yourself in need of some hints for the best implementations available, this book might be a life saver.

  12. Golden book

    CERN Multimedia

    2004-01-01

    On 19 October, CERN reached the climax of its Jubilee with the official celebration in the presence of very high representatives of the Member and Observer States. Above, one of the high moments of the day: the signing of the golden book by the King of Spain, Juan Carlos, and at his right the Director-General of CERN, Robert Aymar, the President of the Swiss Confederation, Joseph Deiss, and the President of the Republic of France, Jacques Chirac. A complete report of this event will be in the next issue of the Bulletin.

  13. Best Books 1982.

    Science.gov (United States)

    School Library Journal, 1982

    1982-01-01

    This annotated bibliography lists 45 children's books and 29 young adult books selected by School Library Journal's Book Review staff and Young Adult Review committee, respectively. Arrangement is alphabetical by author with the grade level indicated for children's books. (EJS)

  14. Book Review

    Science.gov (United States)

    Kragh, Helge

    2015-11-01

    Ever since the days of William Blake there has been an underground resistance against the soulless yet triumphant science and its unholy alliance with money, technology and political power. With the nearly undisputed hegemony that science and technological innovation has attained in the post-World War II era, this kind of resistance has resulted in numerous books and articles that in different ways warn against the dark sides of science and the socio-economic system that nourishes a science in degeneration. Classical examples include Herbert Marcuse's One-Dimensional Man (1964), Jacques Ellul's The Technological Society (1965), Theodore Roszak's The Making of a Counter Culture (1968), and Paul Feyerabend's Science in a Free Society (1978). A fair part of the literature written by sociologists and philosophers is not only critical to trends in modern science, but tends to or is overtly anti-science. The book under review belongs in some respects to this heterogeneous literary tradition, but Twilight of the Scientific Age is primarily directed against the institutional system of science and its associated ideology and not against science itself. Indeed, the author is himself a practicing scientist, an astrophysicist, and he emphasizes several times that he firmly believes in science, even that he loves it. He is not a "stupid cultural relativist," he asserts (p. 11), but a critical freethinker independent of dogmatic beliefs.

  15. Book Review:

    Science.gov (United States)

    Webb, Steve

    2008-11-01

    The Polish physicist Józio (Joseph, Josh, Jo) Rotblat was catapulted into the public eye when he (and the 'Pugwash Conferences' organization) received the 1995 Nobel Peace Prize. His life prior to that had been most distinguished but conducted well out of the public eye. Born and raised as a Jewish physicist in pre-World War II Poland, and thus potentially educationally disadvantaged, he battled away for education and scientific achievement. He came to Liverpool University just before the outbreak of World War II, worked in James Chadwick's laboratory on the early beginnings of neutron fission physics, moved to Los Alamos to take part in the US-UK collaborative Manhattan Project to build a nuclear bomb and was motivated by a desire to rid Poland of Nazi 'racial cleansing'. On realizing the US-UK goal was somewhat wider, he resigned this work and dedicated his life to the peaceful uses of radiation and the campaigns to rid the world of the potential world-eliminating possibility of nuclear war. For this purpose he interacted with Albert Einstein and Bertrand Russell, and in July 1957 founded the 'Pugwash Conferences', named for a small fishing village in Nova Scotia, Canada where the first was held. Along the way his personal life was no less dramatic. Cruel events conspired, and his wife Tola remained in Poland and was killed in the Nazi extermination camp at Majdanek. He grieved for his beloved Poland and those left behind or unaccounted for. He was suspected by some Americans of being a spy and had his personal papers and family artefacts impounded. After the war he was Professor of Medical Physics at St Bartholomew's Hospital, London for 30 years up to retirement. After John Roberts, he was the second editor of this journal Physics in Medicine and Biology from 1961-72 (see e.g. Bob Burns' paper in our 50th birthday issue, 2006. Kit Hill's little book which chronicles the life and times of Rotblat weaves together the key events in his personal and professional

  16. Guided self-help interventions for mental health disorders in children with neurological conditions: study protocol for a pilot randomised controlled trial.

    Science.gov (United States)

    Bennett, Sophie; Heyman, Isobel; Coughtrey, Anna; Simmonds, Jess; Varadkar, Sophia; Stephenson, Terence; DeJong, Margaret; Shafran, Roz

    2016-11-04

    Rates of mental health disorders are significantly greater in children with physical illnesses than in physically well children. Children with neurological conditions, such as epilepsy, are known to have particularly high rates of mental health disorders. Despite this, mental health problems in children with neurological conditions have remained under-recognised and under-treated in clinical settings. Evidence-based guided self-help interventions are efficacious in reducing symptoms of mental health disorders in children, but their efficacy in reducing symptoms of common mental health disorders in children with neurological conditions has not been investigated. We aim to pilot a guided self-help intervention for the treatment of mental health disorders in children with neurological conditions. A pilot randomised controlled trial with 18 patients with neurological conditions and mental health disorders will be conducted. Participants attending specialist neurology clinics at a National UK Children's Hospital will be randomised to receive guided self-help for common mental health disorders or to a 12-week waiting list control. Participants in the treatment group will receive 10 sessions of guided self-help delivered over the telephone. The waiting list control group will receive the intervention after a waiting period of 12 weeks. The primary outcome measure is reduction in symptoms of mental health disorders. Exclusion criteria are limited to those at significant risk of harm to self or others, the presence of primary mental health disorder other than anxiety, depression or disruptive behaviour (e.g. psychosis, eating disorder, obsessive-compulsive disorder) or intellectual disability at a level meaning potential participants would be unable to access the intervention. The study has ethical approval from the Camden and Islington NHS Research Ethics Committee, registration number 14.LO.1353. Results will be disseminated to patients, the wider public, clinicians and

  17. Book Review:

    Science.gov (United States)

    Poisson, E.

    2006-09-01

    The motion of a charged particle interacting with its own electromagnetic field is an area of research that has a long history; this problem has never ceased to fascinate its investigators. On the one hand the theory ought to be straightforward to formulate: one has Maxwell's equations that tell the field how to behave (given the motion of the particle), and one has the Lorentz-force law that tells the particle how to move (given the field). On the other hand the theory is fundamentally ambiguous because of the field singularities that necessarily come with a point particle. While each separate sub-problem can easily be solved, to couple the field to the particle in a self-consistent treatment turns out to be tricky. I believe it is this dilemma (the theory is straightforward but tricky) that has been the main source of the endless fascination. For readers of Classical and Quantum Gravity, the fascination does not end there. For them it is also rooted in the fact that the electromagnetic self-force problem is deeply analogous to the gravitational self-force problem, which is of direct relevance to future gravitational wave observations. The motion of point particles in curved spacetime has been the topic of a recent Topical Review [1], and it was the focus of a recent Special Issue [2]. It is surprising to me that radiation reaction is a subject that continues to be poorly covered in the standard textbooks, including Jackson's bible [3]. Exceptions are Rohrlich's excellent text [4], which makes a very useful introduction to radiation reaction, and the Landau and Lifshitz classic [5], which contains what is probably the most perfect summary of the foundational ideas (presented in characteristic terseness). It is therefore with some trepidation that I received Herbert Spohn's book, which covers both the classical and quantum theories of a charged particle coupled to its own field (the presentation is limited to flat spacetime). Is this the text that graduate students

  18. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2008-12-01

    Melaka and Enyan anak Usen, Iban art; Sexual selection and severed heads: weaving, sculpture, tattooing and other arts of the Iban of Borneo (Viktor T. King John Roosa; Pretext for mass murder; The September 30th Movement and Suharto’s coup d’état in Indonesia (Gerry van Klinken Vladimir Braginsky; The heritage of traditional Malay literature; A historical survey of genres, writings and literary views (Dick van der Meij Joel Robbins, Holly Wardlow (eds; The making of global and local modernities in Melanesia; Humiliation, transformation and the nature of cultural change (Toon van Meijl Kwee Hui Kian; The political economy of Java’s northeast coast c. 1740-1800; Elite synergy (Luc Nagtegaal Charles A. Coppel (ed.; Violent conflicts in Indonesia; Analysis, representation, resolution (Gerben Nooteboom Tom Therik; Wehali: the female land; Traditions of a Timorese ritual centre (Dianne van Oosterhout Patricio N. Abinales, Donna J. Amoroso; State and society in the Philippines (Portia L. Reyes Han ten Brummelhuis; King of the waters; Homan van der Heide and the origin of modern irrigation in Siam (Jeroen Rikkerink Hotze Lont; Juggling money; Financial self-help organizations and social security in Yogyakarta (Dirk Steinwand Henk Maier; We are playing relatives; A survey of Malay writing (Maya Sutedja-Liem Hjorleifur Jonsson; Mien relations; Mountain people and state control in Thailand (Nicholas Tapp Lee Hock Guan (ed.; Civil society in Southeast Asia (Bryan S. Turner Jan Mrázek; Phenomenology of a puppet theatre; Contemplations on the art of Javanese wayang kulit (Sarah Weiss Janet Steele; Wars within; The story of Tempo, an independent magazine in Soeharto’s Indonesia (Robert Wessing REVIEW ESSAY Sean Turnell; Burma today Kyaw Yin Hlaing, Robert Taylor, Tin Maung Maung Than (eds; Myanmar; Beyond politics to societal imperatives Monique Skidmore (ed.; Burma at the turn of the 21st century Mya Than; Myanmar in ASEAN

  19. Book Review:

    Science.gov (United States)

    Poisson, E.

    2005-10-01

    The ever growing relevance of general relativity to astrophysics and cosmology continues to motivate the publication of new textbooks which put the theory in a fresh perspective informed by recent developments. In the last few years we have witnessed the appearance of two new books which reflect this trend, and which stand proud among the classic relativity texts. While the 1970s were the decade of Weinberg [1] and Misner et al [2], and the 80s the decade of Schutz [3] and Wald [4], this is clearly the decade of Hartle [5] and Carroll. Hartle has introduced a novel pedagogical approach to teaching general relativity, which he convincingly argues [6] should be done in the standard undergraduate physics curriculum. His 'physics-first approach' emphasizes physical phenomena and minimizes mathematical formalism. Hartle achieves a lot by introducing only the spacetime metric and the geodesic equation, which are the main tools needed to explore curved spacetime and extract physical consequences. To be sure, to explain how the metric is obtained in the first place does require a background of differential geometry and the formulation of the Einstein field equations. But in Hartle's book this material is wisely presented at a later stage, after an ample sampling of the physics of curved spacetime has motivated the need for the advanced mathematics. Carroll follows instead the traditional route, what Hartle calls the 'math-first approach', in which one introduces first the required mathematical formalism and only then derives the physical consequences. He is, of course, in good company, as this is the method followed in all existing textbooks (with Hartle's being the sole exception). Carroll's approach may not be original, but it is tried and true, and the result of Carroll's efforts is an excellent introduction to general relativity. The book covers the standard topics that would be found in virtually all textbooks (differential geometry, the field equations, linearized

  20. Book Review:

    Science.gov (United States)

    Borcherds, P.

    2005-03-01

    This book achieves what its subtitle indicates. The author skilfully weaves together the story of Bragg's life and of the scientific developments with which he was most closely involved. The author has a good understanding of Bragg's scientific work which he explains in considerable detail, with a number of diagrams reproduced from Bragg's papers, and manages to convey the excitement generated by Bragg's discoveries. The salient points of Bragg's life are well known. He was born and brought up in Australia and is still the youngest ever winner of a Nobel prize (though Josephson did his seminal work at a comparable age, it took many years for him to get his Prize). From 1914 to 1918 Bragg was involved with acoustic methods of detecting enemy guns. From 1919 to 1938 he was Professor of Physics in Manchester, and for about a year he was Director of the National Physical Laboratory. He then went to Cambridge as Cavendish Professor until 1953, when he moved to the Royal Institution (where his father had been). While an undergraduate at Cambridge 'Bragg's most influential teacher was...C T R Wilson [Nobel Laureate, 1927]...[whose] lectures "were the best, and delivery the worst, of any lectures to which I have ever been. He mumbled facing the board, he was very hesitant in his delivery, and yet the way he presented the subject was quite brilliant'' '. One wonders how long Wilson's inspirational teaching would survive today, with continual inspections and the requirement to satisfy the demands of the jobsworths. Bragg's comments on this would make interesting reading! Bragg was a very successful public lecturer on science. He made use of vivid analogies, many of which are quoted by Hunter. Since this book is published by Oxford University Press, I hope that some of them may appear in future editions of The Oxford Dictionary of Quotations. (Bragg is included in Mackay's A Dictionary of Scientific Quotations (Bristol: Institute of Physics Publishing)). There are too many

  1. Book Review:

    Science.gov (United States)

    Kiefer, C.

    2005-10-01

    The most difficult unsolved problem in fundamental theoretical physics is the consistent implementation of the gravitational interaction into a quantum framework, which would lead to a theory of quantum gravity. Although a final answer is still pending, several promising attempts do exist. Despite the general title, this book is about one of them - loop quantum gravity. This approach proceeds from the idea that a direct quantization of Einstein's theory of general relativity is possible. In contrast to string theory, it presupposes that the unification of all interactions is not needed as a prerequisite for quantum gravity. Usually one divides theories of quantum general relativity into covariant and canonical approaches. Covariant theories employ four-dimensional concepts in its formulation, one example being the path integral approach. Canonical theories start from a classical Hamiltonian version of the theory in which spacetime is foliated into spacelike hypersurfaces. Loop quantum gravity is a variant of the canonical approach, the oldest being quantum geometrodynamics where the fundamental configuration variable is the three-metric. Loop quantum gravity has developed from a new choice of canonical variables introduced by Abhay Ashtekar in 1986, the new configuration variable being a connection defined on a three-manifold. Instead of the connection itself, the loop approach employs a non-local version in which the connection is integrated over closed loops. This is similar to the Wilson loops used in gauge theories. Carlo Rovelli is one of the pioneers of loop quantum gravity which he started to develop with Lee Smolin in two papers written in 1988 and 1990. In his book, he presents a comprehensive and competent overview of this approach and provides at the same time the necessary technical background in order to make the treatment self-contained. In fact, half of the book is devoted to 'preparations' giving a detailed account of Hamiltonian mechanics, quantum

  2. Book Review:

    Science.gov (United States)

    Walcher, J.

    2006-10-01

    This book is a find. Mariño meets the challenge of filling in less than 200 pages the need for an accessible review of topological gauge / gravity duality. He is one of the pioneers of the subject and a clear expositor. It is no surprise that reading this book is a great pleasure. The existence of dualities between gauge theories and theories of gravity remains one of the most surprising recent discoveries in mathematical physics. While it is probably fair to say that we do not yet understand the full reach of such a relation, the impressive amount of evidence that has accumulated over the past years can be regarded as a substitute for a proof, and will certainly help to delineate the question of what is the most fundamental quantum mechanical theory. As has been the case in the past, it is in the context of Witten's 'topological' quantum theories that the mathematical framework is well enough established to firmly ground, and fully benefit from, the development of the physical theories. This book makes an important contribution to this new chapter in the math / physics interaction. There are two main instances of topological gauge/gravity duality. In the A-model, Chern Simons gauge theory on the 3-sphere is related to the closed topological string theory on the local Calabi Yau 3-fold {\\mathcal O}_{{\\mathbb P}^1}(-1) \\oplus{\\mathcal O}_{{\\mathbb P}^1} (-1), also known as the resolved conifold (Gopakumar-Vafa duality). In the B-model, certain types of matrix models are related on the gravity side to topological strings on certain cousins of the deformed conifold (Dijkgraaf-Vafa duality). In both cases, and similarly to the more physical AdS/CFT correspondence, the duality can be discovered by realizing the gauge theory as the target space theory of open strings ending on particular D-branes in a geometry closely related to the closed string background of the gravity theory. The A-branes supporting Chern Simons theory are wrapped on the Lagrangian three

  3. Book Review:

    Science.gov (United States)

    Israel, W.

    2006-07-01

    The evaporation of a black hole formed by the collapse of matter is a nonunitary process involving loss of information. At least, this is how it appears in Hawking's semiclassical description, in which gravity is not quantized and the emergent radiation appears thermal. Since unitarity is one of the pillars of quantum mechanics there has been an understandable reluctance to accept this as an ironclad conclusion. Conformal field theories in flat space are manifestly unitary, and the AdS/CFT correspondence therefore suggests that the information trapped in the depths of the hole must find some way to escape—a conclusion almost universally accepted today, at least among particle theorists. Just how it could escape remains a mystery, however, since nothing can escape without violating causality until the black hole has shrunk too far to hold much information. Gerard 't Hooft and the senior author of this book, Leonard Susskind, have been vocal advocates of the view that the information paradox poses a real crisis for physics requiring significant paradigm shifts. They suggest that locality must be given up as an objective property of physical phenomena (even on large scales) and replaced by a new principle of 'black hole complementarity'. Specifically, there are two very different ways to view the process of collapse and evaporation. To a free-falling observer, nothing unusual happens at the horizon and matter and information fall deep into the hole. To a stationary observer hovering just outside the hole it appears instead that the matter and information are deposited on the horizon (which he experiences as very hot because of his large acceleration), to be eventually re-emitted from there as Hawking radiation. According to 't Hooft and Susskind, these must be viewed as equally valid, 'complementary' descriptions of the same process. Black hole complementarity is essentially the statement (supported by operational arguments) that their simultaneous validity cannot

  4. Book Reviews

    Directory of Open Access Journals (Sweden)

    Nico G. Schulte Nordholt

    1996-01-01

    , The Tasaday controversy; Assessing the evidence. AAA 28 Special Publication. Washington: American Anthropological Association, 1992, xi + 255 pp. - Remco Raben, Peter Harmen van der Brug, Malaria en malaise; De VOC in Batavia in de achttiende eeuw. Amsterdam: De Bataafsche Leeuw, 1994, 256 pp. - Nico G. Schulte Nordholt, Marcel Bonneff, ‘L’Indonésie contemporaine; vue par ses intellectuels’. Un choix d’articles de la revue PRISMA (1971-1991. Cahier d’Archipel 21. L’Harmattan, 1994, 287 pp. - A. Teeuw, Henri Chambert-Loir, Littérature indonésienne, une introduction. Éditeur Henri Chambert-Loir. Cahier d’Archipel 22. Paris: Association Archipel, 1994, 237 pp. - A. Teeuw, Martina Heinschke, Angkatan 45. Literaturkonzeptionen im gesellschaftspolitischen Kontext; Zur Funktionsbestimmung von Literatur im postkolonialen Indonesien. Veröffentlichungen des Seminars für Indonesische und Südseesprachen der Universität Hamburg, Band 18. Berlin/Hamburg: Dietrich Reimer Verlag, 1993, viii + 365 pp., - Wim van Zanten, Philip Yampolsky, Music of Indonesia, Volumes 1-6. Series of CDs/cassette tapes with documentation. Washington: Smithsonian/Folkways Recordings. Vol. 1: ‘Songs before dawn: Gandrung Banyuwangi’ (1991; SF40055; Vol. 2: ‘Indonesian popular music: Kroncong, Dangdut, and Langgam Jawa’ (1991; SF40056; Vol. 3: ‘Music from the outskirts of Jakarta: Gambang Kromong’ (1991; SF40057; Vol. 4: ‘Music of Nias and North Sumatra: Hoho, Gendang Karo, Gondang Toba’ (1992; SF40420; Vol. 5: ‘Betawi and Sundanese music of the north coast of Java: Topeng Betawi, Tanjidor, Ajeng’ (1994; SF40421; Vol. 6: ‘Night music of West Sumatra: Saluang, Rabab Pariaman, Dendang Pauah’(1994; SF 40422.

  5. Neutrino book

    International Nuclear Information System (INIS)

    Spiro, Michel

    1995-01-01

    André Rousset's book (in French - Gargamelle et les Courants Neutres - Ecole des Mines de Paris) tells the story of Gargamelle and the discovery at CERN in 1973 of neutral currents, the cornerstone of the electroweak theory. This vital discovery helped to give credence to the Standard Model of particle physics. Rousset is both an observer and one of the key figures in the story. His book is lively and well documented; in it he uses archive material to ensure the accuracy of his information on dates, choices and decisions. After an introduction to particle physics which puts into perspective the electroweak theory unifying weak and electromagnetic interactions, Rousset comes straight to the point. From the late 1950s onwards he was involved in the construction of the first heavy liquid bubble chambers by the BP1, BP2 and BP3 teams at the Ecole Polytechnique in Paris. For Gargamelle a bigger laboratory was needed, and it was at the CEA (French Atomic Energy Commission) in Saclay that the chamber was designed by teams from the Saturne accelerator and the Ecole Polytechnique. However, the decision to build Gargamelle was taken in 1965 through the impetus of André Lagarrigue, in defiance of the normal CERN procedures. Gargamelle was then in competition with the other big bubble chamber project, BEBC; was it really necessary to build two big chambers? The decision by Francis Perrin and the CEA to contribute ''generously'' to the project was probably what swung the decision. Construction took five years, during which many problems were encountered, right up to the fault in the main part of the chamber which caused delays and, a few years later, was to prove fatal to the detector. As Rousset correctly states, Gargamelle was probably the first big detector designed to be built on industrial lines, in direct cooperation with industry. The reward: the first neutrino interaction was photographed on 28 January 1971

  6. Book Review:

    Science.gov (United States)

    Barbour, J. B.

    2007-02-01

    These colloquium proceedings will be valuable, the blurb says, for graduate students and researchers in cosmology and theoretical astrophysics. Specifically, the book 'looks at both the strengths and weaknesses of the current big bang model in explaining certain puzzling data' and gives a 'comprehensive coverage of the expanding field of cosmology'. The reality is rather different. Conference proceedings rarely compare in value with a solid monograph or good review articles, and Current Issues in Cosmology is no exception. The colloquium was convened by the two editors, who have both long harboured doubts about the big bang, and was held in Paris in June 2004. The proceedings contain 19 presented papers and relatively brief summary comments by four panel speakers. The questions and answers at the end of each talk and a general discussion at the end were recorded and transcribed but contain little of interest. The nature of the colloquium is indicated by panellist Francesco Bertola's comment: 'While in the 1950s it was possible to speak of rival theories in cosmology, now the big-bang picture has no strong rivals. This is confirmed by the fact that out of 1500 members of the IAU Division VIII (Galaxies and the Universe) only a dozen, although bright people, devote their time to the heterodox views.' This was largely a platform for them to give their views. At least half of the dozen, all the 'usual suspects', were present: Geoffery and Margaret Burbidge, Jayant Narlikar, Halton Arp, Chandra Wickramasinghe and, in spirit only but playing a role somewhat like the ghost of Hamlet's father, the late Fred Hoyle. Doubters presented 12 of the 19 papers. Orthodoxy should certainly be challenged and the sociology of science questioned, but I found two main problems with this book. The papers putting the orthodox view are too short, even perfunctory. The most that a serious graduate student would get out of them is a reference to a far better review article or book on modern

  7. Book Review:

    Science.gov (United States)

    Trimble, Virginia

    2007-05-01

    Here are two textbooks, both published by Springer and each roughly half devoted to cosmology—the large scale structure and evolution of the Universe. I can imagine a context (not the same context) in which each would be useful. And there the similarities largely end. Bergstrom and Goobar's (hereafter B&G) other topic is particle astrophysics, and they are addressing students who already have some knowledge of advanced quantum mechanics and classical field theory (or who can master some relativistic dynamics and the Dirac equation on the basis of a couple of very information-dense appendices). The book is meant for use at the graduate level, probably the second year by US standards (the authors are from Stockholm). Schneider (hereafter PS), on the other hand, begins with galaxies, and then alternates between cosmological topics of gradually increasing sophistication (expanding universe to CMB fluctuations) and additional galactic topics—clusters, quasars and all. The book is meant as the second half of an introductory astronomy/astrophysics course for physics majors, and in the US would fit into an upper division `capstone' course. Each is meant for a single semester class at the target level, and might be squeezed into a 10-week term with elimination of some topics. B&G is a paperback of a second edition, with colour confined to a central block of plates, relatively few graphs and drawings, but lots of complex equations. PS is a hard cover translation from a German original, with colour used freely in astronomical images and graphs throughout, with fewer and less complex equations. Though the nominal difference in copyright date is only two years (2006 for PS, 2004 for B&G), the former is considerably more up to date, mentioning, for instance, that the third year WMAP results are not different enough from the first year to justify redoing drawings and such (I agree). What can you expect to get if you buy one or both of these? B&G have a homepage of error

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2000-07-01

    : The Press University of the West Indies, 1998. xviii + 152 pp. -Kris Lane, Hans Turley, Rum, sodomy, and the lash: Piracy, sexuality, and masculine identity. New York: New York University Press, 1999. lx + 199 pp. -Jonathan Schorsch, Eli Faber, Jews, slaves, and the slave trade: Setting the record straight. New York: New York University Press, 1998. xvii + 367 pp. -Bonham C. Richardson, Bridget Brereton ,The Colonial Caribbean in transition: Essays on postemancipation social and cultural history. Barbados: The Press University of the West Indies; Gainesville: University Press of Florida, 1999. xxiii + 319 pp., Kevin A. Yelvington (eds -Ransford W. Palmer, Thomas Klak, Globalization and neoliberalism: The Caribbean context. New York: Rowman and Littlefield, 1998. xxiv + 319 pp. -Susan Saegert, Robert B. Potter ,Self-help housing, the poor, and the state in the Caribbean. Knoxville: University of Tennessee Press, 1997. xiv + 299 pp., Dennis Conway (eds -Peter Redfield, Michèle-Baj Strobel, Les gens de l'or: Mémoire des orpailleurs créoles du Maroni. Petit-Bourg, Guadeloupe: Ibis Rouge, 1998. 400 pp. -Donald R. Hill, Louis Regis, The political calypso: True opposition in Trinidad and Tobago 1962-1987. Gainesville: University Press of Florida, 1999. xv + 277 pp. -A. James Arnold, Christiane P. Makward, Mayotte Capécia ou l'aliénation selon Fanon. Paris: Karthala, 1999. 230 pp. -Chris Bongie, Celia M. Britton, Edouard Glissant and postcolonial theory: Strategies of language and resistance. Charlottesville: University Press of Virginia, 1999. xiv + 224 pp. -Chris Bongie, Anne Malena, The negotiated self: The dynamics of identity in Francophone Caribbean narrative. New York: Peter Lang, 1999. x + 192 pp. -Catherine A. John, Kathleen M. Balutansky ,Caribbean creolization: Reflections on the cultural dynamics of language, literature, and identity., Marie-Agnès Sourieau (eds -Leland Ferguson, Jay B. Haviser, African sites archaeology in the Caribbean. Princeton NJ: Markus

  9. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. van Goor

    1997-07-01

    Full Text Available - Peter Boomgaard, Christine Dobbin, Asian entrepreneurial minorities; Conjoint communities in the making of the world economy, 1570-1940. Richmond: Curzon Press, 1996, xiii + 246 pp. [Nordic Institute of Asian Studies Monograph Series 71.] - Ian Brown, Fukuda Shozo, With sweat and abacus; Economic roles of Southeast Asian Chinese on the eve of World War II, edited by George Hicks. Singapore: Select Books, 1995, xii + 246 pp. - Ian Brown, George Hicks, Chinese organisations in Southeast Asia in the 1930s. Singapore: Select Books, 1996, xv + 168 pp. - Matthew I. Cohen, Laurie J. Sears, Shadows of empire; Colonial discourse and Javanese tales. Durham/London: Duke University Press, 1996, xxi + 349 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. II: Expansion and crisis. New Haven/London: Yale University Press, 1993, xv + 390 pp. - J. van Goor, Anthony Reid, Southeast Asia in the age of commerce 1450-1680. Vol. I: The lands below the winds. New Haven/London: Yale University Press, 1988, xvi + 275 pp. - David Henley, Saya S. Shiraishi, Young heroes; The Indnesian family in politics. Ithaca/New York: Southeast Asia Program, Cornell University, Southeast Asia Program Publications, 1997, 183 pp. [Studies on Southeast Asia 22.] - Gerrit Knaap, P. Jobse, Bronnen betreffende de Midden-Molukken 1900-1942. Den Haag: Instituut voor Nederlandse Geschiedenis, 1997. 4 volumes. Rijks Geschiedkundige Publicatiën, Kleine Serie, 81, 82, 83, 84. Volume 1 bewerkt door P. Jobse, 2 en 3 door Ch.F. van Fraassen, 4 door Ch.F van Fraassen en P. Jobse. xii + 578, xii + 578, xii + 711, x + 655, xi + 261 pp., Ch. F. van Fraassen (eds. - Indro Nugroho-Heins, Clara Brakel-Papenhuyzen, Classical Javanese dance; The Surakarta tradition and its terminology. Leiden: KITLV Press, 1995, xi + 252 pp. [Verhandelingen 155.] - László Sluimers, Shigeru Sato, War, nationalism and peasants; Java under the Japanese occupation, 1942-1945. Armonk, New

  10. Optical Sensor Based on a Single CdS Nanobelt

    Directory of Open Access Journals (Sweden)

    Lei Li

    2014-04-01

    Full Text Available In this paper, an optical sensor based on a cadmium sulfide (CdS nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT method. X-Ray Diffraction (XRD and Transmission Electron Microscopy (TEM results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 104, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  11. Optical sensor based on a single CdS nanobelt.

    Science.gov (United States)

    Li, Lei; Yang, Shuming; Han, Feng; Wang, Liangjun; Zhang, Xiaotong; Jiang, Zhuangde; Pan, Anlian

    2014-04-23

    In this paper, an optical sensor based on a cadmium sulfide (CdS) nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT) method. X-Ray Diffraction (XRD) and Transmission Electron Microscopy (TEM) results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL) technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 10⁴, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  12. Mn2+ anchored CdS polymer nanocomposites: An efficient alternative for Mn2+ doped CdS nanoparticles

    International Nuclear Information System (INIS)

    Saikia, Bhaskar Jyoti; Nath, Bikash Chandra; Borah, Chandramika; Dolui, Swapan Kumar

    2015-01-01

    A chelating bi-functional polymer brushes was prepared via atom transfer radical polymerization using grafting-from methodology. Mn 2+ -anchored CdS-polymer nanocomposites were synthesized using this graft copolymer by simple chelation method resulting in emission at about 620 nm which originates from the fluorescence of manganese ions embedded on the surface of CdS nanoparticles. This method provides an efficient straightforward substitute of Mn 2+ dopped CdS nanoparticles. Optical properties of the composites were investigated which indicates that simple Mn 2+ chelation and subsequent binding of CdS in a polymer matrix can have similar effect in the luminescence property as those synthesized via complex doping methods. Moreover this methodology can be applied for synthesis of any metal anchored nanocomposites proficiently and cost effectively in large-scale production. - Highlights: • A chelating bifunctional copolymer brush was synthesized via ATRP. • CdS nanoparticles and Mn 2+ were coupled with the bifunctional polymer. • Composites showed emission properties similar to Mn 2+ doped CdS nanoparticles. • Side chain length of the polymers also affect the emission properties of the composites.

  13. The effect of a community-based self-help multimodal behavioral intervention in Korean American seniors with high blood pressure.

    Science.gov (United States)

    Kim, Kim B; Han, Hae-Ra; Huh, Boyun; Nguyen, Tam; Lee, Hochang; Kim, Miyong T

    2014-09-01

    Great strides have been made in improving heart health in the United States during the last 2 decades, yet these strides have not encompassed many ethnic minority populations. There are significant health disparity gaps stemming from both a paucity of valid research and a lack of culturally sensitive interventions. In particular, many Korean Americans with chronic illnesses encounter difficulty navigating the healthcare system because of limited health literacy. The effect of a multimodal Self-Help Intervention Program on the Control of High Blood Pressure (HBP) was tested in a community-based clinical trial for Korean American seniors. Of 440 seniors enrolled, 369 completed the study (184 in the intervention group and 185 in the control group; mean age = 70.9±5.3 years). The intervention group received 6 weekly educational sessions on HBP management skill building, including health literacy training, followed by telephone counseling and home blood pressure (BP) monitoring for 12 months. Findings support that the Self-Help Intervention Program on the Control of HBP was effective in controlling BP in this ethnic/linguistic minority population. The BP control rates for the intervention and control groups were 49.5% vs. 43.2% at baseline, 58.5% vs. 42.4% at 6 months, 67.9% vs. 52.5% at 12 months, and 54.3% vs. 53.0% at 18 months. Significant changes were observed over time in some psychobehavioral outcomes, including self-efficacy for BP control, medication adherence behavior, HBP knowledge, and depression. The study findings suggest that the multimodal Self-Help Intervention Program on the Control of HBP is effective at promoting optimal HBP control for this ethnic/linguistic minority population. NCT00406614. © American Journal of Hypertension, Ltd 2014. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Does a pre-treatment diagnostic interview affect the outcome of internet-based self-help for social anxiety disorder? a randomized controlled trial.

    Science.gov (United States)

    Boettcher, Johanna; Berger, Thomas; Renneberg, Babette

    2012-10-01

    Numerous studies suggest that Internet-based self-help treatments are effective in treating anxiety disorders. Trials evaluating such interventions differ in their screening procedures and in the amount of clinician contact in the diagnostic assessment phase. The present study evaluates the impact of a pre-treatment diagnostic interview on the outcome of an Internet-based treatment for Social Anxiety Disorder (SAD). One hundred and nine participants seeking treatment for SAD were randomized to either an interview-group (IG, N = 53) or to a non-interview group (NIG, N = 56). All participants took part in the same 10-week cognitive-behavioural unguided self-help programme. Before receiving access to the programme, participants of the IG underwent a structured diagnostic interview. Participants of the NIG started directly with the programme. Participants in both groups showed significant and substantial improvement on social anxiety measures from pre- to post-assessment (d IG = 1.30-1.63; d NIG = 1.00-1.28) and from pre- to 4-month follow-up assessment (d IG = 1.38-1.87; d NIG = 1.10-1.21). Significant between-groups effects in favour of the IG were found on secondary outcome measures of depression and general distress (d = 0.18-0.42). These findings suggest that Internet-based self-help is effective in treating SAD, whether or not a diagnostic interview is involved. However, the pre-treatment interview seems to facilitate change on secondary outcomes such as depression and general distress.

  15. We cannot change the past, but we can change its meaning. A randomized controlled trial on the effects of self-help imagery rescripting on depression.

    Science.gov (United States)

    Moritz, Steffen; Ahlf-Schumacher, Jana; Hottenrott, Birgit; Peter, Ulrike; Franck, Stephanie; Schnell, Thomas; Peter, Helmut; Schneider, Brooke C; Jelinek, Lena

    2018-05-01

    Imagery rescripting is a psychotherapeutic technique that aims to ameliorate negative emotions by altering (i.e., rescripting) inner representations of negative memories and images. Although the treatment was initially developed for traumatized individuals, face-to-face interventions have yielded promising results for patients with other diagnoses as well. The present study explored the feasibility and efficacy of the approach when used as a self-help intervention for depression. A total of 127 individuals with diagnosed depression were randomly allocated to either a wait-list control condition or received a brief or long version of a manual teaching imagery rescripting. Six weeks after inclusion, patients were invited to participate in the post assessment. The Beck Depression Inventory (BDI-II) served as the primary outcome (registered at ClinicalTrials.gov (NCT03299127). The long version was superior to the wait-list control condition on the BDI-II, self-esteem, and quality of life at a medium effect size. No effects emerged for anxiety. No significant between-group differences were found for the brief version. Moderation analyses indicated that the self-help approach seems particularly beneficial for those scoring high on symptoms, willingness to change, and expectancy (baseline). Most patients indicated they would use the technique in the future. The efficacy of imagery rescripting was confirmed when applied via self-help. Use of the long form of the manual is recommended. Future studies are needed to ascertain whether treatment effects are sustained over time. Copyright © 2018. Published by Elsevier Ltd.

  16. Barriers to diabetes awareness and self-help are influenced by people's demographics: perspectives of South Asians with type 2 diabetes.

    Science.gov (United States)

    Pardhan, Shahina; Nakafero, Georgina; Raman, Rajiv; Sapkota, Raju

    2018-03-26

    To determine whether barriers to diabetes awareness and self-help differ in South Asian participants of different demographic characteristics (age, gender, and literacy) with type 2 diabetes living in the United Kingdom. Six focus group discussions (FGDs) were carried out in patients who were categorized according to age (30-60 years, ≥60 years), gender (male, female) and literacy status (literate, illiterate). Data were analysed following the iterative process of thematic analysis techniques. Barriers were demographic-specific. The illiterate groups reported language as the major barrier to improved diabetes awareness and self-help. The literate groups reported that information provided by healthcare providers was general, and not specific to their diet/culture. Major barriers to adherence to the recommended diet for diabetes included: insufficient knowledge/awareness about nutritional content of food (all groups); lack of self-will to resist eating sweets, especially during weddings/festivals (literate older groups/literate younger females/illiterate older males); difficulty cooking separate meals for diabetic and non-diabetic family members (illiterate/literate older females). Other barriers to seeking advice/help ranged from not wanting to disclose their diabetes as it may affect employment/work (literate groups) to fear of being singled out at social gatherings (illiterate groups). General lack of motivation to exercise was reported by all groups. Time constraints and not knowing what/how to exercise was reported by literate younger groups whilst the illiterate older groups reported to not having suitable exercising facilities at local communities. Different barriers were also reported when accessing healthcare; language barriers (illiterate groups), restricted access to doctors' appointments/difficulty attending specific appointment slots offered by General Practitioners (literate females). Different barriers exist to improved awareness about diabetes and

  17. Beyond the Trial: Systematic Review of Real-World Uptake and Engagement With Digital Self-Help Interventions for Depression, Low Mood, or Anxiety.

    Science.gov (United States)

    Fleming, Theresa; Bavin, Lynda; Lucassen, Mathijs; Stasiak, Karolina; Hopkins, Sarah; Merry, Sally

    2018-06-06

    Digital self-help interventions (including online or computerized programs and apps) for common mental health issues have been shown to be appealing, engaging, and efficacious in randomized controlled trials. They show potential for improving access to therapy and improving population mental health. However, their use in the real world, ie, as implemented (disseminated) outside of research settings, may differ from that reported in trials, and implementation data are seldom reported. This study aimed to review peer-reviewed articles reporting user uptake and/or ongoing use, retention, or completion data (hereafter usage data or, for brevity, engagement) from implemented pure self-help (unguided) digital interventions for depression, anxiety, or the enhancement of mood. We conducted a systematic search of the Scopus, Embase, MEDLINE, and PsychINFO databases for studies reporting user uptake and/or usage data from implemented digital self-help interventions for the treatment or prevention of depression or anxiety, or the enhancement of mood, from 2002 to 2017. Additionally, we screened the reference lists of included articles, citations of these articles, and the titles of articles published in Internet Interventions, Journal of Medical Internet Research (JMIR), and JMIR Mental Health since their inception. We extracted data indicating the number of registrations or downloads and usage of interventions. After the removal of duplicates, 970 papers were identified, of which 10 met the inclusion criteria. Hand searching identified 1 additional article. The included articles reported on 7 publicly available interventions. There was little consistency in the measures reported. The number of registrants or downloads ranged widely, from 8 to over 40,000 per month. From 21% to 88% of users engaged in at least minimal use (eg, used the intervention at least once or completed one module or assessment), whereas 7-42% engaged in moderate use (completing between 40% and 60% of

  18. Effectiveness of a Guided Self-help Manual in Strengthening Resilience in People Diagnosed with Moderate Depression and Their Family Caregivers in Thailand: A Randomised Controlled Trial.

    Science.gov (United States)

    McCann, Terence V; Songprakun, Wallapa; Stephenson, John

    2017-08-01

    The growing incidence of depression in developing countries, such as Thailand, is placing increasing pressure on public mental health services, and those living in rural areas have limited access to these services. Resilience is integral to the recovery of people with depression and to caregivers. This parallel-group randomised controlled trial evaluated the effectiveness of a guided self-help manual in improving resilience in adults diagnosed with moderate depression and their primary caregivers in Thailand. Our findings provide preliminary evidence that the approach is an effective way of increasing resilience in adults with depression and their caregivers.

  19. Book reviews

    Directory of Open Access Journals (Sweden)

    T. Abdel-Motey., C. Urfels., K. Rodriguez., J. Mardikian., J.A. Drobnicki., V. Diodato.

    2000-10-01

    Full Text Available Title:(1 The Library and Information Professional’s Guide to the Internet. (2 Reinvention of the Public Library for the 21st Century. (3 Public Library Collection Development in the Information Age. (4 Making Sense of Journals in the Life Science: From Specialty Origins to Contemporary Assortment. (5 The Holocaust: Memories, Research, Reference. (6 How to Index Your Local Newspaper Using WordPerfect or Microsoft Word for Windows. (7 Effective Utilization and Management of Emerging Information Technologies. (8 Information Technology and Organizations: Challenges of New Technologies. (9 Facilities Planning for School Media and Technology Centers. (10 Libraries Without Walls 2: The Delivery of Library Services to Distance Users. (11 New International Directions in HIV Prevention for Gay and Bisexual Men. (12 Soaring to Excellence Videos: Tools of Our Trade III: Books, the Internet, and Beyond.Author:(1Reviewed by Teresa Abdel-Motey. (2Review by Claire Urfels. (3Reviewed by Dr. Ketty Rodriguez. (4Reviewed by Jackie Mardikian. (5Reviewed by John A. Drobnicki.(6Reviewed by Dr. Virgil Diodato. (7Reviewed by Dr. Lisa M. Covi. (8Reviewed by Tom Zillner. (9Reviewed by Dr. W. Bernard Lukenbill. (10Reviewed by Dr. Elizabeth Buchanan. (11Reviewed by Aisha White. (12Reviewed by Phyllis Tragash

  20. Book Review

    Science.gov (United States)

    Smith, René J.

    2006-01-01

    Editors Note: This book is written in Spanish and the review is given in both English and Spanish. Both reviews were written by the same individual and essentially have the same content. Code of Practice for Quality Control of Treatment Planning Systems (TPS) in Radiation Therapy, by José Miguel Delgado Rodríguez, Feliciano García Vicente, Esther Millán Cebrián. Sociedad Española de Física Médica. Ramírez de Arellano Editores, S. L. 2005, Madrid, Spain; available. secretaria@sefm.es, 50ε Protocolo para Control de Calidad en Sistemas de Planificación de Terapia con Radiaciones Ionizantes, por José Miguel Delgado Rodríguez, Feliciano García Vicente, Esther Millán Cebrián. Sociedad Española de Física Médica. Ramírez de Arellano Editores, S. L. 2005, Madrid, Spain. secretaria@sefm.es, 50ε

  1. Book Review:

    Science.gov (United States)

    Rogister, A. L.

    2004-03-01

    John Wesson’s well known book, now re-edited for the third time, provides an excellent introduction to fusion oriented plasma physics in tokamaks. The author’s task was a very challenging one, for a confined plasma is a complex system characterised by a variety of dimensionless parameters and its properties change qualitatively when certain threshold values are reached in this multi-parameter space. As a consequence, theoretical description is required at different levels, which are complementary: particle orbits, kinetic and fluid descriptions, but also intuitive and empirical approaches. Theory must be carried out on many fronts: equilibrium, instabilities, heating, transport etc. Since the properties of the confined plasma depend on the boundary conditions, the physics of plasmas along open magnetic field lines and plasma surface interaction processes must also be accounted for. Those subjects (and others) are discussed in depth in chapters 2 9. Chapter 1 mostly deals with ignition requirements and the tokamak concept, while chapter 14 provides a list of useful relations: differential operators, collision times, characteristic lengths and frequencies, expressions for the neoclassical resistivity and heat conduction, the bootstrap current etc. The presentation is sufficiently broad and thorough that specialists within tokamak research can either pick useful and up-to-date information or find an authoritative introduction into other areas of the subject. It is also clear and concise so that it should provide an attractive and accurate initiation for those wishing to enter the field and for outsiders who would like to understand the concepts and be informed about the goals and challenges on the horizon. Validation of theoretical models requires adequately resolved experimental data for the various equilibrium profiles (clearly a challenge in the vicinity of transport barriers) and the fluctuations to which instabilities give rise. Chapter 10 is therefore

  2. Book Reviews

    Directory of Open Access Journals (Sweden)

    Alistair Lamb

    1964-10-01

    Full Text Available - B.V.A. Röling, Paul Shepard, Psycholex. Megwa, New York, 1960. 144 blz. - L. Sluimers, J.F. Cady, Southeast Asia: Its historical development. New York etc., McGraw-Hill Book Company, 1964. XVII, 657, IX blz., foto, krtn. - H.J. de Graaf, Nicholas Tarling, Piracy and politics in the Malay world. A study of British imperialism in nineteenth-century Sout-East Asia. F.W. Cheshire, Melbourne, Canberra, Sydney, 1963. 273 pp., frontispiece, endpaper maps. - W. Brand, N.A. Simoniya, Overseas Chinese in Southeast Asia - A Russian study. Data Paper Number 45, Southeast Asia Program, Department of Far Eastern Studies, Cornell University Press, Ithaca, New York, December 1961, 151 blz. - B.H.M. Vlekke, Alistair Lamb, The China-India border, The origins of the disputed boundaries. Published for the Royal Institute of International Affairs by Oxford University Press, London 1964, XVI + 192 pp. - R.S. Karni, Beda Lim, Malaya, a background bibilography. Journal Malayan Branch, RAS, vol. XXXV, pts. 2 & 3, 1962; V. 199 pp. - L. Sluimers, R.K. Goldsen, Factors related to acceptance of innovation in Bang Chan, Thailand; Analysis of a survey conducted by the Cornell Cross-cultural Methodology Project, May 1955. Cornell Thailand Project Interim Report Series no. 3. Data Paper: No. 25 Southeast Asia Program Department of Far Eastern Studies Cornell University. 3de druk, Ithaca, Cornell University Press, 1963. VIII, 72, X blz., M. Rallis (eds.

  3. Book Review:

    Science.gov (United States)

    Stewart, J. M.

    2006-02-01

    In 1952, Mme Yvonne Choquet-Bruhat published a major paper, Théorème d'existence pour certains systèmes d'équations aux dérivées partielles non linéaires (Acta Math. 88 141-225), which laid the foundation for modern studies of the Cauchy problem in general relativity. The fiftieth anniversary of this event was celebrated with an eponymous Cargèse Summer School in 2002. The proceedings of that summer school are summarized electronically (as audio, video, transparencies and lecture notes, where available) on a DVD archive included with this volume, and are also available on the internet. However the organizers decided that a separate volume describing the 'state of the art in mathematical general relativity' would be useful, and this book is the result. It includes some material not covered in the school and excludes some school material which has been covered adequately elsewhere. Unfortunately, I was unable to find, electronically, a table of contents, which every prospective purchaser would wish to see, and so this review does in fact list all the articles, ordered, roughly, by length. About one fifth of the book is devoted to a survey of Smoothness at Null Infinity and the Structure of Initial Data by Helmut Friedrich. This is a modern study of gravitational radiation, and the analysis of Einstein's equations. It is extremely helpful to survey all of this material, including some of the latest developments, using a consistent notation. This article is strongly recommended to anyone hoping to gain a foothold in this area. Note also that 47 pages of transparencies have become 84 book pages. Lars Andersson has surveyed, in The Global Existence Problem in General Relativity, some results and conjectures about the global properties of 3+1-dimensional spacetimes with a compact Cauchy surface. Again it is very useful to have essentially all of the known results presented in a consistent notation. This material is not on the DVD. Yvonne Choquet-Bruhat has

  4. Book Reviews

    Directory of Open Access Journals (Sweden)

    Hans Antlöv

    1996-04-01

    , vii + 231 pp., Ulricht Mai (eds. - Tineke Hellwig, Brigitte Müller, Op de wipstoel; De niet-gewettigde inheemse vrouw van de blanke Europeaan in Nederlands-Indië (1890-1940; Een literatuuronderzoek naar beeldvorming en werkelijkheid. Amsterdam: Vakgroep Culturele Antropologie/Sociologie der Niets-Westerse Samenlevingen, 1995, xii + 131 pp. - Jan van der Putten, Liaw Yock Fang, Standard Malay made simple. Singapore: Times Books International, 1988. - Jan van der Putten, Liaw Yock Fang, Standard Indonesian made simple, written with the assistance of Nini Tiley-Notodisuryo, Singapore: Times Books International, 1990. - Jan van der Putten, Liaw Yock Fang, Speak standard Malay; A beginner’s guide. Singapore: Times Books International, 1993, xxii + 280 pp. - Jan van der Putten, Liaw Yock Fang, Speak Indonesian; A beginner’s guide, written in collaboration with Munadi Padmadiwiria and Abdullah Hassan. Singapore: Times Books International, 1990. - Alle G. Hoekema, Chr.G.F. de Jong, Geschiedenis van de Nederlandse Zending op Zuid-Sulawesi 1852-1966; Een bronnenpublicatie. Oegstgeest: Raad voor de Zending der Nederlands Hervormde Kerk, 1995, xi + 524 pp. - George Hotze, Ronald G. Gill, De Indische stad op Java en Madura; Een morfologische studie van haar ontwikkeling. Delft: Publikatieburo Bouwkunde, Technische Universiteit Delft, 1995, 350 pp. - H.A.J. Klooster, Holk H. Dengel, Neuere Darstellung der Geschichte Indonesiens in Bahasa Inonesia; Entwicklung und Tendenzen der indonesischen Historiographie. Stuttgart: Steiner, 1994, vii + 269 pp. - Harry A. Poeze, Hans Antlöv, Imperial policy and Southeast Asian nationalism 1930-1957. Richmond: Curzon Press, 1995, xiii + 323 pp., Stein Tonnesson (eds. - P.W. Preston, Michael Hill, The politics of nation building and citizenship in Singapore. London: Routledge, 1995, x + 285 pp., Lian Kwen Fee (eds. - J.W. (Pim Schoorl, Michael Southon, The navel of the perahu; Meaning and values in the maritime trading economy of a Butonese

  5. Book Review:

    Science.gov (United States)

    Wainwright, John

    2007-04-01

    The present volume is an introduction to general relativity and cosmology, at a level suitable for beginning graduate students or advanced undergraduates. The book consists of two main parts, the first entitled `Elements of differential geometry', and the second `The theory of gravitation'. Chapters 2-7, part I, introduce the basic ideas of differential geometry in a general setting, and are based on previously unpublished notes by one of the authors. On the one hand, the treatment is modern in that it uses a `top-down' approach, i.e. starting with general differentiable manifolds, and deferring the introduction of a metric tensor until after the notions of affine connection and curvature have been introduced. On the other hand, the treatment is classical in that it relies heavily, though not exclusively, on index notation. The general material, chapters 1-7, is then followed by four more specialized chapters dealing with matters of specific interest for general relativity. Topics include symmetry groups acting on Riemannian manifolds, with spherically symmetric spacetimes and spatially homogeneous spacetimes as examples, the efficient calculation of curvature, and the Petrov classification of the Weyl curvature tensor using spinors. Part II deals with general relativity and cosmology. The basic assumptions of the theory and its application to spherically symmetric gravitational fields are discussed in two chapters, and there is some historical material and motivation for the basic assumptions at the beginning of the book. The final chapter contains a detailed discussion of the Kerr solution. But the main emphasis in part II is on relativistic cosmology, in particular the analysis of cosmological models more general than the familiar Friedmann-Lemaitre (FL) models. The material on cosmology begins with a discussion of relativistic hydrodynamics and thermodynamics. The kinematical quantities (rate of expansion, shear, etc, of a timelike congruence) are introduced

  6. A CDO option market model on standardized CDS index tranches

    DEFF Research Database (Denmark)

    Dorn, Jochen

    We provide a market model which implies a dynamic for standardized CDS index tranche spreads. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling emerging options on struc- tured credit derivatives. With the upcoming regulation of the CDS market...... in perspective, the model presented here is also an attempt to face the e ects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke tenors/tranche subordination to market data obtained by more liquid Index Tranche Options...

  7. Analysis of the customers' choice networks: an application on Amazon books and CDs data:

    OpenAIRE

    Batagelj, Vladimir; Kejžar, Nataša; Korenjak-Černe, Simona

    2007-01-01

    Customer's choice implies some kind of relations among products. Customers' choices of products induce a network among them. Analyses of such networks can offer interesting information for marketing. In the paper some network analysis approaches are proposed to analyze such data. Two large networks obtained in 2004 from Amazon Internet bookstore and CD-store are used to illustrate these approaches. All analyses were done with program Pajek.

  8. The Economics of Books

    NARCIS (Netherlands)

    Canoy, M.F.M.; van Ours, J.C.; van der Ploeg, F.

    2005-01-01

    The tensions between books and book markets as expressions of culture and books as products in profit-making businesses are analysed and insights from the theory of industrial organisation are given.Governments intervene in the market for books through laws concerning prices of books, grants for

  9. Best Books of 1977

    Science.gov (United States)

    Gerhardt, Lillian N.; And Others

    1977-01-01

    School Library Journal book review editors have selected and annotated their choices for the best children's and young adults' books from those books that were submitted for review during 1977 by general book trade book publishers. Included in the annotations are: author, title, publisher, price, and recommended reading and interest levels. (JPF)

  10. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2010-09-01

    upland Southeast Asia. (Guido Sprenger Guido Sprenger, Die Männer, die den Geldbaum fällten; Konzepte von Austausch und Gesellschaft bei den Rmeet von Takheung, Laos. (Oliver Tappe Review Essay Two books on East Timor. Carolyn Hughes, Dependent communities; Aid and politics in Cambodia and East Timor. David Mearns (ed., Democratic governance in Timor-Leste; Reconciling the local and the national. (Helene van Klinken Review Essay Two books on Islamic terror Zachary Abuza, Political Islam and violence in Indonesia. Noorhaidi Hasan, Laskar jihad; Islam, militancy, and the quest for identity in post-New Order Indonesia. (Gerry van Klinken Korte Signaleringen Janneke van Dijk, Jaap de Jonge en Nico de Klerk, J.C. Lamster, een vroege filmer in Nederlands-Indië. Griselda Molemans en Armando Ello, Zwarte huid, oranje hart; Afrikaanse KNIL-nazaten in de diaspora. Reisgids Indonesië; Oorlogsplekken 1942-1949. Hilde Janssen, Schaamte en onschuld; Het verdrongen oorlogsverleden van troostmeisjes in Indonesië. Jan Banning, Comfort women/Troostmeisjes. (Harry Poeze

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Adrianus Koster

    1981-01-01

    Full Text Available - H.J.M. Claessen, David Lewis, From Maui to Cook: The discovery and settlement of the Pacific, Drawings by Walter Stackpool. Sydney: Doubleday, 1977. Bibliography. - P. van Emst, Carl Lumholtz, Among Cannibals. An account of four years travel in Australia and of camp life with the aborigines of Queensland. Firle: Caliban Books. 383 pp. Maps, illustrations and index. Reprinted from the first edition, London: John Murray. - D.C. Geirnaert-Martin, Robert Wessing, Cosmology and social behaviour in a West Javanese settlement, Papers in International Studies, Southeast Asia Series no. 47, Ohio University Center for International Studies, Southeast Asia Program, 1978, Athens, Ohio. - B.G. Grijpstra, William Wood, Cultural-ecological perspectives in Southeast Asia, edited and with an introduction by William Wood, Papers in International Studies, Southeast Asia Studies no. 41, Ohio University Center for International Studies, Southeast Asia Program, 1977, Athens, Ohio. - R. Hagesteijn, M. Jacq-Hergoualc’h, L’armement et l’organisation de l’armée khmère aux XIIe et XIIIe siècles; d’après les bas-reliefs d’Angkor Vat, du Bayon et de Bantay Chmar. Paris: Presses Universitaires de France. - C.K. Jonker-de Putter, John Ingleson, Road to exile; The Indonesian nationalist movement, 1927-1934. ASAA Southeast Asia Publications Series, No. 1. Heinemann Educational Books (Asia Ltd., Singapore, 1979. xii + 254 blz. Bibliographie, index. - P.E. de Josselin de Jong, Roland Werner, Jah-het of Malaysia: art and culture, 1975. Kuala Lumpur: Penerbit Universiti Malaya. xxxv, 626 pp., 39 figs., 2 maps, 746 plates. - P.E. de Josselin de Jong, Roland Werner, Mah-Meri of Malaysia: Art and culture, 1974. Kuala Lumpur: Penerbit Universiti Malaya. xxvi, 485 pp., 13 figs., 3 maps, 460 plates. - Simon Kooijman, Peter Gathercole, The art of the Pacific Islands. National Gallery of Art, Washington, 1979, 365 pp., 386 illustrations + 6 sketch-maps., Adrienne L

  12. The CDS and the Government Bonds Markets During the Last Financial Crisis

    Directory of Open Access Journals (Sweden)

    Križanič France

    2015-11-01

    Full Text Available Financial market had developed a special instrument to insure the buyers of bonds. This instrument is so called Credit Default Swap (CDS. The CDS price is a kind of insurance premium that the buyer of CDS pays to the seller of CDS in exchange for compensation of possible loss in operation. Paper analyses causality between CDS price and dynamics of bond yields and influence of macroeconomic factors on it in four selected countries during the last financial crisis. Analysis results show that there is no important macroeconomic variable included in the analysis that preceded the CDS prices connected with German government bonds. Sellers of CDS were apparently aware of the systemic nature of the financial crisis in the euro area. In the case of the United Kingdom, Russia and Slovenia we can observe the unemployment rate as the most important macroeconomic variable that preceded the CDS prices for government bonds.

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Noorduyn

    1982-10-01

    Full Text Available - C. van Dijk, M.C. Ricklefs, A history of modern Indonesia. C. 1300 to the present, London and Basingstoke, The MacMillan Press Ltd., 1981. xii + 335 pp. MacMillan Asian Histories Series. - L.A. Hoedemaker, S.C. Graaf van Randwijck, Handelen en denken in dienst der zending (Oestgeest 1897-1942, 2 delen, Den Haag Boekencentrum, 1981. - G.J. Knaap, Hubert Jacobs SJ, Documenta Malucensia II (1577-1606, annotated by Hubert Jacobs SJ, Monumenta Missionum Societatis Iesu volumen XXXIX, Missiones Orientalis, Rome, Jesuit Historical Institute; 1980, XXXI + 65* + 794 blz. - David S. Moyer, H. Sutherland, The making of a bureaucratic elite; The colonial transformation of the Javanese Priyayi, Asian studies association of Australia, Southeast Asia publication series no. 2, Heinemann educational books (Asia, Singapore, Kuala Lumpur, Hong Kong, 1979, xx + 182 pp. - S.A. Niessen, Garrett Solyom, The world of the Javanese Keris, 1978, East-West Centre, Honolulu, Hawaii., Bronwen Solyom (eds. - S.A. Niessen, Anne Leonard, Patterns of Paradise; The styles and significance of bark cloth around the world, 1980, Field museum of natural history., John Terrell (eds. - S.A. Niessen, Kirk Endicott, Batek Negrito Religion, 1979, Oxford Clarendon Press. - J. Noorduyn, Olivier Carré, L’Islam et l’état dans le monde d’aujourd’hui, Paris, Presses Universitaires de France, 1982. 270 p. - H.A. Poeze, Joop Morriën, Indonesië los van Holland. De CPN en de PKI in hun strijd tegen het Nederlands kolonialisme, Pegasus Amsterdam, 1982, 272 pp.

  14. Book Reviews

    Directory of Open Access Journals (Sweden)

    J.G. Oosten

    1980-10-01

    Full Text Available - M.A. van Bakel, Frederic L. Pryor, The origins of the economy. A comparative study of distribution in primitive and peasant economies. Academic Press, New York 1977. XVIII + 475 blz. - H.J. de Graaf, W. Ph. Coolhaas, Generale missiven van Gouverneurs-Generaal en Raden aan heren XVII der Verenigde Oost-Indische Compagnie. Deel VII. 1713-1725. ‘s-Gravenhage 1979. Rijks geschiedkundige publicatiën. Grote Serie 164. - F.G.P. Jaquet, P. Sutikno, J. Bastin, Nineteenth century prints and illustrated books of Indonesia; with particular reference to the print collection of the Tropenmuseum, Amsterdam; a descriptive bibliography. Utrecht etc., Het Spectrum, 1979. XIV, 386 pp. Ills., B. Brommer (eds. - S. Kooijman, Adrienne L. Kaeppler, “Artificial curiosities” being an exposition of native manufactures collected on the three Pacific voyages of Captain James Cook, R.N. at the Bernice Pauahi Bishop Museum January 18, 1978 - August 31, 1978 on the occasion of the Bicentennial of the European discovery of the Hawaiian islands by Captain Cook - January 18, 1778. Bernice P. Bishop Museum special publication 65, Honolulu, Hawaii, 1978. - J.G. Oosten, Marcel Mauss, Seasonal variations of the Eskimo. A study in social morphology. Marcel Mauss in collaboration with Henri Beuchat. Translated, with a foreword by James J. Fox. Routledge & Kegan Paul, London, Boston and Henley 1979. - Jérôme Rousseau, W.F. Schneeberger, Contributions to the ethnology of central Northeast Borneo (parts of Kalimantan, Sarawak and Sabah. The University of Berne, Institute of Ethnology, Berne 1979. Series: Studia ethnologica Bernensia, no. 2. 143 pages. Maps, figures, plates.

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Yu. V. Maretin

    1975-01-01

    Full Text Available - J. Prins, Buiten de grenzen, sociologische opstellen aangeboden aan Prof. Dr. W.F. Wertheim, benevens een “bibliografie van de geschriften van W.F. Wertheim”. Boom, Meppel 1971. 365 blz. - H.C.G. Schoenaker, Ethnologische Zeitschrift Zuerich I, 1972. Festschrift Alfred Steinmann. Verlag Herbert Lang & Cie A.G., Bern. 397 pp. - J.C. Neuteboom, Harald Eidheim, Aspects of the Lappish minority situation. Universitetsforlaget, Oslo 1971. 86 pags. Fig. - H.J.M. Claessen, Paul Ottino, Rangiroa; parenté étendue, résidence et terres dans un atoll ploynésien. Editions Cujas. Paris 1972. 530 p. Bibl., appendices, 37 fig. en kaarten, registers. - David S. Moyer, Adelin Linton, Ralph Linton. Leaders of Modern Anthropological Series, American University Publishers Group. London 1971, pp. 196., C. Wagley (eds. - R.A.M. van Zantwijk, Carlo J.E. Gay, Chalcacingo. Drawings by Frances Pratt. Akademische Druck- und Verlagsanstalt. Graz 1971. 119 blz., geïll., XXIV fotopag. - P. van Emst, Yu. V. Maretin, Countries and peoples of the East. Vol. XIII, Countries and peoples of the Pacific Basin. Book 2. Nauka Publishing House. Central Department of Oriental Literature. Moscow 1972. (Strany i narody vostoka. Pod obscej redakciej D.A. Ol’derogge. Vypusk XIII. Strany i narody bassejna Tichogo Okeana. Kniga 2. - H. van Mierlo, Atlantische Commissie, De school en het buitenlands beleid IX. De internationale politieke vormingstaak van de school. Atlantische Commissie, Den Haag 1970, 56 blz. - Geert A. Banck, Philip Staniford, Pioneers in the tropics. The political organization of Japanese in an immigrant community in Brazil. London School of Economics Monographs on Social Anthropology no. 45. London; The Athlone Press. 1973. xvi + 201 pag.

  16. Book Review:

    Science.gov (United States)

    Parthasarathy, R.

    2005-06-01

    This book gives a clear exposition of quantum field theory at the graduate level and the contents could be covered in a two semester course or, with some effort, in a one semester course. The book is well organized, and subtle issues are clearly explained. The margin notes are very useful, and the problems given at the end of each chapter are relevant and help the student gain an insight into the subject. The solutions to these problems are given in chapter 12. Care is taken to keep the numerical factors and notation very clear. Chapter 1 gives a clear overview and typical scales in high energy physics. Chapter 2 presents an excellent account of the Lorentz group and its representation. The decomposition of Lorentz tensors under SO(3) and the subsequent spinorial representations are introduced with clarity. After giving the field representation for scalar, Weyl, Dirac, Majorana and vector fields, the Poincaré group is introduced. Representations of 1-particle states using m2 and the Pauli Lubanski vector, although standard, are treated lucidly. Classical field theory is introduced in chapter 3 and a careful treatment of the Noether theorem and the energy momentum tensor are given. After covering real and complex scalar fields, the author impressively introduces the Dirac spinor via the Weyl spinor; Abelian gauge theory is also introduced. Chapter 4 contains the essentials of free field quantization of real and complex scalar fields, Dirac fields and massless Weyl fields. After a brief discussion of the CPT theorem, the quantization of electromagnetic field is carried out both in radiation gauge and Lorentz gauge. The presentation of the Gupta Bleuler method is particularly impressive; the margin notes on pages 85, 100 and 101 invaluable. Chapter 5 considers the essentials of perturbation theory. The derivation of the LSZ reduction formula for scalar field theory is clearly expressed. Feynman rules are obtained for the λphi4 theory in detail and those of QED

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    Full Text Available -Selwyn R. Cudjoe, John Thieme, The web of tradition: uses of allusion in V.S. Naipaul's fiction, -A. James Arnold, Josaphat B. Kubayanda, The poet's Africa: Africanness in the poetry of Nicolás Guillèn and Aimé Césaire. Westport CT: Greenwood, 1990. xiv + 176 pp. -Peter Mason, Robin F.A. Fabel, Shipwreck and adventures of Monsieur Pierre Viaud, translated by Robin F.A. Fabel. Pensacola: University of West Florida Press, 1990. viii + 141 pp. -Alma H. Young, Robert B. Potter, Urbanization, planning and development in the Caribbean, London: Mansell Publishing, 1989. vi + 327 pp. -Hymie Rubinstein, Raymond T. Smith, Kinship and class in the West Indies: a genealogical study of Jamaica and Guyana, Cambridge: Cambridge University Press, 1988. xiv + 205 pp. -Shepard Krech III, Richard Price, Alabi's world, Baltimore and London: Johns Hopkins University Press, 1990. xx + 445 pp. -Graham Hodges, Sandra T. Barnes, Africa's Ogun: Old world and new, Bloomington & Indianapolis: Indiana University Press, 1989. xi + 274 pp. -Pamela Wright, Philippe I. Bourgois, Ethnicity at work: divided labor on a Central American banana plantation, Baltimore MD: John Hopkins University Press, 1989. xviii + 311 pp. -Idsa E. Alegría-Ortega, Andrés Serbin, El Caribe zona de paz? geopolítica, integración, y seguridad, Caracas: Editorial Nueva Sociedad, 1989. 188 pp. (Paper n.p. [Editor's note. This book is also available in English: Caribbean geopolitics: towards security through peace? Boulder CO: Lynne Rienner, 1990. -Gary R. Mormino, C. Neale Ronning, José Martí and the émigré colony in Key West: leadership and state formation, New York; Praeger, 1990. 175 pp. -Gary R. Mormino, Gerald E. Poyo, 'With all, and for the good of all': the emergence of popular nationalism in the Cuban communities of the United States, 1848-1898, Durham NC: Duke University Press, 1989. xvii + 182 pp. -Fernando Picó, Raul Gomez Treto, The church and socialism in Cuba, translated from

  18. Book reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-07-01

    W. Collinwood ,Modern Bahamian society. Parkersburg IA: Caribbean Books, 1989. 278 pp., Steve Dodge (eds -Peter Hulme, Pierrette Frickey, Critical perspectives on Jean Rhys. Washington DC: Three Continents Press, 1990. 235 pp. -Alvina Ruprecht, Lloyd W. Brown, El Dorado and Paradise: Canada and the Caribbean in Austin Clarke's fiction. Parkersburg IA: Caribbean Books, 1989. xv + 207 pp. -Ineke Phaf, Michiel van Kempen, De Surinaamse literatuur 1970-1985: een documentatie. Paramaribo: Uitgeverij de Volksboekwinkel, 1987. 406 pp. -Genevieve Escure, Barbara Lalla ,Language in exile: three hundred years of Jamaican Creole. Tuscaloosa AL: University of Alabama Press, 1990. xvii + 253 pp., Jean D'Costa (eds -Charles V. Carnegie, G. Llewellyn Watson, Jamaican sayings: with notes on folklore, aesthetics, and social control.Tallahassee FL: Florida A & M University Press, 1991. xvi + 292 pp. -Donald R. Hill, Kaiso, calypso music. David Rudder in conversation with John La Rose. London: New Beacon Books, 1990. 33 pp. -Mark Sebba, John Victor Singler, Pidgin and creole tense-mood-aspect systems. Amsterdam and Philadelphia: John Benjamins, 1990. xvi + 240 pp. -Dale Tomich, Pedro San Miguel, El mundo que creó el azúcar: las haciendas en Vega Baja, 1800-873. Río Piedras, Puerto Rico: Ediciones Huracán, 1989. 224 pp. -César J. Ayala, Juan José Baldrich, Sembraron la no siembra: los cosecheros de tabaco puertorriqueños frente a las corporaciones tabacaleras, 1920-1934. Río Piedras, Puerto Rico: Ediciones Huracán, 1988. -Robert Forster, Jean-Michel Deveau, La traite rochelaise. Paris: Kathala, 1990. 334 pp. -Ernst van den Boogaart, Johannes Menne Postma, The Dutch in the Atlantic slave trade, 1600-1815. Cambridge: Cambridge University Press, 1990. xiv + 428 pp. -W.E. Renkema, T. van der Lee, Plantages op Curacao en hun eigenaren (1708-1845: namen en data voornamelijk ontleend aan transportakten. Leiden, the Netherlands: Grafaria, 1989. xii + 87 pp. -Mavis C. Campbell, Wim

  19. Book Review:

    Science.gov (United States)

    Fulling, S. A.

    2006-05-01

    saying that gravity was not only an honourable member of the forces of nature, but ultimately the source of them all. It has become a cliche that the unification of relativity with quantum theory is the central problem of contemporary physics. In the 1950s, before strings, non-Abelian monopoles, or even quasars, Bryce DeWitt was applying the quantum-field-theoretical methods and conceptual framework of his mentor, Julian Schwinger, to gravity. His central insight was that the conceptual and technical problems of quantum gravity were closely analogous to those of gauge theories. He developed a unified, relentlessly abstract, and highly personal vision of the fundamentals of physical theory. It was, and is, expressed in idiosyncratic and condensed notation often different from the languages of mainstream field theorists, traditional relativists, and mathematicians alike. In short, he has never been easy reading. His ideas were systematically presented in famous lecture series at the Les Houches summer schools on Relativity, Groups and Topology in 1963 [1] and 1983 [2], the book Supermanifolds [3], and a number of (relatively) shorter expositions that have been widely read. By the middle 1970s the methods that he had developed mainly for gravity were widely recognized as very useful for Yang Mills gauge theories, and his work had become part of the mainstream. Now, another 20 years after the second Les Houches, we have this final testament of Bryce DeWitt's ideas. At over 1000 pages in two volumes in a fabric-covered slipcase, it is the sort of work usually described as 'magisterial' (meaning, perhaps, 'no one has yet succeeded in reading it all the way through'). Over the years, of course, DeWitt learned many new things and thought of ways to say the old things better. Accordingly, the new books consist of reworkings of the most important parts of the older writings together with some new material. Oxford University Press is to be thanked and congratulated for the care it

  20. The role of psychological flexibility in a self-help acceptance and commitment therapy intervention for psychological distress in a randomized controlled trial.

    Science.gov (United States)

    Fledderus, Martine; Bohlmeijer, Ernst T; Fox, Jean-Paul; Schreurs, Karlein M G; Spinhoven, Philip

    2013-03-01

    This study examined the role of psychological flexibility, as a risk factor and as a process of change, in a self-help Acceptance and Commitment Therapy (ACT) intervention for adults with mild to moderate depression and anxiety. Participants were randomized to the self-help programme with e-mail support (n=250), or to a waiting list control group (n=126). All participants completed measures before and after the intervention to assess depression, anxiety and psychological flexibility. Participants in the experimental condition also completed these measures during the intervention (after three and six weeks) and at a three-month follow-up. With multilevel modelling, it was shown that the effects of the intervention on psychological distress were stronger for participants with higher levels of psychological flexibility. Furthermore, our study showed that improved psychological flexibility mediated the effects of the ACT intervention. With a cross-lagged panel design, it was shown that especially improvements in psychological flexibility in the last three sessions of the intervention were important for further reductions in anxiety. To conclude, our study showed the importance of targeting psychological flexibility during an ACT intervention for a reduction in depressive and anxiety symptoms. Copyright © 2012 Elsevier Ltd. All rights reserved.

  1. Book Reviews

    Directory of Open Access Journals (Sweden)

    Ger P. Reesink

    1995-07-01

    Full Text Available - Rogier Busser, Peter Post, Japanse bedrijvigheid in Indonesië, 1868-1942; Structurele elementen van Japan’s vooroorlogse economische expansie in Zuidoost Azië. Proefschrift Vrije Universiteit, Amsterdam, 1991, xviii + 374 pp. - H.J.M. Claessen, Arne Aleksej Perminow, The long way home; Dilemmas of everyday life in a Tongan village. Oslo: Scandinavian University Press, 1993, 166 pp. - Aone van Engelenhoven, René van den Berg, Studies in Sulawesi linguistics III. Jakarta: Badan Penyelenggara Seri Nusa, Universitas Katolik Indonesia Atma Jaya, 1994, xii + 116 pp. [NUSA, Linguistic Studies of Indonesian and Other Languages in Indonesia 36.] - Will Derks, Wolfgang Marschall, Texts from the Islands; Oral and written traditions of Indonesia and the Malay world, (Procedings of the 7th European Colloquium on Indonesia and Malay Studies, Berne, June 1989 1994, iii + 411 pp. [Ethnologica Bernensia 4]. - Michael Kaden, Krishna Sen, Indonesian Cinema; Framing the New Order, London: Zed Books, 1994, x + 188 pp. - Nico Kaptein, Mona Abaza, Indonesian Students in Cairo; Islamic education perceptions and exchanges, Paris: Association Archipel, 1994, 198 pp. [Cahier d’Archipel 23.] - P. Keppy, Chris Manning, Indonesia assessment 1993; Labour: Sharing in the benefits of growth? Canberra: Australian National University, 1993, xxi + 326 pp., Joan Hardjono (eds. - Anke Niehof, Jan-Paul Dirkse, Development and social welfare; Indonesia’s experiences under the New Order, Leiden: KITLV Press, 1993, xi + 295 pp., Frans Hüsken, Mario Rutten (eds. - Hetty Nooy-Palm, Michale C. Howard, Textiles of Southeast Asia; An annotated and illustrated bibliography. Bangkok: White Lotus, 1994, 212 pp. + 64 pp. pf photographs in colour. - Harry A. Poeze, Hans van Miert, Een koel hoofd en een warm hart; Nationalisme, Javanisme en jeugdbeweging in Nederlands-Indië, 1918-1930. Amsterdam: De Bataafsche Leeuw, 1995, 424 pp. - Ger P. Reesink, Jürg Wassmann, Historical atlas of

  2. The use of CDS/ISIS software in Africa | Abboy | Innovation

    African Journals Online (AJOL)

    CDS/ISIS is free-of-charge software that has been developed by UNESCO and is distributed through a network of country distributors and more recently through the World Wide Web. CDS/ISIS is ideally suited for the manipulation of bibliographic data. Literature sources reveal that the use of CDS/ISIS is widespread in Africa ...

  3. Dielectric properties of CdS nanoparticles synthesized by soft ...

    Indian Academy of Sciences (India)

    If the field applied to the condenser is time-dependent (as in an alternating current), so ... tematically the dielectric properties of CdS synthesized by a soft chemical method .... The real parts of conductivity spectra can be explained by the power ...

  4. Luminescence in Mn-doped CdS nanocrystals

    Indian Academy of Sciences (India)

    Wintec

    and the Mn d levels occur at two different energies, allowed us to study the PL lifetime decay behaviour of both kinds of .... seen from the XRD analysis, the size of the nanocrystals .... levels couple to the CdS electronic states and the excited.

  5. The Learning Management System Evolution. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service (CDS) to better understand how higher education institutions approach learning management systems (LMSs). Information provided for this Spotlight was derived from Module 8 of the Core Data Service, which contains several questions regarding information systems and applications.…

  6. CdS films deposited by chemical bath under rotation

    International Nuclear Information System (INIS)

    Oliva-Aviles, A.I.; Patino, R.; Oliva, A.I.

    2010-01-01

    Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl 2 , KOH, NH 4 NO 3 and CS(NH 2 ) 2 as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

  7. CdS films deposited by chemical bath under rotation

    Energy Technology Data Exchange (ETDEWEB)

    Oliva-Aviles, A.I., E-mail: aoliva@mda.cinvestav.mx [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico); Patino, R.; Oliva, A.I. [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico)

    2010-08-01

    Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl{sub 2}, KOH, NH{sub 4}NO{sub 3} and CS(NH{sub 2}){sub 2} as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

  8. Electroluminescent Cu-doped CdS quantum dots

    NARCIS (Netherlands)

    Stouwdam, J.W.; Janssen, R.A.J.

    2009-01-01

    Incorporating Cu-doped CdS quantum dots into a polymer host produces efficient light-emitting diodes. The Cu dopant creates a trap level that aligns with the valence band of the host, enabling the direct injection of holes into the quantum dots, which act as emitters. At low current densities, the

  9. Extraction of CdS pigment from waste polyethylene

    NARCIS (Netherlands)

    Wanrooij, P.H.P.; Agarwal, U.S.; Meuldijk, J.; Kasteren, van J.M.N.; Lemstra, P.J.

    2006-01-01

    Cadmium sulfide has often been used as a pigment in plastics such as high-density polyethylene (HDPE). Removal of CdS after the useful life of plastics is desired since it poses an environmental hazard in the waste phase of these plastics. In this study, a process is investigated to convert the

  10. Characterization of chemically synthesized CdS nanoparticles

    Indian Academy of Sciences (India)

    Similar to the effects of charge carriers on optical properties, confinement of optical and acoustic phonons leads to interesting changes in the phonon spectra. In the present work, we have synthesized nanoparticles of CdS using chemical precipitation technique. The crystal structure and grain size of the particles are studied ...

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2002-01-01

    Full Text Available -Stephen J. Appold, Heidi Dahles ,Tourism and small entrepreneurs; Development, national policy, and entrepreneurial culture: Indonesian cases. Elmsford, New York: Cognizant Communication Corporation, 1999, vi + 165 pp., Karin Bras (eds -Jean-Pascal Bassino, Peter Boothroyd ,Socioeconomic renovation in Vietnam; The origin, evolution and impact of Doi Moi. Singapore: Institute of Southeast Asian Studies, 2001, xv + 175 pp., Pham Xuan Nam (eds -Peter Boomgaard, Patrick Vinton Kirch, The wet and the dry; Irrigation and agricultural intensification in Polynesia. Chicago: The University of Chicago Press, 1994, xxii + 385 pp. -A.Th. Boone, Chr.G.F. de Jong, De Gereformeerde Zending in Midden-Java 1931-1975; Een bronnenpublicatie. Zoetermeer: Boekencentrum, 1997, xxiv + 890 pp. [Uitgaven van de Werkgroep voor de Geschiedenis van de Nederlandse Zending en Overzeese Kerken, Grote Reeks 6.] -Okke Braadbaart, Colin Barlow, Institutions and economic change in Southeast Asia; The context of development from the 1960s to the 1990s. Cheltenham: Edward Elgar, xi + 204 pp. -Freek Colombijn, Abidin Kusno, Behind the postcolonial; Architecture, urban space, and political cultures in Indonesia. London: Routledge, 2000, xiv + 250 pp. -Raymond Corbey, Michael O'Hanlon ,Hunting the gatherers; Ethnographic collectors, agents and agency in Melanesia, 1870s -1930s. Oxford: Bergahn Books, 2000, xviii + 286 pp. [Methodology and History in Anthropology 6.], Robert L. Welsch (eds -Olga Deshpande, Hans Penth, A brief histroy of Lan Na; Civilizations of North Thailand. Chiang Mai: Silkworm Books, 2000, v + 74 pp. -Aone van Engelenhoven, I Ketut Artawa, Ergativity and Balinese syntax. Jakarta: Badan Penyelenggaran Seri NUSA, Universitas Katolik Indonesia Atma Jaya, 1998, v + 169 pp (in 3 volumes. [NUSA Linguistic Studies of Indonesian and Other Languages in Indonesia 42, 43, 44.] -Rens Heringa, Jill Forshee, Between the folds; Stories of cloth, lives, and travels from Sumba

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-10-01

    : KITLV Press, 2002, viii + 246 pp. [Proceedings 5.], Nico Kaptein (eds -Anton Ploeg, William C. Clarke, Remembering Papua New Guinea; An eccentric ethnography. Canberra: Pandanus Books, Research School of Pacific and Asian Studies, Australian National University, 2003, 178 pp. -Nathan Porath, Gerco Kroes, Same hair, different hearts; Semai identity in a Malay context; An analysis of ideas and practices concerning health and illness. Leiden: Research School of Asian, African and Amerindian Studies (CNWS, Universiteit Leiden, 2002, 188 pp. -Guido Sprenger, Grant Evans, Laos; Culture and society. Chiang Mai: Silkworm Books, 1999, xi + 313 pp. -Gerard Termorshuizen, Dik van der Meulen, Multatuli; Leven en werk van Eduard Douwes Dekker. Nijmegen: SUN, 2002, 912 pp. -Paige West, Karl Benediktsson, Harvesting development; The construction of fresh food markets in Papua New Guinea. Copenhagen: Nordic Institute of Asian Studies/Ann Arbor: University of Michigan Press, 2002, xii + 308 pp. -Edwin Wieringa, Amirul Hadi, Islam and state in Sumatra; A study of seventeenth-century Aceh. Leiden: Brill, 2004, xiii + 273 pp. [Islamic History and Civilization, 48.] -Robin Wilson, Pamela J. Stewart ,Remaking the world; Myth, mining and ritual change among the Duna of Papua New Guinea. Washington: Smithsonian Institution Press, 2002, xvi + 219 pp. [Smithsonian Series in Ethnographic Enquiry.], Andrew Strathern (eds

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    Danker H. Schaareman

    1980-01-01

    Full Text Available - H.J.M. Claessen, Jan van Bremen, Symposion. Tijdschrift voor Maatschappijwetenschap. Onder redactie van Jan van Bremen, Cees Cruson, Helle Snel, Jojada Verrips, Willem Wolters en Ton Zwaan. Uitgave: Stichting voor Maatschappijwetenschappelijk Onderzoek., Cees Cruson, Helle Snel (eds. - H.J.M. Claessen, Neil Lifuka, Logs in the current of the sea. Neil Lifuka’s story of Kioa and the Vaitupu colonists. Edited and introduced by Klaus-Friedrich Koch. With a foreword by Professor H.E. Maude. Cambridge, Mass.: Langdon Associates Press. 1978. - H.J.M. Claessen, R.R. Nayacakalou, Leadership in Fiji. 1975. Melbourne etc.: Oxford University Press. 170 pp. Appendices, tables, notes. - H.J.M. Claessen, Michael W. Young, The ethnography of Malinowski; The Trobriand Islands 1915-1918. London: Routledge and Kegan Paul, 1979. Bibliography, Index, illustrations. - P.E. de Josselin de Jong, G.B. Milner, Natural symbols in South East Asia. School of Oriental and African Studies, London 1978. 181 p., 13 plates. - P. Kloos, G.N. Appell, Ethical dilemmas in anthropological inquiry: A case book, Waltham (Mass., Crossroads Press, 1978, xii + 291 pp. - David S. Moyer, M.B. Hooker, A concise legal history of South-East Asia. Oxford: Clarendon Press, 1978. 289 pp. - J.G. Oosten, Henri J.M. Claessen, The early state. Mouton Publishers. The Hague, The Netherlands 1978. XII + 690 pages., P. Skalník (eds. - J.G. Oosten, Jean Poirier, Ethnologie Régionale 2. Asie-Amérique-Mascareignes. Sous la direction de Jean Poirier. Encyclopédie de la Pleiade. Gallimard, Paris 1978. - J.G. Oosten, A. de Ruyter, Een speurtocht naar het denken. Een inleiding tot het structuralisme van Claude Lévi Strauss. Van Gorcum & Comp. N.V., Assen 1979. Serie: Terreinverkenningen in de Culturele Anthropologie, nr. 16. - Anton Ploeg, Raymond C. Kelly, Etoro Social Structure. A study in structural contradiction. Foreword by Marshall Sahlins. The University of Michigan Press. Ann Arbor, 1974, 1977

  14. Book Review:

    Science.gov (United States)

    Hudson, R. P.

    1981-04-01

    In July 1976, some thirty young scientists and their lecturers were privileged to participate in a conference on "Metrology and the Fundamental Constants" at Varenna, this being the 68th course in the "Enrico Fermi International School of Physics". Now, at last, we are all privileged to share in that experience—to a large degree—with the appearance of the Proceedings, published last summer under the auspices of the Italian Physical Society. This rather massive volume (800 pages) places in one's hands a summary of the "state of the art" in the greater part of physical metrology. It is not, however, a metrology handbook, designed to assist the unskilled in making trustworthy measurements. It summarizes, via the lectures of internationally-recognized experts, the most recent attempts to realize with enhanced accuracy the basic units of measurement and, in so doing, it presents the subject of measurement science as the central (or all-pervasive) topic in physics itself. Clearly demonstrated is the progress from discovery to "understanding" of physical phenomena which is made possible through the historical alternation of observation and measurement. The volume includes informative reviews of the fundamentals of this fundamental science, namely, the concepts of quantities and units (Allisy); systems of units and the Système International, SI. (Terrien); international aspects of metrology and standards (Terrien); practical considerations in a hierarchy of standards (Terrien); materials problems affecting metrology (Ferro Milone and Sourdo) and statistical methods (Allisy). These discussions alone, being brought together in one place, are of particular usefulness. The remaining, and major, part of the book is taken up by authoritative and generally very readable discussions of measurement topics, for the most part separately focused on one of the base units. For these one cannot help noticing nor refrain from recording a measure of imbalance: some quantities (for

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2005-01-01

    Full Text Available -Monika Arnez, Niels Mulder, Southeast Asian images; Towards civil society? Chiang Mai: Silkworm Books, 2003, ix + 253 pp. -Adriaan Bedner, Connie Carter, Eyes on the prize; Law and economic development in Singapore. The Hague: Kluwer Law International, xviii + 307 pp. [The London-Leiden series on law, administration and development 7.] -Amrit Gomperts, J.R. van Diessen ,Grote atlas van Nederlands Oost-Indië/Comprehensive atlas of the Netherlands East Indies. Zierikzee: Asia Maior, Utrecht: Koninklijk Nederlands Aardrijkskundig Genootschap (KNAG, 2004, 480 pp. (editors, with the collaboration of R.C.M. Braam, W. Leijnse, P.A. Levi, J.J. Reijnders, R.P.G.A. Voskuil and M.P.B. Ziellemans, F.J. Ormeling (eds -Stuart R. Harrop, Adriaan Bedner ,Towards integrated environmental law in Indonesia? Leiden: Research school CNWS, School of Asian, African and Amerindian studies, 2003, 161 pp. [CNWS publications 127.], Nicole Niessen (eds -David Henley, Paul H. Kratoska ,Locating Southeast Asia: Geographies of knowledge and politics of space. Singapore: Singapore University Press, 2005, xi + 326 pp., Remco Raben, Henk Schulte Nordholt (eds -Gerry van Klinken, Anthony J. Langlois, The politics of justice and human rights; Southeast Asia and universalist theory. Cambridge: Cambridge University Press, 2001, xi + 214 pp. [Cambridge Asia-Pacific studies.] -Koh Keng We, Jurrien van Goor, Prelude to colonialism; The Dutch in Asia. Hilversum: Verloren, 2004, 127 pp. -Lim Beng Soon, Thomas H. Slone, Prokem; An analysis of a Jakartan slang. Oakland: Masalai Press, 2003, 95 pp. -Lim Beng Soon, Neil Khor Jin Keong ,The Penang Po Leung Kuk; Chinese women, prostitution and a welfare organisation. Kuala Lumpur; The Malaysian branch of the Royal Asiatic society (MBRAS, 2004, VII + 181 pp., Khoo Keat Siew (eds -Dick van der Meij, J. Thomas Lindblad ,Macht en majesteit; Opstellen voor Cees Fasseur bij zijn afscheid als hoogleraar in de geschiedenis van Indonesië aan de

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    R.A. Römer

    1963-10-01

    Full Text Available - A.J.C. Lach de Bére, Fernand van Langenhove, Consciences Tribales et Nationales en Afrique Noire. Institut Royal des Relations Internationales, Bruxelles. Martinus Nijhoff, ‘s-Gravenhage, 1960; 444 blz. - J.H. Scherer, A.H.J. Prins, The Swahili-speaking peoples of Zanzibar and the E. African Coast (Arabs, Shirazi and Swahili. Ethnographic Survey of Africa: East Central Africa, part XII. Uitgave van het International African Institute, London, 1961. 143 pp., m. kaart. - P. Driessens, Carol Brubaker, Geesten van het woud. Servire Luxe Pockets nr. 66. Servire, Den Haag 1963. 175 pp., 24 foto’s. - Joh. J. Hanrath, Indonesian Economics. The concept of dualism in theory and policy. Den Haag (W. van Hoeve 1961. 443 pp. - W. Ph. Coolhaas, H.R.C. Wright, East-Indian economic problems of the age of Cornwallis and Raffles. Luzac, London, 1961; 271 pp. - H.J. de Graaf, M.A.P. Meilink-Roelofsz, Asian trade and European influence in the Indonesian Archipelago between 1500 and about 1630. Academisch Proefschrift Amsterdam (S.U.. M. Nijhoff, ‘s-Gravenhage 1962. 471 pp. - Logemann, Herbert Feith, The decline of constitutional democracy in Indonesia. Cornell University Press, Ithaca, New York, 1962. XX en 608 blz. - F.D.K. Bosch, G. Coedés, Les peuples de la péninsule indochinoise. 228 pp., 16 pl., 1 carte; Ed. Dunod, Paris, 1962. - L. Sluimers, Sirdar Ikbal Ali Shah, Viet-nam. London, Octagon Press, 1960. XV, 232 blz., krt. - L. Sluimers, J.G. Keyes, A bibliography of North Vietnamese Publications in the Cornell University Library. Ithaca, Cornell University, 1962. Data paper: Number 47. Southeast Asia Program. Department of Asian Studies. Cornell University. X, 116 blz., X. - A.F.P. Hulsewé, G.P. Oery, The Man-Shu (Book of the Southern Barbarians, translated by Gordon H. Luce, edited by G.P. Oery; Data Paper Nr. 44, Southeast Asia Program, Dept. of Far Eastern Studies, Cornell Univ., Ithaca, N.Y.; 1961. (X + 116 pp., 1 map. - C.H.M. Palm, Felix M

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-01-01

    Jeroen Kemperman. Leiden: KITLV Press, 2002, 570 pp. [Verhandelingen 206.] -Gerry van Klinken, Grayson Lloyd ,Indonesia today; Challenges of history. Singapore: Institute of Southeast Asian studies, 2001, 359 pp., Shannon Smith (eds -Johanna van Reenen, Frédéric Durand, Timor Lorosa'e, pays au carrefour de l'Asie et du Pacifique; Un atlas géo-historique. Marne-la-Vallée: Presses Universitaires de Marne-la-Vallée, 2002, 208 pp. -William R. Roff, Mona Abaza, Debates on Islam and knowledge in Malaysia and Egypt; Shifting worlds. London: RoutledgeCurzon, 2002, xix + 304 pp. -Mariëtte van Selm, Chr. van Fraassen ,G.E. Rumphius, De Ambonse eilanden onder de VOC, zoals opgetekend in 'De Ambonse landbeschrijving'. Utrecht: Landelijk Steunpunt Educatie Molukkers, 2002, 254 pp., H. Straver (eds -K. Thirumaran, Prema-Chandra Athukorala, Crisis and recovery in Malaysia; The role of capital controls. Cheltenham: Elgar, 2001, xii + 159 pp. -K. Thirumaran, John Hilley, Malaysia; Mahathirism, hegemony and the new opposition. London: Zed books, 2001, xiii + 305 pp. -Reina van der Wiel, Damien Kingsbury ,Foreign devils and other journalists. Clayton VIC: Monash Asia Institute, 2000, vi + 277 pp. [Monash papers on Southeast Asia 52.], Eric Loo, Patricia Payne (eds -Jennifer Fraser, Philip Yampolsky, Music of Indonesia. Washington DC: Smithsonian Folkways recordings, 1991-2000, 20 compact discs plus a CD of selections from the series, Discover Indonesia. All with accompanying booklets. -Robert Wessing, Nicola Tannenbaum ,Founders' cults in Southeast Asia; Ancestors, polity, and identity. New Haven CT: Yale University Southeast Asian studies, 2003, xi + 373 pp. [Yale Southeast Asia studies Monograph 52.], Cornelia Ann Kammerer (eds -Robert Wessing, Henri Chambert-Loir ,The potent dead; Ancestors, saints and heroes in contemporary Indonesia. Crows Nest, New South Wales: Allen and Unwin, Honolulu: University of Hawai'i Press, 2002, xxvi + 243 pp. [Southeast Asia publications series

  18. An internet-based self-help intervention for older adults after marital bereavement, separation or divorce: study protocol for a randomized controlled trial.

    Science.gov (United States)

    Brodbeck, Jeannette; Berger, Thomas; Znoj, Hans Joerg

    2017-01-13

    Marital bereavement and separation or divorce are among the most stressful critical life events in later life. These events require a dissolution of social and emotional ties, adjustments in daily routine and changes in identity and perspectives for the future. After a normative grief or distress reaction, most individuals cope well with the loss. However, some develop a prolonged grief reaction. Internet-based self-help interventions have proved beneficial for a broad range of disorders, including complicated grief. Based on the task model and the dual-process model of coping with bereavement, we developed a guided internet-based self-help intervention for individuals who experienced marital bereavement, separation or divorce at least 6 months prior to enrolment. The intervention consists of 10 text-based self-help sessions and one supportive email a week. The primary purpose of this study is the evaluation of the feasibility and efficacy of the intervention compared with a waiting control group. The secondary purpose is to compare the effects in bereaved and separated participants. Furthermore, we aim to analyze other predictors, moderators and mediators of the outcome, such as age, psychological distress and intensity of use of the intervention. The design is a randomized controlled trial with a waiting control condition of 12 weeks and a 24-weeks follow-up. At least 72 widowed or separated participants will be recruited via our study website and internet forums. Primary outcomes are reductions in grief symptoms, depression and psychological distress. Secondary outcome measures are related to loneliness, satisfaction with life, embitterment and the sessions. The trial will provide insights into the acceptance and efficacy of internet-based interventions among adults experiencing grief symptoms, psychological distress and adaptation problems in daily life after spousal bereavement, separation or divorce. Findings will add to existing knowledge by (1) evaluating

  19. The 6-month effectiveness of Internet-based guided self-help for depression in adults with Type 1 and 2 diabetes mellitus.

    Science.gov (United States)

    Ebert, D D; Nobis, S; Lehr, D; Baumeister, H; Riper, H; Auerbach, R P; Snoek, F; Cuijpers, P; Berking, M

    2017-01-01

    The aim of this research is to examine the 6-month effects of an Internet-based guided self-help intervention for comorbid depressive symptoms in people with diabetes. Participants (n = 260) with Type 1 or 2 diabetes and elevated depressive symptoms [Center for Epidemiological Studies Depression Scale (CES-D) ≥ 23] were randomly assigned to a guided Internet-based self-help intervention or a control condition (treatment as usual + online psychoeducation about depression). The primary outcome was a change in depressive symptom severity (CES-D) from baseline to 6-month follow-up. The secondary outcomes included numbers of people achieving treatment response (reliable change of depressive symptoms) and remission (CES-D ≤ 16), as well as the effects on glycaemic control, diabetes-related emotional distress and diabetes acceptance. Repeated measures analysis of variance examined between-group differences using intent-to-treat principles. Both conditions showed improvements in depression severity: intervention condition, d = 1.48 [95% confidence interval (95% CI): 1.21 to 1.76]; control condition d = 0.55 (95% CI: 0.30 to 0.80). Changes were significantly greater in the intervention condition with a large between-group effect size (d = 0.83, 95% CI: 0.57 to 1.08). Accordingly, effects on response [relative risk (RR) = 2.60 (95% CI: 2.01 to 3.36), P 1] and remission [RR = 3.36 (95% CI: 2.98 to 5.44), P 1] were in favour of the intervention group, as were differences in change in diabetes emotional distress (d = 0.50, 95% CI: 0.04 to 0.54), and physical and mental functioning [Short Form Health Survey (SF-12) Physical d = 0.27 (95% CI: 0.01 to 0.51) and SF-12 Mental d = 0.68 (95% CI: 0.11 to 0.40)]. The intervention group was not superior with regard to glycaemic control, diabetes self-management and diabetes acceptance. The trial indicates that Internet-based guided self-help treatments for depression in people with diabetes can have sustained effects on depressive

  20. Protocol for a feasibility study of a self-help cognitive behavioural therapy resource for the reduction of dental anxiety in young people.

    Science.gov (United States)

    Marshman, Zoe; Morgan, Annie; Porritt, Jenny; Gupta, Ekta; Baker, Sarah; Creswell, Cathy; Newton, Tim; Stevens, Katherine; Williams, Christopher; Prasad, Suneeta; Kirby, Jennifer; Rodd, Helen

    2016-01-01

    Childhood dental anxiety is very common, with 10-20 % of children and young people reporting high levels of dental anxiety. It is distressing and has a negative impact on the quality of life of young people and their parents as well as being associated with poor oral health. Affected individuals may develop a lifelong reliance on general anaesthetic or sedation for necessary dental treatment thus requiring the support of specialist dental services. Children and young people with dental anxiety therefore require additional clinical time and can be costly to treat in the long term. The reduction of dental anxiety through the use of effective psychological techniques is, therefore, of high importance. However, there is a lack of high-quality research investigating the impact of cognitive behavioural therapy (CBT) approaches when applied to young people's dental anxiety. The first part of the study will develop a profile of dentally anxious young people using a prospective questionnaire sent to a consecutive sample of 100 young people referred to the Paediatric Dentistry Department, Charles Clifford Dental Hospital, in Sheffield. The second part will involve interviewing a purposive sample of 15-20 dental team members on their perceptions of a CBT self-help resource for dental anxiety, their opinions on whether they might use such a resource with patients, and their willingness to recruit participants to a future randomised controlled trial (RCT) to evaluate the resource. The third part of the study will investigate the most appropriate outcome measures to include in a trial, the acceptability of the resource, and retention and completion rates of treatment with a sample of 60 dentally anxious young people using the CBT resource. This study will provide information on the profile of dentally anxious young people who could potentially be helped by a guided self-help CBT resource. It will gain the perceptions of dental care team members of guided self-help CBT for

  1. Internet-based self-help smoking cessation and alcohol moderation interventions for cancer survivors: a study protocol of two RCTs.

    Science.gov (United States)

    Mujcic, Ajla; Blankers, Matthijs; Boon, Brigitte; Engels, Rutger; van Laar, Margriet

    2018-04-02

    Brief interventions for smoking cessation and alcohol moderation may contribute considerably to the prevention of cancer among populations at risk, such as cancer survivors, in addition to improving their general wellbeing. There is accumulating evidence for the effectiveness of internet-based brief health behaviour interventions. The objective of this study is to assess the effectiveness, patient-level cost-effectiveness and cost-utility of two new online theory-based self-help interventions among adult cancer survivors in the Netherlands. One of the interventions focuses on alcohol moderation, the other on smoking cessation. Both interventions are tailored to cancer survivors. Effectiveness will be assessed in two separate, nearly identical 2-armed RCTs: alcohol moderation (AM RCT) and smoking cessation (SC RCT). Participants are randomly allocated to either the intervention groups or the control groups. In the intervention groups, participants have access to one of the newly developed interventions. In the control groups, participants receive an online static information brochure on alcohol (AM RCT) or smoking (SC RCT). Main study outcome parameters are the number of drinks post-randomisation (AM RCT) and tobacco abstinence (SC RCT). In addition, cost-data and possible effect moderators and mediators will be assessed. Both treatments are internet-based minimally guided self-help interventions: MyCourse - Moderate Drinking (in Dutch: MijnKoers - Minderen met Drinken) and MyCourse - Quit Smoking (MijnKoers - Stoppen met Roken). They are based on cognitive behaviour therapy (CBT), motivational interviewing (MI) and acceptance and commitment therapy (ACT). Both interventions are optimized in collaboration with the target population of cancer survivors in focus groups and interviews, and in collaboration with several experts on eHealth, smoking cessation, alcohol misuse and cancer survivorship. The present study will add to scientific knowledge on the (cost

  2. Guided graded exercise self-help plus specialist medical care versus specialist medical care alone for chronic fatigue syndrome (GETSET): a pragmatic randomised controlled trial.

    Science.gov (United States)

    Clark, Lucy V; Pesola, Francesca; Thomas, Janice M; Vergara-Williamson, Mario; Beynon, Michelle; White, Peter D

    2017-07-22

    Graded exercise therapy is an effective and safe treatment for chronic fatigue syndrome, but it is therapist intensive and availability is limited. We aimed to test the efficacy and safety of graded exercise delivered as guided self-help. In this pragmatic randomised controlled trial, we recruited adult patients (18 years and older) who met the UK National Institute for Health and Care Excellence criteria for chronic fatigue syndrome from two secondary-care clinics in the UK. Patients were randomly assigned to receive specialist medical care (SMC) alone (control group) or SMC with additional guided graded exercise self-help (GES). Block randomisation (randomly varying block sizes) was done at the level of the individual with a computer-generated sequence and was stratified by centre, depression score, and severity of physical disability. Patients and physiotherapists were necessarily unmasked from intervention assignment; the statistician was masked from intervention assignment. SMC was delivered by specialist doctors but was not standardised; GES consisted of a self-help booklet describing a six-step graded exercise programme that would take roughly 12 weeks to complete, and up to four guidance sessions with a physiotherapist over 8 weeks (maximum 90 min in total). Primary outcomes were fatigue (measured by the Chalder Fatigue Questionnaire) and physical function (assessed by the Short Form-36 physical function subscale); both were self-rated by patients at 12 weeks after randomisation and analysed in all randomised patients with outcome data at follow-up (ie, by modified intention to treat). We recorded adverse events, including serious adverse reactions to trial interventions. We used multiple linear regression analysis to compare SMC with GES, adjusting for baseline and stratification factors. This trial is registered at ISRCTN, number ISRCTN22975026. Between May 15, 2012, and Dec 24, 2014, we recruited 211 eligible patients, of whom 107 were assigned to the

  3. A Web-Disseminated Self-Help and Peer Support Program Could Fill Gaps in Mental Health Care: Lessons From a Consumer Survey

    Science.gov (United States)

    Banschback, Kaitlin; Santorelli, Gennarina D; Constantino, Michael J

    2017-01-01

    Background Self-guided mental health interventions that are disseminated via the Web have the potential to circumvent barriers to treatment and improve public mental health. However, self-guided interventions often fail to attract consumers and suffer from user nonadherence. Uptake of novel interventions could be improved by consulting consumers from the beginning of the development process in order to assess their interest and their preferences. Interventions can then be tailored using this feedback to optimize appeal. Objective The aim of our study was to determine the level of public interest in a new mental health intervention that incorporates elements of self-help and peer counseling and that is disseminated via a Web-based training course; to identify predictors of interest in the program; and to identify consumer preferences for features of Web-based courses and peer support programs. Methods We surveyed consumers via Amazon’s Mechanical Turk to estimate interest in the self-help and peer support program. We assessed associations between demographic and clinical characteristics and interest in the program, and we obtained feedback on desired features of the program. Results Overall, 63.9% (378/592) of respondents said that they would try the program; interest was lower but still substantial among those who were not willing or able to access traditional mental health services. Female gender, lower income, and openness to using psychotherapy were the most consistent predictors of interest in the program. The majority of respondents, although not all, preferred romantic partners or close friends as peer counselors and would be most likely to access the program if the training course were accessed on a stand-alone website. In general, respondents valued training in active listening skills. Conclusions In light of the apparent public interest in this program, Web-disseminated self-help and peer support interventions have enormous potential to fill gaps in

  4. Prevention of depression and anxiety in adolescents: A randomized controlled trial testing the efficacy and mechanisms of Internet-based self-help problem-solving therapy

    Directory of Open Access Journals (Sweden)

    Schuurmans Josien

    2009-10-01

    Full Text Available Abstract Background Even though depression and anxiety are highly prevalent in adolescence, youngsters are not inclined to seek help in regular healthcare. Therapy through the Internet, however, has been found to appeal strongly to young people. The main aim of the present study is to examine the efficacy of preventive Internet-based guided self-help problem-solving therapy with adolescents reporting depressive and anxiety symptoms. A secondary objective is to test potential mediating and moderating variables in order to gain insight into how the intervention works and for whom it works best. Methods/design This study is a randomized controlled trial with an intervention condition group and a wait-list control group. The intervention condition group receives Internet-based self-help problem-solving therapy. Support is provided by a professional and delivered through email. Participants in the wait-list control group receive the intervention four months later. The study population consists of adolescents (12-18-year-olds from the general population who report mild to moderate depressive and/or anxiety symptoms and are willing to complete a self-help course. Primary outcomes are symptoms of depression and anxiety. Secondary outcomes are quality of life, social anxiety, and cost-effectiveness. The following variables are examined for their moderating role: demographics, motivation, treatment credibility and expectancy, externalizing behaviour, perceived social support from parents and friends, substance use, the experience of important life events, physical activity, the quality of the therapeutic alliance, and satisfaction. Mediator variables include problem-solving skills, worrying, mastery, and self-esteem. Data are collected at baseline and at 3 weeks, 5 weeks, 4 months, 8 months, and 12 months after baseline. Both intention-to-treat and completer analyses will be conducted. Discussion This study evaluates the efficacy and mechanisms of

  5. Scientific Library’s Book and Media Swap Coming April 16 | Poster

    Science.gov (United States)

    By Robin Meckley, Contributing Writer The 14th annual Book and Media Swap will be held on Wednesday, April 16, from 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549. The staff is holding the swap to coincide with National Library Week, an annual celebration of libraries that occurs in April. As of April 10, the library had collected nearly 2,000 books, DVDs, and CDs for the swap. Employees who donated these items received book cards indicating the number of items donated. 

  6. Book Reviews

    Directory of Open Access Journals (Sweden)

    J. Bastin

    1982-04-01

    . - F.G.P. Jaquet, H.J. de Graaf, Wonderlijke verhalen uit de Indische historie, ‘s-Gravenhage, Moesson 1981. 173 pp. Ills. - F.G.P. Jaquet, J. Landwehr, De Nederlander uit en thuis; spiegel van het dagelijks leven uit bijzondere zeventiende-eeuwse boeken. Alphen aan den Rijn, Sijthoff, 1981. 200 pp. Ills. - P.E. de Josselin de Jong, Michael G. Peletz, Social history and evolution in the interrelationship of adat and Islam in Rembau, Negeri Sembilan, Research Notes and Discussions Paper no. 27, Institute of Southeast Asian Studies, Singapore 1981. 59 pages. - P.E. de Josselin de Jong, Anthony Reid, Perceptions of the past in Southeast Asia, Heinemann Educational Books for Asian Studies Asociation of Australia, Singapore 1979. 436 pp. Bibliographical Appendix, Index, 3 maps., David Marr (eds. - J.E. van Lohuizen-de Leeuw, J. Bastin, Prints of Southeast Asia in the India Office Library - The East India Company in Malaysia and Indonesia 1786-1824, Her Majesty’s Stationery Office, London, 1979, XIII + 228 pp. including 98 pls., frontispiece in colour., P. Rohatgi (eds. - Anke Niehof, Victor T. King, Essays on Borneo Society, Hull Monographs on South-East Asia 7, Oxford University Press, 1978, 256 pp. - C.H.M. Nooy-Palm, Renato Rosaldo, Ilongot headhunting 1883-1974, a study in society and history. Stanford University Press, Stanford, California, 1980. 313 pp., maps, photographs and diagrams. Chronological and general index. - Els Postel-Coster, Clio Presvelou, The household, women and agricultural development, Proceedings of a symposium organised by the Department of Home Economics, Agricultural University, Wageningen, Miscellaneous Papers 17, 1980, Landbouwhogeschool Wageningen, The Netherlands., Saskia Spijkers-Zwart (eds. - G.J. van Reenen, Claudine Salmon, Les Chinois de Jakarta; Temples et vie collective [The Chinese of Jakarta; Temples and communal life], Etudes insulindiennes - Archipel 1, Association Archipel, Paris, 1980 (deuxième impression, xxviii + 358 pp

  7. Book Reviews

    Directory of Open Access Journals (Sweden)

    Janet Rodenburg

    1992-04-01

    Full Text Available - Leonard Y. Andaya, H.A. Poeze, Excursies in Celebes; Een bundel bijdragen bij het afscheid van J. Noorduyn als directeur-secretaris van het Koninklijk Instituut voor Taal-, Land- en Volkenkunde. Leiden: KITLV Uitgeverij, 1991, 348 pp., P. Schoorl (eds. - Anne Booth, Adrian Clemens, Changing economy in Indonesia Volume 12b; Regional patterns in foreign trade 1911-40. Amsterdam: Royal Tropical Institute, 1992., J.Thomas Lindblad, Jeroen Touwen (eds. - A.P. Borsboom, James F. Weiner, The empty place; Poetry space, and being among the Foi of Papua New Guinea. Bloomington: Indiana University Press, 1991. - Martin van Bruinessen, Ozay Mehmet, Islamic identity and development; Studies of the Islamic periphery. London and New York: Routledge, 1990 (cheap paperback edition: Kula Lumpur: Forum, 1990, 259 pp. - H.J.M. Claessen, Timothy Earle, Chiefdoms: power, economy, and ideology. A school of American research book. Cambridge: Cambridge University Press, 1991. 341 pp., bibliography, maps, figs. - H.J.M. Claessen, Henk Schulte Nordholt, State, village, and ritual in Bali; A historical perspective. (Comparitive Asian studies 7. Amsterdam: VU University press for the centre for Asian studies Amsterdam, 1991. 50 pp. - B. Dahm, Ruby R. Paredes, Philippine colonial democracy. (Monograph series 32/Yale University Southeast Asia studies. New Haven: Yale Center for international and Asia studies, 1988, 166 pp. - Eve Danziger, Bambi B. Schieffelin, The give and take of everyday life; Language socialization of Kaluli children. (Studies in the social and cultural foundations of language 9. Cambridge: Cambridge University Press, 1991. - Roy Ellen, David Hicks, Kinship and religion in Eastern Indonesia. (Gothenburg studies in social anthropology 12. Gothenburg: Acta Universitatis Gothoburgensis, 1990, viii 132 pp., maps, figs, tbls. - Paul van der Grijp, Pierre Lemonnier, Guerres et festins; Paix, échanges et competition dans les highlands de Nouvelle

  8. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-01-01

    Full Text Available -Louis Allaire, Samuel M. Wilson, Hispaniola: Caribbean chiefdoms in the age of Columbus. Tuscaloosa: University of Alabama Press, 1990. xi + 170 pp. -Douglas Melvin Haynes, Philip D. Curtin, Death by migration: Europe's encounter with the tropical world in the nineteenth century. Cambridge: Cambridge University Press, 1989. xviii + 251 pp. -Dale Tomich, J.H. Galloway, The sugar cane industry: An historical geography from its origins to 1914. Cambridge: Cambridge University Press, 1989. xii + 266 pp. -Myriam Cottias, Dale Tomich, Slavery in the circuit of sugar: Martinique and the world economy, 1830 -1848. Baltimore: John Hopkins University Press, 1990. xiv + 352 pp. -Robert Forster, Pierre Dessalles, La vie d'un colon à la Martinique au XIXe siècle. Pré-senté par Henri de Frémont. Courbevoie: s.n., 1984-1988, four volumes, 1310 pp. -Hilary Beckles, Douglas V. Armstrong, The old village and the great house: An archaeological and historical examination of Drax Hall Plantation, St Ann's Bay, Jamaica. Chicago: University of Illinois Press, 1990. xiii + 393 pp. -John Stewart, John A. Lent, Caribbean popular culture. Bowling Green OH: Bowling Green State University Popular Press, 1990. 157 pp. -W. Marvin Will, Susanne Jonas ,Democracy in Latin America: Visions and realities. New York: Bergin & Garvey Publishers, 1990. viii + 224 pp., Nancy Stein (eds -Forrest D. Colburn, Kathy McAfee, Storm signals: Structural adjustment and development alternatives in the Caribbean. London: Zed books, 1991. xii + 259 pp. -Derwin S. Munroe, Peggy Antrobus ,In the shadows of the sun: Caribbean development alternatives and U.S. policy. Carmen Diana Deere (coordinator, Peter Phillips, Marcia Rivera & Helen Safa. Boulder CO: Westview Press, 1990. xvii + 246 pp., Lynne Bolles, Edwin Melendez (eds -William Roseberry, Louis A. Pérez, Jr., Lords of the mountain: Social banditry and peasant protest in Cuba, 1878-1918. Pittsburgh: University of Pittsburgh Press, 1989

  9. Book Review:

    Science.gov (United States)

    Swenson, C. A.

    1984-01-01

    whole, although the discussions may be too detailed for the casual reader (who need read only the introduction and conclusions) and yet without sufficient detail for the person who requires a basic understanding (who then will consult the citations). Although he cannot anticipate the recommendations of the CCT for a new international temperature scale, the clues certainly are present in the discussions which he gives. Most important are the descriptions of the deviations of the IPTS-68 from thermodynamic temperatures, the limitations of thermocouples, and the need, which currently is met by the provisionally adopted EPT-76, for an extension of the international scale to temperatures below 13.8 K. I am pleased to have this monograph available and anticipate making good use of it. Over the past several years I often have felt the need for a resource book to answer general questions or to obtain an introduction to an unfamiliar area of temperature measurement, and regret very much that "Temperature" was not available earlier. This monograph undoubtedly will be a necessity for any laboratory where thermodynamic measurements are carried out and thermometers are used as serious tools. A great deal of basic and developmental work has been done on thermometry in the past ten years or so, probably considerably more than remains to be done in many areas of the temperature scale. The publication of "Temperature" is timely in this respect, and it should have a long, useful life as a standard reference. The author may consider a second edition when a new international temperature scale is adopted, but there will be few corrections and only relatively minor changes and additions beyond the details of the new scale.

  10. Book Reviews

    Directory of Open Access Journals (Sweden)

    R. de Ridder

    1986-01-01

    (50 pp. - R. de Ridder, Dennis Tedlock, The spoken word and the work of interpretation, Philadelphia: University of Pennsylvania Press, 1983. ix + 365 pp., 8 ill. - R. de Ridder, Dennis Tedlock, Popol Vuh, The definitive edition of the Mayan Book of the Dawn of Life and the Glories of Gods and Kings, New York: Simon and Schuster, 1985. 380 pp., 32 ill. - G. van Roon, Dietmar Rothermund, Die Peripherie in der Weltwirtschaftskrise: Afrika, Asien und Lateinamerika 1929-1939, Paderborn: Ferdinand Schýningh, 1983, 295 pp. - Thilo C. Schadeberg, Gýnter Dabitz, Geschichte der erforschung der Nuba-Berge, Arbeiten aus dem Seminar fýr Výlkerkunde der Johann Wolfgang Goethe-Universitýt Frankfurt am Main, Band 17, Wiesbaden: Franz Steiner Verlag, 1985. 280 pp., maps, tables, illus. - L. van Vroonhoven, Ger van Roon, Derde Wereld in depressie, Leiden: Nijhoff, 1985, 139 p. - Wim van Zanten, Nigel Phillips, Sijobang, sung narrative poetry of West Sumatra, Cambridge Studies in Oral and Literate Culture, no. 1, Cambridge: Cambridge University Press, 1981. xi + 255 pp., photos, texts and translations, short glossary of Minangkabau words, Bibliography, index.

  11. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2004-07-01

    Full Text Available -Bill Maurer, Mimi Sheller, Consuming the Caribbean: From Arawaks to Zombies. New York: Routledge, 2003. ix + 252 pp. -Norman E. Whitten, Jr., Richard Price ,The root of roots: Or, how Afro-American anthropology got its start. Chicago: Prickly Paradigm Press/University of Chicago Press, 2003. 91 pp., Sally Price (eds -Holly Snyder, Paolo Bernardini ,The Jews and the expansion of Europe to the West, 1450-1800. New York: Berghahn Books, 2001. xv + 567 pp., Norman Fiering (eds -Bridget Brereton, Seymour Drescher, The mighty experiment: Free labor versus slavery in British emancipation. New York: Oxford University Press, 2002. 307 pp. -Jean Besson, Kathleen E.A. Monteith ,Jamaica in slavery and freedom: History, heritage and culture. Kingston; University of the West Indies Press, 2002. xx + 391 pp., Glen Richards (eds -Michaeline A. Crichlow, Jean Besson, Martha Brae's two histories: European expansion and Caribbean culture-building in Jamaica. Chapel Hill: University of North Carolina Press, 2002. xxxi + 393 pp. -Christopher Schmidt-Nowara, Joseph C. Dorsey, Slave traffic in the age of abolition: Puerto Rico, West Africa, and the Non-Hispanic Caribbean, 1815-1859. Gainesville: University Press of Florida, 2003. xvii + 311 pp. -Arnold R. Highfield, Erik Gobel, A guide to sources for the history of the Danish West Indies (U.S. Virgin Islands, 1671-1917. Denmark: University Press of Southern Denmark, 2002. 350 pp. -Sue Peabody, David Patrick Geggus, Haitian revolutionary studies. Bloomington: Indiana University Press, 2002. xii + 334 pp. -Gerdès Fleurant, Elizabeth McAlister, Rara! Vodou, power, and performance in Haiti and its Diaspora. Berkeley: University of California Press, 2002. xviii + 259 pp. and CD demo. -Michiel Baud, Ernesto Sagás ,The Dominican people: A documentary history. Princeton NJ: Marcus Wiener, 2003. xiii + 278 pp., Orlando Inoa (eds -Samuel Martínez, Richard Lee Turits, Foundations of despotism: Peasants, the Trujillo regime

  12. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    2003-01-01

    Full Text Available -Timothy Barnard, J.M. Gullick, A history of Selangor (1766-1939. Kuala Lumpur: Malaysian branch of the Royal Asiatic Society, 1989, vi + 220 pp. [MBRAS Monograph 28.] -Okke Braadbaart, Michael L. Ross, Timber booms and institutional breakdown in Southeast Asia. Cambridge: Cambridge University Press, 2001, xvi + 237 pp. -H.J.M. Claessen, Patrick Vinton Kirch ,Hawaiki, ancestral Polynesia; An essay in historical anthropology. Cambridge: Cambridge University Press, 2001, xvii + 375 pp., Roger C. Green (eds -Harold Crouch, R.E. Elson, Suharto; A political biography. Cambridge: Cambridge University Press, 2001, xix + 389 pp. -Kees van Dijk, H.W. Arndt ,Southeast Asia's economic crisis; Origins, lessons, and the way forward. Singapore: Institute of Southeast Asian studies, 1999, ix + 182 pp., Hal Hill (eds -Kees van Dijk, Sebastiaan Pompe, De Indonesische algemene verkiezingen 1999. Leiden: KITLV Uitgeverij, 1999, 290 pp. -David van Duuren, Albert G. van Zonneveld, Traditional weapons of the Indonesian archipelago. Leiden: Zwartenkot art books, 2001, 160 pp. -Peter van Eeuwijk, Christian Ph. Josef Lehner, Die Heiler von Samoa. O Le Fofo; Monographie über die Heiler und die Naturheilmethoden in West-Samoa. Frankfurt am Main: Lang, 1999, 234 pp. [Mensch und Gesellschaft 4.] -Hans Hägerdal, Frans Hüsken ,Reading Asia; New research of Asian studies. Richmond: Curzon, 2001, xvi + 338 pp., Dick van der Meij (eds -Terence E. Hays, Jelle Miedema ,Perspectives on the Bird's head of Irian Jaya, Indonesia; Proceedings of the conference, Leiden, 13-17 October 1997. Amsterdam: Rodopi, 1998, xiii + 982 pp. (editors with the assistance of Connie Baak, Cecilia Odé, Rien A.C. Dam (eds -Menno Hekker, Peter Metcalf, They lie, we lie; Getting on with anthropology. London: Routledge, 2002, ix + 155 pp. -David Henley, Foong Kin, Social and behavioural aspects of malaria control; A study among the Murut of Sabah. Phillips, Maine: Borneo research council , 2000, xx

  13. Book Reviews

    Directory of Open Access Journals (Sweden)

    Joseph Aquilina

    1976-01-01

    .J. Zoetmulder, Himansu Bhusan Sarkar, Corpus of the inscriptions of Java (Corpus Inscriptionum Javanicorum (up to 928 A.D., K.L. Mukhopadhyay, Calcutta, 1972. Vol. I 314 pp., Vol. II 359 pp. - J.G. Oosten, Wilhelmina van Wetering, Hekserij bij de Djuka. Een sociologische benadering. Academisch proefschrift, gestencilde uitgave, 1973. - Willem F.L. Buschkens, Richard Price, Maroon societies, rebel slave communities in the Americas. Anchor Books, Anchor Press/Doubleday Garden City, New York 1973. 429 pag., 7 ill.

  14. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1996-07-01

    . xiv + 217 pp., Lou Anne Barclay (eds -Catherine Levesque, Allison Blakely, Blacks in the Dutch world: The evolution of racial imagery in a modern society. Bloomington: Indiana University Press, 1993. xix + 327 pp. -Dennis J. Gayle, Frank Fonda Taylor, 'To hell with paradise': A history of the Jamaican tourist industry. Pittsburgh: University of Pittsburgh Press, 1993. ix + 239 pp. -John P. Homiak, Frank Jan van Dijk, Jahmaica: Rastafari and Jamaican society, 1930-1990. Utrecht: ISOR, 1993. 483 pp. -Peter Mason, Arthur MacGregor, Sir Hans Sloane: Collector, scientist, antiquary, founding Father of the British Museum. London: British Museum Press, 1994. -Philip Morgan, James Walvin, The life and times of Henry Clarke of Jamaica, 1828-1907. London: Frank Cass, 1994. xvi + 155 pp. -Werner Zips, E. Kofi Agorsah, Maroon heritage: Archaeological, ethnographic and historical perspectives. Kingston: Canoe Press, 1994. xx + 210 pp. -Michael Hoenisch, Werner Zips, Schwarze Rebellen: Afrikanisch-karibischer Freiheitskampf in Jamaica. Vienna Promedia, 1993. 301 pp. -Elizabeth McAlister, Paul Farmer, The uses of Haiti. Monroe ME: Common Courage Press, 1994. 432 pp. -Robert Lawless, James Ridgeway, The Haiti files: Decoding the crisis. Washington DC: Essential Books, 1994. 243 pp. -Bernadette Cailler, Michael Dash, Edouard Glissant. Cambridge: Cambridge University Press, 1995. xii + 202 pp. -Peter Hulme, Veronica Marie Gregg, Jean Rhys's historical imagination: Reading and writing the Creole. Chapel Hill: University of North Carolina Press, 1995. xi + 228 pp. -Silvia Kouwenberg, Francis Byrne ,Focus and grammatical relations in Creole languages. Amsterdam/Philadelphia: John Benjamins, 1993. xvi + 329 pp., Donald Winford (eds -John H. McWhorter, Ingo Plag, Sentential complementation in Sranan: On the formation of an English-based Creole language. Tübingen: Max Niemeyer, 1993. ix + 174 pp. -Percy C. Hintzen, Madan M. Gopal, Politics, race, and youth in Guyana. San Francisco: Mellen

  15. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-01-01

    Full Text Available -Peter Hulme, Simon Gikandi, Writing in limbo: Modernism and Caribbean literature. Ithaca: Cornell University Press, 1992. x + 260 pp. -Charles V. Carnegie, Alistair Hennessy, Intellectuals in the twentieth-century Caribbean (Volume 1 - Spectre of the new class: The Commonwealth Caribbean. London: Macmillan, 1992. xvii 204 pp. -Nigel Rigby, Anne Walmsley, The Caribbean artists movement, 1966-1972: A literary and cultural history. London: New Beacon Books, 1992. xx + 356 pp. -Carl Pedersen, Tyrone Tillery, Claude McKay: A black poet's struggle for identity. Amherst: University of Massachusetts Press, 1992. xii + 235 pp. -Simone Dreyfus, Irving Rouse, The Tainos: Rise and decline of the people who greeted Columbus. New Haven: Yale University Press, 1992. xii + 211 pp. -Louis Allaire, Antonio M. Stevens-Arroyo, Cave of the Jagua: The mythological world of the Taino. Alburquerque: University of New Mexico Press, 1988. xiii + 282 pp. -Irving Rouse, William F. Keegan, The people who discovered Columbus: The prehistory of the Bahamas. Gainesville: University of Florida Press, 1992. xx + 279 pp. -Neil L. Whitehead, Philip P. Boucher, Cannibal encounters: Europeans and Island Caribs, 1492-1763. Baltimore: John Hopkins University Press, 1992. xii + 217 pp. -Peter Kloos, Kaliña, des amérindiens à Paris: Photographies du prince Roland. Présentées par Gérard Collomb. Paris: Créaphis, 1992. 119 pp. -Maureen Warner-Lewis, Alan Gregor Cobley ,The African-Caribbean connection: Historical and cultural perspectives. Bridgetown, Barbados: Department of History, University of the West Indies, Cave Hill, 1990. viii + 171 pp., Alvin Thompson (eds -H. Hoetink, Jean-Luc Bonniol, La couleur comme maléfice: une illustration créole de la généalogie des 'Blancs' et des 'Noirs'. Paris: Albin Michel, 1992. 304 pp. -Michael Aceto, Richard Price ,Two evenings in Saramaka. Chicago and London: University of Chicago Press, 1991. xvi + 417 pp., Sally Price (eds -Jorge P

  16. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1994-07-01

    Full Text Available -Peter Hulme, Stephen Greenblatt, New World Encounters. Berkeley: University of California Press, 1993. xviii + 344 pp. -Nigel Rigby, Alan Riach ,The radical imagination: Lectures and talks by Wilson Harris. Liège: Department of English, University of Liège, xx + 126 pp., Mark Williams (eds -Jonathan White, Rei Terada, Derek Walcott's poetry: American Mimicry. Boston: North-eastern University Press, 1992. ix + 260 pp. -Ray A. Kea, John Thornton, Africa and Africans in the making of the Atlantic world, 1400-1680. Cambridge: Cambridge University Press, 1992. xxxviii + 309 pp. -B.W. Higman, Barbara L. Solow, Slavery and the rise of the Atlantic system. Cambridge: Cambridge University Press, 1991. viii + 355 pp. -Sidney W. Mintz, Michael Mullin, Africa in America: Slave acculturation and resistance in the American South and the British Caribbean, 1736-1831. Urbana: University of Illinois Press. 412 pp. -Karen Fog Olwig, Corinna Raddatz, Afrika in Amerika. Hamburg: Hamburgisches Museum für Völkerkunde, 1992. 264 pp. -Lee Haring, William Bascom, African folktales in the new world. Bloomington: Indiana University Press, 1992. xxv + 243 pp. -Frank Jan van Dijk, Dale A. Bisnauth, History of religions in the Caribbean. Kingston: Kingston Publishers, 1989. 225 pp. -Gloria Wekker, Philomena Essed, Everyday racism: Reports from women of two cultures. Alameda CA: Hunter House, 1990. xiii + 288 pp.''Understanding everyday racism: An interdisciplinary theory. Newbury Park CA: Sage, 1991. x + 322 pp. -Deborah S. Rubin, Vron Ware, Beyond the Pale: White women, racism, and history. London: Verso, 1992. xviii + 263 pp. -Michael Hanchard, Peter Wade, Blackness and race mixture: The dynamics of racial identity in Colombia. Baltimore: John Hopkins University Press, 1993. xv + 415 pp. -Rosalie Schwartz, Louis A. Pérez, Jr., Slaves, sugar, & colonial society: Travel accounts of Cuba, 1801-1899. Wilmington DE: SR Books, 1992. xxvi + 259 pp. -Susan Eckstein, Sandor

  17. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1993-07-01

    Full Text Available -Gesa Mackenthun, Stephen Greenblatt, Marvelous Possessions: The wonder of the New World. Chicago: University of Chicago Press, 1991. ix + 202 pp. -Peter Redfield, Peter Hulme ,Wild majesty: Encounters with Caribs from Columbus to the present day. An Anthology. Oxford: Oxford University Press, 1992. x + 369 pp., Neil L. Whitehead (eds -Michel R. Doortmont, Philip D. Curtin, The rise and fall of the plantation complex: Essays in Atlantic history. New York: Cambridge University Press, 1990. xi + 222 pp. -Roderick A. McDonald, Hilary McD.Beckles, A history of Barbados: From Amerindian settlement to nation-state. Cambridge: Cambridge University Press, 1990. xv + 224 pp. -Gertrude J. Fraser, Hilary McD.Beckles, Natural rebels; A social history of enslaved black women in Barbados. New Brunswick NJ and London: Rutgers University Press and Zed Books, 1990 and 1989. ix + 197 pp. -Bridget Brereton, Thomas C. Holt, The problem of freedom: Race, labor, and politics in Jamaica and Britain, 1832-1938. Baltimore: John Hopkins University Press, 1991. xxxi + 517 pp. -Peter C. Emmer, A. Meredith John, The plantation slaves of Trinidad, 1783-1816: A mathematical and demographic inquiry. Cambridge: Cambridge University Press, 1988. xvi + 259 pp. -Richard Price, Robert Cohen, Jews in another environment: Surinam in the second half of the eighteenth century. Leiden: E.J. Brill, 1991. xv + 350 pp. -Russell R. Menard, Nigel Tattersfield, The forgotten trade: comprising the log of the Daniel and Henry of 1700 and accounts of the slave trade from the minor ports of England, 1698-1725. London: Jonathan Cape, 1991. ixx + 460 pp. -John D. Garrigus, James E. McClellan III, Colonialism and science: Saint Domingue in the old regime. Baltimore: John Hopkins University Press, 1992. xviii + 393 pp. -Lowell Gudmundson, Richard H. Collin, Theodore Roosevelt's Caribbean: The Panama canal, the Monroe doctrine, and the Latin American context. Baton Rouge: Louisiana State University

  18. An optimized multilayer structure of CdS layer for CdTe solar cells application

    International Nuclear Information System (INIS)

    Han Junfeng; Liao Cheng; Jiang Tao; Spanheimer, C.; Haindl, G.; Fu, Ganhua; Krishnakumar, V.; Zhao Kui; Klein, A.; Jaegermann, W.

    2011-01-01

    Research highlights: → Two different methods to prepare CdS films for CdTe solar cells. → A new multilayer structure of window layer for the CdTe solar cell. → Thinner CdS window layer for the solar cell than the standard CdS layer. → Higher performance of solar cells based on the new multilayer structure. - Abstract: CdS layers grown by 'dry' (close space sublimation) and 'wet' (chemical bath deposition) methods are deposited and analyzed. CdS prepared with close space sublimation (CSS) has better crystal quality, electrical and optical properties than that prepared with chemical bath deposition (CBD). The performance of CdTe solar cell based on the CSS CdS layer has higher efficiency than that based on CBD CdS layer. However, the CSS CdS suffers from the pinholes. And consequently it is necessary to prepare a 150 nm thin film for CdTe/CdS solar cell. To improve the performance of CdS/CdTe solar cells, a thin multilayer structure of CdS layer (∼80 nm) is applied, which is composed of a bottom layer (CSS CdS) and a top layer (CBD CdS). That bi-layer film can allow more photons to pass through it and significantly improve the short circuit current of the CdS/CdTe solar cells.

  19. The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

    Energy Technology Data Exchange (ETDEWEB)

    Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz, E-mail: yonganer@atauni.edu.tr

    2015-01-15

    The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K{sub app}) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M{sup −1} and 0.51 for 4 nm CdS NPs and 624.3 M{sup −1} and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher.

  20. The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

    International Nuclear Information System (INIS)

    Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz

    2015-01-01

    The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K app ) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M −1 and 0.51 for 4 nm CdS NPs and 624.3 M −1 and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher

  1. Book Reviews

    Directory of Open Access Journals (Sweden)

    Redactie KITLV

    1992-01-01

    studies. New Haven, 1990. xiii + 369 pp., W.J. O’Malley, A. Weidemann (eds. - Gisele de Meur, F. Tjon Sie Fat, Representing kinship; Simple models of elementary structures. 1990. (Doctoral thesis. Leiden, published by the author. - Toon van Meijl, Maurice Godelier, Big men and great men; Personifications of power in Melanesia, Cambridge/Paris: Cambridge University Press/Editions de la maison des sciences de l’Homme, 1991, xviii, 328 pp., maps, tables, figures, bibliography, index., Marilyn Strathern (eds. - J.A. de Moor, B.A. Hussainmiya, Orang rejimen; The Malays of the Ceylon rifle regiment. Bangi: Universiti Kebangsaan Malaysia, 1990, 185 pp. - Pieter Muysken, J.M.W. Verhaar, Melanesian pidgin and tok pisin; Studies in language companion series 20. Amsterdam: Benjamins, 1990, xiv + 409 pp. - Niels Mulder, Paul Voogt, Thailand. Amsterdam/’s-Gravenhage: Koninklijk Instituut voor de Tropen/NOVIB, 1991. 70 pp. + kaart, slappe kaft., Han ten Brummelhuis, Irene Stengs (eds. - Ton van Naerssen, George Cho, The Malaysian economy; Spatial perspectives. London: Routledge. 1990, 300 pp. - Julianti Parani, J.R. van Diessen, Jakarta/Batavia. Het centrum van het Nederlandse koloniale rijk in Azië en zijn cultuurhistorische nalatenschap. Cantecleer Kunst - Reisgidsen. De Bilt: Cantecleer, 1989. 343 pp. - A. Ploeg, Christopher J. Healey, Pioneers of the mountain forest, University of Sydney, 1985, Oceania Monographs no. 29, v + 64 pp., plates, figures, maps. - Els Postel-Coster, Carla Risseeuw, The fish don’t talk about the water; Gender transformation, power and resistance among women in Sri Lanka, Leiden: E.J.Brill, 1988, 415 pp., also published as Gender transformation, power and resistance among women in Sri Lanka; The fish don’t speak about the water, New Delhi: Manohar Book service, 1991. Ca. 400 pp., - Willem van Schendel, Mya Tan, Myanmar dilemmas and options; The challenge of economic transition in the 1990’s. Singapore: Institute of Southeast Asian studies, 1990

  2. Evaluating the effectiveness and efficacy of unguided internet-based self-help intervention for the prevention of depression: a randomized controlled trial.

    Science.gov (United States)

    Lintvedt, Ove K; Griffiths, Kathleen M; Sørensen, Kristian; Østvik, Andreas R; Wang, Catharina E A; Eisemann, Martin; Waterloo, Knut

    2013-01-01

    The Internet has the potential to increase the capacity and accessibility of mental health services. This study aimed to investigate whether an unguided Internet-based self-help intervention delivered without human support or guidance can reduce symptoms of depression in young people at risk of depression. The study also aimed to explore the usage of such sites in a real-life setting, to estimate the effects of the intervention for those who received a meaningful intervention dose and to evaluate user satisfaction. Young adults were recruited by means of a screening survey sent to all students at the University of Tromsø. Of those responding to the survey, 163 students (mean age 28.2 years) with elevated psychological distress were recruited to the trial and randomized to an Internet intervention condition or the waiting list control group. The Internet condition comprised a depression information website and a self-help Web application delivering automated cognitive behavioural therapy. The participants in the waiting list condition were free to access formal or informal help as usual. Two-thirds of the users who completed the trial initially reported an unmet need for help. The findings demonstrated that an unguided intervention was effective in reducing symptoms of depression and negative thoughts and in increasing depression literacy in young adults. Significant improvements were found at 2-month follow up. Internet-based interventions can be effective without tracking and thus constitute a minimal cost intervention for reaching a large number of people. User satisfaction among participants was high. Copyright © 2011 John Wiley & Sons, Ltd.

  3. Predicting meaningful outcomes to medication and self-help treatments for binge-eating disorder in primary care: The significance of early rapid response.

    Science.gov (United States)

    Grilo, Carlos M; White, Marney A; Masheb, Robin M; Gueorguieva, Ralitza

    2015-04-01

    We examined rapid response among obese patients with binge-eating disorder (BED) in a randomized clinical trial testing antiobesity medication and self-help cognitive-behavioral therapy (shCBT), alone and in combination, in primary-care settings. One hundred four obese patients with BED were randomly assigned to 1 of 4 treatments: sibutramine, placebo, shCBT + sibutramine, or shCBT + placebo. Treatments were delivered by generalist primary-care physicians and the medications were given double-blind. Independent assessments were performed by trained and monitored doctoral research clinicians monthly throughout treatment, posttreatment (4 months), and at 6- and 12-month follow-ups (i.e., 16 months after randomization). Rapid response, defined as ≥65% reduction in binge eating by the fourth treatment week, was used to predict outcomes. Rapid response characterized 47% of patients, was unrelated to demographic and baseline clinical characteristics, and was significantly associated, prospectively, with remission from binge eating at posttreatment (51% vs. 9% for nonrapid responders), 6-month (53% vs. 23.6%), and 12-month (46.9% vs. 23.6%) follow-ups. Mixed-effects model analyses revealed that rapid response was significantly associated with greater decreases in binge-eating or eating-disorder psychopathology, depression, and percent weight loss. Our findings, based on a diverse obese patient group receiving medication and shCBT for BED in primary-care settings, indicate that patients who have a rapid response achieve good clinical outcomes through 12-month follow-ups after ending treatment. Rapid response represents a strong prognostic indicator of clinically meaningful outcomes, even in low-intensity medication and self-help interventions. Rapid response has important clinical implications for stepped-care treatment models for BED. clinicaltrials.gov: NCT00537810 (PsycINFO Database Record (c) 2015 APA, all rights reserved).

  4. Eccentric housing finance sources by the urban poor in Zimbabwe: case of Cowdray Park low-income self help housing scheme in Bulawayo

    Directory of Open Access Journals (Sweden)

    Trynos GUMBO

    2010-06-01

    Full Text Available Zimbabwe has a sombre housing crisis in all its urban centres. All attempts by the government to vary housing delivery systems to ameliorate the problem have proved futile as the backlog it inherited from the colonial masters continues to soar. The situation has however been exacerbated by 2005 demolitions and evictions in the country’s major cities that destroyed homes and businesses leaving the majority of the poor and disadvantaged segments of society in deeper poverty, deprivation and destitution. The main challenge to housing the urban poor is housing finance. Public funds are meagre and private funds are not accessible to the poor due to lack of collateral security and inability to service the loans. Fascinatingly, the poor’s income comes from informal sector activities that absorbs a large percentage of the labour force and keeps the economy going while the large modern enterprises continue to reel under the economic downturn. Unfortunately the Zimbabwean informal sector has generally been perceived as a nuisance, a haven for criminals and a menace. Evidence shows that there is a strong relationship between the urban poor’s housing finance, informal sector activities and self-help housing strategies in Zimbabwe. In the pre-2005 Operation Murambatsvina era, the poor were making some construction progress as evidenced by the structures that had developed. This paper calls for active support and facilitation of the poor’s sources of income, and advocates for the involvement of other players such as the private sector and the international community in housing the poor. The Zimbabwe government’s plan to house the homeless and poor on its 250 000 stands countrywide through self-help programmes can only be successful if their sources of income are promoted and facilitated.

  5. A community-based group-guided self-help intervention for low mood and stress: study protocol for a randomized controlled trial.

    Science.gov (United States)

    McClay, Carrie-Anne; Morrison, Jill; McConnachie, Alex; Williams, Christopher

    2013-11-19

    Depression is a mental health condition which affects millions of people each year, with worldwide rates increasing. Cognitive behavioral therapy (CBT) is recommended in the National Institute for Health and Clinical Excellence (NICE) guidelines for the treatment of depression. However, waiting lists can cause delays for face-to-face therapy. Also a proportion of people decline to present for help through the health service - the so-called treatment gap. Self-referral to CBT using community-based group interventions delivered by a voluntary sector organization may serve to resolve this problem. The aim of this randomized controlled trial (RCT) is to determine the efficacy of such a guided CBT self-help course, the 'Living Life to the Full' (LLTTF) classes delivered by the charity Action on Depression (AOD). The primary outcome is level of depression at 6 months assessed using the patient health questionnaire-9 (PHQ9) depression scale. Secondary measures include levels of anxiety and social functioning. Participants with symptoms of low mood will be recruited from the community through newspaper adverts and also via the AOD website. Participants will receive either immediate or delayed access to guided CBT self-help classes - the eight session LLTTF course. The primary endpoint will be at 6 months at which point the delayed group will be offered the intervention. Levels of depression, anxiety and social functioning will be assessed and an economic analysis will be carried out. This RCT will test whether the LLTTF intervention is effective and/or cost-effective. If the LLTTF community-based classes are found to be cost effective, they may be helpful as both an intervention for those already seeking care in the health service, as well as those seeking help outside that setting, widening access to psychological therapy. Current Controlled Trials ISRCTN86292664.

  6. Study protocol of a multicentre randomised controlled trial of self-help cognitive behaviour therapy for working women with menopausal symptoms (MENOS@Work).

    Science.gov (United States)

    Hunter, Myra S; Hardy, Claire; Norton, Sam; Griffiths, Amanda

    2016-10-01

    Hot flushes and night sweats (HFNS) - the main symptoms of the menopause transition - can reduce quality of life and are particularly difficult to manage at work. A cognitive behaviour therapy (CBT) intervention has been developed specifically for HFNS that is theoretically based and shown to reduce significantly the impact of HFNS in several randomised controlled trials (RCTs). Self-help CBT has been found to be as effective as group CBT for these symptoms, but these interventions are not widely available in the workplace. This paper describes the protocol of an RCT aiming to assess the efficacy of CBT for menopausal symptoms implemented in the workplace, with a nested qualitative study to examine acceptability and feasibility. One hundred menopausal working women, aged 45-60 years, experiencing bothersome HFNS for two months will be recruited from several (2-10) large organisations into a multicentre randomised controlled trial. Women will be randomly assigned to either treatment (a self-help CBT intervention lasting 4 weeks) or to a no treatment-wait control condition (NTWC), following a screening interview, consent, and completion of a baseline questionnaire. All participants will complete follow-up questionnaires at 6 weeks and 20 weeks post-randomisation. The primary outcome is the rating of HFNS; secondary measures include HFNS frequency, mood, quality of life, attitudes to menopause, HFNS beliefs and behaviours, work absence and presenteeism, job satisfaction, job stress, job performance, disclosure to managers and turnover intention. Adherence, acceptability and feasibility will be assessed at 20 weeks post-randomisation in questionnaires and qualitative interviews. Upon trial completion, the control group will also be offered the intervention. This is the first randomised controlled trial of a self-management intervention tailored for working women who have troublesome menopausal symptoms. Clin.Gov NCT02623374. Copyright © 2016 Elsevier Ireland Ltd. All

  7. Randomized Controlled Trial of SuperBetter, a Smartphone-Based/Internet-Based Self-Help Tool to Reduce Depressive Symptoms.

    Science.gov (United States)

    Roepke, Ann Marie; Jaffee, Sara R; Riffle, Olivia M; McGonigal, Jane; Broome, Rose; Maxwell, Bez

    2015-06-01

    Technological advances have sparked the development of computer- and smartphone-based self-help programs for depressed people, but these programs' efficacy is uncertain. This randomized controlled trial evaluated an intervention called SuperBetter (SB), which is accessed via smartphone and/or the SB Web site. Online, we recruited 283 adult iPhone(®) (Apple, Cupertino, CA) users with significant depression symptoms according to the Center for Epidemiological Studies Depression questionnaire (CES-D). They were randomly assigned to one of three conditions: (a) a version of SB using cognitive-behavioral therapy and positive psychotherapy strategies to target depression (CBT-PPT SB); (b) a general SB version focused on self-esteem and acceptance (General SB); or (c) a waiting list control group (WL). The two SB groups were instructed to use SB for 10 minutes daily for 1 month. All participants completed psychological distress and well-being measures online every 2 weeks through follow-up. An intent-to-treat analysis was conducted using hierarchical linear modeling. As hypothesized, SB participants achieved greater reductions in CES-D scores than WL participants by posttest (Cohen's d=0.67) and by follow-up (d=1.05). Contrary to prediction, CBT-PPT SB did not perform better than General SB; both versions of SB were more effective than the WL control. Differences between SB versions favored General SB but were not statistically significant. These large effect sizes should be interpreted cautiously in light of high attrition rates and the motivated, self-selected sample. Nonetheless, smartphone-based/Internet-based self-help may play an important role in treating depression.

  8. Top-selling childbirth advice books: a discourse analysis.

    Science.gov (United States)

    Kennedy, Holly Powell; Nardini, Katrina; McLeod-Waldo, Rebecca; Ennis, Linda

    2009-12-01

    Recent evidence suggests that one-third of women receive information about pregnancy and childbirth through books. Messages about what characteristics are normal (or expected) in childbirth are disseminated in a variety of ways, including popular childbirth education books, but little study of them has been conducted. The purpose of this investigation is to address that gap by examining the discussions about childbirth in the 10 top-selling books in the United States. Discourse analysis (relating to the public, personal, and political discussions about a specific phenomenon) was used to study 10 best-selling United States childbirth advice books marketed to childbearing women during the first week of November 2007. Book styles ranged from clinical descriptions of pregnancy and birth primarily offering reassurance, self-help information, and danger signs to more folksy and humorous commentaries. Presentation of scientific evidence to support recommendations was uneven and at times inaccurate. Five focal areas of discourse included body image, labor and birth, pain, power and control, and life preparation for motherhood. Top-selling books shine an interesting light on the current state of United States maternity practices. Women and health professionals should assess them carefully and engage with each other about their recommendations and implications for childbirth.

  9. The book thief

    Directory of Open Access Journals (Sweden)

    Leandro Diniz

    2008-04-01

    Full Text Available The Book Thief (The Book Thief, in the original is an Australian writer of the novel juvenile Markus Zusak, published in 2006. In Brazil, his work was launched in March 2007 by the publisher Intrinsically, translated by Vera Ribeiro, and so far has sold nationally more than 105 thousand copies. Among the nine books that the author has published, only two books have translated into Portuguese: I am the messenger and The Book Thief.

  10. REGIME SWITCHING DETERMINANTS OF SOVEREIGN CDS SPREADS: EVIDENCE FROM TURKEY

    Directory of Open Access Journals (Sweden)

    Umurcan Polat

    2017-12-01

    Full Text Available In this study, it is assessed the main determinants of sovereign CDS spreads in Turkey from January 2006 to December 2015. Before delving into the nonlinear Markov regime-switching model estimation, a conventional one-state linear model is estimated answering to what extent the sovereign credit risk is affected in between global and country-specific market variables and by credit ratings announcement changes. In broad strokes, the regime-switching analysis reveals that among domestic variables, it is the foreign exchange rate that affects the sovereign credit risk more in more volatile periods and among global variables, the indicators standing for global volatility risk premiums and international liquidity primarily influence the changes in the sovereign CDS spread in turbulent regimes whereas proxies for global risk free rate are significant more in tranquil regimes.

  11. Preliminary Results from Coordinated UVCS-CDS-Ulysses Observations

    Science.gov (United States)

    Parenti, S.; Bromage, B. J.; Poletto, G.; Suess, S. T.; Raymond, J. C.; Noci, G.; Bromage, G. E.; Rose, M. Franklin (Technical Monitor)

    2001-01-01

    The June 2000 quadrature between the Sun, Earth, and Ulysses took place with Ulysses at a distance of 3.35 AU from the Sun and at heliocentric latitude 58.2 deg south, in the southeast quadrant. This provided an opportunity to observe the corona close to the Sun with Coronal Diagnostic Spectrometer (CDS) and Ultraviolet Coronograph Spectrometer (UVCS) and, subsequently, to sample the same plasma when it reached Ulysses. Here we focus on simultaneous observations of UVCS and CDS made on June 12, 13, 16 and 17. The UVCS data were acquired at heliocentric altitudes ranging from 1.6 to 2.2 solar radii, using different grating positions, in order to get a wide wavelength range. CDS data consisted of Normal Incidence Spectrometer (NIS) full wavelength rasters of 120" x 150" centered at altitudes up to 1.18 solar radii, together with Grazing Incidence Spectrometer (GIS) 4" x 4" rasters within the same field of view, out to 1.2 solar radii. The radial direction to Ulysses passed through a high latitude streamer, throughout the 4 days of observations, Analysis of the spectra taken by UVCS shows a variation of the element abundances in the streamer over our observing interval: however, because the observations were in slightly different parts of the streamer on different days, the variation could be ascribed either to a temporal or spatial effect. The oxygen abundance, however, seems to increase at the edge of the streamer, as indicated by previous analyses. This suggests the variation may be a function of position within the streamer, rather than a temporal effect. Oxygen abundances measured by SWICS on Ulysses are compared with the CDS and UVCS results to see whether changes measured in situ follow the same pattern.

  12. A simple route to shape controlled CdS nanoparticles

    Science.gov (United States)

    Nejo, Ayorinde O.; Nejo, Adeola A.; Pullabhotla, Rajasekhar V. S. R.; Revaprasadu, Neerish

    2013-02-01

    We report the synthesis of CdS nanoparticles in the form of spheres, triangles and wire-like structures. The method involves the reaction of reduced sulfur with a cadmium salt followed by thermolysis in hexadecylamine (HDA). The different shapes were obtained by variation of reaction conditions such as reaction time, temperature and cadmium source. The optical studies show the particles to be quantum confined and luminescent at room temperature.

  13. The importance of gold-electrode-adjacent stationary high-field Boeer domains for the photoconductivity of CdS

    Energy Technology Data Exchange (ETDEWEB)

    Boeer, Karl Wolfgang [Department of Physics and Astronomy, University of Delaware, Newark, DE (United States)

    2015-06-15

    When the electron density decreases stronger than linearly with the electric field in photoconductive CdS due to field quenching, high-field domains must occur that remain attached to either the cathode or anode in slit electrode geometry with blocking cathodes. These Boeer domains{sup 1} are easily seen by their shift in optical absorption due to the Franz-Keldysh effect and offer unique opportunities to analyze field dependent parameters within the range of constant electron density and electric field, such as the carrier density or mobility as a function of the field, and give information of the light dependent work function. They also provide insight why a 200 Aa thick cover layer of CdS on top of a CdTe solar cell increases its efficiency from 8 to 16%. The behavior of these Boeer domains escapes conventional current voltage analyses except for their visual observation, while other high-field domains with their current fluctuations or oscillations are easily observed and are the subjects of thousands of publications and many books. In this review we will exclude detailed discussion of dynamic domains, but include some new specifics that help to understand the mechanisms of the Boeer domains and their applications. Only properties at low optical excitation intensities are discussed that exclude Joules heating. Within the p-type regime of the anode-adjacent domain extremely steep electronic quenching signal becomes visible that could signalize an intrinsic donor level slightly above the middle of the band gap that may be responsible for not allowing CdS to ever become p-type by doping. (copyright 2015 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Long-term results of a web-based guided self-help intervention for employees with depressive symptoms: randomized controlled trial.

    Science.gov (United States)

    Geraedts, Anna S; Kleiboer, Annet M; Twisk, Jos; Wiezer, Noortje M; van Mechelen, Willem; Cuijpers, Pim

    2014-07-09

    Depressive disorders are highly prevalent in the working population and are associated with excessive costs. The evidence for effective worker-directed interventions for employees with depressive symptoms is limited. Treating employees with depressive symptoms via the Internet before they report sick from work could be beneficial and cost saving. In this study, we tested the effectiveness over the period of 1 year of a Web-based guided self-help intervention, called Happy@Work, for employees with depressive symptoms who were not on sick leave. A two-arm randomized controlled trial comparing a worker-directed, Web-based, guided self-help intervention to care as usual (CAU) was carried out. We recruited employees from 6 companies via the company's Intranet and by putting up posters. The inclusion criteria were elevated depressive symptoms as measured by a score ≥16 on the Center for Epidemiologic Studies Depression scale (CES-D) and not being on sick leave. The intervention contained 6 lessons and consisted of problem-solving treatment and cognitive therapy. Participants were asked to submit weekly assignments via the website after completion of a lesson and they received feedback from a coach via the website. Self-report questionnaires on depressive symptoms (CES-D; primary outcome), burnout (Maslach Burnout Inventory, MBI), work performance (Health and Work Performance Questionnaire, HPQ), duration of absenteeism, and anxiety (Hospital Anxiety and Depression Scale, HADS; secondary outcomes), were completed at baseline, posttreatment, and at 6-, and 12-month follow-up. Several subgroup and per-protocol analyses were performed. A total of 231 employees were randomized to either the intervention group (n=116) or to CAU (n=115). Completion of assessments varied between 54%-74%. Improvement in depressive symptoms between baseline and posttreatment was shown in all participants and these effects sustained over time. However, there were no differences between the 2

  15. Treatment of Binge Eating Disorder in Racially and Ethnically Diverse Obese Patients in Primary Care: Randomized Placebo-Controlled Clinical Trial of Self-Help and Medication

    Science.gov (United States)

    Grilo, Carlos M.; Masheb, Robin M.; White, Marney A.; Gueorguieva, Ralitza; Barnes, Rachel D.; Walsh, B. Timothy; McKenzie, Katherine C.; Genao, Inginia; Garcia, Rina

    2014-01-01

    Objective The objective was to determine whether treatments with demonstrated efficacy for binge eating disorder (BED) in specialist treatment centers can be delivered effectively in primary care settings to racially/ethnically diverse obese patients with BED. This study compared the effectiveness of self-help cognitive-behavioral therapy (shCBT) and an anti-obesity medication (sibutramine), alone and in combination, and it is only the second placebo-controlled trial of any medication for BED to evaluate longer-term effects after treatment discontinuation. Method 104 obese patients with BED (73% female, 55% non-white) were randomly assigned to one of four 16-week treatments (balanced 2-by-2 factorial design): sibutramine (N=26), placebo (N=27), shCBT+sibutramine (N=26), or shCBT+placebo (N=25). Medications were administered in double-blind fashion. Independent assessments were performed monthly throughout treatment, post-treatment, and at 6- and 12-month follow-ups (16 months after randomization). Results Mixed-models analyses revealed significant time and medication-by-time interaction effects for percent weight loss, with sibutramine but not placebo associated with significant change over time. Percent weight loss differed significantly between sibutramine and placebo by the third month of treatment and at post-treatment. After the medication was discontinued at post-treatment, weight re-gain occurred in sibutramine groups and percent weight loss no longer differed among the four treatments at 6- and 12-month follow-ups. For binge-eating, mixed-models revealed significant time and shCBT-by-time interaction effects: shCBT had significantly lower binge-eating frequency at 6-month follow-up but the treatments did not differ significantly at any other time point. Demographic factors did not significantly predict or moderate clinical outcomes. Discussion Our findings suggest that pure self-help CBT and sibutramine did not show long-term effectiveness relative to

  16. Fighting for life: a qualitative analysis of the process of psychotherapy-assisted self-help in patients with metastatic cancer.

    Science.gov (United States)

    Cunningham, Alastair J; Phillips, Catherine; Stephen, Joanne; Edmonds, Claire

    2002-06-01

    This exploratory study is an attempt to define psychological attributes related to longer survival in patients with metastatic cancers. Previous published analyses have been limited in two ways. First, they have almost always been carried out on patients not receiving therapy; we have followed people receiving a year of group therapy, on the assumption that if mental qualities are to affect cancer progression, substantial mental change would be needed to alter the established balance between the cancer cells and host regulatory mechanisms. Second, the methods typically used to characterize patients' psychology have been self-report inventories, and many decades of research with such methods have largely failed to produce a consensus on what mental qualities, if any, promote survival. By contrast, we have used qualitative methods, allowing a much more in-depth analysis of the patients, without preliminary assumptions as to what would be important. The present report describes the results of a detailed qualitative analysis of data collected from 22 participants over a year of weekly group therapy. Using grounded methods, categories were derived from the extensive verbal data (comprising patients' written homework and therapists' notes), and linked in a model of change. By applying ratings to some of these categories, and combining these ratings, we derived a quantitative estimate of patients' "involvement in self-help." Rankings on degree of involvement corresponded quite closely with the quality of patients' experience and with their survival duration. There was a great range in degree of involvement, and various subgroupings could be discerned. Nine of the participants were classed as "highly involved," meaning that they devoted regular daily time, often several hours, to such self-help strategies as relaxation, mental imaging, meditation, cognitive monitoring and journalling. All but 1 of these patients enjoyed a good quality of life and lived at least 2 years

  17. Treatment of binge eating disorder in racially and ethnically diverse obese patients in primary care: randomized placebo-controlled clinical trial of self-help and medication.

    Science.gov (United States)

    Grilo, Carlos M; Masheb, Robin M; White, Marney A; Gueorguieva, Ralitza; Barnes, Rachel D; Walsh, B Timothy; McKenzie, Katherine C; Genao, Inginia; Garcia, Rina

    2014-07-01

    The objective was to determine whether treatments with demonstrated efficacy for binge eating disorder (BED) in specialist treatment centers can be delivered effectively in primary care settings to racially/ethnically diverse obese patients with BED. This study compared the effectiveness of self-help cognitive-behavioral therapy (shCBT) and an anti-obesity medication (sibutramine), alone and in combination, and it is only the second placebo-controlled trial of any medication for BED to evaluate longer-term effects after treatment discontinuation. 104 obese patients with BED (73% female, 55% non-white) were randomly assigned to one of four 16-week treatments (balanced 2-by-2 factorial design): sibutramine (N = 26), placebo (N = 27), shCBT + sibutramine (N = 26), or shCBT + placebo (N = 25). Medications were administered in double-blind fashion. Independent assessments were performed monthly throughout treatment, post-treatment, and at 6- and 12-month follow-ups (16 months after randomization). Mixed-models analyses revealed significant time and medication-by-time interaction effects for percent weight loss, with sibutramine but not placebo associated with significant change over time. Percent weight loss differed significantly between sibutramine and placebo by the third month of treatment and at post-treatment. After the medication was discontinued at post-treatment, weight re-gain occurred in sibutramine groups and percent weight loss no longer differed among the four treatments at 6- and 12-month follow-ups. For binge-eating, mixed-models revealed significant time and shCBT-by-time interaction effects: shCBT had significantly lower binge-eating frequency at 6-month follow-up but the treatments did not differ significantly at any other time point. Demographic factors did not significantly predict or moderate clinical outcomes. Our findings suggest that pure self-help CBT and sibutramine did not show long-term effectiveness relative to placebo for treating BED in

  18. Twelve-Month Follow-Up of a Randomized Controlled Trial of Internet-Based Guided Self-Help for Parents of Children on Cancer Treatment.

    Science.gov (United States)

    Cernvall, Martin; Carlbring, Per; Wikman, Anna; Ljungman, Lisa; Ljungman, Gustaf; von Essen, Louise

    2017-07-27

    A substantial proportion of parents of children on cancer treatment report psychological distress such as symptoms of post-traumatic stress (PTSS), depression, and anxiety. During their child's treatment many parents also experience an economic burden. The aim of this study was to evaluate the long-term efficacy of Internet-based guided self-help for parents of children on cancer treatment. This study was a parallel randomized controlled trial comparing a 10-week Internet-based guided self-help program, including weekly support from a therapist via encrypted email, with a wait-list control condition. The intervention was based on cognitive behavior therapy (CBT) and focused on psychoeducation and skills to cope with difficult thoughts and feelings. Primary outcome was self-reported PTSS. Secondary outcomes were self-reported symptoms of depression, anxiety, health care consumption, and sick leave during the past month. Outcomes were assessed pre- and postintervention and at 12-month follow-up. Parents of children on cancer treatment were invited by health care personnel at pediatric oncology centers, and parents meeting the modified symptom criteria on the PCL-C were included in the study. Self-report assessments were provided on the Web. A total of 58 parents of children on cancer treatment (median months since diagnosis=3) were included in the study (intervention n=31 and control n=27). A total of 18 participants completed the intervention, and 16 participants in each group participated in the 12-month follow-up. Intention-to-treat analyses revealed significant effects in favor of the intervention on the primary outcome PTSS, with large between-group effect sizes at postassessment (d=0.89; 95% CI 0.35-1.43) and at 12-month follow-up (d=0.78; 95% CI 0.25-1.32). Significant effects in favor of the intervention on the secondary outcomes depression and anxiety were also observed. However, there was no evidence for intervention efficacy on health care consumption or

  19. Combining self-help and professional help to minimize barriers to physical activity in persons with multiple sclerosis: a trial of the "Blue Prescription" approach in New Zealand.

    Science.gov (United States)

    Mulligan, Hilda; Treharne, Gareth J; Hale, Leigh A; Smith, Cath

    2013-06-01

    Increasing participation in physical activity is a goal for many health care providers working with persons with disability. In order to reduce the physical and social barriers to participation, there is a need to develop approaches that integrate self-help with professional help for autonomous yet supported health promotion. This study reports on an innovative program, entitled the "Blue Prescription approach", in which physical therapists work collaboratively with persons with a disability to promote community-based physical activity participation. We trialed this collaborative approach with two physical therapists and 27 participants with multiple sclerosis (MS) over a three month period. We gathered qualitative data from four sources: (i) individual interviews with our participants, (ii) individual interviews with the physical therapists, (iii) clinical notes, and (iv) Advisory Group meeting notes. We then analyzed these data for categories to inform the content and resources required for delivery of the approach. For most participants, the Blue Prescription approach facilitated regular engagement in the physical activity of their choice. The Advisory Group provided advice to help solve individual contexts that presented as challenges to participants. Based on review of interview transcripts, we identified four strategies or issues to inform the further development of Blue Prescription. Evidence indicated that the Blue Prescription approach can provide a collaborative and flexible way for physical therapists to work with individuals with MS, to increase participation in community-based physical activity. To further develop the approach, there is a need to address issues related to the use of standardized measures and develop strategies to train physical therapists in collaborative approaches for promotion of physical activity.The integration of self-help and professional help provided by the Blue Prescription approach appeared to result in successful promotion

  20. The New Russian Book

    DEFF Research Database (Denmark)

    Pristed, Birgitte Beck

    This book takes up the obtrusive problem of visual representation of fiction in contemporary Russian book design. By analyzing a broad variety of book covers, the study offers an absolutely unique material that illustrates a radically changing notion of literature in the transformation of Soviet ...... the fields of Russian studies, contemporary book and media history, art, design, and visual studies.......This book takes up the obtrusive problem of visual representation of fiction in contemporary Russian book design. By analyzing a broad variety of book covers, the study offers an absolutely unique material that illustrates a radically changing notion of literature in the transformation of Soviet...... print culture to a post-Soviet book market. It delivers a profound and critical exploration of Russian visual imaginary of classic, popular, and contemporary prose. Among all the carelessly bungled covers of mass-published post-Soviet series the study identifies gems from experimental designers...

  1. BOOKS I BOEKE

    African Journals Online (AJOL)

    The South African reader in using this book should bear in mind that there ... practice. This book does an admirable job in bringing the .... encouraged its use for these purposes locally. .... translator's error in confusing schrecken (startle, alarin).

  2. Keeping Books of Account

    OpenAIRE

    2009-01-01

    Books of account are a record of a company’s income and spending. These records may be kept in paper or electronic form. The books of account contain the information for preparing the company’s annual financial statements.

  3. BOOKS I BOEKE

    African Journals Online (AJOL)

    butions porentially of broad imerest to all medical practi- tioners. ... tures; forensic psychiany; and some issues of special rele- vance to the ... research projects'. The book .... quizzical whimsicality, and endurance, running through the book.

  4. Book Reviews | Sheppey | African Zoology

    African Journals Online (AJOL)

    Book Authors: Edited by Richard E. Brown & David W. Macdonald. Oxford University Press, Oxford, 1985. 556 pp. Book Review 4. Book Title: Biology of Communication. Book Authors: D. Brian Lewis & D. Michael Gower. Blackie & Son, Glasgow. 239 pp. Book Review 5. Book Title: Animal Osmoregulation. Book Authors: J.

  5. BookFinder.com

    CERN Document Server

    BookFinder.com is produced by the bibliophiles at 13th Generation Media of Berkeley, California. Our goal is to provide fellow readers unbiased realtime information about books available online. Rather than selling books ourselves (does the world rea Amazon.com wannabe?), we've teamed up with over 15,000 of the finest booksellers online to bring you the largest book catalog available anywhere, either online or offline.

  6. Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

    International Nuclear Information System (INIS)

    Gonzalez, G.; Krishnan, B.; Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K.; Shaji, S.

    2011-01-01

    Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

  7. Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2011-08-31

    Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

  8. Synthesis and Characterization of CdS Nanoparticles with Strong Electrolyte Behavior

    International Nuclear Information System (INIS)

    Zhang Yu; Fu, Degang; Liu Juzheng

    2000-01-01

    The CdS nanoparticles whose structure is similar to a strong electrolyte were synthesized by the colloidal chemical method. The CdS nanoparticles with Cd 2+ -rich surface are capped by the electrically neutral ligand of 2,2'-bipyridine (bpy), and the counterion, BPh 4 - , is adsorbed around the particle as balance charge. The ω donation from 2,2'-bipyridine at 2-position to the Cd 2+ -rich surface of the CdS nanoparticles was characterized by X-ray photoelectron spectroscopy (XPS). These CdS nanoparticles can redisperse in pyridine (py) or DMF, and have high stability. The determination of electroconductivity and the electrophoresis deposition in dilute solution containing the CdS nanoparticles further prove the rationality of the above electrolyte structure of the CdS nanoparticles

  9. The Role of Regular Eating and Self-Monitoring in the Treatment of Bulimia Nervosa: A Pilot Study of an Online Guided Self-Help CBT Program.

    Science.gov (United States)

    Barakat, Sarah; Maguire, Sarah; Surgenor, Lois; Donnelly, Brooke; Miceska, Blagica; Fromholtz, Kirsty; Russell, Janice; Hay, Phillipa; Touyz, Stephen

    2017-06-26

    Background : Despite cognitive behavioural therapy (CBT) being regarded as the first-line treatment option for bulimia nervosa (BN), barriers such as its time-consuming and expensive nature limit patient access. In order to broaden treatment availability and affordability, the efficacy and convenience of CBT could be improved through the use of online treatments and selective emphasis on its most 'potent' components of which behavioural techniques form the focus. Method: Twenty-six individuals with BN were enrolled in an online CBT-based self-help programme and 17 completed four weeks of regular eating and food-monitoring using the online Food Diary tool. Participants were contacted for a weekly check-in phone call and had their bulimic symptom severity assessed at five time points (baseline and weeks 1-4). Results : There was a significant decrease in the frequency of self-reported objective binge episodes, associated loss of control and objective binge days reported between pre- and post-treatment measures. Significant improvements were also observed in most subscales of the Eating Disorder Examination-Questionnaire. Conclusion : This study provides encouraging preliminary evidence of the potential of behavioural techniques of online CBT in the treatment of BN. Online therapy with this focus is potentially a viable and practical form of treatment delivery in this illness group. These preliminary findings support the need for larger studies using control groups.

  10. Selling an Energy Efficiency Loan Portfolio in Oregon: Resale of the Craft3 loan portfolio to Self-Help Credit Union

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, Peter; Borgeson, Merrian; Kramer, Chris; Zimring, Mark; Goldman, Charles

    2014-05-30

    Under the Clean Energy Works (CEW) program, Craft3 developed a loan product that widened access to financing for homeowners, offered long term funding, and collected repayments through the customer?s utility bill. The program?s success led Craft3 to pursue the sale of the loan portfolio to both mitigate its own risks and replenish funds for lending. This sale breaks new ground for energy efficiency finance and is notable as it was completed even with many novel program design elements. It replenished Craft3?s program capital and uncovered some valuable lessons that may facilitate future transactions. However, the lack of data history and the unproven nature of the loan portfolio meant that Craft3 had to limit the risk of losses to Self-Help, the purchaser of the portfolio. It remains to be seen whether this experience will pave the way for more sales of on-bill energy efficiency loan portfolios. This case study illustrates how certain program design decisions can sometimes both facilitate programmatic objectives and possibly present challenges for the sale of a portfolio of energy efficiency loans.

  11. Book Reviews Boekbesprekings

    African Journals Online (AJOL)

    Book Reviews. HYPOTHALAMIC HORMONES. Hypothalamic Hypophysiotropic Hormones. Physiological and clinical studies. Proceedings of the Conference .... tricians, it certainly succeeds in its aim. 'A book is of little use if it has no pictures', thought Alice. This book has many. Of particular interest is the last chapter in ...

  12. The Book of Luck.

    Science.gov (United States)

    Young, Carol

    2002-01-01

    Describes an art project that focused on the supernatural in which students create their own "Book Of Luck" using plastic videocassette containers. Discusses how each student created a book and the types of things that were included in the book. Includes examples. (CMK)

  13. Re-dispersible Li+ and Eu3+ co-doped CdS nanoparticles ...

    Indian Academy of Sciences (India)

    Also, it can be used as sensor for drug delivery in our body [12,13]. In the present work, we prepare re-dispersible CdS, Li+- and Eu3+-doped CdS nanoparticles in organic solvent by urea hydrolysis at 170◦C and their lumines- cence properties are studied. We propose the mechanism of re-dispersion of CdS nanoparticles ...

  14. Chemical synthesis of porous web-structured CdS thin films for photosensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Gosavi, S.R., E-mail: srgosavi.taloda@gmail.com [C. H. C. Arts, S. G. P. Commerce, and B. B. J. P. Science College, Taloda, Dist., Nandurbar 425413, M. S. (India); Nikam, C.P. [B.S.S.P.M.S. Arts, Commerce and Science College, Songir, Dist., Dhule 424309, M. S. (India); Shelke, A.R.; Patil, A.M. [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India); Ryu, S.-W. [Department of Physics, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Bhat, J.S. [Department of Physics, Karnatak University, Dharwad 580003 (India); Deshpande, N.G., E-mail: nicedeshpande@yahoo.co.in [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India)

    2015-06-15

    The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting.

  15. Chemical synthesis of porous web-structured CdS thin films for photosensor applications

    International Nuclear Information System (INIS)

    Gosavi, S.R.; Nikam, C.P.; Shelke, A.R.; Patil, A.M.; Ryu, S.-W.; Bhat, J.S.; Deshpande, N.G.

    2015-01-01

    The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting

  16. Microwave assisted synthesis of CdS nanoparticles and their size evolution

    International Nuclear Information System (INIS)

    Lopez, I. A.; Vazquez, A.; Gomez, I.

    2013-01-01

    The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

  17. Microwave assisted synthesis of CdS nanoparticles and their size evolution

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, I. A.; Vazquez, A.; Gomez, I., E-mail: idaliagomezmx@yahoo.com.mx [Universidad Autonoma de Nuevo Leon, Facultad de Ciencias Quimicas, Laboratorio de Materiales I, Av. Universidad, Cd. Universitaria, 66451 San Nicolas de los Garza, Nuevo Leon (Mexico)

    2013-05-01

    The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

  18. Give a Book, Take a Book | Poster

    Science.gov (United States)

    Collection has begun for the 15th Annual Book & Media Swap sponsored by the Scientific Library. NCI at Frederick staff can use this opportunity to clear out personal book and DVD shelves of unwanted materials, donate them to the swap, and then receive “new” materials in return. The library staff will collect materials through Tuesday, Oct. 27. Kick-off day for the event is

  19. Radioactivity content of books

    International Nuclear Information System (INIS)

    Lalit, B.Y.; Shukla, V.K.; Ramachandran, T.V.

    1981-01-01

    The natural and fallout radioactivity was measured in a large number of books produced in various countries after 1955. Results of these measurements showed that the books contained radioactivity due to fallout 137 Cs and 226 Ra, 228 Th and 40 K radioisotopes of primordial origin. Books printed in the U.S.A. had low radioactivity of 40K and 226 Ra origin compared to books printed in the European subcontinent. Books printed during high fallout rate (1962-64) or thereafter did not exhibit any significantly higher 137 Cs levels. The maximum radiation dose to the eyes calculated for the radioactivity content of the books was 0.8 μR/hr and the minimum was 0.07 μR/hr; most of the books were in the range 0.3-0.5 μR/hr. (U.K.)

  20. Preparing a new book on ATLAS

    CERN Multimedia

    Claudia Marcelloni de Oliveira

    A book about the ATLAS project and the ATLAS collaboration is going to be published and available for sale in mid 2008. The book is intended to be a symbol of appreciation for all the people from ATLAS institutes, triggering fond memories through photos, interviews, short commentaries and anecdotes about the daily life and milestones encountered while designing, constructing and completing ATLAS. We would like to give you the opportunity to collaborate with this project in two different ways: Firstly, please send us the best anecdotes related to ATLAS that you remember. To submit anecdotes, send an email to Claudia.Marcelloni@cern.ch. Secondly, you are invited to participate in our PHOTO COMPETITION. Please send the best photos you have of ATLAS attached with a description, the location, and date taken. The categories are: Milestones in the process of designing and building the detector, People at work and Important gatherings. To submit photos you should go to the CDS page and select ATLAS Photo Competi...

  1. Predicting successful treatment outcome of web-based self-help for problem drinkers: secondary analysis from a randomized controlled trial.

    Science.gov (United States)

    Riper, Heleen; Kramer, Jeannet; Keuken, Max; Smit, Filip; Schippers, Gerard; Cuijpers, Pim

    2008-11-22

    Web-based self-help interventions for problem drinking are coming of age. They have shown promising results in terms of cost-effectiveness, and they offer opportunities to reach out on a broad scale to problem drinkers. The question now is whether certain groups of problem drinkers benefit more from such Web-based interventions than others. We sought to identify baseline, client-related predictors of the effectiveness of Drinking Less, a 24/7, free-access, interactive, Web-based self-help intervention without therapist guidance for problem drinkers who want to reduce their alcohol consumption. The intervention is based on cognitive-behavioral and self-control principles. We conducted secondary analysis of data from a pragmatic randomized trial with follow-up at 6 and 12 months. Participants (N = 261) were adult problem drinkers in the Dutch general population with a weekly alcohol consumption above 210 g of ethanol for men or 140 g for women, or consumption of at least 60 g (men) or 40 g (women) one or more days a week over the past 3 months. Six baseline participant characteristics were designated as putative predictors of treatment response: (1) gender, (2) education, (3) Internet use competence (sociodemographics), (4) mean weekly alcohol consumption, (5) prior professional help for alcohol problems (level of problem drinking), and (6) participants' expectancies of Web-based interventions for problem drinking. Intention-to-treat (ITT) analyses, using last-observation-carried-forward (LOCF) data, and regression imputation (RI) were performed to deal with loss to follow-up. Statistical tests for interaction terms were conducted and linear regression analysis was performed to investigate whether the participants' characteristics as measured at baseline predicted positive treatment responses at 6- and 12-month follow-ups. At 6 months, prior help for alcohol problems predicted a small, marginally significant positive treatment outcome in the RI model only (beta = .18

  2. Large multi-centre pilot randomized controlled trial testing a low-cost, tailored, self-help smoking cessation text message intervention for pregnant smokers (MiQuit).

    Science.gov (United States)

    Naughton, Felix; Cooper, Sue; Foster, Katharine; Emery, Joanne; Leonardi-Bee, Jo; Sutton, Stephen; Jones, Matthew; Ussher, Michael; Whitemore, Rachel; Leighton, Matthew; Montgomery, Alan; Parrott, Steve; Coleman, Tim

    2017-07-01

    To estimate the effectiveness of pregnancy smoking cessation support delivered by short message service (SMS) text message and key parameters needed to plan a definitive trial. Multi-centre, parallel-group, single-blinded, individual randomized controlled trial. Sixteen antenatal clinics in England. Four hundred and seven participants were randomized to the intervention (n = 203) or usual care (n = 204). Eligible women were 5 pre-pregnancy), were able to receive and understand English SMS texts and were not already using text-based cessation support. All participants received a smoking cessation leaflet; intervention participants also received a 12-week programme of individually tailored, automated, interactive, self-help smoking cessation text messages (MiQuit). Seven smoking outcomes, including validated continuous abstinence from 4 weeks post-randomization until 36 weeks gestation, design parameters for a future trial and cost-per-quitter. Using the validated, continuous abstinence outcome, 5.4% (11 of 203) of MiQuit participants were abstinent versus 2.0% (four of 204) of usual care participants [odds ratio (OR) = 2.7, 95% confidence interval (CI) = 0.93-9.35]. The Bayes factor for this outcome was 2.23. Completeness of follow-up at 36 weeks gestation was similar in both groups; provision of self-report smoking data was 64% (MiQuit) and 65% (usual care) and abstinence validation rates were 56% (MiQuit) and 61% (usual care). The incremental cost-per-quitter was £133.53 (95% CI = -£395.78 to 843.62). There was some evidence, although not conclusive, that a text-messaging programme may increase cessation rates in pregnant smokers when provided alongside routine NHS cessation care. © 2017 The Authors. Addiction published by John Wiley & Sons Ltd on behalf of Society for the Study of Addiction.

  3. Effectiveness of individually tailored smoking cessation advice letters as an adjunct to telephone counselling and generic self-help materials: randomized controlled trial.

    Science.gov (United States)

    Sutton, Stephen; Gilbert, Hazel

    2007-06-01

    To evaluate the effectiveness of individually tailored smoking cessation advice letters as an adjunct to telephone counselling and generic self-help materials. Randomized controlled trial. The UK Quitline. A total of 1508 current smokers and recent ex-smokers. The control group received usual care (telephone counselling and an information pack sent through the post). The intervention group received in addition a computer-generated individually tailored advice letter. All outcomes were assessed at 6-month follow-up. The primary outcome measure was self-reported prolonged abstinence for at least 3 months. Secondary outcomes were self-reported prolonged abstinence for at least 1 month and 7-day and 24-hour point-prevalence abstinence. For the sample as a whole, quit rates did not differ significantly between the two conditions. However, among the majority (n = 1164) who were smokers at baseline, quit rates were consistently higher in the intervention group: prolonged abstinence for 3 months, 12.2% versus 9.0% [odds ratio (OR) = 1.40, 95% confidence interval (CI) = 0.96-2.04, P = 0.080); prolonged abstinence for 1 month, 16.4% versus 11.3% (OR = 1.53, 95% CI = 1.09-2.15, P = 0.013); 7-day point-prevalence abstinence, 18.9% versus 12.7% (OR = 1.59, 95% CI = 1.15-2.19, P = 0.004); 24-hour point-prevalence abstinence, 20.9% versus 15.4% (OR = 1.45, 95% CI = 1.07-1.96, P = 0.015). The results for the smokers are encouraging in showing a small but useful effect of the tailored letter on quit rate. Versions of the tailoring program could be used on the web and in general practices, pharmacies and primary care trusts.

  4. Effectiveness of TB sensitization initiatives in improving the involvement of self help group members in rural TB control in south India.

    Science.gov (United States)

    Thomas, Beena; Priscilla Rebecca, B; Dhanalakshmi, A; Rani, S; Deepa Lakshmi, A; Watson, Basilea; Vijayalakshmi, R; Muniyandi, M; Karikalan, N

    2016-12-01

    The 'End TB strategy' has highlighted the importance of inter-sectoral collaboration and community mobilization for achieving zero TB deaths by 2020. The aim of the study was to develop and test a model TB sensitization programme involving self help groups (SHGs). This experimental study was conducted in two blocks (intervention and control), in Tiruvallur district. The intervention content included short-lecture, musical story telling activity, role play, short film on TB. The impact was compared at baseline, third and sixth months in terms of SHGs' awareness, promotion of awareness, identification and referral of presumptive TB cases and provision of TB treatment. A total of 764 vs 796 SHGs were enrolled in control and intervention groups, respectively. The knowledge attitude, and practice score (lower score indicated a better attitude and practice), from baseline to 6 months was significantly reduced (29 to 24) in the intervention group. Similarly, a significant difference was observed in identification and referral of chest symptomatics in the intervention group at 3 and 6 months. During the 3 month follow-up a significantly higher proportion of SHG members were involved in TB awareness activities in the intervention (623/748 [83.3%]) vs control group (471/728 [64.7%]; p<0.001). Findings from this study highlight the feasibility of involving SHGs through a model TB sensitization program for strengthening TB prevention and control activities. © The Author 2017. Published by Oxford University Press on behalf of Royal Society of Tropical Medicine and Hygiene. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Systematic development of a self-help and motivational enhancement intervention to promote sexual health in HIV-positive men who have sex with men.

    Science.gov (United States)

    Van Kesteren, Nicole M C; Kok, Gerjo; Hospers, Harm J; Schippers, Jan; De Wildt, Wencke

    2006-12-01

    The objective of this study was to describe the application of a systematic process-Intervention Mapping-to developing a theory- and evidence-based intervention to promote sexual health in HIV-positive men who have sex with men (MSM). Intervention Mapping provides a framework that gives program planners a systematic method for decision-making in each phase of intervention development. In Step 1, we focused on the improvement of two health-promoting behaviors: satisfactory sexual functioning and safer sexual behavior. These behaviors were then linked with selected personal and external determinants, such as attitudes and social support, to produce a set of proximal program objectives. In Step 2, theoretical methods were identified to influence the proximal program objectives and were translated into practical strategies. Although theoretical methods were derived from various theories, self-regulation theory and a cognitive model of behavior change provided the main framework for selecting the intervention methods. The main strategies chosen were bibliotherapy (i.e., the use of written material to help people solve problems or change behavior) and motivational interviewing. In Step 3, the theoretical methods and practical strategies were applied in a program that comprised a self-help guide, a motivational interviewing session and a motivational interviewing telephone call, both delivered by specialist nurses in HIV treatment centers. In Step 4, implementation was anticipated by developing a linkage group to ensure involvement of program users in the planning process and conducting additional research to understand how to implement our program better. In Step 5, program evaluation was anticipated based on the planning process from the previous Intervention Mapping steps.

  6. A single-arm pilot study of guided self-help treatment based cognitive behavioral therapy for bulimia nervosa in Japanese clinical settings.

    Science.gov (United States)

    Setsu, R; Asano, K; Numata, N; Tanaka, M; Ibuki, H; Yamamoto, T; Uragami, R; Matsumoto, J; Hirano, Y; Iyo, M; Shimizu, E; Nakazato, M

    2018-04-25

    Guided self-help treatments based on cognitive behavioral therapy (CBT-GSH) are regarded as a first-line effective treatment for bulimia nervosa (BN). With limited application for CBT-GSH in Japanese clinical settings, we conducted a single arm pilot study in order to confirm the acceptability and availability of CBT-GSH in Japan. 25 women with BN received 16-20 sessions of face-to-face CBT-GSH. Primary outcomes were the completion rate of intervention and abstinence rates from objective bingeing and purging as assessed by the Eating Disorder Examination. Secondary outcomes were other self-report measurements of the frequency of bingeing and purging, and characteristic psychopathologies of eating disorders. Assessments were conducted before CBT as baseline as well as after CBT. 92% (23/25) of the participants completed the CBT sessions. After CBT-GSH, 40% (10/25) of the participants (intention-to-treat) achieved symptom abstinence. The mean binge and purge episodes during the previous 28 days improved from 21.88 to 10.96 (50% reduction) and from 22.44 to 10.88 (52% reduction), each (before CBT-GSH to after CBT-GSH), and the within-group effect sizes were medium (Cohen's d = 0.67, 0.65, each). Our study provided a preliminary evidence about the feasibility of CBT-GSH in Japanese clinical settings for the future. Trial registration This study was registered retrospectively in the national UMIN Clinical Trials Registry on July 10, 2013 (registration ID: UMIN000011120).

  7. Self-help cognitive behavior therapy for working women with problematic hot flushes and night sweats (MENOS@Work): a multicenter randomized controlled trial.

    Science.gov (United States)

    Hardy, Claire; Griffiths, Amanda; Norton, Sam; Hunter, Myra S

    2018-05-01

    The aim of the study was to examine the efficacy of an unguided, self-help cognitive behavior therapy (SH-CBT) booklet on hot flush and night sweat (HFNS) problem rating, delivered in a work setting. Women aged 45 to 60 years, having 10 or more problematic HFNS a week, were recruited to a multicenter randomized controlled trial, via the occupational health/human resources departments of eight organizations. Participants were 1:1 randomized to SH-CBT or no treatment waitlist control (NTWC). The primary outcome was HFNS problem rating; secondary outcomes included HFNS frequency, work and social adjustment, sleep, mood, beliefs and behaviors, and work-related variables (absence, performance, turnover intention, and work impairment due to presenteeism). Intention-to-treat analysis was used, and between-group differences estimated using linear mixed models. A total of 124 women were randomly allocated to SH-CBT (n = 60) and NTWC (n = 64). 104 (84%) were assessed for primary outcome at 6 weeks and 102 (82%) at 20 weeks. SH-CBT significantly reduced HFNS problem rating at 6 weeks (SH-CBT vs NTWC adjusted mean difference, -1.49; 95% CI, -2.11 to -0.86; P work and social adjustment; sleep, menopause beliefs, HFNS beliefs/behaviors at 6 and 20 weeks; improved wellbeing and somatic symptoms and reduced work impairment due to menopause-related presenteeism at 20 weeks, compared with the NTWC. There was no difference between groups in other work-related outcomes. A brief, unguided SH-CBT booklet is a potentially effective management option for working women experiencing problematic HFNS.

  8. Guided self-help cognitive-behaviour Intervention for VoicEs (GiVE): Results from a pilot randomised controlled trial in a transdiagnostic sample.

    Science.gov (United States)

    Hazell, Cassie M; Hayward, Mark; Cavanagh, Kate; Jones, Anna-Marie; Strauss, Clara

    2017-10-12

    Few patients have access to cognitive behaviour therapy for psychosis (CBTp) even though at least 16 sessions of CBTp is recommended in treatment guidelines. Briefer CBTp could improve access as the same number of therapists could see more patients. In addition, focusing on single psychotic symptoms, such as auditory hallucinations ('voices'), rather than on psychosis more broadly, may yield greater benefits. This pilot RCT recruited 28 participants (with a range of diagnoses) from NHS mental health services who were distressed by hearing voices. The study compared an 8-session guided self-help CBT intervention for distressing voices with a wait-list control. Data were collected at baseline and at 12weeks with post-therapy assessments conducted blind to allocation. Voice-impact was the pre-determined primary outcome. Secondary outcomes were depression, anxiety, wellbeing and recovery. Mechanism measures were self-esteem, beliefs about self, beliefs about voices and voice-relating. Recruitment and retention was feasible with low study (3.6%) and therapy (14.3%) dropout. There were large, statistically significant between-group effects on the primary outcome of voice-impact (d=1.78; 95% CIs: 0.86-2.70), which exceeded the minimum clinically important difference. Large, statistically significant effects were found on a number of secondary and mechanism measures. Large effects on the pre-determined primary outcome of voice-impact are encouraging, and criteria for progressing to a definitive trial are met. Significant between-group effects on measures of self-esteem, negative beliefs about self and beliefs about voice omnipotence are consistent with these being mechanisms of change and this requires testing in a future trial. Copyright © 2017. Published by Elsevier B.V.

  9. Improving self-help e-therapy for depression and anxiety among sexual minorities: an analysis of focus groups with lesbians and gay men.

    Science.gov (United States)

    Rozbroj, Tomas; Lyons, Anthony; Pitts, Marian; Mitchell, Anne; Christensen, Helen

    2015-03-11

    E-therapies for depression and anxiety rarely account for lesbian and gay users. This is despite lesbians and gay men being at heightened risk of mood disorders and likely to benefit from having access to tailored self-help resources. We sought to determine how e-therapies for depression and anxiety could be improved to address the therapeutic needs of lesbians and gay men. We conducted eight focus groups with lesbians and gay men aged 18 years and older. Focus groups were presented with key modules from the popular e-therapy "MoodGYM". They were asked to evaluate the inclusiveness and relevance of these modules for lesbians and gay men and to think about ways that e-therapies in general could be modified. The focus groups were analyzed qualitatively using a thematic analysis approach to identify major themes. The focus groups indicated that some but not all aspects of MoodGYM were suitable, and suggested ways of improving e-therapies for lesbian and gay users. Suggestions included avoiding language or examples that assumed or implied users were heterosexual, improving inclusiveness by representing non-heterosexual relationships, providing referrals to specialized support services and addressing stigma-related stress, such as "coming out" and experiences of discrimination and harassment. Focus group participants suggested that dedicated e-therapies for lesbians and gay men should be developed or general e-therapies be made more inclusive by using adaptive logic to deliver content appropriate for a user's sexual identity. Findings from this study offer in-depth guidance for developing e-therapies that more effectively address mental health problems among lesbians and gay men.

  10. Understanding the acceptability of e-mental health--attitudes and expectations towards computerised self-help treatments for mental health problems.

    Science.gov (United States)

    Musiat, Peter; Goldstone, Philip; Tarrier, Nicholas

    2014-04-11

    E-mental health and m-mental health include the use of technology in the prevention, treatment and aftercare of mental health problems. With the economical pressure on mental health services increasing, e-mental health and m-mental health could bridge treatment gaps, reduce waiting times for patients and deliver interventions at lower costs. However, despite the existence of numerous effective interventions, the transition of computerised interventions into care is slow. The aim of the present study was to investigate the acceptability of e-mental health and m-mental health in the general population. An advisory group of service users identified dimensions that potentially influence an individual's decision to engage with a particular treatment for mental health problems. A large sample (N = 490) recruited through email, flyers and social media was asked to rate the acceptability of different treatment options for mental health problems on these domains. Results were analysed using repeated measures MANOVA. Participants rated the perceived helpfulness of an intervention, the ability to motivate users, intervention credibility, and immediate access without waiting time as most important dimensions with regard to engaging with a treatment for mental health problems. Participants expected face-to-face therapy to meet their needs on most of these dimensions. Computerised treatments and smartphone applications for mental health were reported to not meet participants' expectations on most domains. However, these interventions scored higher than face-to-face treatments on domains associated with the convenience of access. Overall, participants reported a very low likelihood of using computerised treatments for mental health in the future. Individuals in this study expressed negative views about computerised self-help intervention and low likelihood of use in the future. To improve the implementation and uptake, policy makers need to improve the public perception of such

  11. Book Reviews | Bernard | African Zoology

    African Journals Online (AJOL)

    Abstract. Book Review 1. Book Title: The Physiology of Reproduction. Book Authors: Editors-in-Chief: E. Knobil, & J.D. Kneill. Raven Press, 1988. 2633 pages. Book Review 2. Book Title: Long-term Studies in Ecology: Approaches and Alternatives. Book Author: Gene E. Likens. Springer-Verlag, New York, 1988. 214 pages ...

  12. English Book Club

    CERN Multimedia

    English Book Club

    2012-01-01

    The CERN English Book Club will hold its 2012 AGM at 17h30 on Monday 5th March in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before February 27th. The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  13. English Book Club

    CERN Document Server

    CERN English Book Club

    2010-01-01

    AGM  --  AGM  -- 2010 --  AGM  --  AGM The CERN ENGLISH BOOK CLUB will hold its 2010 AGM at 18h00 on Monday November 22nd in the club rooms (club barrack 564). Club members are invited to attend. Any members wishing to add points on to the agenda should contact one of the committee before November 12th. AGM  --  AGM  -- 2010 --  AGM  --  AGM The English Book Club has a collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.  

  14. Electrical engineer's reference book

    CERN Document Server

    Laughton, M A

    1985-01-01

    Electrical Engineer's Reference Book, Fourteenth Edition focuses on electrical engineering. The book first discusses units, mathematics, and physical quantities, including the international unit system, physical properties, and electricity. The text also looks at network and control systems analysis. The book examines materials used in electrical engineering. Topics include conducting materials, superconductors, silicon, insulating materials, electrical steels, and soft irons and relay steels. The text underscores electrical metrology and instrumentation, steam-generating plants, turbines

  15. Software engineer's pocket book

    CERN Document Server

    Tooley, Michael

    2013-01-01

    Software Engineer's Pocket Book provides a concise discussion on various aspects of software engineering. The book is comprised of six chapters that tackle various areas of concerns in software engineering. Chapter 1 discusses software development, and Chapter 2 covers programming languages. Chapter 3 deals with operating systems. The book also tackles discrete mathematics and numerical computation. Data structures and algorithms are also explained. The text will be of great use to individuals involved in the specification, design, development, implementation, testing, maintenance, and qualit

  16. An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

    International Nuclear Information System (INIS)

    Cao, Fengfeng; Wang, Hao; Xia, Zhouhui; Dai, Xiao; Cong, Shan; Dong, Chao; Sun, Baoquan; Lou, Yanhui; Sun, Yinghui; Zhao, Jie; Zou, Guifu

    2015-01-01

    Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0 # diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement

  17. An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Fengfeng; Wang, Hao [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Xia, Zhouhui [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Dai, Xiao; Cong, Shan [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Dong, Chao [Department of Chemistry and Biology, University of New Mexico, ABQ 87120 (United States); Sun, Baoquan [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Lou, Yanhui, E-mail: yhlou@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Sun, Yinghui; Zhao, Jie [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Zou, Guifu, E-mail: zouguifu@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China)

    2015-01-15

    Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0{sup #} diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement.

  18. Preparation of CdS Nanoparticles by First-Year Undergraduates

    Science.gov (United States)

    Winkelmann, Kurt; Noviello, Thomas; Brooks, Stephen

    2007-01-01

    The first year undergraduates use a simple method to synthesize 5-nm CdS nanoparticles in a water-in-oil microemulsion. The quantum size effect, the relationship between colors, optical absorbance, band-gap energy and the CdS particles affected by the formation of micelles are observed.

  19. Effect of precursor concentration, temperature and capping group on the morphology of CdS nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2008-01-01

    Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

  20. Effect of temperature, precursor concentration and capping group on the shape of Cds nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2009-01-01

    Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

  1. Ultrasonic/surfactant assisted of CdS nano hollow sphere synthesis and characterization

    International Nuclear Information System (INIS)

    Rafati, Amir Abbas; Borujeni, Ahmad Reza Afraz; Najafi, Mojgan; Bagheri, Ahmad

    2011-01-01

    CdS hollow nanospheres with diameters ranging from 40 to 150 nm have been synthesized by a surfactant-assisted sonochemical route. The successful vesicle templating indicates that the outer leaflet of the bilayer is the receptive surface in the controlled growth of CdS nanoparticles which provide the unique reactor for the nucleation and mineralization growth of CdS nanoparticles. The CdS nanostructures obtained were characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, ultraviolet-visible spectroscopy and photoluminescence spectroscopy. Structural characterization of hollow CdS nanospheres indicates that these products packed with square subunits having sizes between 5 and 7 nm in diameter. The formation of the hollow nanostructure was explained by a vesicle template mechanism, in which sonication and surfactant play important roles. The band-edge emission and surface luminescence of the CdS nanoparticles were observed. -Research Highlights: → CdS hollow nanospheres with diameters of 40-150 nm were synthesized. → Nanoparticles were characterized by UV/Vis and photoluminescence. → Nanospheres are composed of smaller nanocrystals with the average size of 6.8 nm. → The band gap energy of the CdS nanoparticles is higher than its bulk value.

  2. BI Reporting, Data Warehouse Systems, and Beyond. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service [CDS] to better understand how higher education institutions approach business intelligence (BI) reporting and data warehouse systems (see the Sidebar for definitions). Information provided for this Spotlight was derived from Module 8 of CDS, which contains several questions regarding…

  3. Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

    International Nuclear Information System (INIS)

    Tripathi, R M; Shrivastav, Archana; Bhadwal, Akhshay Singh; Singh, Priti; Singh, M P; Shrivastav, B R

    2014-01-01

    A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles. (papers)

  4. Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

    Science.gov (United States)

    Tripathi, R. M.; Singh Bhadwal, Akhshay; Singh, Priti; Shrivastav, Archana; Singh, M. P.; Shrivastav, B. R.

    2014-06-01

    A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles.

  5. The Financial Management System: A Pivotal Tool for Fiscal Viability. CDS Spotlight. ECAR Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This spotlight focuses on data from the 2013 CDS to better understand how higher education institutions approach financial management systems. Information provided for this spotlight was derived from Module 8 of Core Data Service (CDS), which asked several questions regarding information systems and applications. Responses from 525 institutions…

  6. Study of optical phonon modes of CdS nanoparticles using Raman

    Indian Academy of Sciences (India)

    In this paper we report the study of optical phonon modes of nanoparticles of CdS using Raman spectroscopy. Nanoparticle sample for the present study was synthesized through chemical precipitation technique. The CdS nanoparticles were then subjected to heat treatment at low temperature (150°C) for extended time ...

  7. Synthesis of CdS nanoparticles based on DNA network templates

    International Nuclear Information System (INIS)

    Yao Yong; Song Yonghai; Wang Li

    2008-01-01

    CdS nanoparticles have been successfully synthesized by using DNA networks as templates. The synthesis was carried out by first dropping a mixture of cadmium acetate and DNA on a mica surface for the formation of the DNA network template and then transferring the sample into a heated thiourea solution. The Cd 2+ reacted with thiourea at high temperature and formed CdS nanoparticles on the DNA network template. UV-vis spectroscopy, photoluminescence, x-ray diffraction and atomic force microscopy (AFM) were used to characterize the CdS nanoparticles in detail. AFM results showed that the resulted CdS nanoparticles were directly aligned on the DNA network templates and that the synthesis and assembly of CdS nanoparticles was realized in one step. CdS nanoparticles fabricated with this method were smaller than those directly synthesized in a thiourea solution and were uniformly aligned on the DNA networks. By adjusting the density of the DNA networks and the concentration of Cd 2+ , the size and density of the CdS nanoparticles could be effectively controlled and CdS nanoparticles could grow along the DNA chains into nanowires. The possible growth mechanism has also been discussed in detail

  8. Chemically deposited TiO2/CdS bilayer system for ...

    Indian Academy of Sciences (India)

    FTO/TiO2/CdS bilayers system showed improved performance of PEC properties over individual ... form distribution of nanocrystalline CdS on TiO2 and this is unfavourable for the ... (TEA), the pH of the solution maintained at 12·0 by drop.

  9. Effects of bacteria on CdS thin films used in technological devices

    Science.gov (United States)

    Alpdoğan, S.; Adıgüzel, A. O.; Sahan, B.; Tunçer, M.; Metin Gubur, H.

    2017-04-01

    Cadmium sulfide (CdS) thin films were fabricated on glass substrates by the chemical bath deposition method at 70 {}^\\circ \\text{C} considering deposition times ranging from 2 h to 5 h. The optical band gaps of CdS thin films were found to be in the 2.42-2.37 eV range. CdS thin films had uniform spherical nano-size grains which had polycrystalline, hexagonal and cubic phases. The films had a characteristic electrical resistivity of the order of {{10}5} Ω \\text{cm} and n-type conductivity at room condition. CdS thin films were incubated in cultures of B.domonas aeruginosa and Staphylococcus aureus, which exist abundantly in the environment, and form biofilms. SEM images showed that S. aureus and K. pneumonia were detected significantly on the film surfaces with a few of P. aeruginosa and B. subtilis cells attached. CdS thin film surface exhibits relatively good resistance to the colonization of P. aeruginosa and B. subtilis. Optical results showed that the band gap of CdS thin films which interacted with the bacteria is 2.42 \\text{eV} . The crystal structure and electrical properties of CdS thin films were not affected by bacterial adhesion. The antimicrobial effect of CdS nanoparticles was different for different bacterial strains.

  10. A comparative study of CdS thin films deposited by different techniques

    Energy Technology Data Exchange (ETDEWEB)

    Pérez-Hernández, G., E-mail: german.perez@ujat.mx [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Pantoja-Enríquez, J. [Centro de Investigación y Desarrollo Tecnológico en Energías Renovables, UNICACH, Libramiento Norte No 1150, Tuxtla Gutiérrez, Chiapas 29039 (Mexico); Escobar-Morales, B. [Instituto Tecnológico de Cancún, Avenida Kábah Km 3, Cancún, Quintana Roo 77500 (Mexico); Martinez-Hernández, D.; Díaz-Flores, L.L.; Ricardez-Jiménez, C. [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Mathews, N.R.; Mathew, X. [Centro de Investigación en Energía, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico)

    2013-05-01

    Cadmium sulfide thin-films were deposited on glass slides and SnO{sub 2}:F coated glass substrates by chemical bath deposition, sputtering and close-spaced sublimation techniques. The films were studied for the structural and opto-electronic properties after annealing in an ambient identical to that employed in the fabrication of CdTe/CdS devices. Quantum efficiency of the CdTe/CdS solar cells fabricated with CdS buffer films prepared by the three methods were investigated to understand the role of CdS film preparation method on the blue response of the devices. The higher blue response observed for the devices fabricated with chemical bath deposited CdS film is discussed. - Highlights: ► CdS films were prepared by different techniques. ► Role of CdS on the blue response of device was studied. ► Structural and optical properties of CdS were analyzed. ► Chemically deposited CdS has high blue transmittance. ► CdS deposition method influences diffusion of S and Te.

  11. Simple and green synthesis of protein-conjugated CdS nanoparticles and spectroscopic study on the interaction between CdS and zein

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Dezhi, E-mail: dezhiqin@163.com; Zhang, Li; Du, Xian; Wang, Yabo; Zhang, Qiuxia [Pingdingshan University, College of Chemistry and Environmental Engineering (China)

    2016-09-15

    The present study demonstrates the role of zein molecules in synthesizing CdS nanoassemblies through protein-directed, green synthetic approach. Zein molecules can as capping ligand and stabilizing agent to regulate the nucleation and growth of CdS nanocrystals, and the obtained products are organic–inorganic nanocomposites. The analysis of surface charge and conductivity indicates that strong electrostatic force restricts mobility of ions, which creates a local supersaturation surrounding the binding sites of zein and reduces the activated energy of nucleation. The interaction between Cd{sup 2+}/CdS and zein molecules was systematically investigated through spectroscopy techniques. Fourier transform infrared (FT-IR) spectra were used to envisage the binding of the functional groups of zein with the surface of CdS nanoparticles. Ultraviolet visible (UV–Vis) and photoluminescence (PL) spectra results show that Cd{sup 2+}/CdS might interact with the aromatic amino acids of protein molecules and change its chemical microenvironment. The quantum-confined effect of nanocrystals is confirmed by optical absorption spectrum due to the small size (3–5 nm) of CdS particles. The data of circular dichroism (CD) spectra indicate that the formation of CdS nanocrystals could lead to the conformational change of zein molecules. Moreover, the possible mechanism of CdS nanocrystals growth in zein solution was also discussed. The weak interactions such as Van der Waals, hydrophobic forces and hydrogen bonds in zein molecules should play a crucial factor in the self-assembly of small nanoparticles.

  12. The Leporello Book

    DEFF Research Database (Denmark)

    2017-01-01

    Referring to the festival's overall framework "Distribution and Markets" this historical photobook exhibition will discuss the mass-produced travel books of the 19th century and their impact on the global development of the city as a commodity and tourist attraction. The exhibition focuses...... examples from the nineteenth century and contemporary ones. It showcases books from many countries, books of different sizes and qualities, with or without text, and containing black-and-white photographs or colour reproductions. It illustrates the variety of the book typology and documents its development...

  13. Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song [Henan Univ., Henan (China)

    2014-02-15

    Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S.

  14. Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

    International Nuclear Information System (INIS)

    Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song

    2014-01-01

    Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S

  15. Sulfonsuccinate (AOT Capped Pure and Mn-Doped CdS Nanoparticles

    Directory of Open Access Journals (Sweden)

    D. Venkatesan

    2012-01-01

    Full Text Available CdS nanoparticles and thin films are well known for their excellent semiconducting properties. When transition metal ions are doped into the CdS, it exhibits magnetic properties in addition to semiconducting properties and they are termed as dilute magnetic semiconductors (DMSs. In this paper, we discuss the preparation of sodium bis(2-ethylhexyl sulfonsuccinate (AOT capped CdS nanoparticles and thin films doped with magnetic impurity Mn. Sodium bis(2-ethulexyl sulfonsuccinate (AOT, capping agent promotes the uniform formation of nanoparticles. Optical characterizations are made using the UV-Vis spectrometer, PL, and FTIR. XRD shows the hexagonal structure of the CdS. SEM images and EDS measurements were made for the thin films. EPR shows the clear hyperfine lines corresponding to Mn2+ ion in the CdS nanoparticles.

  16. Effects of precursors on the crystal structure and photoluminescence of CdS nanocrystalline

    International Nuclear Information System (INIS)

    Fu Zuoling; Zhou Shihong; Shi Jinsheng; Zhang Siyuan

    2005-01-01

    A series of cadmium sulfide (CdS) nanocrystalline were synthesized by precipitation from a mixture of aqueous solutions of cadmium salts and sulfur salts without adding any surface-termination agent. Their crystal structures and particle sizes were determined by X-ray diffraction (XRD). The CdS nanocrystalline precipitated from different precursors exhibited three cases: cubic phase, hexagonal phase and a hybrid of cubic and hexagonal phases. The photoluminescence (PL) of cadmium salt precursors and CdS nanocrystalline is also analyzed. Similar spectral band structure of cadmium salt precursors and CdS nanocrystalline is found. The PL of 3.4, 2.4 and 2.0 nm sized CdS nanocrystalline with the same crystal structure indicated quantum confinement effect

  17. Comparison of behavioural activation with guided self-help for treatment of depression in adults with intellectual disabilities: a randomised controlled trial.

    Science.gov (United States)

    Jahoda, Andrew; Hastings, Richard; Hatton, Chris; Cooper, Sally-Ann; Dagnan, Dave; Zhang, Ruiqi; McConnachie, Alex; McMeekin, Nicola; Appleton, Kim; Jones, Rob; Scott, Katie; Fulton, Lauren; Knight, Rosie; Knowles, Dawn; Williams, Chris; Briggs, Andrew; MacMahon, Ken; Lynn, Helen; Smith, Ian; Thomas, Gail; Melville, Craig

    2017-12-01

    Psychological therapies are first-line interventions for depression, but existing provision is not accessible for many adults with intellectual disabilities. We investigated the clinical and cost-effectiveness of a behavioural activation intervention (BeatIt) for people with intellectual disabilities and depression. BeatIt was compared with a guided self-help intervention (StepUp). We did a multicentre, single-blind, randomised, controlled trial with follow-up at 4 months and 12 months after randomisation. Participants aged 18 years or older, with mild to moderate intellectual disabilities and clinically significant depression were recruited from health and social care services in the UK. The primary outcome was the Glasgow Depression Scale for people with a Learning Disability (GDS-LD) score at 12 months. Analyses were done on an intention-to-treat basis. This trial is registered with ISCRTN, number ISRCTN09753005. Between Aug 8, 2013, and Sept 1, 2015, 161 participants were randomly assigned (84 to BeatIt; 77 to StepUp); 141 (88%) participants completed the trial. No group differences were found in the effects of BeatIt and StepUp based on GDS-LD scores at 12 months (12·03 [SD 7·99] GDS-LD points for BeatIt vs 12·43 [SD 7·64] GDS-LD points for StepUp; mean difference 0·26 GDS-LD points [95% CI -2·18 to 2·70]; p=0·833). Within-group improvements in GDS-LD scores occurred in both groups at 12 months (BeatIt, mean change -4·2 GDS-LD points [95% CI -6·0 to -2·4], peffect sizes (BeatIt, 0·590 [95% CI 0·337-0·844]; StepUp, 0·627 [0·380-0·873]). BeatIt was not cost-effective when compared with StepUp, although the economic analyses indicated substantial uncertainty. Treatment costs were only approximately 3·6-6·8% of participants' total support costs. No treatment-related or trial-related adverse events were reported. This study is, to our knowledge, the first large randomised controlled trial assessing individual psychological interventions for

  18. Service users' perspectives in the design of an online tool for assisted self-help in mental health: a case study of implications.

    Science.gov (United States)

    Gammon, Deede; Strand, Monica; Eng, Lillian Sofie

    2014-01-09

    The involvement of persons with lived experiences of mental illness and service use is increasingly viewed as key to improving the relevance and utility of mental health research and service innovation. Guided by the principles of Community-Based Participatory Research we developed an online tool for assisted self-help in mental health. The resulting tool, PsyConnect, is ready for testing in two communities starting 2014. This case study reports from the design phase which entailed clarifying very basic questions: Who is the primary target group? What are the aims? What functions are priorities? Roles and responsibilities? What types of evidence can legitimize tool design decisions? Here we highlight the views of service users as a basis for discussing implications of user involvement for service design and research. PsyConnect has become a tool for those who expect to need assistance over long periods of time regardless of their specific condition(s). The aim is to support service users in gaining greater overview and control, legitimacy, and sense of continuity in relationships. It has a personalized "my control panel" which depicts status → process → goals. Functionality includes support for: mapping life domains; medication overview; crisis management; coping exercises; secure messaging; and social support. While the types of evidence that can legitimize design decisions are scattered and indirectly relevant, recent trends in recovery research will be used to guide further refinements. PsyConnect has undoubtedly become something other than it would have been without careful attention to the views of service users. The tool invites a proactive approach that is likely to challenge treatment cultures that are reactive, disorder-focused and consultation-based. Service user representatives will need to play central roles in training peers and clinicians in order to increase the likelihood of tool usage in line with intentions. Similarly, their influence on tool

  19. Toxicity of cadmium sulfide (CdS) nanoparticles against Escherichia coli and HeLa cells

    International Nuclear Information System (INIS)

    Hossain, Sk Tofajjen; Mukherjee, Samir Kumar

    2013-01-01

    Highlights: • Toxic effect of CdS NPs on the growth and cell division in E. coli was studied. • CdS NPs affected cell surface topology and cell division. • Downregulation of both FtsZ and FtsQ was observed due to NPs exposure. • CdS NPs affected HeLa cell morphology with fragmented nuclei. • All such effects might be due to elevated oxidative stress. -- Abstract: The present study endeavours to assess the toxic effect of synthesized CdS nanoparticles (NPs) on Escherichia coli and HeLa cells. The CdS NPs were characterized by DLS, XRD, TEM and AFM studies and the average size of NPs was revealed as ∼3 nm. On CdS NPs exposure bacterial cells changed morphological features to filamentous form and damage of the cell surface was found by AFM study. The expression of two conserved cell division components namely ftsZ and ftsQ in E. coli was decreased both at transcriptional and translational levels upon CdS NPs exposure. CdS NPs inhibited proper cell septum formation without affecting the nucleoid segregation. Viability of HeLa cells declined with increasing concentration of CdS NPs and the IC 50 value was found to be 4 μg/mL. NPs treated HeLa cells showed changed morphology with condensed and fragmented nuclei. Increased level of reactive oxygen species (ROS) was found both in E. coli and HeLa cells on CdS NPs exposure. The inverse correlation between declined cell viabilities and elevated ROS level suggested that oxidative stress seems to be the key event by which NPs induce toxicity both in E. coli and HeLa cells

  20. Synthesis of CdS nanorods in soft template under gamma-irradiation.

    Science.gov (United States)

    Zhao, Bing; Wang, Yanli; Zhang, Haijiao; Jiao, Zheng; Wang, Haobo; Ding, Guoji; Wu, Minghong

    2009-02-01

    CdS nano material which has a band gap of 2.42 eV at room temperature is a typical II-VII semiconductor having many commercial or potential applications, e.g., light-emitting diodes, solar cell and optoelectronic devices. In this paper, we use a new strategy to synthesize CdS nanorods. CdS nanorods were prepared in soft template under gamma-irradiation though the reaction of cadmium sulphide and thiacetamide (TAA). The formation process and characters of CdS nanorods was investigated in detail by transmission electron microscopy (TEM), electron diffraction (ED) pattern, X-ray powder diffraction (XRD), ultraviolet spectrophotometer (UV) and photoluminescence spectrophotometer (PL). In the experiment we proposed that the irradiation of gamma-ray accelerated the formation of S(2-) under acidic condition (pH = 3) and vinyl acetate (VAc) monomer formed pre-organized nano polymer tubules which were used as both templates and nanoreacters for the growth of CdS nanorods. In this process, we have obtained the CdS polycrystal nanorods with PVAc nano tubules and CdS single-crystal nanorods. The result of X-ray powder diffraction confirms that the crystal type of CdS nanorods is cubic F-43 m (216). The results from transmission electron microscopy and electron diffraction show that the concentrations of reactants and the dose rate of gamma-ray are key to produce appropriate CdS nanorods. Relatively low concentrations (Cd2+: 0.008-0.02 mol/L, Cd2+ : S(2-) = 1 : 2) of reactants and long time (1-2 d) of irradiation in low dose rate (6-14 Gy/min) are propitious to form CdS single-crystal nanorods with small diameter (less than 100 nm) and well length (2-5 microm). UV and PL characterizations show the sample have well optical properties.

  1. 2012 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2013-10-01

    This Renewable Energy Data Book for 2012 provides facts and figures in a graphical format on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  2. 2011 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2012-10-01

    This Renewable Energy Data Book for 2011 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  3. 2010 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Gelman, R.

    2011-10-01

    This Renewable Energy Data Book for 2010 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar energy, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investments.

  4. 2013 Renewable Energy Data Book (Book)

    Energy Technology Data Exchange (ETDEWEB)

    Esterly, S.

    2014-12-01

    This Renewable Energy Data Book for 2013 provides facts and figures on energy in general, renewable electricity in the United States, global renewable energy development, wind power, solar power, geothermal power, biopower, hydropower, advanced water power, hydrogen, renewable fuels, and clean energy investment.

  5. Book and Market

    NARCIS (Netherlands)

    Marja Appelman; Andries van den Broek

    2002-01-01

    Original title: Boek en markt. The fixed book price is controversial. This evaluation reviews the effectiveness and efficiency of the fixed book price; are the three aims of cultural policy (availability of a wide range of titles, wide accessibility and public participation) being

  6. Distributed Digital Book

    Directory of Open Access Journals (Sweden)

    Mario Žagar

    2006-06-01

    Full Text Available Concept of distributed digital book (DDB based on the XML is proposed. The author's side as well as the reader's side are analyzed. Different book modules and their frameworks are defined. Module design tools are proposed. Practical solution with appropriate examples is shown.

  7. The Briefing Book Concept.

    Science.gov (United States)

    Minix, Dean A.

    1990-01-01

    Describes an open admissions program, a public university's nontraditional population, and their unique academic needs. Provides a political science briefing book assignment in which students research and write about one country. Claims the book is effective in helping students to organize and focus their thoughts and to improve their research and…

  8. Better Bankers Book Symposium

    DEFF Research Database (Denmark)

    Ringe, Georg

    2016-01-01

    Book review of: "Better Bankers, Better Banks: Promoting Good Business Through Contractual Commitment" by: Claire A Hill and Richard W. Painter (University of Chicago Press, 2015).......Book review of: "Better Bankers, Better Banks: Promoting Good Business Through Contractual Commitment" by: Claire A Hill and Richard W. Painter (University of Chicago Press, 2015)....

  9. ATLAS Colouring Book

    CERN Multimedia

    Anthony, Katarina

    2016-01-01

    The ATLAS Experiment Colouring Book is a free-to-download educational book, ideal for kids aged 5-9. It aims to introduce children to the field of High-Energy Physics, as well as the work being carried out by the ATLAS Collaboration.

  10. Nourishing Children with Books

    OpenAIRE

    Nickols-Richardson, Sharon Michelle, 1965-; Parra, Danielle Elizabeth; Serrano, Elena Lidia

    2009-01-01

    Books with food and nutrition topics, cultural food patterns, and physical activity themes help to improve the quality of life of children by exposing them to a variety of foods and activities through creative stories. This guide helps parents and caregivers select books that achieve this goal.

  11. Astronomy books in Spanish

    Science.gov (United States)

    Fierro, Julieta

    Great cultures have created language. They have discovered its strength among other reasons for education. For a long time the Bible was one of the few books available in western culture, its influence is beyond any doubt. Many developing nations have no science books in their mother tongue. They might carry a few translations but these do not convey the local culture so it is harder for students to grasp the concepts and to build on what they know. Books, even if they are extremely simple, should be written in local languages because that will facilitate the conveying of knowledge and the creation of scientific culture. In the books examples that pertain to every day local life must be given, in particular examples that have to do with women. Women play a central role in developing nations by child bearing; if they become literate they will influence enormously the quality of their children's education, in particular their science comprehension. In Mexico a collection that includes astronomy books has recently been edited by the National Council for Culture and Arts. The books are small and light, which encourages middle-school students to carry them around and read them while traveling in public transportation, such as the subway. Every other page is a new subject, that carries illustrations, abstracts and conclusions. The astronomy books are on search for extraterrestrial life, the stars and the universe. These books are distributed nation-wide and are inexpensive. They have been written by Mexican astronomers.

  12. BOOKS I BOEKE

    African Journals Online (AJOL)

    and treatment are given, finer details such as doses and duration of ... examinations fall outside the scope of this book. Its use as a .... practical reference manual. Some of the ... Overall, this compact book has achieved a balance between ...

  13. More2books

    Science.gov (United States)

    Australian Mathematics Teacher, 2012

    2012-01-01

    Reach for the Stars is AAMT's data-collection activity for National Literacy and Numeracy Week, funded by the Australian Government. This year's activity was on the theme "More2books" and many thousands of students and their teachers explored the mathematics of the books in their classrooms. This article presents a version of the…

  14. The Book Club Exploded

    Science.gov (United States)

    Hoffert, Barbara

    2006-01-01

    One leader, 12 readers, and a few well-thumbed copies of Jane Austen's "Pride and Prejudice." That is all a book club once required, but this is no longer the case. This article describes how the runaway popularity of book clubs has brought with it a whole new set of possibilities. Thematic discussion? A fiction/nonfiction mix? Videoconferencing?…

  15. The Obama Books Boom

    Science.gov (United States)

    Roach, Ronald

    2009-01-01

    As Barack Obama's rise to power inspires a flood of books, scholars hope the publishing trend will yield serious analysis. Barack Obama's rise from Illinois politics to the U.S. presidency has inspired authors to produce a flood of books chronicling the 44th commander in chief's life story and political career. Obama's political odyssey invites…

  16. More than Comic Books

    Science.gov (United States)

    Boerman-Cornell, Bill

    2013-01-01

    Graphic novels (book-length fiction or nonfiction narratives told using the conventions of a comic book) bring together text and image in a way that seems to capture students' imaginations. Right now, there is little more than anecdotal research about how graphic novels can be used within specific middle school and high school disciplines. As…

  17. Children's Ecology Books.

    Science.gov (United States)

    Lussenhop, Martha

    Selected for this listing of children's books are fiction and non-fiction books which add to an understanding of ecology, broadly considered here as the study of the interrelationships of organisms to each other and their environment. General ecology, natural resources, man and his environment, evolution and adaptation, appreciation, survival,…

  18. Data communications pocket book

    CERN Document Server

    Tooley, Michael

    2014-01-01

    Data Communications Pocket Book, Second Edition presents information relevant to data communication. The book provides tabulated reference materials with a brief description and diagrams. The coverage of the text includes abbreviations, terminal control codes, and conversion tables. The text will be of great use to individuals involved in the interconnection of computer systems.

  19. English Book Club

    CERN Multimedia

    English Book Club

    The minutes of the AGM held on Tuesday November 17th can now be found on the club web-site: http://club-englishbookclub.web.cern.ch. A new version of the club’s book data-base is also available on the web: http://club-englishbookclub.web.cern.ch/club-englishbookclub/Export/index.html The last book selection for 2009 is done and the order for the new books has been placed, with luck they will be on the shelves before the end of year break. The English Book Club has a growing collection of over 4500 English language books, mostly general fiction with a sprinkling of nonfiction and children’s books. New books are purchased regularly and the books are shelved in our club room which is accessible to members at all times. Membership is open to all (staff and external) and there is a special tariff for short term students. See the club’s website at http://cern.ch/englishbookclub for more details.

  20. One book too many

    Directory of Open Access Journals (Sweden)

    Andrej Blatnik

    2008-01-01

    Full Text Available The article is exploring the changes in the communication value of Slovenian book after the year 1991. The shifted (selfunderstanding of the publishing business going from activity of ‘special social importance’to explicitly profit-making activity has not only changed the ways of book production, but also the products themselves. This has influenced also those factors in the communication circuit of the book which still belong to the public sector. Following the example of two bestsellers published in 2008,the author points out the differences in public and market functioning of structurally same books and emphasizes the importance of a conscious choice which positions the adequate product into the communication circuit of the book.

  1. Supporting Book Search

    DEFF Research Database (Denmark)

    Bogers, Toine; Petras, Vivien

    2017-01-01

    of information needs. In this paper, we present a large-scale empirical comparison of the effectiveness of book metadata elements for searching complex information needs. Using a test collection of over 2 million book records and over 330 real-world book search requests, we perform a highly controlled and in......-depth analysis of topical metadata, comparing controlled vocabularies with social tags. Tags perform better overall in this setting, but controlled vocabulary terms provide complementary information, which will improve a search. We analyze potential underlying factors that contribute to search performance......, such as the relevance aspect(s) mentioned in a request or the type of book. In addition, we investigate the possible causes of search failure. We conclude that neither tags nor controlled vocabularies are wholly suited to handling the complex information needs in book search, which means that different approaches...

  2. Photon induced resonant Raman scattering in CdS

    International Nuclear Information System (INIS)

    Muzart, J.; Lluesma, E.G.; Arguello, C.A.; Leite, R.C.C.

    1975-01-01

    A novel aspect of resonant Raman scattering is observed in CdS by means of the ratio of Stokes to anti-Stokes intensities. With increasing temperature, as the forbidden band energy approaches a value that is twice the incident photon energy, (from a Nd-Yag-laser) a large enhancement of the above ratio is observed for both the LO and the 2LO phonon Raman intensities. The results indicate a resonance with the scattered photon. Resonance is only observed for high incident photon intensities. A possible explanation for the above observations is that flooding of the crystal with photons of energy hν induces states of energy hν displaced from the electronic bands by mixing of electronic and photon states

  3. Book Reviews | Musgrave | African Zoology

    African Journals Online (AJOL)

    Museo Nacional de Ciencias Naturales, Consejo Superior de Investigaciones Cientificas, Madrid, 1992. 327 pages and 19 colour photographs. Book Review 4. Book Title: Roberts' Birds of Southern Africa. Book Author: Gordon L. Maclean. 6th edition 1993. John Voelcker Bird Book Fund. Cape Town. Book Review 5.

  4. Hexagonal pencil-like CdS nanorods: Facile synthesis and enhanced visible light photocatalytic performance

    Science.gov (United States)

    An, Liang; Wang, Guanghui; Zhao, Lei; Zhou, Yong; Gao, Fang; Cheng, Yang

    2015-07-01

    In the present study, hexagonal pencil-like CdS nanorods have been successfully synthesized through a typical facile and economical one-step hydrothermal method without using any surfactant or template. The product was characterized by X-ray powder diffraction (XRD), field-emission scanning electron microscopy (FE-SEM) and energy dispersive analysis of X-ray (EDX). The results revealed that the prepared CdS photocatalyst consisted of a large quantity of straight and smooth solid hexagonal nanorods and a few nanoparticles. The photocatalytic activities of CdS nanorods and commercial CdS powders were investigated by the photodegradation of Orange II (OII) in aqueous solution under visible light, and the CdS nanorods presented the highest photocatalytic activity. Its photocatalytic efficiency enhancement was attributed to the improved transmission of photogenerated electron-hole pairs in the CdS nanostructures. The present findings may provide a facile approach to synthesize high efficient CdS photocatalysts.

  5. Anodic Titania Nanotube Arrays Sensitized with Mn- or Co-Doped CdS Nanocrystals

    International Nuclear Information System (INIS)

    Smith, York R.; Gakhar, Ruchi; Merwin, Augustus; Mohanty, Swomitra K.; Chidambaram, Dev; Misra, Mano

    2014-01-01

    Highlights: • Mn or Co doped CdS where synthesized and deposited onto TiO 2 nanotubular arrays. • Synthesis and deposition were achieved simultaneously using SILAR method. • Various characterization techniques demonstrate lattice incorporation of dopant. • Photoelectrochemical performance was analyzed using AM 1.5 irradiation. • Dopants increases depletion width of CdS and increase photoelectrochemical responses. - Abstract: The use of doped luminescent nanocrystals or quantum dots have mainly been explored for imaging applications; however, recently they have gained interest in solar energy conversion applications due to long electron lifetimes, tunable band gaps and emission by compositional control. In this study, we have examined the application of Mn or Co doped CdS nanocrystals as a sensitizing layer over titania nanotubular arrays synthesized via electrochemical anodization in photoelectrochemical applications. The doped and undoped CdS nanocrystals were simultaneously synthesized and deposited onto the titania surface by adoption of a successive ion layer adsorption-reaction (SILAR) method. Various characterization methods indicate lattice incorporation of the dopant within CdS. The addition of dopants to CdS was found to improve the photoelectrochemical performance by increasing the depletion width of the CdS nanocrystals and reducing recombination losses of charge carriers

  6. Broad spectral response photodetector based on individual tin-doped CdS nanowire

    Directory of Open Access Journals (Sweden)

    Weichang Zhou

    2014-12-01

    Full Text Available High purity and tin-doped 1D CdS micro/nano-structures were synthesized by a convenient thermal evaporation method. SEM, EDS, XRD and TEM were used to examine the morphology, composition, phase structure and crystallinity of as-prepared samples. Raman spectrum was used to confirm tin doped into CdS effectively. The effect of impurity on the photoresponse properties of photodetectors made from these as-prepared pure and tin-doped CdS micro/nano-structures under excitation of light with different wavelength was investigated. Various photoconductive parameters such as responsivity, external quantum efficiency, response time and stability were analyzed to evaluate the advantage of doped nanowires and the feasibility for photodetector application. Comparison with pure CdS nanobelt, the tin-doped CdS nanowires response to broader spectral range while keep the excellect photoconductive parameters. Both trapped state induced by tin impurity and optical whispering gallery mode microcavity effect in the doped CdS nanowires contribute to the broader spectral response. The micro-photoluminescence was used to confirm the whispering gallery mode effect and deep trapped state in the doped CdS nanowires.

  7. Microwave Synthesized Monodisperse CdS Spheres of Different Size and Color for Solar Cell Applications

    Directory of Open Access Journals (Sweden)

    Carlos A. Rodríguez-Castañeda

    2015-01-01

    Full Text Available Monodisperse CdS spheres of size of 40 to 140 nm were obtained by microwave heating from basic solutions. It is observed that larger CdS spheres were formed at lower solution pH (8.4–8.8 and smaller ones at higher solution pH (10.8–11.3. The color of CdS products changed with solution pH and reaction temperature; those synthesized at lower pH and temperature were of green-yellow color, whereas those formed at higher pH and temperature were of orange-yellow color. A good photovoltage was observed in CdS:poly(3-hexylthiophene solar cells with spherical CdS particles. This is due to the good dispersion of CdS nanoparticles in P3HT solution that led to a large interface area between the organic and inorganic semiconductors. Higher photocurrent density was obtained in green-yellow CdS particles of lower defect density. The efficient microwave chemistry accelerated the hydrolysis of thiourea in pH lower than 9 and produced monodisperse spherical CdS nanoparticles suitable for solar cell applications.

  8. Development of a Self-Help Web-Based Intervention Targeting Young Cancer Patients With Sexual Problems and Fertility Distress in Collaboration With Patient Research Partners.

    Science.gov (United States)

    Winterling, Jeanette; Wiklander, Maria; Obol, Claire Micaux; Lampic, Claudia; Eriksson, Lars E; Pelters, Britta; Wettergren, Lena

    2016-04-12

    The Internet should be suitable for delivery of interventions targeting young cancer patients. Young people are familiar with the technologies, and this patient group is small and geographically dispersed. Still, only few psycho-educational Web-based interventions are designed for this group. Young cancer patients consider reproductive health, including sexuality, an area of great importance and approximately 50% report sexual problems and fertility-related concerns following cancer treatment. Therefore, we set out to develop a self-help Web-based intervention, Fex-Can, to alleviate such problems. To improve its quality, we decided to involve patients and significant others as research partners. The first 18 months of our collaboration are described in this paper. The intervention will subsequently be tested in a feasibility study followed by a randomized controlled trial. The study aims to describe the development of a Web-based intervention in long-term collaboration with patient research partners (PRPs). Ten former cancer patients and two significant others participated in building the Web-based intervention, using a participatory design. The development process is described according to the design step in the holistic framework presented by van Gemert-Pijnen et al and evaluates the PRPs' impact on the content, system, and service quality of the planned intervention. The collaboration between the research group and the PRPs mainly took place in the form of 1-day meetings to develop the key components of the intervention: educational and behavior change content, multimedia (pictures, video vignettes, and audios), interactive online activities (eg, self-monitoring), and partial feedback support (discussion forum, tailored feedback from experts). The PRPs influenced the intervention's content quality in several ways. By repeated feedback on prototypes, the information became more comprehensive, relevant, and understandable. The PRPs gave suggestions concerning the

  9. Nanoniobia modification of CdS photoanode for an efficient and stable photoelectrochemical cell.

    Science.gov (United States)

    Pareek, Alka; Paik, Pradip; Borse, Pramod H

    2014-12-30

    Herein we report the surface modification of a CdS film by niobia nanoparticles via thioglycerol as an organic linker and thus fabricate an efficient and a stable photoanode for a photoelectrochemical (PEC) cell. We have synthesized three differenly sized (∼3, ∼6 ,and ∼9 nm) niobia nanoparticles by a hydrothermal synthesis approach and have further investigated the particle-size-dependent PEC performance of the nanoparticle-modified CdS photoanode. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS) confirm the formation of Nb2O5 nanoparticles that are prepared via decomposition of the niobium peroxo complex during the hydrothermal reaction and reveal the presence of surface OH(-) groups over niobia nanoparticles that impart a high catalytic property to a material. The nano-Nb2O5-modified photoanode displayed a 23-fold higher power conversion efficiency compared to that of CdS. This modified structure increases the open circuit voltage (OCV) from 0.65 to 0.77 V, which is attributed to the nano-Nb2O5-induced surface passivation effect over bare CdS. Linking of nanoparticles on the CdS surface improves the photocorrosion stability of the CdS photoanode for even longer than 4 h in contrast to the tens of minutes for the base CdS surface. The uniform coverage of the CdS photoanode surface by niobia nanoparticles is thus found to be the controlling parameter for achieving a higher PEC performance and stability of the photoanode. This finding directed us to design an improved CdS photoanode for efficient and prolonged PEC hydrogen generation from a PEC cell.

  10. Fullerene (C{sub 60})/CdS nanocomposite with enhanced photocatalytic activity and stability

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Qiang [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Hu, Zhuofeng, E-mail: st04hzhf@gmail.com [Department of Chemistry, The Chinese University of Hong Kong, Shatin, New Territories, Hong Kong (China); Zhang, Qian; Li, Boyuan [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Shen, Zhurui, E-mail: shenzhurui@tju.edu.cn [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China)

    2017-05-01

    Highlights: • C{sub 60}/CdS nanocomposite has been fabricated as a novel visible-light-driven photocatalyst. • It exhibits enhanced photocatalytic activity and photostability than that of pure CdS reference. • The C{sub 60} improved the charge separation and transfer of nanocomposite due to its high electron affinity. - Abstract: Herein, the fullerene (C{sub 60})/CdS nanocomposite has been fabricated by a facile one-pot hydrothermal method. Its photocatatlytic hydrogen (H{sub 2}) evolution rate and degradation efficiency of Rhodamine B (Rh B) are evaluated under visible light irradiation (λ ≥ 420 nm). The content of C{sub 60} has been changed from 0.4 wt% to 8 wt%, and the optimal value for photocatalytic activity is determined to be 0.4 wt%. The H{sub 2} evolution rate over this optimal sample reaches 1.73 mmol h{sup −1} g{sup −1} and its apparent degradation rate of Rh B is 0.089 min{sup −1} (degradation efficiency of 97% within 40 min), which is 2.3 times and 1.5 times compared to that of pure CdS reference. Moreover, the photocorrosion of CdS in composite is effectively suppressed, and its photocatalytic activity can be well maintained after three recycles (97.8% retaining for composite vs. 84.4% retaining for CdS). Then, the enhanced photocatalytic activity and stability of C{sub 60}/CdS nanocomposite are further studied by spectroscopic and electrochemical methods. Results show that the C{sub 60} species covering on the surface of CdS can efficiently accelerate the separation and transfer of photoexcited charge carriers, which can improve its activity, and reduce the photocorrosion of CdS.

  11. Structural, morphological and optical properties of Na and K dual doped CdS thin film

    International Nuclear Information System (INIS)

    Mageswari, S.; Dhivya, L.; Palanivel, Balan; Murugan, Ramaswamy

    2012-01-01

    Highlights: ► Effect of incorporation of Na, K and Na,K dual dopants into CdS thin film was investigated. ► Thin films were prepared by simple chemical bath deposition technique. ► The XRD analysis revealed cubic phase for all the investigated films. ► AFM analysis revealed uniform surface with crack free and densely packed morphology for CdS:Na,K film. ► The band gap value increases for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. - Abstract: CdS, sodium doped CdS (CdS:Na), potassium doped CdS (CdS:K) and sodium and potassium dual doped CdS (CdS:Na,K) thin films were deposited on glass substrate by chemical bath deposition (CBD) technique. Structural, morphological and optical properties of the as-grown films were characterised using X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDAX), atomic force microscopy (AFM) and ultraviolet visible (UV–VIS) spectroscopy. The XRD analysis revealed cubic phase for ‘as-deposited’ CdS, CdS:Na, CdS:K and CdS:Na,K dual doped thin films. AFM analysis revealed uniform film surface with crack free and densely packed morphology for CdS:Na,K film. The absorption edge in the optical absorption spectra shifts towards the shorter wavelength for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. The optical band gap of CdS, CdS:Na, CdS:K and CdS:Na,K thin films was found to be 2.31, 2.35, 2.38 and 2.34 eV, respectively.

  12. Book Presentation | 27 February

    CERN Multimedia

    The CERN Library

    2013-01-01

    "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo" by Luciano Maiani and Romeo Bassoli, published by Mondadori. On Wednesday 27 February Luciano Maiani will present the book "A caccia del bosone di Higgs. Magneti, governi, scienziati e particelle nell'impresa scientifica del secolo". More information here. The presentation will take place in the Council Chamber at 16.00 and will be followed by a debate and book signing. The book will be on sale. You are cordially invited.

  13. CdS loaded on coal based activated carbon nanofibers with enhanced photocatalytic property

    Science.gov (United States)

    Guo, Jixi; Guo, Mingxi; Jia, Dianzeng; Song, Xianli; Tong, Fenglian

    2016-08-01

    The coal based activated carbon nanofibers (CBACFs) were prepared by electrospinning a mixture of polyacrylonitrile (PAN) and acid treated coal. Cadmium sulfide (CdS) nanoparticles loaded on CBACFs were fabricated by solvothermal method. The obtained samples were characterized by FESEM, TEM, and XRD. The results reveal that the CdS nanoparticles are homogeneously dispersed on the surfaces of CBACFs. The CdS/CBACFs nanocomposites exhibited higher photoactivity for photodegradation of methyl blue (MB) under visible light irradiation than pure CdS nanoparticles. CBACFs can be used as low cost support materials for the preparation of nanocomposites with high photocatalytic activity.

  14. Raman spectroscopy of optical properties in CdS thin films

    Directory of Open Access Journals (Sweden)

    Trajić J.

    2015-01-01

    Full Text Available Properties of CdS thin films were investigated applying atomic force microscopy (AFM and Raman spectroscopy. CdS thin films were prepared by using thermal evaporation technique under base pressure 2 x 10-5 torr. The quality of these films was investigated by AFM spectroscopy. We apply Raman scattering to investigate optical properties of CdS thin films, and reveal existence of surface optical phonon (SOP mode at 297 cm-1. Effective permittivity of mixture were modeled by Maxwell - Garnet approximation. [Projekat Ministarstva nauke Republike Srbije, br. 45003

  15. Influence of Ag doping concentration on structural and optical properties of CdS thin film

    International Nuclear Information System (INIS)

    Kumar, Pragati; Saxena, Nupur; Gupta, Vinay; Agarwal, Avinash

    2015-01-01

    This work shows the influence of Ag concentration on structural properties of pulsed laser deposited nanocrystalline CdS thin film. X-ray photoelectron spectroscopy (XPS) studies confirm the dopant concentration in CdS films and atomic concentration of elements. XPS studies show that the samples are slightly sulfur deficient. GAXRD scan reveals the structural phase transformation from cubic to hexagonal phase of CdS without appearance of any phase of CdO, Ag 2 O or Ag 2 S suggesting the substitutional doping of Ag ions. Photoluminescence studies illustrate that emission intensity increases with increase in dopant concentration upto 5% and then decreases for higher dopant concentration

  16. Influence of Irradiation Time on properties of CdS Nanoparticles Synthesized using Microwave Irradiation

    International Nuclear Information System (INIS)

    Nayereh Soltani; Elias SSaion; Maryam Erfani; Mohd Zobir Hussein; Robiah Yunus

    2011-01-01

    Different sizes of cadmium sulfide nanoparticles which exhibit obvious quantum confinement effect have been synthesized of cadmium chloride and thioacetamide through the simple and rapid microwave method. The properties of these CdS nanoparticles were examined with varying irradiation time from 10 to 40 min using a pulse regime. The obtained CdS particles were characterized by X-ray diffraction (XRD), transition electron microscopy (TEM) and UV-visible (UV-Vis) spectroscopy. The effects of irradiation time on the size, degree of crystallinity, yield of reaction and optical band gap of CdS nanoparticles are investigated. (author)

  17. Chemical Bath Deposition and Characterization of CdS layer for CZTS Thin Film Solar Cell

    OpenAIRE

    Kamal, Tasnim; Parvez, Sheikh; Matin, Rummana; Bashar, Mohammad Shahriar; Hossain, Tasnia; Sarwar, Hasan; Rashid, Mohammad Junaebur

    2016-01-01

    CZTS is a new type of an absorber and abundant materials for thin film solar cells (TFSC). Cadmium sulfide (CdS) is the n-type buffer layer of it with band gap of 2.42 eV. Cadmium sulfide (CdS) buffer layer of CZTS solar cell was deposited on soda-lime glass substrates by the Chemical Bath Deposition(CBD) method, using anhydrous Cadmium chloride(CdCl_2) and Thiourea (CS(NH_2)_2). Deposition of CdS using CBD is based on the slow release of Cd^ ions and S^ ions in an alkaline bath which is achi...

  18. Effect of the sulfur and fluorine concentration on physical properties of CdS films grown by chemical bath deposition

    Directory of Open Access Journals (Sweden)

    K.E. Nieto-Zepeda

    Full Text Available Undoped and F-doped CdS thin films were grown on glass slides by chemical bath deposition using thiourea, cadmium acetate and ammonium fluoride as sulfur, cadmium, and fluorine sources, respectively. Undoped CdS films were deposited varying the concentration of thiourea. Once the optimal thiourea concentration was determined, based on the crystalline quality of the samples, this concentration was maintained and ammonium fluoride was added at different concentrations in order to explore the effect of the F nominal concentration on properties of CdS films. Undoped and F-doped CdS films were characterized by X-ray diffraction, UV–Vis, room temperature photoluminescence, and four probe resistivity measurements. Results showed highly transparent F-doped CdS films with strong PL and low resistivity were obtained. Keywords: CdS films, F-doped CdS films, Chemical bath deposition, Optical properties, Room temperature photoluminescence

  19. Transportation energy data book

    Science.gov (United States)

    2009-01-01

    The Transportation Energy Data Book: Edition 28 is a statistical compendium prepared and : published by Oak Ridge National Laboratory (ORNL) under contract with the U.S. Department of : Energy, Office of Energy Efficiency and Renewable Energy, Vehicl...

  20. Climate Record Books

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Climate Record Books contain daily, monthly, seasonal, and annual averages, extremes, or occurrences. Most data are sequential by period of record 1871-1910,...