Self-Published Books: An Empirical "Snapshot"

Science.gov (United States)

Bradley, Jana; Fulton, Bruce; Helm, Marlene

2012-01-01

The number of books published by authors using fee-based publication services, such as Lulu and AuthorHouse, is overtaking the number of books published by mainstream publishers, according to Bowker's 2009 annual data. Little empirical research exists on self-published books. This article presents the results of an investigation of a random sample…

Promoting Self-Questioning through Picture Book Illustrations

Science.gov (United States)

Lohfink, Gayla

2013-01-01

This teaching tip manuscript demonstrates how picture book illustrations can be used as an inquiry tool that facilitates one's connecting of visual investigations in a picture to the process of generating self-questions. Techniques suggested to promote self-questioning are (1) introducing young readers to an interactive picture book read aloud…

Study of electrostatically self-assembled thin films of CdS and ZnS nanoparticle semiconductors

Science.gov (United States)

Suryajaya

In this work, CdS and ZnS semiconducting colloid nanoparticles coated with organic shell, containing either SO[3-] or NH[2+] groups, were deposited as thin films using the technique of electrostatic self-assembly. The films produced were characterized with UV-vis spectroscopy and spectroscopic ellipsometry - for optical properties; atomic force microscopy (AFM) - for morphology study; mercury probe - for electrical characterisation; and photon counter - for electroluminescence study. UV-vis spectra show a substantial blue shift of the main absorption band of both CdS and ZnS, either in the form of solutions or films, with respect to the bulk materials. The calculation of nanoparticles' radii yields the value of about 1.8 nm for both CdS and ZnS.The fitting of standard ellipsometry data gave the thicknesses (d) of nanoparticle layers of around 5 nm for both CdS and ZnS which corresponds well to the size of particles evaluated from UV-vis spectral data if an additional thickness of the organic shell is taken into account. The values of refractive index (n) and extinction coefficient (k) obtained were about 2.28 and 0.7 at 633 nm wavelength, for both CdS and ZnS.Using total internal reflection (TIRE), the process of alternative deposition of poly-allylamine hydrochloride (PAH) and CdS (or ZnS) layers could be monitored in-situ. The dynamic scan shows that the adsorption kinetic of the first layer of PAH or nanoparticles was slower than that of the next layer. The fitting of TIRE spectra gavethicknesses of about 7 nm and 12 nm for CdS and ZnS, respectively. It supports the suggestion of the formation of three-dimensional aggregates of semiconductor nanoparticles intercalated with polyelectrolyte.AFM images show the formation of large aggregates of nanoparticles, about 40-50 nm, for the films deposited from original colloid solutions, while smaller aggregates, about 12-20 nm, were obtained if the colloid solutions were diluted.Current-voltage (I-V) and capacitance

One-pot solvothermal route to self-assembly of cauliflower-shaped CdS microspheres

Energy Technology Data Exchange (ETDEWEB)

Ge Ming [Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Cui Yao [Institute of New Energy Material Chemistry, and Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), Nankai University, Tianjin 300071 (China); Liu Lu, E-mail: liul@nankai.edu.cn [Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Zhou Zhen, E-mail: zhouzhen@nankai.edu.cn [Institute of New Energy Material Chemistry, and Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), Nankai University, Tianjin 300071 (China)

2011-05-15

Nearly monodispersed cauliflower-shaped CdS microspheres were prepared through a simple one-step solvothermal route on a large scale by employing sodium dodecyl sulfate (SDS) as the surfactant. Images by field emission scanning electron microscope (FESEM) and transmission electron microscope (TEM) indicate that cauliflower-shaped CdS microspheres with diameters in the range from 1.3 to 4.5 {mu}m are assembled by nanoparticles with an average diameter of approximately 30 nm. The possible formation mechanism of the cauliflower-shaped CdS microspheres was also proposed. The photovoltaic activity of cauliflower-shaped CdS architectures has been investigated, indicating that the as-obtained CdS microspheres exhibited higher photovoltaic performance in comparison with CdS nanoparticles.

Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using ...

African Journals Online (AJOL)

Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using culture supernatants of Escherichia coli ATCC 8739, Bacillus subtilis ATCC 6633 and Lactobacillus ... The process of extracellular and fast biosynthesis may help in the development of an easy and eco-friendly route for the synthesis of CdS nanoparticles.

Cambridge English First 2 audio CDs : authentic examination papers

CERN Document Server

2016-01-01

Four authentic Cambridge English Language Assessment examination papers for the Cambridge English: First (FCE) exam. These examination papers for the Cambridge English: First (FCE) exam provide the most authentic exam preparation available, allowing candidates to familiarise themselves with the content and format of the exam and to practise useful exam techniques. The Audio CDs contain the recorded material to allow thorough preparation for the Listening paper and are designed to be used with the Student's Book. A Student's Book with or without answers and a Student's Book with answers and downloadable Audio are available separately. These tests are also available as Cambridge English: First Tests 5-8 on Testbank.org.uk

Effects of Self-Assembled Monolayers on Solid-State CdS Quantum Dot Sensitized Solar Cells

KAUST Repository

Ardalan, Pendar; Brennan, Thomas P.; Lee, Han-Bo-Ram; Bakke, Jonathan R.; Ding, I-Kang; McGehee, Michael D.; Bent, Stacey F.

2011-01-01

Quantum dot sensitized solar cells (QDSSCs) are of interest for solar energy conversion because of their tunable band gap and promise of stable, low-cost performance. We have investigated the effects of self-assembled monolayers (SAMs) with phosphonic acid headgroups on the bonding and performance of cadmium sulfide (CdS) solid-state QDSSCs. CdS quantum dots ∼2 to ∼6 nm in diameter were grown on SAM-passivated planar or nanostructured TiO 2 surfaces by successive ionic layer adsorption and reaction (SILAR), and photovoltaic devices were fabricated with spiro-OMeTAD as the solid-state hole conductor. X-ray photoelectron spectroscopy, Auger electron spectroscopy, ultraviolet-visible spectroscopy, scanning electron microscopy, transmission electron microscopy, water contact angle measurements, ellipsometry, and electrical measurements were employed to characterize the materials and the resulting device performance. The data indicate that the nature of the SAM tailgroup does not significantly affect the uptake of CdS quantum dots on TiO2 nor their optical properties, but the presence of the SAM does have a significant effect on the photovoltaic device performance. Interestingly, we observe up to ∼3 times higher power conversion efficiencies in devices with a SAM compared to those without the SAM. © 2011 American Chemical Society.

Effects of Self-Assembled Monolayers on Solid-State CdS Quantum Dot Sensitized Solar Cells

KAUST Repository

Ardalan, Pendar

2011-02-22

Quantum dot sensitized solar cells (QDSSCs) are of interest for solar energy conversion because of their tunable band gap and promise of stable, low-cost performance. We have investigated the effects of self-assembled monolayers (SAMs) with phosphonic acid headgroups on the bonding and performance of cadmium sulfide (CdS) solid-state QDSSCs. CdS quantum dots ∼2 to ∼6 nm in diameter were grown on SAM-passivated planar or nanostructured TiO 2 surfaces by successive ionic layer adsorption and reaction (SILAR), and photovoltaic devices were fabricated with spiro-OMeTAD as the solid-state hole conductor. X-ray photoelectron spectroscopy, Auger electron spectroscopy, ultraviolet-visible spectroscopy, scanning electron microscopy, transmission electron microscopy, water contact angle measurements, ellipsometry, and electrical measurements were employed to characterize the materials and the resulting device performance. The data indicate that the nature of the SAM tailgroup does not significantly affect the uptake of CdS quantum dots on TiO2 nor their optical properties, but the presence of the SAM does have a significant effect on the photovoltaic device performance. Interestingly, we observe up to ∼3 times higher power conversion efficiencies in devices with a SAM compared to those without the SAM. © 2011 American Chemical Society.

Efficacy of a Multicomponent Positive Psychology Self-Help Intervention: Study Protocol of a Randomized Controlled Trial

Science.gov (United States)

Drossaert, Constance HC; Pieterse, Marcel E; Walburg, Jan A; Bohlmeijer, Ernst T

2015-01-01

Background Positive psychology interventions have been found to enhance well-being and decrease clinical symptomatology. However, it is still unknown how flourishing can also be increased. Although multicomponent interventions seem to be necessary for this purpose, different formats can be used. A cost-effective approach could be a positive psychology-based self-help book with tailored email support to reach large target groups and to prevent dropout. Objective This study will evaluate the efficacy of a comprehensive multicomponent self-help intervention with or without email support on well-being and flourishing, and will seek to determine the working mechanisms underlying the intervention. Methods In this 3-armed, parallel, randomized controlled trial, 396 participants with low or moderate levels of well-being and without clinical symptomatology will be randomly assigned to (1) a self-help book condition with weekly email support, (2) a self-help book condition without email support but with a weekly information email, or (3) a waiting list control condition. Online measurements will be assessed at baseline, at post-test (3 months after baseline), and at 6 and 12 months after baseline. Results The primary outcomes are well-being and flourishing (ie, high levels of well-being). Secondary outcomes are the well-being components included in the intervention: positive emotion, use of strengths, optimism, self-compassion, resilience, and positive relations. Other measures include depressive and anxiety symptoms, personality traits, direct medical and non-medical costs, life-events, and client satisfaction. Conclusions This study will add knowledge to the efficacy and cost-effectiveness of a multicomponent positive psychology intervention. We will also explore who can benefit most from this intervention. If the intervention is found to be effective, our results will be especially relevant for public mental health services, governments, and primary care. Trial

Simple and green synthesis of protein-conjugated CdS nanoparticles and spectroscopic study on the interaction between CdS and zein

Energy Technology Data Exchange (ETDEWEB)

Qin, Dezhi, E-mail: dezhiqin@163.com; Zhang, Li; Du, Xian; Wang, Yabo; Zhang, Qiuxia [Pingdingshan University, College of Chemistry and Environmental Engineering (China)

2016-09-15

The present study demonstrates the role of zein molecules in synthesizing CdS nanoassemblies through protein-directed, green synthetic approach. Zein molecules can as capping ligand and stabilizing agent to regulate the nucleation and growth of CdS nanocrystals, and the obtained products are organic–inorganic nanocomposites. The analysis of surface charge and conductivity indicates that strong electrostatic force restricts mobility of ions, which creates a local supersaturation surrounding the binding sites of zein and reduces the activated energy of nucleation. The interaction between Cd{sup 2+}/CdS and zein molecules was systematically investigated through spectroscopy techniques. Fourier transform infrared (FT-IR) spectra were used to envisage the binding of the functional groups of zein with the surface of CdS nanoparticles. Ultraviolet visible (UV–Vis) and photoluminescence (PL) spectra results show that Cd{sup 2+}/CdS might interact with the aromatic amino acids of protein molecules and change its chemical microenvironment. The quantum-confined effect of nanocrystals is confirmed by optical absorption spectrum due to the small size (3–5 nm) of CdS particles. The data of circular dichroism (CD) spectra indicate that the formation of CdS nanocrystals could lead to the conformational change of zein molecules. Moreover, the possible mechanism of CdS nanocrystals growth in zein solution was also discussed. The weak interactions such as Van der Waals, hydrophobic forces and hydrogen bonds in zein molecules should play a crucial factor in the self-assembly of small nanoparticles.

The author training manual develop marketable ideas, craft books that sell, become the author publishers want, and self-publish effectively

CERN Document Server

Amir, Nina

2014-01-01

Anyone can publish a book and become an ""author,"" but if you want to become a successful author with a profitable publishing career, you need a clear, step-by-step guide to help you develop book ideas that sell. In The Author Training Manual, expert editor and book coach Nina Amir reveals the exact process successful authors have used to create business plans and proposals for their books and teaches you how to view your ideas through the eyes of acquisitions editors and literary agents. Whether you write fiction or nonfiction, plan to traditionally publish or self-publish, The Author Tra

Who Seeks Help Online for Self-Injury?

Science.gov (United States)

Frost, Mareka; Casey, Leanne

2016-01-01

The objective of this study was to identify differences between young people who seek help online for self-injury and those who self-injure but do not seek help online, in order to improve online services for young people at high risk of suicide. Young people reporting a history of self-injury (N = 679) were identified as part of larger study (N = 1,463) exploring help-seeking. One third of young people with a history of self-injury reported online help-seeking for self-injury. Online help-seekers were significantly more distressed, suicidal, and had a greater degree of self-injury compared to those who did not seek help online. The Internet provides an important form of support to the most at risk young people in this population, and may be a proximal step to face-to-face help-seeking. Further research is required to investigate the forms of support currently accessed by young people online, and their effectiveness.

Books/Boeke

African Journals Online (AJOL)

answer these questions, unless they are total in-depth addicts to the contentious nursing ... Self- proclaimed middle of the road political psychologists have tended to portray ..... This well-produced book reports the proceedings of the Second. International ... ment of the Faculty by some who helped to shape it and others.

Self-Help Groups and Professional Helpers.

Science.gov (United States)

Balgopal, Pallassana R.; And Others

1986-01-01

Suggests innovative solutions for mutual benefits for self-help groups and the professionals. Through a derivative paradigm the role of the professional helper within self-help groups is presented. (Author/BL)

CERN Document Server (CDS): Introduction

CERN Multimedia

CERN. Geneva; Costa, Flavio

2017-01-01

A short online tutorial introducing the CERN Document Server (CDS). Basic functionality description, the notion of Revisions and the CDS test environment. Links: CDS Production environment CDS Test environment  

Guided self-help cognitive behavioural therapy for depression in primary care: a randomised controlled trial.

Directory of Open Access Journals (Sweden)

Christopher Williams

Full Text Available BACKGROUND: Access to Cognitive behavioural therapy (CBT for depression is limited. One solution is CBT self-help books. Trial Objectives: To assess the impact of a guided self-help CBT book (GSH-CBT on mood, compared to treatment as usual (TAU. HYPOTHESES: GSH-CBT will have improved mood and knowledge of the causes and treatment of depression compared to the control receiving TAUGuided self-help will be acceptable to patients and staff. METHODS AND FINDINGS: PARTICIPANTS: Adults attending seven general practices in Glasgow, UK with a BDI-II score of ≥14. 141 randomised to GSH-CBT and 140 to TAU. INTERVENTIONS: RCT comparing 'Overcoming Depression: A Five Areas Approach' book plus 3-4 short face to face support appointments totalling up to 2 hours of guided support, compared with general practitioner TAU. PRIMARY OUTCOME: The BDI (II score at 4 months. Numbers analysed: 281 at baseline, 203 at 4 months (primary outcome, 117 at 12 months. OUTCOME: Mean BDI-II scores were lower in the GSH-CBT group at 4 months by 5.3 points (2.6 to 7.9, p<0.001. At 4 and 12 months there were also significantly higher proportions of participants achieving a 50% reduction in BDI-II in the GSH-CBT arm. The mean support was 2 sessions with 42.7 minutes for session 1, 41.4 minutes for session 2 and 40.2 minutes of support for session 3. Adverse effects/Harms: Significantly less deterioration in mood in GSH-CBT (2.0% compared to 9.8% in the TAU group for BDI-II category change. LIMITATIONS: Weaknesses: Our follow-up rate of 72.2% at 4 months is better than predicted but is poorer at 12 months (41.6%. In the GSH-CBT arm, around 50% of people attended 2 or fewer sessions. 22% failed to take up treatment. CONCLUSIONS: GSH-CBT is substantially more effective than TAU. TRIAL REGISTRATION: Controlled-Trials.com ISRCTN13475030.

[Performance of self-help groups and their economic evaluation].

Science.gov (United States)

Engelhardt, H D; Trojan, A; Nickel, S

2009-01-01

Hoffmann von Fallersleben is quoted with the sentence "Self-help is worthwhile, because it does not demand anything from others". This sounds catchy; it is, however, wrong: Self-help groups ask for support, particularly for financial resources for the work of either individual, highly organized self-help associations or for general support of self-help groups via local contact and information centers ("contact points for self-help groups"). With this request for economic "investments" in self-help, the question arises whether this is profitable for the country, the local authority or the social health insurance. In principle, the initial answer to this is: yes, the work of self-help groups is worthwhile for a single person, but also for the larger community, as various kinds of services are provided by self-help groups and organizations. Despite many surveys of members or co-operation partners which show positive effects of self-help groups, the question remains whether services of self-help groups can be measured and economically evaluated. The socio- political question regarding funding is closely connected to the idea of an economic evaluation of self-help groups. The aim of this article is to summarize and discuss which empiric approaches and findings are available on this subject. The monetary value for the work done per member of self-help groups and year lies between approximately 700 and 900 EUR.

Review of the Book “Defense Mechanisms. Coping Strategies. Self-Regulation”

Directory of Open Access Journals (Sweden)

Stoil Mavrodiev

2012-10-01

Full Text Available This book deals with coping strategies and defense mechanisms as two kinds of self-regulation of human behaviour. The defense mechanisms are described with some examples of fiction books.

41 CFR 301-50.6 - What is an “online self-service booking tool?”

Science.gov (United States)

2010-07-01

.... ETS and some agency TMS's incorporate a self service booking tool. [FTR Amdt. 2006-04, 71 FR 49375...-service booking tool?â 301-50.6 Section 301-50.6 Public Contracts and Property Management Federal Travel...-service booking tool?” An online self-service booking tool is an Internet based system that permits...

Choosing Great Books for Babies: Helping Children Develop a Life-Long Love of Reading

Science.gov (United States)

Honig, Alice Sterling

2007-01-01

This article describes how a great choice of books could help children develop a life-long love of reading. Every teacher wants to boost a baby's chances in later success. The single most powerful tool a teacher has for awakening a deep love of books and learning is to read to children daily. Reading should become a loved, intimate activity filled…

Self-assembly of tetrapod-shaped CdS nanostructures into 3D networks by a transverse growth process

International Nuclear Information System (INIS)

Fu Xiuli; Li Dan; Zhang Lei; Xiao Jinghua; Li Jiangyan; Peng Zhijian; Fang Zheyu

2011-01-01

Spontaneous formation of 3D tetrapod-shaped CdS nanostructure networks has been achieved for the first time by vapor diffusion-deposition growth from CdS powders. The growth mechanism of the hexagonal and preferentially oriented CdS tetrapod-shaped nanostructures is a combination of the classic vapor-liquid-solid and vapor-solid processes, and the formation of a 3D network results from the spontaneous growths along the longitudinal and across the axial directions of the primarily formed CdS nanorods. Micro-photoluminescence measurements and near-field scanning optical microscopy investigations show that the synthesized CdS tetrapod networks have an excellent luminescence property and can be used as an optical waveguide cavities in which the guided light can be extremely confined.

Luminescence studies of CdS spherical particles via hydrothermal synthesis

Science.gov (United States)

Xu, Guo Qin; Liu, Bing; Xu, Shi Jie; Chew, Chwee Har; Chua, Soo Jin; Gana, Leong Ming

2000-06-01

The spherical particles of CdS consisting of nanoparticles (∼100 nm) were synthesized by a hydrothermal process. The particle formation and growth depend on the rate of sulfide-ion generation and diffusion-controlled aggregation of nanoparticles. As demonstrated in the profiles of powder X-ray diffraction, the crystalline phases are governed by the reaction temperature. Photoluminescence studies on CdS particles show two emission bands at the room temperature. The red emission at 680 nm is due to sulfur vacancies, and a new infrared red (IR) emission at 760 nm is attributed to self-activated centers. A red shift of IR band with the decrease of temperature was explained with a configurational coordinate model. The different saturation limits for the red and IR bands are discussed in terms of the formation of donor-acceptor pairs and exciton in CdS particles.

TiO2-CdS Nanocomposites: Effect of CdS Oxidation on the Photocatalytic Activity

Directory of Open Access Journals (Sweden)

A. Hamdi

2016-01-01

Full Text Available Nanocomposites TiO2-CdS with different relative contents of CdS (molar ratios Cd/Ti = 0.02, 0.03, 0.05, 0.1, 0.2, and 0.5 were studied. The structural, photophysical, and chemical properties were investigated using XRD, Raman spectroscopy, XPS, GSDR, and LIL. XRD and Raman results confirmed the presence of TiO2 and CdS with intensities dependent on the ratio Cd/Ti. The presence of CdSO4 was detected by XPS at the surface of all TiO2-CdS composites. The relative amount of sulphate was dependent on the CdS loading. Luminescence time-resolved spectra clearly proved the existence of an excitation transfer process from CdS to TiO2 through the luminescence emission from TiO2 after excitation of CdS at λexc=410 nm, where no direct excitation of TiO2 occurs. Photodegradation of a series of aromatic carboxylic acids—benzoic, salicylic, 4-bromobenzoic, 3-phenylpropionic, and veratric acids—showed a great enhancement in the photocatalytic efficiency of the TiO2-CdS composites, which is due, mainly, to the effect of the charge carriers’ increased lifetime. In addition, it was shown that the oxidation of CdS to CdSO4 did not result in the deactivation of the photocatalytic properties and even contributed to enhance the degradation efficiency.

C. pneumoniae CdsL regulates CdsN ATPase activity, and disruption with a peptide mimetic prevents bacterial invasion

Directory of Open Access Journals (Sweden)

Chris Blair Stone

2011-02-01

Full Text Available Chlamydiae are obligate intracellular pathogens that likely require type III secretion (T3S to invade cells and replicate intracellulary within a cytoplasmic vacuole called an inclusion body. C. pneumoniae possess a YscL ortholog, CdsL, that has been shown to interact with the T3S ATPase (CdsN. In this report we demonstrate that CdsL down-regulates CdsN enzymatic activity in a dose-dependent manner. Using PepScan epitope mapping we identified two separate binding domains to which CdsL binds viz. CdsN 221-229 and CdsN265-270. We confirmed the binding domains using a pull-down assay and showed that GST-CdsN221-270, which encompasses these peptides, co-purified with His-CdsL. Next, we used orthology modeling based on the crystal structure of a T3S ATPase ortholog from E. coli, EscN, to map the binding domains on the predicted three dimensional structure of CdsN. The CdsL binding domains mapped to the catalytic domain of the ATPase, one in the central channel of the ATPase hexamer and one on the outer face. Since peptide mimetics have been used to disrupt essential protein interactions of the chlamydial T3S system and inhibit T3S-mediated invasion of HeLa cells, we hypothesized that if CdsL – CdsN binding is essential for regulating T3S then a CdsN peptide mimetic could be used to potentially block T3S and Chlamydial invasion. Treatment of EBs with a CdsN peptide mimetic inhibited C. pneumoniae invasion into HeLa cells in a dose-dependent fashion. This report represents the first use of Pepscan technology to identify binding domains for specific T3S proteins viz. CdsL on the ATPase, CdsN, and demonstrates that peptide mimetics can be used as anti-virulence factors to block bacterial invasion.

Neurodharma Self-Help: Personalized Science Communication as Brain Management.

Science.gov (United States)

Eklöf, Jenny

2017-09-01

Over the past ten to fifteen years, medical interventions, therapeutic approaches and scientific studies involving mindfulness meditation have gained traction in areas such as clinical psychology, psychotherapy, and neuroscience. Simultaneously, mindfulness has had a very strong public appeal. This article examines some of the ways in which the medical and scientific meaning of mindfulness is communicated in public and to the public. In particular, it shows how experts in the field of mindfulness neuroscience seek to communicate to the public at large the imperative of brain fitness for the promotion of health, wellbeing and happiness. The study identifies claims being made in popular outlets that, by and large, bypass traditional mass media, such as self-help books, websites and online videos. By treating this material as a form of personalized science communication, this article contributes to the body of literature that understands science communication as a continuum and the boundary between science and popularized science as the outcome of human negotiations. The study finds that processes of personalization help to build bridges between scientific findings and their supposed application, that they infuse science with subjective meaning, and turn expert communication with the public into a moral vocation.

Disentangling self-stigma: are mental illness and help-seeking self-stigmas different?

Science.gov (United States)

Tucker, Jeritt R; Hammer, Joseph H; Vogel, David L; Bitman, Rachel L; Wade, Nathaniel G; Maier, Emily J

2013-10-01

Two established but disparate lines of research exist: studies examining the self-stigma associated with mental illness and studies examining the self-stigma associated with seeking psychological help. Whereas some researchers have implicitly treated these 2 constructs as synonymous, others have made the argument that they are theoretically and empirically distinct. To help clarify this debate, we examined in the present investigation the overlap and uniqueness of the self-stigmas associated with mental illness and with seeking psychological help. Data were collected from a sample of college undergraduates experiencing clinical levels of psychological distress (N = 217) and a second sample of community members with a self-reported history of mental illness (N = 324). Confirmatory factor analyses provide strong evidence for the factorial independence of the 2 types of self-stigma. Additionally, results of regression analyses in both samples suggest that the 2 self-stigmas uniquely predict variations in stigma-related constructs (i.e., shame, self-blame, and social inadequacy) and attitudes and intentions to seek help. Implications for researchers and clinicians interested in understanding stigma and enhancing mental health service utilization are discussed.

Sociological perspectives on self-help groups

DEFF Research Database (Denmark)

Adamsen, L; Rasmussen, J M

2001-01-01

and significance of self-help groups. FINDINGS: New empirical sociological evidence shows that health care professionals - nurses, psychologists, social workers - have become an integrated part and thus essential actors in self-help groups within as well as outside the framework of the formal health care system...... that it is necessary to introduce new aspects and themes for discussion in the health care debate and the work that goes beyond the predominantly individual orientated treatment and care function....

Book review: Reptiles and amphibians: Self-assessment color review

Science.gov (United States)

Green, David E.

2017-01-01

No abstract available.Book information: Reptiles and Amphibians: Self-Assessment Color Review. 2nd Edition. By Fredric L. Frye. CRC Press, Taylor and Francis Group, Boca Raton, Florida USA. 2015. 252 pp. ISBN 9781482257601.

A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

Energy Technology Data Exchange (ETDEWEB)

Padmaja, S. [Thin film centre, PSG College of Technology, Coimbatore (India); Jayakumar, S., E-mail: s_jayakumar_99@yahoo.com [Department of Physics, PSG Institute of Technology and Applied Research, Coimbatore (India); Balaji, R.; Vaideki, K. [Thin film centre, PSG College of Technology, Coimbatore (India)

2016-08-15

Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

International Nuclear Information System (INIS)

Padmaja, S.; Jayakumar, S.; Balaji, R.; Vaideki, K.

2016-01-01

Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

Self-help conferences for people who stutter: a qualitative investigation.

Science.gov (United States)

Trichon, Mitchell; Tetnowski, John

2011-12-01

Self-help activities for people who stutter (PWS) have been gaining in popularity; however, there is a scarcity of evidence to support their utility in stuttering management. The purpose of this investigation was to understand the lived experience of individuals who attended a self-help conference(s) for PWS from the perspective of a PWS to learn its potential utility in stuttering management. The investigator used Interpretive Phenomenological Analysis (IPA) to systematically collect authentic data of this social phenomenon. Twelve participants were recruited from a self-help conference and the self-help community of PWS. Semi-structured interviews were conducted 4-18 months after each participant's last conference. Interviews were transcribed and analyzed. Themes were explained in investigator narratives and illustrated through participants' quotes. Interpreted themes of the experience of having attended a self-help conference(s) for PWS included: socializing opportunities with other PWS, affiliation, redefining oneself and post-conference disclosures. A conclusion of the study was that the experience of having attended a self-help conference(s) for PWS helped to minimize negative impact that stuttering can have on daily functioning. It appears that self-help conferences were perceived as a safer or "stutter-friendly" environment and promoted social interaction, relationship building, and community building through planned and unplanned activities. Another conclusion was that the experience of having attended self-help conferences for PWS helped participants to communicate more easily. Reported increases in social activity and an "openness" about stuttering, suggest self-help conferences' utility in stuttering management. These findings are supported by other studies about successful stuttering management and self-help activities for PWS. They have helped attendees who stutter to communicate more easily and suggest a reduction in the negative impact that

Phase- and shape-controlled hydrothermal synthesis of CdS nanoparticles, and oriented attachment growth of its hierarchical architectures

Science.gov (United States)

Cao, Yali; Hu, Pengfei; Jia, Dianzeng

2013-01-01

Hydrothermal strategies were successfully used to control the phases and morphologies of CdS nanocrystals. In the absence of an external direction-controlling process, the hexagonal and cubic phase well-defined leaf- and flower-like CdS nanocrystals were controlled obtained via adjusting the reaction duration or the concentration of surfactant. Oriented attachment growth modes were suggested for the formation of CdS superstructures, which was clarified through the tracing of temporal evolution of CdS nanoparticles. The CdS superstructures were structured by primary building nanoparticles, and held excellent visible emission with a peak in the green regions. This strategy is very helpful for studying the phase and morphology controlled fabrication of sulfides nanocrystals.

Enriching the Metadata on CERN Document Server And Implementation of a Book Acquisition System To Predict the potential bottlenecks in availability of records in Library

CERN Document Server

Ahuja, Chakshu

2015-01-01

The automated script for data acquisition project ( bibtasklet ) which aims to enhance existing metadata in our CERN Document Server with data from Springer was implemented. An implicit part of this task is to manage disambiguation (within incoming data), removal of multiple entries, handle replications between new and existing records and further automate the latest file upload task to CDS. All such elements and their corresponding changes are integrated within Invenio to make the upgraded metadata available on the CDS. Another implementation was to make a web interface for the invenio software to calculate the normalized loan period to help the librarians to predict bottleneck on the books on loan over certain period of time and facilitate their decision to buy the new records accordingly.

Cyber-support: an analysis of online self-help forums (online self-help forums in bipolar disorder).

Science.gov (United States)

Bauer, Rita; Bauer, Michael; Spiessl, Hermann; Kagerbauer, Tanja

2013-06-01

The Internet is becoming increasingly important in psychiatry and psychotherapy. The objective of this study was to evaluate if and how online self-help forums are used by patients with bipolar disorders, their relatives and treating professionals. A total of 2400 postings in two online forums were analysed qualitatively and quantitatively. "Disclosure", "friendship" and "online-group cohesion" were the main self-help mechanisms. The topics most discussed were "social network", "symptoms of the illness" and "medication". Factor analyses revealed three factors concerning self-help mechanisms: "group cohesion", "emotional support" and "exchange of information", as well as three factors concerning fields of interest: "illness-related aspects", "social aspects" and "financial and legal issues". We infer that the main interest in participating in online forums for patients with bipolar disorders and their relatives is to share emotions and to discuss their daily struggles with the illness. Our study also reveals that social networking is very important for patients coping with bipolar disorders. Psycho-educative programmes should focus on those aspects.

Role of Self-help Group in Substance Addiction Recovery

Science.gov (United States)

Das, Prangya Paramita Priyadarshini

2012-11-01

Background: The Narcotics Anonymous (NA)/Alcoholic Anonymous(AA) is based on the philosophy of self-help, where the former addicts and recovering addicts share experiences, provide emotional support and do active monitoring through mentoring. In mentoring, a former addict with longer duration of drug-free life acts as a guide to the newly recovering addict. Objective: The objective was to study the effect of involvement in self help group upon addictís level of depression, functional social support, and anxiety. Method: The size of the sample was 60. 30 addicts were taken from rehabilitation centre and 30 were taken from self-help groups. ANOVA was used to analyze the result. Result: In all the criteria it was found that there exists a significant impact of Self-help group. Conclusion: Self-help group provide clients with a social network of individuals with similar problems and experiences, since most of these individuals may be isolated from society due to the social stigma attached to their addictions. The transition from being help recipients to being helpers enables recovering addicts to build their self-confidence and feelings of being wanted and desired in society, which facilitates their self-confidence and positive self-esteem.

Mesoporous CdS via Network of Self-Assembled Nanocrystals: Synthesis, Characterization and Enhanced Photoconducting Property.

Science.gov (United States)

Patra, Astam K; Banerjee, Biplab; Bhaumik, Asim

2018-01-01

Semiconduction nanoparticles are intensively studied due to their huge potential in optoelctronic applications. Here we report an efficient chemical route for hydrothermal synthesis of aggregated mesoporous cadmium sulfide (CdS) nanoparticles using supramolecular-assembly of ionic and water soluble sodium salicylate as the capping agent. The nanostructure, mesophase, optical property and photoconductivity of these mesoporous CdS materials have been characterized by using small and wide angle powder X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM), N2-sorption, Raman analysis, Fourier transformed infrared (FT-IR), UV-Visible DSR spectroscopy, and photoconductivity measurement. Wide angle XRD pattern and high resolution TEM image analysis suggested that the particle size of the materials is within 10 nm and the nanoparticles are in well-crystallized cubic phase. Mesoporous CdS nanoparticles showed drastically enhanced photoelectrochemical response under visible light irradiation on entrapping a photosensitizer (dye) molecule in the interparticle spaces. Efficient synthesis strategy and the enhanced photo response in the mesoporous CdS material could facilitate the designing of other porous semiconductor oxide/sulfide and their applications in photon-to-electron conversion processes.

Self-Help for Depression via E-mail: A Randomised Controlled Trial of Effects on Depression and Self-Help Behaviour.

Directory of Open Access Journals (Sweden)

Amy J Morgan

Full Text Available Self-help or self-management strategies are commonly used to deal with depression, but not all are thought to be helpful. A previous study found that sub-threshold depression symptoms were improved by an e-mail intervention that encouraged the use of evidence-based self-help strategies.To investigate whether these e-mails were effective for adults with a range of depression symptomatology including major depression.The study was a parallel-group randomised controlled trial. Adult participants with any level of depressive symptoms were recruited over the internet from the United Kingdom, Australia, Canada, Ireland, New Zealand and the United States. Participants were randomised to receive a series of e-mails either promoting the use of evidence-based self-help strategies or containing depression information as a control. E-mails were sent automatically twice a week for six weeks. Depression symptoms were assessed with the self-rated Patient Health Questionnaire depression scale (PHQ-9.1736 participants with a wide range of symptom severity were recruited and assigned to active (n = 862 and control (n = 874 groups. However, there was a significant attrition rate, with 66.9% lost to follow-up at post-intervention. Both groups showed large improvements in depression symptoms overall, with no significant difference in improvement at the end of the study (mean difference in improvement 0.35 points, 95% CI: -0.57 to 1.28, d = 0.11, 95% CI: -0.06 to 0.27, although there was a small effect at the study mid-point. Results were similar for the sub-group of participants with major depression. The active group showed small to moderate improvements in self-help behaviour (d = 0.40, 95% CI: 0.23 to 0.56.These results suggest that the e-mails were able to increase participants' use of evidence-based self-help, but that this did not improve depression more than an attention control.NCT01399502.

Loose-fit polypseudorotaxanes constructed from γ-CDs and PHEMA-PPG-PEG-PPG-PHEMA

Directory of Open Access Journals (Sweden)

Tao Kong

2014-10-01

Full Text Available A pentablock copolymer was prepared via the atom transfer radical polymerization of 2-hydroxyethyl methacrylate (HEMA initiated by 2-bromoisobutyryl end-capped PPO-PEO-PPO as a macroinitiator in DMF. Attaching PHEMA blocks altered the self-assembly process of the pentablock copolymer with γ-CDs in aqueous solution. Before attaching the PHEMA, the macroinitiator was preferentially bent to pass through the inner cavity of γ-CDs to give rise to tight-fit double-chain stranded polypseudorotaxanes (PPRs. After attaching the PHEMA, the resulting pentablock copolymer was single-chain stranded into the interior of γ-CDs to form more stable, loose-fit PPRs. The results of 1H NMR, WXRD, DSC, TGA, 13C CP/MAS NMR and FTIR analyses indicated that γ-CDs can accommodate and slip over PHEMA blocks to randomly distribute along the entire pentablock copolymer chain. This results in unique, single-chain stranded PPRs showing no characteristic channel-type crystal structure.

The importance of gold-electrode-adjacent stationary high-field Boeer domains for the photoconductivity of CdS

Energy Technology Data Exchange (ETDEWEB)

Boeer, Karl Wolfgang [Department of Physics and Astronomy, University of Delaware, Newark, DE (United States)

2015-06-15

When the electron density decreases stronger than linearly with the electric field in photoconductive CdS due to field quenching, high-field domains must occur that remain attached to either the cathode or anode in slit electrode geometry with blocking cathodes. These Boeer domains{sup 1} are easily seen by their shift in optical absorption due to the Franz-Keldysh effect and offer unique opportunities to analyze field dependent parameters within the range of constant electron density and electric field, such as the carrier density or mobility as a function of the field, and give information of the light dependent work function. They also provide insight why a 200 Aa thick cover layer of CdS on top of a CdTe solar cell increases its efficiency from 8 to 16%. The behavior of these Boeer domains escapes conventional current voltage analyses except for their visual observation, while other high-field domains with their current fluctuations or oscillations are easily observed and are the subjects of thousands of publications and many books. In this review we will exclude detailed discussion of dynamic domains, but include some new specifics that help to understand the mechanisms of the Boeer domains and their applications. Only properties at low optical excitation intensities are discussed that exclude Joules heating. Within the p-type regime of the anode-adjacent domain extremely steep electronic quenching signal becomes visible that could signalize an intrinsic donor level slightly above the middle of the band gap that may be responsible for not allowing CdS to ever become p-type by doping. (copyright 2015 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Template-directed nucleation and growth of CdS nanocrystal: the role of helical and nonhelical nanofibers on their shape and size

International Nuclear Information System (INIS)

Bose, Partha Pratim; Banerjee, Arindam

2010-01-01

This study describes the use of chiral nature of synthetic self-assembled nanofibers for nucleation and growth of Cadmium sulfide (CdS) nanocrystals with different sizes and shapes in room temperature. The templates are built by immobilizing a peptide capping agent on the surface of synthetic self-assembled helical or nonhelical nanofibers and CdS nanocrystals were allowed to grow on them. It is observed that there are differences in shapes and sizes of the nanocrystals depending on the chiral nature of the nanofibers on which they were growing. Even the CdS nanocrystals grown on different chiral and achiral nanofibers differ markedly in their photoluminescence properties. Thus, here we introduce a new way of using chirality of nanofibers to nucleate and grow CdS nanocrystals of different shape, size, and optical property.

Safe-haven CDS Premia

DEFF Research Database (Denmark)

Klingler, Sven; Lando, David

We argue that Credit Default Swap (CDS) premia for safe-haven sovereigns, like Germany and the United States, are driven to a large extent by regulatory requirements under which derivatives dealing banks have an incentive to buy CDS to hedge counterparty credit risk of their counterparties. We...

Clinical Decision Support (CDS) Inventory

Data.gov (United States)

U.S. Department of Health & Human Services — The Clinical Decision Support (CDS) Inventory contains descriptions of past and present CDS projects across the Federal Government. It includes Federal projects,...

Self-assembly of cyclodextrins

DEFF Research Database (Denmark)

Fülöp, Z.; Kurkov, S.V.; Nielsen, T.T.

2012-01-01

The design of functional cyclodextrin (CD) nanoparticles is a developing area in the field of nanomedicine. CDs can not only help in the formation of drug carriers but also increase the local concentration of drugs at the site of action. CD monomers form aggregates by self-assembly, a tendency...... that increases upon formation of inclusion complexes with lipophilic drugs. However, the stability of such aggregates is not sufficient for parenteral administration. In this review CD polymers and CD containing nanoparticles are categorized, with focus on self-assembled CD nanoparticles. It is described how...

Scientific Library’s Book and Media Swap Coming April 16 | Poster

Science.gov (United States)

By Robin Meckley, Contributing Writer The 14th annual Book and Media Swap will be held on Wednesday, April 16, from 10 a.m. to 2 p.m., in the lobby of the Conference Center in Building 549. The staff is holding the swap to coincide with National Library Week, an annual celebration of libraries that occurs in April. As of April 10, the library had collected nearly 2,000 books, DVDs, and CDs for the swap. Employees who donated these items received book cards indicating the number of items donated. 

Safe Haven CDS Premiums

DEFF Research Database (Denmark)

Klingler, Sven; Lando, David

Credit Default Swaps can be used to lower capital requirements of dealer banks who enter into uncollateralized derivatives positions with sovereigns. We show in a model that the regulatory incentive to obtain capital relief makes CDS contracts valuable to dealer banks and empirically that...... support that CDS contracts are used for capital relief....

Psychometric testing of the modified Care Dependency Scale (Neuro-CDS).

Science.gov (United States)

Piredda, Michela; Biagioli, Valentina; Gambale, Giulia; Porcelli, Elisa; Barbaranelli, Claudio; Palese, Alvisa; De Marinis, Maria Grazia

2016-01-01

Effective measures of nursing care dependency in neurorehabilitation are warranted to plan nursing interventions to help patients avoid increasing dependency. The Care Dependency Scale (CDS) is a theory-based, comprehensive tool to evaluate functional disability. This study aimed to modify the CDS for neurological and neurorehabilitation patients (Neuro-CDS) and to test its psychometric properties in adult neurorehabilitation inpatients. Exploratory factor analysis (EFA) was performed using a Maximum Likelihood robust (MLR) estimator. The Barthel Index (BI) was used to evaluate concurrent validity. Stability was measured using the Intra-class Correlation Coefficient (ICC). The sample included 124 patients (mean age = 69.7 years, 54% male). The EFA revealed a two-factor structure with good fit indexes, Factor 1 (Physical care dependence) loaded by 11 items and Factor 2 (Psycho-social care dependence) loaded by 4 items. The correlation between factors was 0.61. Correlations between Factor 1 and the BI and between Factor 2 and the BI were r = 0.843 and r = 0.677, respectively (p dependence in neurorehabilitation patients as a basis for individualized and holistic care.

White light emitting device based on single-phase CdS quantum dots

Science.gov (United States)

Li, Feng; Nie, Chao; You, Lai; Jin, Xiao; Zhang, Qin; Qin, Yuancheng; Zhao, Feng; Song, Yinglin; Chen, Zhongping; Li, Qinghua

2018-05-01

White light emitting diodes (WLEDs) based on quantum dots (QDs) are emerging as robust candidates for white light sources, however they are suffering from the problem of energy loss resulting from the re-absorption and self-absorption among the employed QDs of different peak wavelengths. It still remains a challenging task to construct WLEDs based on single-phase QD emitters. Here, CdS QDs with short synthesis times are introduced to the fabrication of WLEDs. With a short synthesis time, on one hand, CdS QDs with a small diameter with blue emission can be obtained. On the other hand, surface reconstruction barely has time to occur, and the surface is likely defect-ridden, which enables the existence of a broad emission covering the range of green, yellow and red regions. This is essential for the white light emission of CdS QDs, and is very important for WLED applications. The temporal evolution of the PL spectra for CdS QDs was obtained to investigate the influence of growth time on the luminescent properties. The CdS QDs with a growth time of 0.5 min exhibited a colour rendering index (CRI) of 79.5 and a correlated colour temperature (CCT) of 6238 K. With increasing reaction time, the colour coordinates of the CdS QDs will move away from the white light region in the CIE 1931 chromaticity diagram. By integrating the as prepared white light emission CdS QDs with a violet GaN chip, WLEDs were fabricated. The fabricated WLEDs exhibited a CRI of 87.9 and a CCT of 4619 K, which satisfy the demand of general illumination. The luminous flux and the luminous efficiency of the fabricated WLEDs, being less advanced than current commercial white light sources, can be further improved, meaning there is a need for much more in-depth studies on white light emission CdS QDs.

Online self-help forums on cannabis: A content assessment.

Science.gov (United States)

Greiner, Christian; Chatton, Anne; Khazaal, Yasser

2017-10-01

To investigate online self-help forums related to cannabis users who were searching for help on the Internet. We analyzed the content of 717 postings by 328 users in three online forums in terms of fields of interest and self-help mechanisms. Only English-language forums that were free of charge and without registration were investigated. The main self-help mechanisms were disclosure and symptoms, with relatively few posts concerning legal issues and social perceptions. The forums differed significantly in all fields of interest and self-help mechanisms except for social network and financial and vocational issues. Highly involved users more commonly posted on topics related to diagnosis, etiology/research, and provision of information and less commonly on those related to gratitude. Correlation analysis showed a moderate negative correlation between emotional support and illness-related aspects and between emotional support and exchange of information. Cannabis forums share similarities with other mental health forums. Posts differ according to user involvement and the specific orientation of the forum. The Internet offers a viable source of self-help and social support for cannabis users, which has potential clinical implications in terms of referring clients to specific forums. Copyright © 2017 Elsevier B.V. All rights reserved.

User centered design of the digital book: why looking backward can help us move forward

Science.gov (United States)

Wallis, Jillian C.

2006-02-01

What is emerging from the digital book revolution is a state of technology that has brought new affordances to the book, such as search, hyperlinking, personalization, dynamic content, 24/7 access, automated indexing and summarizing, aggregated content, and new modes of reading and access. These could solve some of the issues users have with the static content of traditional bound volumes, but the technology so far has staunchly ignored the tried and true technologies of books, such as infinite resolution, high contrast, low glare, haptic navigation, typographic niceties, and the rights of first sale to borrow, lend, or resell a work. By exploring a survey of literature, reviews, and user tests, I intend to address the point of how the current concept of the digital book is an inappropriate tool for the user and the task of reading, and as a result not been enthusiastically embraced by the market. The collected evidence indicates that it is impossible to forget our past in our quest for the future, and that technology can help us to unite the disparate realities of analog and digital to create a truly digital book.

Strasbourg Astronomical Data Center (CDS

Directory of Open Access Journals (Sweden)

F Genova

2013-01-01

Full Text Available The Centre de Donnees astronomiques de Strasbourg (CDS, created in 1972, has been a pioneer in the dissemination of digital scientific data. Ensuring sustainability for several decades has been a major issue because science and technology evolve continuously and the data flow increases endlessly. The paper briefly describes CDS activities, major services, and its R&D strategy to take advantage of new technologies. The next frontiers for CDS are the new Web 2.0/3.0 paradigm and, at a more general level, global interoperability of astronomical on-line resources in the Virtual Observatory framework.

Surfactant-ligand co-assisted solvothermal technique for the synthesis of different-shaped CdS nanorod-based materials

International Nuclear Information System (INIS)

Bao Chunyan; Jin Ming; Lu Ran; Xue Pengchong; Zhang Qinglin; Wang Dejun; Zhao Yingying

2003-01-01

1-D nanorods, twinrods, golfclubs, and tripods of CdS were prepared via a surfactant-ligand co-assisted solvothermal method at 160 deg. C. The surfactant of S-dodecylisothiounium bromide (C 12 ) used in the process was favorable for synthesis of different-shaped CdS nanorod with high aspect ratio. X-ray diffraction (XRD) and TEM images showed that the 1-D nanorods had wurtzite phase and others had a zinc blende core and wurtzite arms. The morphologies of CdS prepared under different conditions suggested the 'template-assistance' of the surfactant and that the nonaqueous organic media are important for the self-assembling of inorganic components at atomic level

Comparing two books and establishing probably efficacious treatment for low sexual desire.

Science.gov (United States)

Balzer, Alexandra M; Mintz, Laurie B

2015-04-01

Using a sample of 45 women, this study compared the effectiveness of a previously studied (Mintz, Balzer, Zhao, & Bush, 2012) bibliotherapy intervention (Mintz, 2009), a similar self-help book (Hall, 2004), and a wait-list control (WLC) group. To examine intervention effectiveness, between and within group standardized effect sizes (interpreted with Cohen's, 1988 benchmarks .20 = small, .50 = medium, .80+ = large) and their confidence limits are used. In comparison to the WLC group, both interventions yielded large between-group posttest effect sizes on a measure of sexual desire. Additionally, large between-group posttest effect sizes were found for sexual satisfaction and lubrication among those reading the Mintz book. When examining within-group pretest to posttest effect sizes, medium to large effects were found for desire, lubrication, and orgasm for both books and for satisfaction and arousal for those reading the Mintz book. When directly comparing the books, all between-group posttest effect sizes were likely obtained by chance. It is concluded that both books are equally effective in terms of the outcome of desire, but whether or not there is differential efficacy in terms of other domains of sexual functioning is equivocal. Tentative evidence is provided for the longer term effectiveness of both books in enhancing desire. Arguing for applying criteria for empirically supported treatments to self-help, results are purported to establish the Mintz book as probably efficacious and to comprise a first step in this designation for the Hall book. (c) 2015 APA, all rights reserved).

Self-injury in young people and the help-negation effect.

Science.gov (United States)

Frost, Mareka; Casey, Leanne M; O'Gorman, John G

2017-04-01

This study examined the relationship between self-injurious behavior and intentions to seek help from professionals, family and friends, technology based support and from no-one. Participants were 679 young people aged 14-25 years drawn from a larger internet survey (N =1463) on the basis of their reported self-injury. A help-negation effect was found only in relation to intentions to seek help from family and friends. That is, a higher extent or severity of self-injury was independently associated with lower intentions to seek help from family and friends. This effect remained after controlling for psychological distress and suicidal ideation. Establishing avenues for early intervention and providing access to a range of potential avenues for help-seeking may assist young people to seek support in relation to self-injury. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

Adolescent Self-Esteem and the Schools.

Science.gov (United States)

Higgins, Keith B.

This book was written to help schools and educators in their efforts to raise the self-esteem of adolescent students. The first chapter presents the layout of the book. Chapter 2 explains Coopersmith's (1967) model of self-esteem, emphasizing the model's relevance to secondary education. Experiences leading to feelings of significance, competence,…

The Self-help Online against Suicidal thoughts (SOS) trial

DEFF Research Database (Denmark)

Mühlmann, Charlotte; Madsen, Trine; Hjorthøj, Carsten Rygaard

2017-01-01

-list assignment for 32 weeks. The primary outcomes are frequency and intensity of suicidal thoughts. Secondary outcome measures include depressive symptoms, hopelessness, worrying, quality of life, costs related to health care utilization and production loss. Number of deliberate self-harm episodes, suicides......BACKGROUND: Suicidal thoughts are common, causing distress for millions of people all over the world. However, people with suicidal thoughts might not access support due to financial restraints, stigma or a lack of available treatment offers. Self-help programs provided online could overcome...... these barriers, and previous efforts show promising results in terms of reducing suicidal thoughts. This study aims to examine the effectiveness of an online self-help intervention in reducing suicidal thoughts among people at risk of suicide. The Danish Self-help Online against Suicidal thoughts (SOS) trial...

Print-based self-help interventions for smoking cessation.

Science.gov (United States)

Hartmann-Boyce, Jamie; Lancaster, Tim; Stead, Lindsay F

2014-06-03

Many smokers give up smoking on their own, but materials giving advice and information may help them and increase the number who quit successfully. The aims of this review were to determine: the effectiveness of different forms of print-based self-help materials, compared with no treatment and with other minimal contact strategies; the effectiveness of adjuncts to print-based self help, such as computer-generated feedback, telephone hotlines and pharmacotherapy; and the effectiveness of approaches tailored to the individual compared with non-tailored materials. We searched the Cochrane Tobacco Addiction Group trials register. Date of the most recent search April 2014. We included randomized trials of smoking cessation with follow-up of at least six months, where at least one arm tested a print-based self-help intervention. We defined self help as structured programming for smokers trying to quit without intensive contact with a therapist. We extracted data in duplicate on the participants, the nature of the self-help materials, the amount of face-to-face contact given to intervention and to control conditions, outcome measures, method of randomization, and completeness of follow-up.The main outcome measure was abstinence from smoking after at least six months follow-up in people smoking at baseline. We used the most rigorous definition of abstinence in each trial, and biochemically validated rates when available. Where appropriate, we performed meta-analysis using a fixed-effect model. We identified 74 trials which met the inclusion criteria. Many study reports did not include sufficient detail to judge risk of bias for some domains. Twenty-eight studies (38%) were judged at high risk of bias for one or more domains but the overall risk of bias across all included studies was judged to be moderate, and unlikely to alter the conclusions.Thirty-four trials evaluated the effect of standard, non-tailored self-help materials. Pooling 11 of these trials in which there

Mn2+ anchored CdS polymer nanocomposites: An efficient alternative for Mn2+ doped CdS nanoparticles

International Nuclear Information System (INIS)

Saikia, Bhaskar Jyoti; Nath, Bikash Chandra; Borah, Chandramika; Dolui, Swapan Kumar

2015-01-01

A chelating bi-functional polymer brushes was prepared via atom transfer radical polymerization using grafting-from methodology. Mn 2+ -anchored CdS-polymer nanocomposites were synthesized using this graft copolymer by simple chelation method resulting in emission at about 620 nm which originates from the fluorescence of manganese ions embedded on the surface of CdS nanoparticles. This method provides an efficient straightforward substitute of Mn 2+ dopped CdS nanoparticles. Optical properties of the composites were investigated which indicates that simple Mn 2+ chelation and subsequent binding of CdS in a polymer matrix can have similar effect in the luminescence property as those synthesized via complex doping methods. Moreover this methodology can be applied for synthesis of any metal anchored nanocomposites proficiently and cost effectively in large-scale production. - Highlights: • A chelating bifunctional copolymer brush was synthesized via ATRP. • CdS nanoparticles and Mn 2+ were coupled with the bifunctional polymer. • Composites showed emission properties similar to Mn 2+ doped CdS nanoparticles. • Side chain length of the polymers also affect the emission properties of the composites.

Solution-Focused Self-Help for Improving University Students' Well-Being

Science.gov (United States)

Pakrosnis, Rytis; Cepukiene, Viktorija

2015-01-01

Along with positive developments in psychology, the self-help movement is becoming widespread, based on the belief that people are capable of growing and achieving positive change with only minimal help. This article addresses the potential of a solution-focused self-help tool to improve university students' well-being by comparing its outcome to…

41 CFR 301-50.7 - Should I use the online self-service booking tool once ETS is available within my agency?

Science.gov (United States)

2010-07-01

... SERVICES § 301-50.7 Should I use the online self-service booking tool once ETS is available within my agency? Yes, you should use the online self-service booking tool offered by ETS or your agency's TMS... self-service booking tool once ETS is available within my agency? 301-50.7 Section 301-50.7 Public...

Optical and AFM study of electrostatically assembled films of CdS and ZnS colloid nanoparticles

International Nuclear Information System (INIS)

Suryajaya; Nabok, A.; Davis, F.; Hassan, A.; Higson, S.P.J.; Evans-Freeman, J.

2008-01-01

CdS and ZnS semiconducting colloid nanoparticles coated with the organic shell, containing either SO 3 - or NH 2 + groups, were prepared using the aqueous phase synthesis. The multilayer films of CdS (or ZnS) were deposited onto glass, quartz and silicon substrates using the technique of electrostatic self-assembly. The films produced were characterized with UV-vis spectroscopy, spectroscopic ellipsometry and atomic force microscopy. A substantial blue shift of the main absorption band with respect to the bulk materials was found for both CdS and ZnS films. The Efros equation in the effective mass approximation (EMA) theoretical model allowed the evaluation of the nanoparticle radius of 1.8 nm, which corresponds well to the ellipsometry results. AFM shows the formation of larger aggregates of nanoparticles on solid surfaces

Efficacy of a behavioral self-help treatment with or without therapist guidance for co-morbid and primary insomnia--a randomized controlled trial.

Science.gov (United States)

Jernelöv, Susanna; Lekander, Mats; Blom, Kerstin; Rydh, Sara; Ljótsson, Brjánn; Axelsson, John; Kaldo, Viktor

2012-01-22

Cognitive behavioral therapy is treatment of choice for insomnia, but availability is scarce. Self-help can increase availability at low cost, but evidence for its efficacy is limited, especially for the typical insomnia patient with co-morbid problems. We hypothesized that a cognitive behaviorally based self-help book is effective to treat insomnia in individuals, also with co-morbid problems, and that the effect is enhanced by adding brief therapist telephone support. Volunteer sample; 133 media-recruited adults with insomnia. History of sleep difficulties (mean [SD]) 11.8 [12.0] years. 92.5% had co-morbid problems (e.g. allergy, pain, and depression). Parallel randomized (block-randomization, n ≥ 21) controlled "open label" trial; three groups-bibliotherapy with (n = 44) and without (n = 45) therapist support, and waiting list control (n = 44). Assessments before and after treatment, and at three-month follow-up. Intervention was six weeks of bibliotherapeutic self-help, with established cognitive behavioral methods including sleep restriction, stimulus control, and cognitive restructuring. Therapist support was a 15-minute structured telephone call scheduled weekly. Main outcome measures were sleep diary data, and the Insomnia Severity Index. Intention-to-treat analyses of 133 participants showed significant improvements in both self-help groups from pre to post treatment compared to waiting list. For example, treatment with and without support gave shorter sleep onset latency (improvement minutes [95% Confidence Interval], 35.4 [24.2 to 46.6], and 20.6 [10.6 to 30.6] respectively), and support gave a higher remission rate (defined as ISI score below 8; 61.4%), than bibliotherapy alone (24.4%, p's < .001). Improvements were not seen in the control group (sleep onset latency 4.6 minutes shorter [-1.5 to 10.7], and remission rate 2.3%). Self-help groups maintained gains at three-month follow-up. Participants receiving self-help for insomnia benefited markedly

[Drug Addiction Self-Help Recovery scale (DASH-scale): an approach to the measurement of recovery from drug addiction in self-help program among drug addicts].

Science.gov (United States)

Shimane, Takuya; Misago, Chizuru

2004-12-01

The purpose of the study was to develop a scale for measuring the recovery in self-help program for drug addicts. Our study sites were fourteen self-help groups for drug addicts called "DARC: Drug Addiction Rehabilitation Center". DARC activities were based on Narcotics Anonymous types of self-help program. The 25-items DASH-scale questionnaire was developed using data, which were obtained through in-depth interview among DARC staff. A cross-sectional study among recovering addicts participating in "DARC" activities was implemented from Jan 2004 to Feb 2004. 164 subjects were responded to our questionnaire. Factor analysis was carried out and items with weaker or split loadings were removed. Factor analysis of DASH-scale results produced a surprisingly clean four-factor solution. 19-items were left to form the final DASH-scale; regular life-style (6 items), acceptance of drug addiction (5 items), sympathy with member (5 items), reborn (3 items). The internal consistency (Cronbach's Alpha) of these scales was very high (0.87). Low but significant concurrent correlations were observed between the DASH-scale and the Rosenberg Self-Esteem Scale (0.22), Purpose in Life Test (0.35). Discriminant validity of the DASH-scale was supported by significant increase with exposed period of self-help program. Evidence supports the DASH-scale was possible to measure recovery in self-help program.

Stomacare nurses and their share in the work with self-help groups of patiens.

OpenAIRE

ŠŤASTNÁ, Olga

2010-01-01

Stoma nurses and their contribution to work with self-help groups of patients. The diploma thesis dealt with the cooperation of stoma nurses with self-help groups of stoma patients in ten regions of the Czech Republic. The aim was to find out if stoma nurses recognize the importance of self-help groups for stoma patients, how their work contributes to self-help groups, if stoma nurses cooperate with self-help groups and if they inform stoma patients about the existence of self-help groups. An...

Climate Change Denial Books and Conservative Think Tanks

Science.gov (United States)

Jacques, Peter J.

2013-01-01

The conservative movement and especially its think tanks play a critical role in denying the reality and significance of anthropogenic global warming (AGW), especially by manufacturing uncertainty over climate science. Books denying AGW are a crucial means of attacking climate science and scientists, and we examine the links between conservative think tanks (CTTs) and 108 climate change denial books published through 2010. We find a strong link, albeit noticeably weaker for the growing number of self-published denial books. We also examine the national origins of the books and the academic backgrounds of their authors or editors, finding that with the help of American CTTs climate change denial has spread to several other nations and that an increasing portion of denial books are produced by individuals with no scientific training. It appears that at least 90% of denial books do not undergo peer review, allowing authors or editors to recycle scientifically unfounded claims that are then amplified by the conservative movement, media, and political elites. PMID:24098056

[Utilization of self-help groups and psychotherapy after psychosomatic-psychotherapeutic in-patient treatment].

Science.gov (United States)

Höflich, Anke; Matzat, Jürgen; Meyer, Friedhelm; Knickenberg, Rudolf J; Bleichner, Franz; Merkle, Wolfgang; Reimer, Christian; Franke, Wolfram; Beutel, Manfred E

2007-05-01

Until now little is known about the role of participation in self-help groups alone or combined with psychotherapy in post-in-patient care. In the present study 2933 patients were questioned about their experience of self-help groups and psychotherapy after discharge from a clinic for psychosomatic medicine and psychotherapy. Nearly 8 % of them utilized self-help groups (mostly combined with out-patient psychotherapy), and altogether 68 % out-patient psychotherapy following in-patient treatment. Patients without out-patient treatment were psychologically less burdened and had better resources than participants of self-help groups or psychotherapy. Self-help group members differed from patients in out-patient psychotherapy by expressing a more positive opinion of groupwork and higher openness to new experiences. Additionly, they had discussed the topic of self-help groups more frequently with their therapists. This may be a starting-point for promoting more self-help activities of patients in the future.

High effectiveness of self-help programs after drug addiction therapy

Directory of Open Access Journals (Sweden)

Kristensen Øistein

2006-08-01

Full Text Available Abstract Background The self-help groups Alcoholics Anonymous (AA and Narcotics Anonymous (NA are very well established. AA and NA employ a 12-step program and are found in most large cities around the world. Although many have argued that these organizations are valuable, substantial scepticism remains as to whether they are actually effective. Few treatment facilities give clear recommendations to facilitate participation, and the use of these groups has been disputed. The purpose of this study was to examine whether the use of self-help groups after addiction treatment is associated with higher rates of abstinence. Methods One hundred and fourteen patients, 59 with alcohol dependency and 55 with multiple drug dependency, who started in self-help groups after addiction treatment, were examined two years later using a questionnaire. Return rate was 66%. Six (5% of the patients were dead. Results Intention-to-treat-analysis showed that 38% still participated in self-help programs two years after treatment. Among the regular participants, 81% had been abstinent over the previous 6 months, compared with only 26% of the non-participants. Logistic regression analysis showed OR = 12.6, 95% CI (4.1–38.3, p Conclusion The study has several methodological problems; in particular, correlation does not necessarily indicate causality. These problems are discussed and we conclude that the probability of a positive effect is sufficient to recommend participation in self-help groups as a supplement to drug addiction treatment. Previous publication This article is based on a study originally published in Norwegian: Kristensen O, Vederhus JK: Self-help programs in drug addiction therapy. Tidsskr Nor Laegeforen 2005, 125:2798–2801.

What do we know about speculation in the CDS market?

NARCIS (Netherlands)

L. Norden (Lars); K. Radoeva (Kristina)

2012-01-01

textabstractWe measure speculation in the CDS market and investigate its determinants. The CDS volume on a firm that exceeds its outstanding debt (= naked CDS) indicates speculation since hedging can be ruled out. Using weekly CDS trading volume data for actively traded U.S. firms during 2008-2012,

A configurable CDS for the production laboratory

CERN Document Server

Meek, Irish

2003-01-01

Various aspects of a configurable chromatography data system (CDS) for the production laboratory are discussed. The Atlas CDS can be configured extensively to fit the production laboratory work flow and meet the needs of analysts. The CDS can also be configured to automatically create a sample sequence with the required number of injections and download methods to the dedicated instrument. The Atlas Quick Start wizard offers uses quick way of generating a sequence from a predefined template and starting a run. (Edited abstract).

Women Empowerment Through Self-Help Groups

NARCIS (Netherlands)

Alemu, Sintayehu Hailu; Kempen, Van Luuk; Ruben, Ruerd

2018-01-01

This paper deals with the impact of self-help groups (SHGs) in apple production on empowering women in the Chencha district of Southern Ethiopia. Impact is traced on the basis of a cross-sectional survey among SHG members and nonmembers, using propensity score matching. Apart from the attitudinal

ORSERG resource book. Operational reactor safety engineering and review group. Final report, March 1992

International Nuclear Information System (INIS)

1992-03-01

EPRI has prepared this resource book to help utilities with their Self-Assessment Programs at nuclear power plants. Self-assessments are reviews performed by nuclear power plant utilities to monitor plant performance status and adequacy, identify trends in operational activities important to safety, and assess the impact of these trends on plant safety. Activities performed as self-assessments include reviews and evaluations of plant performance and abnormal events, technical evaluations of plant activities to identify potential problem areas, and reviews of other sources of plant design and operating experience for applicability to safety. This resource book is based on information obtained from utilities and includes examples of activities and methods that have proven effective. The resource book includes a summary of NRC requirements, guidelines for self-assessment program planning, descriptions and examples of investigative techniques, and key references that can be consulted for additional information. It can serve as a training guide for plant staff members who are assigned to self-assessment activities. (author)

Self-help initiatives and rural development in Ibesikpo community of ...

African Journals Online (AJOL)

This study investigates the impact of self-help initiatives on rural development in Ibesikpo community of Akwa Ibom State, Nigeria. Self help initiatives were defined in terms of provision of employment, education and health-care. A sample size of 369 rural dwellers was drawn and data were analyzed using simple regression ...

Self-help groups and mental health/substance use agencies: the benefits of organizational exchange.

Science.gov (United States)

Powell, Thomas; Perron, Brian Edward

2010-02-01

Self-help groups benefit clients by linking them to people who have "been there" and are successfully coping with their situations. Mental health/substance use agencies can increase access to evidence-based benefits of self-help groups by engaging them in organizational exchanges. Organizational theories are used to frame beneficial exchanges with self-help groups. Adaptational theory is used to frame exchanges with self-help groups and various service agency subunits, e.g., board, practitioner, and client units. Institutional theory is used to frame joint agency/self-help initiatives to promote community acceptance of self-help groups, which in turn may enhance the credibility of the professional agency.

Efficacy of a Self-Help Treatment for At-Risk and Pathological Gamblers.

Science.gov (United States)

Boudreault, Catherine; Giroux, Isabelle; Jacques, Christian; Goulet, Annie; Simoneau, Hélène; Ladouceur, Robert

2018-06-01

Available evidence suggests that self-help treatments may reduce problem gambling severity but inconsistencies of results across clinical trials leave the extent of their benefits unclear. Moreover, no self-help treatment has yet been validated within a French Canadian setting. The current study therefore assesses the efficacy of a French language self-help treatment including three motivational telephone interviews spread over an 11-week period and a cognitive-behavioral self-help workbook. At-risk and pathological gamblers were randomly assigned to the treatment group (n = 31) or the waiting list (n = 31). Relative to the waiting list, the treatment group showed a statistically significant reduction in the number of DSM-5 gambling disorder criteria met, gambling habits, and gambling consequences at Week 11. Perceived self-efficacy and life satisfaction also significantly improved after 11 weeks for the treatment group, but not for the waiting list group. At Week 11, 13% of participants had dropped out of the study. All significant changes reported for the treatment group were maintained throughout 1, 6 and 12-month follow-ups. Results support the efficacy of the self-help treatment to reduce problem gambling severity, gambling behaviour and to improve overall functioning among a sample of French Canadian problem gamblers over short, medium and long term. Findings from this study lend support to the appropriateness of self-help treatments for problem gamblers and help clarify inconsistencies found in the literature. The low dropout rate is discussed with respect to the advantages of the self-help format. Clinical and methodological implications of the results are put forth.

Biosynthesis of CdS nanoparticles in banana peel extract.

Science.gov (United States)

Zhou, Guang Ju; Li, Shuo Hao; Zhang, Yu Cang; Fu, Yun Zhi

2014-06-01

Cadmium sulfide (CdS) nanoparticles (NPs) were synthesized by using banana peel extract as a convenient, non-toxic, eco-friendly 'green' capping agent. Cadmium nitrate and sodium sulfide are main reagents. A variety of CdS NPs are prepared through changing reaction conditions (banana extracts, the amount of banana peel extract, solution pH, concentration and reactive temperature). The prepared CdS colloid displays strong fluorescence spectrum. X-ray diffraction analysis demonstrates the successful formation of CdS NPs. Fourier transform infra-red (FTIR) spectrogram indicates the involvement of carboxyl, amine and hydroxyl groups in the formation of CdS NPs. Transmission electron microscope (TEM) result reveals that the average size of the NPs is around 1.48 nm.

Helpers' Self-Assessment Biases Before and after Helping Skills Training

Science.gov (United States)

Jaeken, Marine; Zech, Emmanuelle; Brison, Céline; Verhofstadt, Lesley L.; Van Broeck, Nady; Mikolajczak, Moïra

2017-01-01

Several studies have shown that therapists are generally biased concerning their performed helping skills, as compared to judges' ratings. As clients' ratings of therapists' performance are better predictors of psychotherapy effectiveness than judges' ratings, this study examined the validity and effectiveness of a helping skills training program at reducing novice helpers' self-enhancement biases concerning their helping skills, in comparison to their clients' ratings. Helping skills were assessed by three objective measures (a knowledge multiple choice test, a video test and a role play), as well as by a self- and peer-reported questionnaire. In addition, some performed helping skills' correlates (relationship quality, session quality, and helpers' therapeutic attitudes) were assessed both by helpers and their simulated helpees. Seventy-two sophomores in psychology participated to this study, 37 being assigned to a 12-h helping skills training program, and 35 to a control group. Helpers were expected to assess the aforementioned performed helping skills and correlates as being better than their helpees' assessments at pretest, thus revealing a self-enhancement bias. At posttest, we expected that trained helpers would objectively exhibit better helping skills than untrained helpers while beginning to underestimate their performance, thus indexing a self-diminishment bias. In contrast, we hypothesized that untrained helpers would continue to overestimate their performance. Our hypotheses were only partly confirmed but results reflected a skilled-unaware pattern among trainees. Trained helpers went either from a pretest overestimation to a posttest equivalence (performed helping skills and performed therapeutic attitudes), or from a pretest equivalence to a posttest underestimation (performed session quality and performed therapeutic relationship), as compared to helpees' ratings. Results showed that trained helpers improved on all helping skills objective measures

Helpers' Self-Assessment Biases Before and after Helping Skills Training.

Science.gov (United States)

Jaeken, Marine; Zech, Emmanuelle; Brison, Céline; Verhofstadt, Lesley L; Van Broeck, Nady; Mikolajczak, Moïra

2017-01-01

Several studies have shown that therapists are generally biased concerning their performed helping skills, as compared to judges' ratings. As clients' ratings of therapists' performance are better predictors of psychotherapy effectiveness than judges' ratings, this study examined the validity and effectiveness of a helping skills training program at reducing novice helpers' self-enhancement biases concerning their helping skills, in comparison to their clients' ratings. Helping skills were assessed by three objective measures (a knowledge multiple choice test, a video test and a role play), as well as by a self- and peer-reported questionnaire. In addition, some performed helping skills' correlates (relationship quality, session quality, and helpers' therapeutic attitudes) were assessed both by helpers and their simulated helpees. Seventy-two sophomores in psychology participated to this study, 37 being assigned to a 12-h helping skills training program, and 35 to a control group. Helpers were expected to assess the aforementioned performed helping skills and correlates as being better than their helpees' assessments at pretest, thus revealing a self-enhancement bias. At posttest, we expected that trained helpers would objectively exhibit better helping skills than untrained helpers while beginning to underestimate their performance, thus indexing a self-diminishment bias. In contrast, we hypothesized that untrained helpers would continue to overestimate their performance. Our hypotheses were only partly confirmed but results reflected a skilled-unaware pattern among trainees. Trained helpers went either from a pretest overestimation to a posttest equivalence (performed helping skills and performed therapeutic attitudes), or from a pretest equivalence to a posttest underestimation (performed session quality and performed therapeutic relationship), as compared to helpees' ratings. Results showed that trained helpers improved on all helping skills objective measures

Quality of life changes in an alcoholics anonymous self-help group

Directory of Open Access Journals (Sweden)

INDRĖ DIRGĖLIENĖ

2017-09-01

Full Text Available The issue of alcohol addiction is one of the most pressing in contemporary society as it causes an effect in the context of poverty, violence and suicidal behaviour. After the restoration of Lithuania‘s Independence a new helping profession such as social worker appeared: they were expected to provide professional help to people in order to help them find inner motivation for positive socialization or re-socialization. The issue of alcohol addiction/dependence was first viewed systemically, with the understanding of the need for systemic help: social, psychological, spiritual and medical. Long-term rehabilitation centres have been created and self-help groups formed: those of Alcoholics Anonymous (AA, Al-anon (self – help groups for friends and families who have relatives suffering from alcohol and ACA (Adult Children of Alcoholics self-help group. The article analyzes the quality of life changes in an Alcoholics Anonymous self-help group. Qualitative survey data are presented in this article. Six life stories of people attending Alcoholics Anonymous (AA self-help groups are provided. The age of the participants ranges from 31 to 58. The main criterion to participate in the research is: people who have or have had problems because of alcohol usage and who are Alcoholics Anonymous self-help group (AA participants that have reached Step 12. This means they are ready to spread the message about recovering from this abuse to people who suffer from it. Deep analysis interview has been used to collect the data. Interview notional blocks are: 1 childhood experiences; 2 addiction to alcohol period and crisis; 3 changes of life quality when attending AA groups. The study data have been provided using content analysis through the deduction method. The theoretical basis is a systematic approach to a person in the course of his life‘ spiritual concepts and stages of recovery (May, 2004; Linn, Linn, 2003; Kubler-Ross, 2008 and the theory of integrated

THE ECONOMIC ROLE OF SELF-HELP GROUP

OpenAIRE

Dr. S. Selvendran

2018-01-01

“All for all” principle behind self-help group (SHG) concept. It is mainly concerned with poor people and it is for the people, by the people and of the people gandhian sarvodaya contained with this.

Self-help and help-seeking for communication disability in Ghana: implications for the development of communication disability rehabilitation services.

Science.gov (United States)

Wylie, Karen; McAllister, Lindy; Davidson, Bronwyn; Marshall, Julie; Amponsah, Clement; Bampoe, Josephine Ohenewa

2017-12-29

In low and middle-income countries, such as Ghana, communication disability is poorly recognised and rehabilitation services for people with communication disability are limited. As rehabilitation services for communication disability develop, and the profession of speech-language pathology grows, it is important to consider how services can most appropriately respond to the needs and preferences of the community. Understanding the ways in which people currently self-help and seek help for communication disability is central to developing services that build on existing local practices and are relevant to the community. A qualitative descriptive survey was used to explore likely self-help and help-seeking behaviours for communication disability, in Accra, Ghana. The survey required participants to describe responses to hypothetical scenarios related to communication disability. A mix of theoretical sampling and convenience sampling was used. Qualitative content analysis was used to analyse data and develop categories and subcategories of reported self-help behaviours and sources of help and advice for communication disability. One hundred and thirty-six participants completed the survey. Results indicated that community members would be likely to engage in a variety self-help strategies in response to communication disability. These included working directly with a person with a communication disability to attempt to remediate a communication impairment, altering physical and communication environments, changing attitudes or care practices, educating themselves about the communication disability, providing resources, and responding in spiritual ways. Participants indicated that they would seek help for communication disability across a range of sectors - including the Western healthcare, religious, and traditional sectors. Understanding existing community actions to self-help and help-seek may allow emerging communication rehabilitation services, including the

Technical training: CERN Document Server (CDS), Inspire and Library Services

CERN Multimedia

IT & GS Departments

2012-01-01

A new training course, “CERN Document Server (CDS), Inspire and Library Services”, is available since the beginning of the year. The training course is given by members of CERN’s CDS Team (IT-CIS group) and the Library Services (GIS SIS group) and is intended for all members of personnel of CERN. This course will present CDS and inspirehep.net and the content, scope and scientific information available in or with CDS, as much as the classification and organization of the documents. It is intended to give you the training needed to know how to use CDS most efficiently and in particular covers: the main characteristics and advanced features for the search of documents (scientific, multimedia, etc). the collaborative tools : baskets, alerts, comments, evaluation, etc. the submission of documents in CDS and examples of workflows. An important part of the training is composed of various exercises, designed to acquire practical ability to work with CDS in cases similar to re...

Synthesis of CdS nanoparticles based on DNA network templates

International Nuclear Information System (INIS)

Yao Yong; Song Yonghai; Wang Li

2008-01-01

CdS nanoparticles have been successfully synthesized by using DNA networks as templates. The synthesis was carried out by first dropping a mixture of cadmium acetate and DNA on a mica surface for the formation of the DNA network template and then transferring the sample into a heated thiourea solution. The Cd 2+ reacted with thiourea at high temperature and formed CdS nanoparticles on the DNA network template. UV-vis spectroscopy, photoluminescence, x-ray diffraction and atomic force microscopy (AFM) were used to characterize the CdS nanoparticles in detail. AFM results showed that the resulted CdS nanoparticles were directly aligned on the DNA network templates and that the synthesis and assembly of CdS nanoparticles was realized in one step. CdS nanoparticles fabricated with this method were smaller than those directly synthesized in a thiourea solution and were uniformly aligned on the DNA networks. By adjusting the density of the DNA networks and the concentration of Cd 2+ , the size and density of the CdS nanoparticles could be effectively controlled and CdS nanoparticles could grow along the DNA chains into nanowires. The possible growth mechanism has also been discussed in detail

Self-Portrait of an Artist with a Book in her Hand

Directory of Open Access Journals (Sweden)

Alenka Spacal

2010-12-01

Full Text Available This article considers the book as an important emancipatory motif, expressing the tendency of women self-portrait painters to present themselves as educated and accomplished, and to establish their own subjectivity. In traditional self-portraits, since the Renaissance some female artists have presented themselves as autonomous active individuals depicted painting, reading, or playing a musical instrument. In the past, the motif of the reader has symbolized female erudition, education, and sophistication. In a time when women could only rarely attend school, the use of this motif represented an important and liberating gesture. In a period when artists preferred to portray women as nude seducers rather than as learned ladies, it was all the more important that some female artists endeavored to stress the role of women as readers. Although images of women authors with a book in their hands represented a symbol of learning and wisdom, this same motif could also be used to replace a female author’s signature. This is examined here with reference to the works of the Renaissance painter Sofonisba Anguissola.

Efficacy of a behavioral self-help treatment with or without therapist guidance for co-morbid and primary insomnia -a randomized controlled trial

Directory of Open Access Journals (Sweden)

Jernelöv Susanna

2012-01-01

Full Text Available Abstract Background Cognitive behavioral therapy is treatment of choice for insomnia, but availability is scarce. Self-help can increase availability at low cost, but evidence for its efficacy is limited, especially for the typical insomnia patient with co-morbid problems. We hypothesized that a cognitive behaviorally based self-help book is effective to treat insomnia in individuals, also with co-morbid problems, and that the effect is enhanced by adding brief therapist telephone support. Methods Volunteer sample; 133 media-recruited adults with insomnia. History of sleep difficulties (mean [SD] 11.8 [12.0] years. 92.5% had co-morbid problems (e.g. allergy, pain, and depression. Parallel randomized (block-randomization, n ≥ 21 controlled "open label" trial; three groups-bibliotherapy with (n = 44 and without (n = 45 therapist support, and waiting list control (n = 44. Assessments before and after treatment, and at three-month follow-up. Intervention was six weeks of bibliotherapeutic self-help, with established cognitive behavioral methods including sleep restriction, stimulus control, and cognitive restructuring. Therapist support was a 15-minute structured telephone call scheduled weekly. Main outcome measures were sleep diary data, and the Insomnia Severity Index. Results Intention-to-treat analyses of 133 participants showed significant improvements in both self-help groups from pre to post treatment compared to waiting list. For example, treatment with and without support gave shorter sleep onset latency (improvement minutes [95% Confidence Interval], 35.4 [24.2 to 46.6], and 20.6 [10.6 to 30.6] respectively, and support gave a higher remission rate (defined as ISI score below 8; 61.4%, than bibliotherapy alone (24.4%, p's Conclusions Participants receiving self-help for insomnia benefited markedly. Self-help, especially if therapist-supported, has considerable potential to be as effective as individual treatment at lower cost, also for

Improving the Formatting Tools of CDS Invenio

CERN Document Server

Caffaro, J; Pu Faltings, Pearl

2006-01-01

CDS Invenio is the web-based integrated digital library system developed at CERN. It is a strategical tool that supports the archival and open dissemination of documents produced by CERN researchers. This paper reports on my Master’s thesis work done on BibFormat, a module in CDS Invenio, which formats documents metadata. The goal of this project was to implement a completely new formatting module for CDS Invenio. In this report a strong emphasis is put on the user-centered design of the new BibFormat. The bibliographic formatting process and its requirements are discussed. The task analysis and its resulting interaction model are detailed. The document also shows the implemented user interface of BibFormat and gives the results of the user evaluation of this interface. Finally the results of a small usability study of the formats included in CDS Invenio are discussed.

Online Counseling: Prioritizing Psychoeducation, Self-Help, and Mutual Help for Counseling Psychology Research and Practice

Science.gov (United States)

Chang, Tai

2005-01-01

This reaction article extends the research and practice recommendations for online counseling from the Major Contribution to the November 2005 issue of "The Counseling Psychologist" by prioritizing research and practice in online psychoeducation, self-help, and mutual help. Research suggests that tens of millions of Americans use the Internet for…

Books and canon building in sociology: the case of Mind, Self, and Society

OpenAIRE

Silva, Filipe Carreira da; Vieira, Mónica Brito

2011-01-01

This paper discusses the canonization process of George Herbert Mead (1863–1931) in sociology through a recounting of the history of the book Mind, Self, and Society (1934). The relation between Mead and this particular work has no parallel in the history of sociological theory. Although the book was not written by Mead, or even organized under his direction, it has been through it that generations of academics and students have come in contact with Mead’s ideas. There are two main goals behi...

Picture Books Featuring Literary Characters with Special Needs

Directory of Open Access Journals (Sweden)

Batič Janja

2013-11-01

Full Text Available This paper introduces a selection of picture books that feature a person with special needs as the main literary character. The selection of the books to be showcased was based on three crucial aspects: the form of the (picture book, as we wanted to underline the visual importance of a literary character with special needs; the age limit of the readers the books are intended for (preschool and early primary school; and undisputable quality of the literary and artistic components of the picture books. The picture books we have selected based on the above criteria are Veveriček posebne sorte by Svetlana Makarovič and Marjan Manček, Mrožek dobi očala by Peter Svetina and Mojca Osojnik, and Zakaj je babica jezna by Lela B. Njatin and Alenka Sottler. Picture books about literary characters with special needs can help highly sensitive children accepting people that are different, while children with special needs can build a better self-image based on such books. Quality literary books which foster a positive attitude towards a character with special needs promote tolerance and can thus play an important role in the early childhood, with regard to awareness of an inclusive society.

INTERBED: internet-based guided self-help for overweight and obese patients with full or subsyndromal binge eating disorder. A multicenter randomized controlled trial

Directory of Open Access Journals (Sweden)

de Zwaan Martina

2012-11-01

Full Text Available Abstract Background Binge eating disorder (BED is a prevalent clinical eating disorder associated with increased psychopathology, psychiatric comorbidity, overweight and obesity, and increased health care costs. Since its inclusion in the DSM-IV, a few randomized controlled trials (RCTs have suggested efficacy of book-based self-help interventions in the treatment of this disorder. However, evidence from larger RCTs is needed. Delivery of self-help through new technologies such as the internet should be investigated in particular, as these approaches have the potential to be more interactive and thus more attractive to patients than book-based approaches. This study will evaluate the efficacy of an internet-based guided self-help program (GSH-I and cognitive-behavioral therapy (CBT, which has been proven in several studies to be the gold standard treatment for BED, in a prospective multicenter randomized trial. Methods The study assumes the noninferiority of GSH-I compared to CBT. Both treatments lasted 4 months, and maintenance of outcome will be assessed 6 and 18 months after the end of treatment. A total of 175 patients with BED and a body mass index between 27 and 40 kg/m2 were randomized at 7 centers in Germany and Switzerland. A 20% attrition rate was assumed. As in most BED treatment trials, the difference in the number of binge eating days over the past 28 days is the primary outcome variable. Secondary outcome measures include the specific eating disorder psychopathology, general psychopathology, body weight, quality of life, and self-esteem. Predictors and moderators of treatment outcome will be determined, and the cost-effectiveness of both treatment conditions will be evaluated. Results The methodology for the INTERBED study has been detailed. Conclusions Although there is evidence that CBT is the first-line treatment for BED, it is not widely available. As BED is still a recent diagnostic category, many cases likely remain

Dynamic Modeling of CDS Index Tranche Spreads

DEFF Research Database (Denmark)

Dorn, Jochen

This paper provides a Market Model which implies a dynamics for standardized CDS index tranche spreads, i.e. tranches which securitise CDS index series and dispose of predefined subordination. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling...... options on structured credit derivatives. With the upcoming regulation of the CDS market in perspective, the model presented here is also an attempt to face the effects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke...... tenors/tranche subordination to market data obtained by more liquid Index Tranche Options with standard characteristics....

Children's Books in Review: Books on Strengthening Family Ties.

Science.gov (United States)

Winfield, Evelyn T.

1991-01-01

Reviews children's books that emphasize the strengthening of family ties. Characters in the books realize the importance and influence of family relationships as they struggle with sibling rivalry, self-discovery, peer relationships, a search for heritage, adoption, and death. (SM)

book reviews

African Journals Online (AJOL)

book reviews. Self-testing in ... This book is a useful tool for registrar trainees and practising psy- chiatrists alike. ... sultation service and is a Professor of Psychiatry at Harvard. Medical ... It is recommended as a study aid and provides the ideal ...

Nourishing Children with Books

OpenAIRE

Nickols-Richardson, Sharon Michelle, 1965-; Parra, Danielle Elizabeth; Serrano, Elena Lidia

2009-01-01

Books with food and nutrition topics, cultural food patterns, and physical activity themes help to improve the quality of life of children by exposing them to a variety of foods and activities through creative stories. This guide helps parents and caregivers select books that achieve this goal.

The Relationship Between Self-Efficacy and Help Evasion

DEFF Research Database (Denmark)

Persson, Roger; Cleal, Bryan; Jakobsen, Mette Øllgaard

2014-01-01

Objective. To examine the relationship between self-efficacy and not wanting help to change health behaviors. Method. All employees in the Danish police department were invited to respond to an electronic questionnaire. All respondents expressing a desire to change health behaviors in relation...... to reporting that one did not want help. Conclusion. A high belief in one's own ability to change lifestyle behaviors in relation to smoking, alcohol, eating, and physical activity may lead to avoidance of help offers in a workplace setting. © 2013 Society for Public Health Education....

Synthesis and Characterization of CdS Nanoparticles with Strong Electrolyte Behavior

International Nuclear Information System (INIS)

Zhang Yu; Fu, Degang; Liu Juzheng

2000-01-01

The CdS nanoparticles whose structure is similar to a strong electrolyte were synthesized by the colloidal chemical method. The CdS nanoparticles with Cd 2+ -rich surface are capped by the electrically neutral ligand of 2,2'-bipyridine (bpy), and the counterion, BPh 4 - , is adsorbed around the particle as balance charge. The ω donation from 2,2'-bipyridine at 2-position to the Cd 2+ -rich surface of the CdS nanoparticles was characterized by X-ray photoelectron spectroscopy (XPS). These CdS nanoparticles can redisperse in pyridine (py) or DMF, and have high stability. The determination of electroconductivity and the electrophoresis deposition in dilute solution containing the CdS nanoparticles further prove the rationality of the above electrolyte structure of the CdS nanoparticles

Self-portraits of the artists’ book: editorial criteria in the work of Román Gil

Directory of Open Access Journals (Sweden)

Francisco José Guillén Martínez

2017-06-01

Full Text Available They way in which artists’ books are perceived depends, for the most part, on editorial criteria that accept the book as a bibliographical artifact which depends on the conditions of its typographical printing. However, if the book takes on its symbolic meaning, it may l ead to the reconsideration of the boundaries of the art-f orm itself, redefining the relationship between artists and spectators in such a way that a self-portrait of all of those involved can be configured.

Turkish Migrant Women with Recurrent Depression: Results from Community-based Self-help Groups.

Science.gov (United States)

Siller, Heidi; Renner, Walter; Juen, Barbara

2017-01-01

The study focuses on psychosocial functioning of female Turkish immigrants in Austria with recurrent depressive disorder participating in self-help groups. Self-help groups guided by group leaders of Turkish descent should increase autonomy in participants, providing the opportunity to follow their ethnic health beliefs. Turkish immigrant women (n = 43) with recurrent depressive disorder participated in self-help groups over four months. Qualitative data of participants and group leaders, containing interviews, group protocols and supervision protocols of group leaders were analyzed using the qualitative content analysis for effects on psychosocial function, such as interaction with others, illness beliefs and benefit from self-help group. Women reported feelings of being neglected and violated by their husbands. They stated that they had gained strength and had emancipated themselves from their husbands. Self-help groups functioned as social resources and support for changes in participants' lives. Further interventions should integrate the functional value of depressive symptoms and focus on social support systems and social networks.

Can self-care health books affect amount of contact with the primary health care team? A randomized controlled trial in general practice.

Science.gov (United States)

Platts, Amanda; Mitton, Rosly; Boniface, David; Friedli, Karin

2005-09-01

To investigate the effects of two differently styled self-care health books in general practice on the frequency and duration of patients' consultations and their views of the books. Random allocation of patients to either a descriptive or a decision-tree based self-care health book, or a no-book control condition. Three- and 12-months follow-up by postal questionnaire and monitoring of consultations. A large general practice in the South East of England. A total of 1967 volunteer, adult patients who attended the practice in 2001 participated. Demographics; health problems; use of health services; use and perceptions of the trial book; frequency and duration of consultations. Response rates to postal questionnaires at 3 and 12 months were 80% and 74%. In all, 48% consulted their allocated book, compared with 25% who consulted any healthcare book in the Control group. Those reporting health problems were more likely to have consulted their allocated book; 60% reported that the allocated book made them more likely to deal with a problem themselves and 40% reported themselves less likely to consult the practice. However, there were no differences in consultation rates or durations of consultations between the three groups. Handing out of self-care health books may provide qualitative benefits for patients but is unlikely to reduce attendance at the GP practice.

Effectiveness of self-help psychological interventions for treating and preventing postpartum depression: a meta-analysis.

Science.gov (United States)

Lin, Ping-Zhen; Xue, Jiao-Mei; Yang, Bei; Li, Meng; Cao, Feng-Lin

2018-04-04

Previous studies have reported different effect sizes for self-help interventions designed to reduce postpartum depression symptoms; therefore, a comprehensive quantitative review of the research was required. A meta-analysis was conducted to examine the effectiveness of self-help interventions designed to treat and prevent postpartum depression, and identified nine relevant randomized controlled trials. Differences in depressive symptoms between self-help interventions and control conditions, changes in depressive symptoms following self-help interventions, and differences in postintervention recovery and improvement rates between self-help interventions and control conditions were assessed in separate analyses. In treatment trials, depression scores continued to decrease from baseline to posttreatment and follow-up assessment in treatment subgroups. Changes in treatment subgroups' depression scores from baseline to postintervention assessment were greater relative to those observed in prevention subgroups. Self-help interventions produced larger overall effects on postpartum depression, relative to those observed in control conditions, in posttreatment (Hedges' g = 0.51) and follow-up (Hedges' g = 0.32) assessments; and self-help interventions were significantly more effective, relative to control conditions, in promoting recovery from postpartum depression. Effectiveness in preventing depression did not differ significantly between self-help interventions and control conditions.The findings suggested that self-help interventions designed to treat postpartum depression reduced levels of depressive symptoms effectively and decreased the risk of postpartum depression.

The CDS and the Government Bonds Markets During the Last Financial Crisis

Directory of Open Access Journals (Sweden)

Križanič France

2015-11-01

Full Text Available Financial market had developed a special instrument to insure the buyers of bonds. This instrument is so called Credit Default Swap (CDS. The CDS price is a kind of insurance premium that the buyer of CDS pays to the seller of CDS in exchange for compensation of possible loss in operation. Paper analyses causality between CDS price and dynamics of bond yields and influence of macroeconomic factors on it in four selected countries during the last financial crisis. Analysis results show that there is no important macroeconomic variable included in the analysis that preceded the CDS prices connected with German government bonds. Sellers of CDS were apparently aware of the systemic nature of the financial crisis in the euro area. In the case of the United Kingdom, Russia and Slovenia we can observe the unemployment rate as the most important macroeconomic variable that preceded the CDS prices for government bonds.

Sulfonsuccinate (AOT Capped Pure and Mn-Doped CdS Nanoparticles

Directory of Open Access Journals (Sweden)

D. Venkatesan

2012-01-01

Full Text Available CdS nanoparticles and thin films are well known for their excellent semiconducting properties. When transition metal ions are doped into the CdS, it exhibits magnetic properties in addition to semiconducting properties and they are termed as dilute magnetic semiconductors (DMSs. In this paper, we discuss the preparation of sodium bis(2-ethylhexyl sulfonsuccinate (AOT capped CdS nanoparticles and thin films doped with magnetic impurity Mn. Sodium bis(2-ethulexyl sulfonsuccinate (AOT, capping agent promotes the uniform formation of nanoparticles. Optical characterizations are made using the UV-Vis spectrometer, PL, and FTIR. XRD shows the hexagonal structure of the CdS. SEM images and EDS measurements were made for the thin films. EPR shows the clear hyperfine lines corresponding to Mn2+ ion in the CdS nanoparticles.

The use of CDS/ISIS software in Africa | Abboy | Innovation

African Journals Online (AJOL)

CDS/ISIS is free-of-charge software that has been developed by UNESCO and is distributed through a network of country distributors and more recently through the World Wide Web. CDS/ISIS is ideally suited for the manipulation of bibliographic data. Literature sources reveal that the use of CDS/ISIS is widespread in Africa ...

The Helpfulness of Spiritually Influenced Group Work in Developing Self-Awareness and Self-Esteem: A Preliminary Investigation

Directory of Open Access Journals (Sweden)

Diana Coholic

2005-01-01

Full Text Available This paper discusses an exploratory study that investigated the helpfulness of spiritually influenced group work with eight adult women who shared a history of substance abuse. The overall purpose of the group was to help participants develop their self-awareness and self-esteem. The group, which was contextualized in transpersonal theory, was organized around the following themes and experiential exercises: meditation, mindfulness practice, dream work, stream of consciousness writing, the shadow self, and other arts-based processes. Grounded-theory analysis of group sessions and individual interviews with the participants found that the participants perceived the group to be helpful in developing their self-awareness and self-esteem. While the participants identified different aspects of the group as spiritual, making-meaning was one practice that was consistently described as a spiritually sensitive process. The results of this study in this emergent field are promising and suggestions are provided for future research.

Climate Change Denial Books and Conservative Think Tanks: Exploring the Connection.

Science.gov (United States)

Dunlap, Riley E; Jacques, Peter J

2013-06-01

The conservative movement and especially its think tanks play a critical role in denying the reality and significance of anthropogenic global warming (AGW), especially by manufacturing uncertainty over climate science. Books denying AGW are a crucial means of attacking climate science and scientists, and we examine the links between conservative think tanks (CTTs) and 108 climate change denial books published through 2010. We find a strong link, albeit noticeably weaker for the growing number of self-published denial books. We also examine the national origins of the books and the academic backgrounds of their authors or editors, finding that with the help of American CTTs climate change denial has spread to several other nations and that an increasing portion of denial books are produced by individuals with no scientific training. It appears that at least 90% of denial books do not undergo peer review, allowing authors or editors to recycle scientifically unfounded claims that are then amplified by the conservative movement, media, and political elites.

Willingness to Seek Help as a Function of Self-Disclosure and Problem Severity.

Science.gov (United States)

Hinson, Janise A.; Swanson, Jane L.

1993-01-01

Examined effects of problem severity, amount of self-disclosure, and self-disclosure flexibility on willingness to seek help for problem. Findings from 101 college students indicated that factors that predicted greatest amount of variance in willingness to seek help were interaction of problem severity with willingness to self-disclose to…

Taiwanese students' gender, age, interdependent and independent self-construal, and collective self-esteem as predictors of professional psychological help-seeking attitudes.

Science.gov (United States)

Yeh, Christine J

2002-02-01

Interdependent self-construal, collective self-esteem, age, and gender were used to predict attitudes toward seeking professional psychological help among a sample of junior high, high school, and college students in Taiwan (N = 594). Self-construal, collective self-esteem, and help-seeking attitudes were measured by the Self-Construal Scale (T. M. Singelis, 1994), the Collective Self-Esteem Scale Revised (R. Luhtanen & J. Crocker, 1992), and the Attitudes Towards Seeking Professional Psychological Help Scale (E. H. Fischer & J. L. Turner, 1970), respectively. By using stepwise regression, each of the independent factors with the exception of age significantly predicted the dependent variable, professional psychological help-seeking attitudes. Implications for counseling and future research are addressed.

Preparing a new book on ATLAS

CERN Multimedia

Claudia Marcelloni de Oliveira

A book about the ATLAS project and the ATLAS collaboration is going to be published and available for sale in mid 2008. The book is intended to be a symbol of appreciation for all the people from ATLAS institutes, triggering fond memories through photos, interviews, short commentaries and anecdotes about the daily life and milestones encountered while designing, constructing and completing ATLAS. We would like to give you the opportunity to collaborate with this project in two different ways: Firstly, please send us the best anecdotes related to ATLAS that you remember. To submit anecdotes, send an email to Claudia.Marcelloni@cern.ch. Secondly, you are invited to participate in our PHOTO COMPETITION. Please send the best photos you have of ATLAS attached with a description, the location, and date taken. The categories are: Milestones in the process of designing and building the detector, People at work and Important gatherings. To submit photos you should go to the CDS page and select ATLAS Photo Competi...

Self-Injury, Help-Seeking, and the Internet: Informing Online Service Provision for Young People.

Science.gov (United States)

Frost, Mareka; Casey, Leanne; Rando, Natalie

2016-01-01

Although increasing numbers of young people are seeking help online for self-injury, relatively little is known about their online help-seeking preferences. To investigate the perspectives of young people who self-injure regarding online services, with the aim of informing online service delivery. A mixed-methods exploratory analysis regarding the perspectives of a subsample of young people who reported a history of self-injury and responded to questions regarding preferences for future online help-seeking (N = 457). The sample was identified as part of a larger study (N = 1,463) exploring self-injury and help-seeking. Seven themes emerged in relation to preferences for future online help-seeking: information, guidance, reduced isolation, online culture, facilitation of help-seeking, access, and privacy. Direct contact with a professional via instant messaging was the most highly endorsed form of online support. Young people expressed clear preferences regarding online services for self-injury, supporting the importance of consumer consultation in development of online services.

Taiwanese Students' Gender, Age, Interdependent and Independent Self-Construal, and Collective Self-Esteem as Predictors of Professional Psychological Help-Seeking Attitudes.

Science.gov (United States)

Yeh, Christine J.

2002-01-01

Self-esteem, age, and gender were used to assess attitudes towards seeking psychological services among secondary school and college students. Self-esteem and gender significantly predicted students help-seeking attitudes. A counselor's knowledge of cultural perspectives of self-esteem, as they relate to help-seeking behaviors, will help with…

Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

Science.gov (United States)

Tripathi, R. M.; Singh Bhadwal, Akhshay; Singh, Priti; Shrivastav, Archana; Singh, M. P.; Shrivastav, B. R.

2014-06-01

A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles.

A comparative study of CdS thin films deposited by different techniques

Energy Technology Data Exchange (ETDEWEB)

Pérez-Hernández, G., E-mail: german.perez@ujat.mx [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Pantoja-Enríquez, J. [Centro de Investigación y Desarrollo Tecnológico en Energías Renovables, UNICACH, Libramiento Norte No 1150, Tuxtla Gutiérrez, Chiapas 29039 (Mexico); Escobar-Morales, B. [Instituto Tecnológico de Cancún, Avenida Kábah Km 3, Cancún, Quintana Roo 77500 (Mexico); Martinez-Hernández, D.; Díaz-Flores, L.L.; Ricardez-Jiménez, C. [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Mathews, N.R.; Mathew, X. [Centro de Investigación en Energía, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico)

2013-05-01

Cadmium sulfide thin-films were deposited on glass slides and SnO{sub 2}:F coated glass substrates by chemical bath deposition, sputtering and close-spaced sublimation techniques. The films were studied for the structural and opto-electronic properties after annealing in an ambient identical to that employed in the fabrication of CdTe/CdS devices. Quantum efficiency of the CdTe/CdS solar cells fabricated with CdS buffer films prepared by the three methods were investigated to understand the role of CdS film preparation method on the blue response of the devices. The higher blue response observed for the devices fabricated with chemical bath deposited CdS film is discussed. - Highlights: ► CdS films were prepared by different techniques. ► Role of CdS on the blue response of device was studied. ► Structural and optical properties of CdS were analyzed. ► Chemically deposited CdS has high blue transmittance. ► CdS deposition method influences diffusion of S and Te.

Up from Dependency: A New National Public Assistance Strategy. Supplement 3: A Self-Help Catalog.

Science.gov (United States)

Kotler, Martin; And Others

Self-help among low-income people is vitally important. In no area is self-help more important than in overcoming poverty's burdens and energizing the escape from poverty. This document comprises an inventory of self-help and mutual-help programs that feature active involvement of members of the low-income population. The programs in this…

Measuring the Self-Stigma Associated with Seeking Psychological Help

Science.gov (United States)

Vogel, David L.; Wade, Nathaniel G.; Haake, Shawn

2006-01-01

Self-stigma is an important factor in people's decisions not to engage in therapy. To measure this construct, the authors developed the 10-item Self-Stigma of Seeking Help (SSOSH) scale. In Study 1 (n = 583), the SSOSH had a unidimensional factor structure and good reliability (0.91) among participants. Study 2 (n = 470) confirmed the factor…

Cyber-Porn Dependence: Voices of Distress in an Italian Internet Self-Help Community

Science.gov (United States)

Cavaglion, Gabriel

2009-01-01

This study analyzes narratives of cyber-porn users and defines major patterns of distress as self-reported by contributors to a self-help group in the Internet. It applies narrative analysis methodology to 2000 messages sent by 302 members of an Italian self-help Internet community for cyber-porn dependents ("noallapornodipendenza").…

Synthesis of CdS nanorods in soft template under gamma-irradiation.

Science.gov (United States)

Zhao, Bing; Wang, Yanli; Zhang, Haijiao; Jiao, Zheng; Wang, Haobo; Ding, Guoji; Wu, Minghong

2009-02-01

CdS nano material which has a band gap of 2.42 eV at room temperature is a typical II-VII semiconductor having many commercial or potential applications, e.g., light-emitting diodes, solar cell and optoelectronic devices. In this paper, we use a new strategy to synthesize CdS nanorods. CdS nanorods were prepared in soft template under gamma-irradiation though the reaction of cadmium sulphide and thiacetamide (TAA). The formation process and characters of CdS nanorods was investigated in detail by transmission electron microscopy (TEM), electron diffraction (ED) pattern, X-ray powder diffraction (XRD), ultraviolet spectrophotometer (UV) and photoluminescence spectrophotometer (PL). In the experiment we proposed that the irradiation of gamma-ray accelerated the formation of S(2-) under acidic condition (pH = 3) and vinyl acetate (VAc) monomer formed pre-organized nano polymer tubules which were used as both templates and nanoreacters for the growth of CdS nanorods. In this process, we have obtained the CdS polycrystal nanorods with PVAc nano tubules and CdS single-crystal nanorods. The result of X-ray powder diffraction confirms that the crystal type of CdS nanorods is cubic F-43 m (216). The results from transmission electron microscopy and electron diffraction show that the concentrations of reactants and the dose rate of gamma-ray are key to produce appropriate CdS nanorods. Relatively low concentrations (Cd2+: 0.008-0.02 mol/L, Cd2+ : S(2-) = 1 : 2) of reactants and long time (1-2 d) of irradiation in low dose rate (6-14 Gy/min) are propitious to form CdS single-crystal nanorods with small diameter (less than 100 nm) and well length (2-5 microm). UV and PL characterizations show the sample have well optical properties.

Enriching The Metadata On CDS

CERN Document Server

Chhibber, Nalin

2014-01-01

The project report revolves around the open source software package called Invenio. It provides the tools for management of digital assets in a repository and drives CERN Document Server. Primary objective is to enhance the existing metadata in CDS with data from other libraries. An implicit part of this task is to manage disambiguation (within incoming data), removal of multiple entries and handle replications between new and existing records. All such elements and their corresponding changes are integrated within Invenio to make the upgraded metadata available on the CDS. Latter part of the report discuss some changes related to the Invenio code-base itself.

La Doping of CdS for Enhanced CdS/CdSe Quantum Dot Cosensitized Solar Cells

Directory of Open Access Journals (Sweden)

Xiaolei Qi

2015-01-01

Full Text Available CdS/CdSe system of quantum dot cosensitized solar cells (QDCSCs is one of the most attractive structures for high-efficiency due to its effect of level adjusting. However, the stepwise structure formed between levels of CdS and CdSe has a limitation for enhancing the efficiencies. Metal ions doping in quantum dots have emerged as a common way for changing the Fermi level, band gap, and conductance. Here we report an innovative concept for the rare earth materials La-doped of the CdS layer in the CdS/CdSe QDCSCs by means of the successive ionic layer adsorption and reaction (SILAR. Then we tested that La doped quantum dots can help more electrons accumulate in CdS film, which makes the Fermi level shift up and form a stepped structure. This method leads to enhanced absorption intensity, obviously increasing current density in CdS/CdSe QDCSCs. Our research is a new exploration for improving efficiencies of quantum dot sensitized solar cells.

Financial Stress, Self-Efficacy, and Financial Help-Seeking Behavior of College Students

Science.gov (United States)

Lim, HanNa; Heckman, Stuart J.; Letkiewicz, Jodi C.; Montalto, Catherine P.

2014-01-01

Financial stress and self-efficacy are examined in relationship to college students' financial help-seeking behavior utilizing Grable and Joo's (1999) framework. A cognitive approach is taken by focusing on the moderating role of financial self-efficacy on the relationship between financial stress and financial help-seeking. Data from the 2010…

Ultrasonic/surfactant assisted of CdS nano hollow sphere synthesis and characterization

International Nuclear Information System (INIS)

Rafati, Amir Abbas; Borujeni, Ahmad Reza Afraz; Najafi, Mojgan; Bagheri, Ahmad

2011-01-01

CdS hollow nanospheres with diameters ranging from 40 to 150 nm have been synthesized by a surfactant-assisted sonochemical route. The successful vesicle templating indicates that the outer leaflet of the bilayer is the receptive surface in the controlled growth of CdS nanoparticles which provide the unique reactor for the nucleation and mineralization growth of CdS nanoparticles. The CdS nanostructures obtained were characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, ultraviolet-visible spectroscopy and photoluminescence spectroscopy. Structural characterization of hollow CdS nanospheres indicates that these products packed with square subunits having sizes between 5 and 7 nm in diameter. The formation of the hollow nanostructure was explained by a vesicle template mechanism, in which sonication and surfactant play important roles. The band-edge emission and surface luminescence of the CdS nanoparticles were observed. -Research Highlights: → CdS hollow nanospheres with diameters of 40-150 nm were synthesized. → Nanoparticles were characterized by UV/Vis and photoluminescence. → Nanospheres are composed of smaller nanocrystals with the average size of 6.8 nm. → The band gap energy of the CdS nanoparticles is higher than its bulk value.

Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

International Nuclear Information System (INIS)

Tripathi, R M; Shrivastav, Archana; Bhadwal, Akhshay Singh; Singh, Priti; Singh, M P; Shrivastav, B R

2014-01-01

A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles. (papers)

Delivering Acceptance and Commitment Therapy for Weight Self-Stigma through Guided Self-Help: Results from an Open Pilot Trial

OpenAIRE

Levin, Michael E.; Potts, Sarah; Haeger, Jack; Lillis, Jason

2017-01-01

Weight self-stigma is a promising target for innovative interventions seeking to improve outcomes among overweight/obese individuals. Preliminary research suggests acceptance and commitment therapy (ACT) may be an effective approach for reducing weight self-stigma, but a guided self-help version of this intervention may improve broad dissemination. This pilot open trial sought to evaluate the potential acceptability and efficacy of a guided self-help ACT intervention, included coaching and a ...

Self-help cognitive-behavioral therapy for insomnia: a meta-analysis of randomized controlled trials.

Science.gov (United States)

Ho, Fiona Yan-Yee; Chung, Ka-Fai; Yeung, Wing-Fai; Ng, Tommy H; Kwan, Ka-Shing; Yung, Kam-Ping; Cheng, Sammy K

2015-02-01

Self-help cognitive-behavioral therapy (CBT) is an increasingly popular treatment option for insomnia. The objective of this meta-analysis was to compile an up-to-date evaluation on the efficacy, adherence, acceptability and dropout rate of self-help CBT for insomnia. We systematically searched six key electronic databases up until May 2013. Two researchers independently selected relevant publications, extracted data, and evaluated methodological quality according to the Cochrane criteria. Twenty randomized controlled trials were included; 10 of which were published after the last review up until January 2007. Meta-analysis of self-help CBT vs. waiting-list, routine care or no treatment was performed. Results showed that self-help CBT improved sleep, sleep-related cognitions and anxiety and depressive symptoms. Effect sizes for sleep-diary-derived sleep efficiency, sleep onset latency, and wake after sleep onset at immediate posttreatment were 0.80, 0.66, and 0.55, respectively. The average dropout rate of self-help CBT at immediate posttreatment was 14.5%, which was not significantly different from the 16.7% in therapist-administered CBT. Subgroup analyses supported the added benefit of telephone consultation. In conclusion, self-help CBT is efficacious and acceptable as an entry level of a stepped care model for insomnia. In places where face-to-face treatments are unavailable or too costly, self-help CBT can be considered as a compromise. Copyright © 2014 Elsevier Ltd. All rights reserved.

Helping the self help others: self-affirmation increases self-compassion and pro-social behaviors.

Science.gov (United States)

Lindsay, Emily K; Creswell, J David

2014-01-01

Reflecting on an important personal value in a self-affirmation activity has been shown to improve psychological functioning in a broad range of studies, but the underlying mechanisms for these self-affirmation effects are unknown. Here we provide an initial test of a novel self-compassion account of self-affirmation in two experimental studies. Study 1 shows that an experimental manipulation of self-affirmation (3-min of writing about an important personal value vs. writing about an unimportant value) increases feelings of self-compassion, and these feelings in turn mobilize more pro-social behaviors to a laboratory shelf-collapse incident. Study 2 tests and extends these effects by evaluating whether self-affirmation increases feelings of compassion toward the self (consistent with the self-compassion account) or increases feelings of compassion toward others (an alternative other-directed compassion account), using a validated storytelling behavioral task. Consistent with a self-compassion account, Study 2 demonstrates the predicted self-affirmation by video condition interaction, indicating that self-affirmation participants had greater feelings of self-compassion in response to watching their own storytelling performance (self-compassion) compared to watching a peer's storytelling performance (other-directed compassion). Further, pre-existing levels of trait self-compassion moderated this effect, such that self-affirmation increased self-compassionate responses the most in participants low in trait self-compassion. This work suggests that self-compassion may be a promising mechanism for self-affirmation effects, and that self-compassionate feelings can mobilize pro-social behaviors.

Enhanced photovoltaic performance of quantum dot-sensitized solar cells with a progressive reduction of recombination using Cu-doped CdS quantum dots

International Nuclear Information System (INIS)

Muthalif, Mohammed Panthakkal Abdul; Lee, Young-Seok; Sunesh, Chozhidakath Damodharan; Kim, Hee-Je; Choe, Youngson

2017-01-01

Highlights: • Cu-doped CdS QDs were deposited on TiO_2 by SILAR method. • Cu-doped CdS electrodes contributes reduction of charge recombination and longer electron lifetime. • A promising power conversion efficiency of 3% is obtained for the Cu-doped CdS Quantum dot sensitized solar cell. - Abstract: In this article, we have systematically probed the effect of Cu-doping in CdS quantum dots (QDs) to enhance the photovoltaic performance of the quantum dot-sensitized solar cells (QDSSCs). The Cu-doped CdS photoanodes were prepared by successive ionic layer adsorption and reaction (SILAR) method and the corresponding cell devices were fabricated using CuS counter electrodes with a polysulfide electrolyte. The photovoltaic performance results demonstrate that 3 mM Cu-doped CdS QDs based QDSSCs exhibit the efficiency (η) of 3% including J_S_C = 9.40 mA cm"−"2, V_O_C = 0.637 V, FF = 0.501, which are higher than those with bare CdS (η = 2.05%, J_S_C = 7.12 mA cm"−"2, V_O_C = 0.588 V, FF = 0.489). The structural, topographical and optical properties of the thin films have been studied with the help of X-ray diffraction pattern (XRD), atomic force microscopy (AFM) and UV–vis spectrophotometer. Electrochemical impedance spectroscopy (EIS) and open circuit voltage decay (OCVD) measurements indicate that Cu-dopant can inhibit the charge recombination at the photoanode/electrolyte interface and extend the lifetime of electrons. These results reveal that incorporation of copper metal in CdS QDs is a simple and effective method to improve the photovoltaic properties of QDSSCs.

Enhanced photovoltaic performance of quantum dot-sensitized solar cells with a progressive reduction of recombination using Cu-doped CdS quantum dots

Energy Technology Data Exchange (ETDEWEB)

Muthalif, Mohammed Panthakkal Abdul [Department of Polymer Science and Chemical Engineering, Pusan National University, Geumjeong-Ku, Jangjeong-Dong, Busan 609-735 (Korea, Republic of); Lee, Young-Seok [School of Electrical Engineering, Pusan National University, Geumjeong-Ku, Jangjeong-Dong, Busan 609-735 (Korea, Republic of); Sunesh, Chozhidakath Damodharan [Department of Polymer Science and Chemical Engineering, Pusan National University, Geumjeong-Ku, Jangjeong-Dong, Busan 609-735 (Korea, Republic of); Kim, Hee-Je [School of Electrical Engineering, Pusan National University, Geumjeong-Ku, Jangjeong-Dong, Busan 609-735 (Korea, Republic of); Choe, Youngson, E-mail: choe@pusan.ac.kr [Department of Polymer Science and Chemical Engineering, Pusan National University, Geumjeong-Ku, Jangjeong-Dong, Busan 609-735 (Korea, Republic of)

2017-02-28

Highlights: • Cu-doped CdS QDs were deposited on TiO{sub 2} by SILAR method. • Cu-doped CdS electrodes contributes reduction of charge recombination and longer electron lifetime. • A promising power conversion efficiency of 3% is obtained for the Cu-doped CdS Quantum dot sensitized solar cell. - Abstract: In this article, we have systematically probed the effect of Cu-doping in CdS quantum dots (QDs) to enhance the photovoltaic performance of the quantum dot-sensitized solar cells (QDSSCs). The Cu-doped CdS photoanodes were prepared by successive ionic layer adsorption and reaction (SILAR) method and the corresponding cell devices were fabricated using CuS counter electrodes with a polysulfide electrolyte. The photovoltaic performance results demonstrate that 3 mM Cu-doped CdS QDs based QDSSCs exhibit the efficiency (η) of 3% including J{sub SC} = 9.40 mA cm{sup −2}, V{sub OC} = 0.637 V, FF = 0.501, which are higher than those with bare CdS (η = 2.05%, J{sub SC} = 7.12 mA cm{sup −2}, V{sub OC} = 0.588 V, FF = 0.489). The structural, topographical and optical properties of the thin films have been studied with the help of X-ray diffraction pattern (XRD), atomic force microscopy (AFM) and UV–vis spectrophotometer. Electrochemical impedance spectroscopy (EIS) and open circuit voltage decay (OCVD) measurements indicate that Cu-dopant can inhibit the charge recombination at the photoanode/electrolyte interface and extend the lifetime of electrons. These results reveal that incorporation of copper metal in CdS QDs is a simple and effective method to improve the photovoltaic properties of QDSSCs.

Which Book and Why: Using Book Bands and Book Levels for Guided Reading in Key Stage 1 [Includes CD-ROM

Science.gov (United States)

Bodman, Sue, Ed.; Franklin, Glen, Ed.

2014-01-01

We want all children to love reading, and Which Book and Why demonstrates how effective guided reading for children in Foundation Stage and Key Stage 1 can help teachers make this happen. Balancing theory and practice, this book explores how schools and teachers can implement guided reading more confidently and more effectively. Which Book and Why…

The Relationship Between Self-Efficacy and Help Evasion

DEFF Research Database (Denmark)

Persson, Roger; Cleal, Bryan; Jakobsen, Mette Øllgaard

2014-01-01

Objective. To examine the relationship between self-efficacy and not wanting help to change health behaviors. Method. All employees in the Danish police department were invited to respond to an electronic questionnaire. All respondents expressing a desire to change health behaviors in relation to...

Top-selling childbirth advice books: a discourse analysis.

Science.gov (United States)

Kennedy, Holly Powell; Nardini, Katrina; McLeod-Waldo, Rebecca; Ennis, Linda

2009-12-01

Recent evidence suggests that one-third of women receive information about pregnancy and childbirth through books. Messages about what characteristics are normal (or expected) in childbirth are disseminated in a variety of ways, including popular childbirth education books, but little study of them has been conducted. The purpose of this investigation is to address that gap by examining the discussions about childbirth in the 10 top-selling books in the United States. Discourse analysis (relating to the public, personal, and political discussions about a specific phenomenon) was used to study 10 best-selling United States childbirth advice books marketed to childbearing women during the first week of November 2007. Book styles ranged from clinical descriptions of pregnancy and birth primarily offering reassurance, self-help information, and danger signs to more folksy and humorous commentaries. Presentation of scientific evidence to support recommendations was uneven and at times inaccurate. Five focal areas of discourse included body image, labor and birth, pain, power and control, and life preparation for motherhood. Top-selling books shine an interesting light on the current state of United States maternity practices. Women and health professionals should assess them carefully and engage with each other about their recommendations and implications for childbirth.

Self-Concealment Mediates the Relationship Between Perfectionism and Attitudes Toward Seeking Psychological Help Among Adolescents.

Science.gov (United States)

Abdollahi, Abbas; Hosseinian, Simin; Beh-Pajooh, Ahmad; Carlbring, Per

2017-01-01

One of the biggest barriers in treating adolescents with mental health problems is their refusing to seek psychological help. This study was designed to examine the relationships between two forms of perfectionism, self-concealment and attitudes toward seeking psychological help and to test the mediating role of self-concealment in the relationship between perfectionism and attitudes toward seeking psychological help among Malaysian high school students. The participants were 475 Malaysian high school students from four high schools in Kuala Lumpur, Malaysia. Structural equation modelling results indicated that high school students with high levels of socially prescribed perfectionism, high levels of self-concealment, and low levels of self-oriented perfectionism reported negative attitudes toward seeking psychological help. Bootstrapping analysis showed that self-concealment emerged as a significant, full mediator in the link between socially prescribed perfectionism and attitudes toward seeking psychological help. Moderated mediation analysis also examined whether the results generalized across men and women. The results revealed that male students with socially prescribed perfectionism are more likely to engage in self-concealment, which in turn, leads to negative attitudes toward seeking psychological help more than their female counterparts. The results suggested that students high in socially prescribed perfectionism were more likely to engage in self-concealment and be less inclined to seek psychological help.

Helping the self help others: Self-affirmation increases self-compassion and pro-social behaviors

Directory of Open Access Journals (Sweden)

Emily K Lindsay

2014-05-01

Full Text Available Reflecting on an important personal value in a self-affirmation activity has been shown to improve psychological functioning in a broad range of studies, but the underlying mechanisms for these self-affirmation effects are unknown. Here we provide an initial test of a novel self-compassion account of self-affirmation in two experimental studies. Study 1 shows that an experimental manipulation of self-affirmation (3-minutes of writing about an important personal value versus writing about an unimportant value increases feelings of self-compassion, and these feelings in turn mobilize more pro-social behaviors to a laboratory shelf-collapse incident. Study 2 tests and extends these effects by evaluating whether self-affirmation increases feelings of compassion toward the self (consistent with the self-compassion account or increases feelings of compassion toward others (an alternative other-directed compassion account, using a validated storytelling behavioral task. Consistent with a self-compassion account, Study 2 demonstrates the predicted self-affirmation by video condition interaction, indicating that self-affirmation participants had greater feelings of self-compassion in response to watching their own storytelling performance (self-compassion compared to watching a peer’s storytelling performance (other-directed compassion. Further, pre-existing levels of trait self-compassion moderated this effect, such that self-affirmation increased self-compassionate responses the most in participants low in trait self-compassion. This work suggests that self-compassion may be a promising mechanism for self-affirmation effects, and that self-compassionate feelings can mobilize pro-social behaviors.

ORF Sequence: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available KGSWTFYIMLLASFRIFFGLGLSLSPMESWTIMNVVHAGVTFIVFHWIKGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSRKFLICVVVFLYLAAVHSTPFERQFFFVHAVNLIAFLVVFVAKLPFMHGVRIFGINR ... cds gnl|CMER >gnl|CMER|CMQ020C hypothetical protein, conserved MQSGHGETRFDVGVEWLRA

The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

Energy Technology Data Exchange (ETDEWEB)

Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz, E-mail: yonganer@atauni.edu.tr

2015-01-15

The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K{sub app}) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M{sup −1} and 0.51 for 4 nm CdS NPs and 624.3 M{sup −1} and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher.

The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

International Nuclear Information System (INIS)

Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz

2015-01-01

The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K app ) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M −1 and 0.51 for 4 nm CdS NPs and 624.3 M −1 and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher

ORF Sequence: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >gnl|CMER|CME069C hypothetical protein MQSGSSEERVSSHMEARDSAPTASSMPSLRLTATATATATAR...LTYAHVSRPRPPAHLPRSDAYGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACDGSPSASTTSSSTATAR...PTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEADHPPQVHRQGSDVSHINHTTKKLLSLWLLARPTATVKATVKVLRSDARRCGPDLSTTAEQARCNCREQCRSRTHR

Chemical synthesis of porous web-structured CdS thin films for photosensor applications

Energy Technology Data Exchange (ETDEWEB)

Gosavi, S.R., E-mail: srgosavi.taloda@gmail.com [C. H. C. Arts, S. G. P. Commerce, and B. B. J. P. Science College, Taloda, Dist., Nandurbar 425413, M. S. (India); Nikam, C.P. [B.S.S.P.M.S. Arts, Commerce and Science College, Songir, Dist., Dhule 424309, M. S. (India); Shelke, A.R.; Patil, A.M. [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India); Ryu, S.-W. [Department of Physics, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Bhat, J.S. [Department of Physics, Karnatak University, Dharwad 580003 (India); Deshpande, N.G., E-mail: nicedeshpande@yahoo.co.in [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India)

2015-06-15

The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting.

Chemical synthesis of porous web-structured CdS thin films for photosensor applications

International Nuclear Information System (INIS)

Gosavi, S.R.; Nikam, C.P.; Shelke, A.R.; Patil, A.M.; Ryu, S.-W.; Bhat, J.S.; Deshpande, N.G.

2015-01-01

The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting

The Effects of Self-Book© Art Therapy on Cancer-Related Distress in Female Cancer Patients during Active Treatment: A Randomized Controlled Trial.

Science.gov (United States)

Radl, Donna; Vita, Maureen; Gerber, Nancy; Gracely, Edward J; Bradt, Joke

2018-05-10

National attention on patients' cancer-related emotional distress produced a need for evidence-based, psychosocial interventions in oncology care. The purpose of this study was to evaluate the efficacy of Self-Book© art therapy for emotional distress and psychological well-being of female oncology patients during active oncology treatment. Sixty consenting women with cancer were randomly assigned to either a six-session Self-Book© art therapy program or standard care. A repeated measures randomized controlled trial design was employed. Data were collected using the Distress Thermometer (DT), Perceived Emotional Distress Inventory (PEDI), Patient-Reported Outcomes Measurement Information System (PROMIS) Brief Psychological Well-being test, and the Functional Assessment of Chronic Illness Therapy - Spiritual Well-being (FACIT-Sp). Measurements were obtained at baseline, week 3, week 6, and 1-to-2 months post-intervention. Forty participants were included in the final analysis. No significant differences between groups were found for the primary outcome measures: emotional distress and psychological well-being. Greater improvements in Self-Book© art therapy participants' spiritual well-being were found compared to the standard care control participants (p = 0.02). Although no statistically significant differences were present between the groups for the primary outcomes, several positive trends were noted. Thirty percent of Self-Book© art therapy participants reported post-intervention emotional distress scores that were below the abnormal range for emotional distress, compared with only 5% of standard care control participants, suggesting that Self-Book© art therapy may have clinical value. Further studies are recommended to better understand the therapeutic mechanisms of Self-Book© art therapy for enhancing psychological well-being. This article is protected by copyright. All rights reserved.

Can We Talk? Helping Families Talk about Self-Esteem, Sex, and Peer Pressure. Training Package = Conversamos? Ayudando a Familias a Hablar sobre la Autoestima, el Sexo, y la Presion de los Amigos. Paquete de Capacitacion.

Science.gov (United States)

Cappello, Dominic; Newberry, Jerald

This English and Spanish language multimedia packet comprises an educational curriculum designed to help families talk about self-esteem, sex, and peer pressure with their children in grades 4 through 8. The packet consists of a planning and training manuals, family activity books, and a videotape. The curriculum is comprised of four parent…

HDR-Clinical Data Service (CDS)

Data.gov (United States)

Department of Veterans Affairs — CDS is a SOAP/REST web service interface that supports Create, Retrieve, Update, and Delete (CRUD) operations against HDR data stores over secure Hypertext Transfer...

An optimized multilayer structure of CdS layer for CdTe solar cells application

International Nuclear Information System (INIS)

Han Junfeng; Liao Cheng; Jiang Tao; Spanheimer, C.; Haindl, G.; Fu, Ganhua; Krishnakumar, V.; Zhao Kui; Klein, A.; Jaegermann, W.

2011-01-01

Research highlights: → Two different methods to prepare CdS films for CdTe solar cells. → A new multilayer structure of window layer for the CdTe solar cell. → Thinner CdS window layer for the solar cell than the standard CdS layer. → Higher performance of solar cells based on the new multilayer structure. - Abstract: CdS layers grown by 'dry' (close space sublimation) and 'wet' (chemical bath deposition) methods are deposited and analyzed. CdS prepared with close space sublimation (CSS) has better crystal quality, electrical and optical properties than that prepared with chemical bath deposition (CBD). The performance of CdTe solar cell based on the CSS CdS layer has higher efficiency than that based on CBD CdS layer. However, the CSS CdS suffers from the pinholes. And consequently it is necessary to prepare a 150 nm thin film for CdTe/CdS solar cell. To improve the performance of CdS/CdTe solar cells, a thin multilayer structure of CdS layer (∼80 nm) is applied, which is composed of a bottom layer (CSS CdS) and a top layer (CBD CdS). That bi-layer film can allow more photons to pass through it and significantly improve the short circuit current of the CdS/CdTe solar cells.

The Relationship between Self-Efficacy and Help Evasion

Science.gov (United States)

Persson, Roger; Cleal, Bryan; Jakobsen, Mette Øllgaard; Villadsen, Ebbe; Andersen, Lars L.

2014-01-01

Objective: To examine the relationship between self-efficacy and not wanting help to change health behaviors. Method: All employees in the Danish police department were invited to respond to an electronic questionnaire. All respondents expressing a desire to change health behaviors in relation to smoking ("n" = 845), alcohol…

Effects of bacteria on CdS thin films used in technological devices

Science.gov (United States)

Alpdoğan, S.; Adıgüzel, A. O.; Sahan, B.; Tunçer, M.; Metin Gubur, H.

2017-04-01

Cadmium sulfide (CdS) thin films were fabricated on glass substrates by the chemical bath deposition method at 70 {}^\\circ \\text{C} considering deposition times ranging from 2 h to 5 h. The optical band gaps of CdS thin films were found to be in the 2.42-2.37 eV range. CdS thin films had uniform spherical nano-size grains which had polycrystalline, hexagonal and cubic phases. The films had a characteristic electrical resistivity of the order of {{10}5} Ω \\text{cm} and n-type conductivity at room condition. CdS thin films were incubated in cultures of B.domonas aeruginosa and Staphylococcus aureus, which exist abundantly in the environment, and form biofilms. SEM images showed that S. aureus and K. pneumonia were detected significantly on the film surfaces with a few of P. aeruginosa and B. subtilis cells attached. CdS thin film surface exhibits relatively good resistance to the colonization of P. aeruginosa and B. subtilis. Optical results showed that the band gap of CdS thin films which interacted with the bacteria is 2.42 \\text{eV} . The crystal structure and electrical properties of CdS thin films were not affected by bacterial adhesion. The antimicrobial effect of CdS nanoparticles was different for different bacterial strains.

Re-dispersible Li+ and Eu3+ co-doped CdS nanoparticles ...

Indian Academy of Sciences (India)

Also, it can be used as sensor for drug delivery in our body [12,13]. In the present work, we prepare re-dispersible CdS, Li+- and Eu3+-doped CdS nanoparticles in organic solvent by urea hydrolysis at 170◦C and their lumines- cence properties are studied. We propose the mechanism of re-dispersion of CdS nanoparticles ...

To Receive from the Rich or the Poor: Effects on the Recipient’s Self Esteem and Subsequent Self-Help Behavior.

Science.gov (United States)

A 2 (aid vs. no aid) x 2 (high vs. low resource potential donor) factorial design tested the effects of aid and donor resources on recipient self ...to self - esteem inherent in aid and subsequent self -help is discussed in terms of self - esteem theory. (Modified author abstract)...perceptions and subsequent self -help behavior. The results were characterized by interactions between the two factors. The relationship between threat

Preparation of CdS Nanoparticles by First-Year Undergraduates

Science.gov (United States)

Winkelmann, Kurt; Noviello, Thomas; Brooks, Stephen

2007-01-01

The first year undergraduates use a simple method to synthesize 5-nm CdS nanoparticles in a water-in-oil microemulsion. The quantum size effect, the relationship between colors, optical absorbance, band-gap energy and the CdS particles affected by the formation of micelles are observed.

Broad spectral response photodetector based on individual tin-doped CdS nanowire

Directory of Open Access Journals (Sweden)

Weichang Zhou

2014-12-01

Full Text Available High purity and tin-doped 1D CdS micro/nano-structures were synthesized by a convenient thermal evaporation method. SEM, EDS, XRD and TEM were used to examine the morphology, composition, phase structure and crystallinity of as-prepared samples. Raman spectrum was used to confirm tin doped into CdS effectively. The effect of impurity on the photoresponse properties of photodetectors made from these as-prepared pure and tin-doped CdS micro/nano-structures under excitation of light with different wavelength was investigated. Various photoconductive parameters such as responsivity, external quantum efficiency, response time and stability were analyzed to evaluate the advantage of doped nanowires and the feasibility for photodetector application. Comparison with pure CdS nanobelt, the tin-doped CdS nanowires response to broader spectral range while keep the excellect photoconductive parameters. Both trapped state induced by tin impurity and optical whispering gallery mode microcavity effect in the doped CdS nanowires contribute to the broader spectral response. The micro-photoluminescence was used to confirm the whispering gallery mode effect and deep trapped state in the doped CdS nanowires.

A REVIEW OF SELF HELP GROUPS: ISSUE AND CHALLENGES IN INDIA

OpenAIRE

Anoop Dixit *, Dr. S. K. Sharma

2017-01-01

Basic purpose of this study is to review the challenges and issues faced by SHGs in India. It was found that SHG’s facilitated the members to become self dependent for solving their social & economic problems and enhances the social status of members by virtue of their being members to the group. Self help groups are small informal association of the poor created at the grass root level for the purpose of enabling members to reap economic benefits out of mutual help solidarity and joint respo...

Self-Stigma, Perceived Stigma, and Help-Seeking Communication in People with Mental Illness

Directory of Open Access Journals (Sweden)

Jen Lee Teh

2014-02-01

Full Text Available People with mental illness (PWMI often internalise negative beliefs (self-stigma or anticipate external sources of stigma (perceived stigma. This study examines how the two types of stigma affect the willingness to communicate for help – such communication is a vital aspect of good patient care and treatment outcome. Seventy-two participants from different ethnic backgrounds who had experienced mental illness responded to an online survey about their level of agreement with statements reflecting self- and perceived stigma and their willingness to disclose to various help sources. Face-to-face interviews with 17 of these respondents provided a deeper understanding of how stigma affected their help-seeking communication. The quantitative results seemed to suggest that self-stigma has a stronger negative correlation with willingness to seek help. Respondents preferred disclosing to friends above family members and health professionals. The results highlight the importance of building resilience to reduce self-stigma and thereby increase help seeking. Given the different ethnic backgrounds of the participants, there emerged some multicultural issues that would seem to contribute to persisting mental illness stigma. These and any cultural differences are discussed.

Microwave assisted synthesis of CdS nanoparticles and their size evolution

International Nuclear Information System (INIS)

Lopez, I. A.; Vazquez, A.; Gomez, I.

2013-01-01

The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

Microwave assisted synthesis of CdS nanoparticles and their size evolution

Energy Technology Data Exchange (ETDEWEB)

Lopez, I. A.; Vazquez, A.; Gomez, I., E-mail: idaliagomezmx@yahoo.com.mx [Universidad Autonoma de Nuevo Leon, Facultad de Ciencias Quimicas, Laboratorio de Materiales I, Av. Universidad, Cd. Universitaria, 66451 San Nicolas de los Garza, Nuevo Leon (Mexico)

2013-05-01

The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

Enhanced photovoltaic performance of quantum dot-sensitized solar cells with a progressive reduction of recombination using Cu-doped CdS quantum dots

Science.gov (United States)

Muthalif, Mohammed Panthakkal Abdul; Lee, Young-Seok; Sunesh, Chozhidakath Damodharan; Kim, Hee-Je; Choe, Youngson

2017-02-01

In this article, we have systematically probed the effect of Cu-doping in CdS quantum dots (QDs) to enhance the photovoltaic performance of the quantum dot-sensitized solar cells (QDSSCs). The Cu-doped CdS photoanodes were prepared by successive ionic layer adsorption and reaction (SILAR) method and the corresponding cell devices were fabricated using CuS counter electrodes with a polysulfide electrolyte. The photovoltaic performance results demonstrate that 3 mM Cu-doped CdS QDs based QDSSCs exhibit the efficiency (η) of 3% including JSC = 9.40 mA cm-2, VOC = 0.637 V, FF = 0.501, which are higher than those with bare CdS (η = 2.05%, JSC = 7.12 mA cm-2, VOC = 0.588 V, FF = 0.489). The structural, topographical and optical properties of the thin films have been studied with the help of X-ray diffraction pattern (XRD), atomic force microscopy (AFM) and UV-vis spectrophotometer. Electrochemical impedance spectroscopy (EIS) and open circuit voltage decay (OCVD) measurements indicate that Cu-dopant can inhibit the charge recombination at the photoanode/electrolyte interface and extend the lifetime of electrons. These results reveal that incorporation of copper metal in CdS QDs is a simple and effective method to improve the photovoltaic properties of QDSSCs.

Regime-dependent determinants of Euro area sovereign CDS spreads

NARCIS (Netherlands)

Blommestein, H.J.; Eijffinger, Sylvester; Qian, Zongxin

We study the determinants of sovereign CDS spreads of five Euro area countries (Greece, Ireland, Italy, Portugal, and Spain) after the collapse of Lehman Brothers. We find that global and/or European Monetary Union (EMU)-wide factors are the main drivers of changes in the sovereign CDS spreads in

Online self-help for suicidal thoughts: 3-month follow-up results and participant evaluation

Directory of Open Access Journals (Sweden)

Bregje A.J. van Spijker

2015-09-01

Conclusions: Effects of online self-help for suicidal thoughts can be maintained for up to three months. Participant evaluation indicated that online self-help for suicidal thoughts is acceptable, but there is also room for improvement.

Summer Student Project: Collecting and disseminating CDS KPIs

CERN Document Server

Alvarez Perez, Carmen

2010-01-01

CDS (CERN Document Server) stores over 900,000 bibliographic records, including 360,000 fulltext documents, of interest to people working in particle physics and related areas. My project consisted on extracting KPIs (Key Performance Indicators) from it and feeding them to a central IT KPI system. To achieve this, I learned the CDS-Invenio open source digital library software, and worked with its statistic module.

Book Review: Book review

Science.gov (United States)

Manohar, C. S.

2015-02-01

The subject of the theory of vibrations has carried an aesthetic appeal to generations of engineering students for its richness of ideas, and for the intellectual challenges it offers. Also, the diverse range of its applications (covering civil, mechanical, automotive, and aerospace structures) has provided obvious motivations for its study. For most students, the subject provides, perhaps, the first encounter in substantial application of mathematical tools (differential equations, calculus of variations, Fourier/Laplace transforms, and matrix algebra) to engineering problems. The intimate relationship that the subject of mechanics has with mathematics strikes home probably for the first time. While teaching this subject, the instructor is spoilt for choice in selecting a text book and so are the students who wish to pursue a self-study of the subject. Many luminaries in the field have offered their own exposition of the subject: starting from the classics of Rayleigh, Timoshenko, Den Hartog, Bishop and Johnson, and the works of more recent vintage (e.g., the books by Meirovich, Clough, and Penzien, and works with computational flavour, such as, those by Bathe and Petyt), several works easily come to one's mind. Given this milieu, it requires a distinctive conviction to write a new book on this subject. And, here we have a book, written by a practitioner, which aims to deal with fundamental aspects of vibrations of engineering systems. The scepticism that this reviewer had on the need for having one more such book vanished as he browsed through the book and read selectively a few sections. The author's gift for elegant explanations is immediately noticeable even in such a preliminary reading. After a more careful reading, the reviewer has found this book to be insightful and he considers the book to be a welcome addition to the family of books on vibration engineering. The author has struck a fine balance between physical explanations, mathematical niceties

Effect of silver doping on the elastic properties of CdS nanoparticles

Science.gov (United States)

Dey, P. C.; Das, R.

2018-05-01

CdS and Ag doped CdS (CdS/Ag) nanoparticles have been prepared via chemical method from a Cadmium acetate precursor and Thiourea. The synthesized CdS and CdS/Ag nanoparticles have been characterized by the X-ray Diffraction and High Resolution Transmission Electron Microscope. Here, these nanoparticles have been synthesized at room temperature and all the characterization have also been done at room temperature only. The XRD results reveal that the products are crystalline with cubic zinc blende structure. HRTEM images show that the prepared nanoparticles are nearly spherical in shape. Williamson-Hall method and Size-Strain Plot (SSP) have been used to study the individual contribution of crystalline sizes and lattice strain on the peak broadening of the CdS and CdS/Ag nanoparticles. The different modified model of Williamson-Hall method such as, uniform deformation model, uniform stress deformation model and uniform energy density deformation model and SSP method have been used to calculate the different physical parameter such as lattice strain, stress and energy density for all diffraction peaks of the XRD, corresponding to the CdS and silver doped CdS (CdS/Ag). The obtained results reveal that the average particle size of the prepared CdS and CdS/Ag nanoparticles estimated from the HRTEM images, Williamson-Hall analysis and SSP method are highly correlated with each other. Further, all these result confirms that doping of Ag significantly affects the elastic properties of CdS.

Behavior change through automated e-mails: mediation analysis of self-help strategy use for depressive symptoms.

Science.gov (United States)

Morgan, Amy J; Mackinnon, Andrew J; Jorm, Anthony F

2013-02-01

To evaluate whether automated e-mails promoting effective self-help strategies for depressive symptoms were effective in changing self-help behavior, and whether this improved depression outcomes. 568 adults with sub-threshold depression participated in a randomized controlled trial and provided complete data. A series of 12 e-mails promoting the use of evidence-based self-help strategies was compared with e-mails providing non-directive depression information. Depression symptoms were assessed with the Patient Health Questionnaire depression scale (PHQ-9) and use of self-help strategies was assessed at baseline and post-intervention. We hypothesized that those receiving the self-help e-mails would increase their use of evidence-based self-help and this would be associated with improvements in depression. Mediation analyses were conducted using a non-parametric bootstrapping procedure. Total use of the self-help strategies promoted in the e-mails significantly mediated the effect of the intervention on depressive symptoms (B = -0.75, SE = 0.16, 95% CI: -1.06 to -0.48). The direct effect of the intervention on depressive symptoms was much smaller and not significant when the mediation path was included. The majority of the individual strategies also had a significant indirect effect on depressive symptoms. In adults with sub-threshold depression, automated e-mails based on behavior change principles can successfully increase use of self-help strategies, leading to a reduction in depressive symptoms. Copyright © 2012 Elsevier Ltd. All rights reserved.

The road to self-leadership development busting out of your comfort zone

CERN Document Server

Ross, Stanley C

2015-01-01

The primary purpose of The Road to Self-Leadership Development: Busting Out of Your Comfort Zone is to provide individuals who want to become a leader with a systematic approach for learning how to first learn to become a self-leader. Organizations can use the book for identifying leader types and within leadership development training programs. Individuals need help in understanding the logic of being a self-leader and the critical role of self-worth (encompasses self-esteem, self-concept and self-confidence) in the process of developing the self-leader as a preparatory step to leadership development. The book offers two important benefits to readers. First, readers learn that to lead others involves learning how to lead the self and self-leadership is all about improving feelings of self-worth. Second, the book provides a practical model for readers to follow in creating a personalized self-leadership development process or an organizations human resource leaders with a model to follow in designing and impl...

Solution precursor plasma deposition of nanostructured CdS thin films

International Nuclear Information System (INIS)

Tummala, Raghavender; Guduru, Ramesh K.; Mohanty, Pravansu S.

2012-01-01

Highlights: ► Inexpensive process with capability to produce large scale nanostructured coatings. ► Technique can be employed to spray the coatings on any kind of substrates including polymers. ► The CdS coatings developed have good electrical conductivity and optical properties. ► Coatings possess large amount of particulate boundaries and nanostructured grains. -- Abstract: Cadmium sulfide (CdS) films are used in solar cells, sensors and microelectronics. A variety of techniques, such as vapor based techniques, wet chemical methods and spray pyrolysis are frequently employed to develop adherent CdS films. In the present study, rapid deposition of CdS thin films via plasma spray route using a solution precursor was investigated, for the first time. Solution precursor comprising cadmium chloride, thiourea and distilled water was fed into a DC plasma jet via an axial atomizer to create ultrafine droplets for instantaneous and accelerated thermal decomposition in the plasma plume. The resulting molten/semi-molten ultrafine/nanoparticles of CdS eventually propel toward the substrate to form continuous CdS films. The chemistry of the solution precursor was found to be critical in plasma pyrolysis to control the stoichiometry and composition of the films. X-ray diffraction studies confirmed hexagonal α-CdS structure. Surface morphology and microstructures were investigated to compare with other synthesis techniques in terms of process mechanism and structural features. Transmission electron microscopy studies revealed nanostructures in the atomized particulates. Optical measurements indicated a decreasing transmittance in the visible light with increasing the film thickness and band gap was calculated to be ∼2.5 eV. The electrical resistivity of the films (0.243 ± 0.188 × 10 5 Ω cm) was comparable with the literature values. These nanostructured polycrystalline CdS films could be useful in sensing and solar applications.

Solution precursor plasma deposition of nanostructured CdS thin films

Energy Technology Data Exchange (ETDEWEB)

Tummala, Raghavender [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States); Guduru, Ramesh K., E-mail: rkguduru@umich.edu [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States); Mohanty, Pravansu S. [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States)

2012-03-15

Highlights: Black-Right-Pointing-Pointer Inexpensive process with capability to produce large scale nanostructured coatings. Black-Right-Pointing-Pointer Technique can be employed to spray the coatings on any kind of substrates including polymers. Black-Right-Pointing-Pointer The CdS coatings developed have good electrical conductivity and optical properties. Black-Right-Pointing-Pointer Coatings possess large amount of particulate boundaries and nanostructured grains. -- Abstract: Cadmium sulfide (CdS) films are used in solar cells, sensors and microelectronics. A variety of techniques, such as vapor based techniques, wet chemical methods and spray pyrolysis are frequently employed to develop adherent CdS films. In the present study, rapid deposition of CdS thin films via plasma spray route using a solution precursor was investigated, for the first time. Solution precursor comprising cadmium chloride, thiourea and distilled water was fed into a DC plasma jet via an axial atomizer to create ultrafine droplets for instantaneous and accelerated thermal decomposition in the plasma plume. The resulting molten/semi-molten ultrafine/nanoparticles of CdS eventually propel toward the substrate to form continuous CdS films. The chemistry of the solution precursor was found to be critical in plasma pyrolysis to control the stoichiometry and composition of the films. X-ray diffraction studies confirmed hexagonal {alpha}-CdS structure. Surface morphology and microstructures were investigated to compare with other synthesis techniques in terms of process mechanism and structural features. Transmission electron microscopy studies revealed nanostructures in the atomized particulates. Optical measurements indicated a decreasing transmittance in the visible light with increasing the film thickness and band gap was calculated to be {approx}2.5 eV. The electrical resistivity of the films (0.243 {+-} 0.188 Multiplication-Sign 10{sup 5} {Omega} cm) was comparable with the literature

77 FR 71609 - Self-Help Homeownership Opportunity Program (SHOP) Grant Monitoring

Science.gov (United States)

2012-12-03

... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5603-N-89] Self-Help Homeownership Opportunity Program (SHOP) Grant Monitoring AGENCY: Office of the Chief Information Officer, HUD. ACTION... electronic submission of responses. This notice also lists the following information: Title of Proposed: Self...

Raman spectroscopy of optical properties in CdS thin films

Directory of Open Access Journals (Sweden)

Trajić J.

2015-01-01

Full Text Available Properties of CdS thin films were investigated applying atomic force microscopy (AFM and Raman spectroscopy. CdS thin films were prepared by using thermal evaporation technique under base pressure 2 x 10-5 torr. The quality of these films was investigated by AFM spectroscopy. We apply Raman scattering to investigate optical properties of CdS thin films, and reveal existence of surface optical phonon (SOP mode at 297 cm-1. Effective permittivity of mixture were modeled by Maxwell - Garnet approximation. [Projekat Ministarstva nauke Republike Srbije, br. 45003

An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

International Nuclear Information System (INIS)

Cao, Fengfeng; Wang, Hao; Xia, Zhouhui; Dai, Xiao; Cong, Shan; Dong, Chao; Sun, Baoquan; Lou, Yanhui; Sun, Yinghui; Zhao, Jie; Zou, Guifu

2015-01-01

Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0 # diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement

An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

Energy Technology Data Exchange (ETDEWEB)

Cao, Fengfeng; Wang, Hao [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Xia, Zhouhui [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Dai, Xiao; Cong, Shan [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Dong, Chao [Department of Chemistry and Biology, University of New Mexico, ABQ 87120 (United States); Sun, Baoquan [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Lou, Yanhui, E-mail: yhlou@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Sun, Yinghui; Zhao, Jie [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Zou, Guifu, E-mail: zouguifu@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China)

2015-01-15

Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0{sup #} diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement.

CdS thin films prepared by laser assisted chemical bath deposition

International Nuclear Information System (INIS)

Garcia, L.V.; Mendivil, M.I.; Garcia Guillen, G.; Aguilar Martinez, J.A.; Krishnan, B.; Avellaneda, D.; Castillo, G.A.; Das Roy, T.K.; Shaji, S.

2015-01-01

Highlights: • CdS thin films by conventional CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • Improved dark conductivity and good photocurrent response for the LACBD CdS. - Abstract: In this work, we report the preparation and characterization of CdS thin films by laser assisted chemical bath deposition (LACBD). CdS thin films were prepared from a chemical bath containing cadmium chloride, triethanolamine, ammonium hydroxide and thiourea under various deposition conditions. The thin films were deposited by in situ irradiation of the bath using a continuous laser of wavelength 532 nm, varying the power density. The thin films obtained during deposition of 10, 20 and 30 min were analyzed. The changes in morphology, structure, composition, optical and electrical properties of the CdS thin films due to in situ irradiation of the bath were analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV–vis spectroscopy. The thin films obtained by LACBD were nanocrystalline, photoconductive and presented interesting morphologies. The results showed that LACBD is an effective synthesis technique to obtain nanocrystalline CdS thin films having good optoelectronic properties

CdS thin films prepared by laser assisted chemical bath deposition

Energy Technology Data Exchange (ETDEWEB)

Garcia, L.V.; Mendivil, M.I.; Garcia Guillen, G.; Aguilar Martinez, J.A. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G.A.; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

2015-05-01

Highlights: • CdS thin films by conventional CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • Improved dark conductivity and good photocurrent response for the LACBD CdS. - Abstract: In this work, we report the preparation and characterization of CdS thin films by laser assisted chemical bath deposition (LACBD). CdS thin films were prepared from a chemical bath containing cadmium chloride, triethanolamine, ammonium hydroxide and thiourea under various deposition conditions. The thin films were deposited by in situ irradiation of the bath using a continuous laser of wavelength 532 nm, varying the power density. The thin films obtained during deposition of 10, 20 and 30 min were analyzed. The changes in morphology, structure, composition, optical and electrical properties of the CdS thin films due to in situ irradiation of the bath were analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV–vis spectroscopy. The thin films obtained by LACBD were nanocrystalline, photoconductive and presented interesting morphologies. The results showed that LACBD is an effective synthesis technique to obtain nanocrystalline CdS thin films having good optoelectronic properties.

Platelike WO3 sensitized with CdS quantum dots heterostructures for photoelectrochemical dynamic sensing of H2O2 based on enzymatic etching.

Science.gov (United States)

Wang, Yanhu; Gao, Chaomin; Ge, Shenguang; Yu, Jinghua; Yan, Mei

2016-11-15

A platelike tungsten trioxide (WO3) sensitized with CdS quantum dots (QDs) heterojunction is developed for solar-driven, real-time, and selective photoelectrochemical (PEC) sensing of H2O2 in the living cells. The structure is synthesized by hydrothermally growing platelike WO3 on fluorine doped tin oxide (FTO) and subsequently sensitized with CdS QDs. The as-prepared WO3-CdS QDs heterojunction achieve significant photocurrent enhancement, which is remarkably beneficial for light absorption and charge carrier separation. Based on the enzymatic etching of CdS QDs enables the activation of quenching the charge transfer efficiency, thus leading to sensitive PEC recording of H2O2 level in buffer and cellular environments. The results indicated that the proposed method will pave the way for the development of excellent PEC sensing platform with the quantum dot sensitization. This study could also provide a new train of thought on designing of self-operating photoanode in PEC sensing, promoting the application of semiconductor nanomaterials in photoelectrochemistry. Copyright © 2016 Elsevier B.V. All rights reserved.

MacSelfService online tutorial

CERN Multimedia

CERN. Geneva

2016-01-01

Mac Self-Service is a functionality within the Mac Desktop Service built and maintained to empower CERN users by giving them easy access to applications and configurations through the Self-Service application. This tutorial (text attached to the event page) explains how to install Mac Self-Service and how to use it to install applications and printers. Content owner: Vincent Nicolas Bippus Presenter: Pedro Augusto de Freitas Batista Tell us what you think via e-learning.support at cern.ch More tutorials in the e-learning collection of the CERN Document Server (CDS) https://cds.cern.ch/collection/E-learning%20modules?ln=en All info about the CERN rapid e-learning project is linked from http://twiki.cern.ch/ELearning  

Self-help interventions for depressive disorders and depressive symptoms: a systematic review

Directory of Open Access Journals (Sweden)

Jorm Anthony F

2008-08-01

Full Text Available Abstract Background Research suggests that depressive disorders exist on a continuum, with subthreshold symptoms causing considerable population burden and increasing individual risk of developing major depressive disorder. An alternative strategy to professional treatment of subthreshold depression is population promotion of effective self-help interventions that can be easily applied by an individual without professional guidance. The evidence for self-help interventions for depressive symptoms is reviewed in the present work, with the aim of identifying promising interventions that could inform future health promotion campaigns or stimulate further research. Methods A literature search for randomised controlled trials investigating self-help interventions for depressive disorders or depressive symptoms was performed using PubMed, PsycINFO and the Cochrane Database of Systematic Reviews. Reference lists and citations of included studies were also checked. Studies were grouped into those involving participants with depressive disorders or a high level of depressive symptoms, or non-clinically depressed participants not selected for depression. A number of exclusion criteria were applied, including trials with small sample sizes and where the intervention was adjunctive to antidepressants or psychotherapy. Results The majority of interventions searched had no relevant evidence to review. Of the 38 interventions reviewed, the ones with the best evidence of efficacy in depressive disorders were S-adenosylmethionine, St John's wort, bibliotherapy, computerised interventions, distraction, relaxation training, exercise, pleasant activities, sleep deprivation, and light therapy. A number of other interventions showed promise but had received less research attention. Research in non-clinical samples indicated immediate beneficial effects on depressed mood for distraction, exercise, humour, music, negative air ionisation, and singing; while potential

Self-help on-line: an outcome evaluation of breast cancer bulletin boards.

Science.gov (United States)

Lieberman, Morton A; Goldstein, Benjamin A

2005-11-01

Many breast cancer patients find help from on-line self-help groups, consisting of self-directed, asynchronous, bulletin boards. These have yet to be empirically evaluated. Upon joining a group and 6 months later, new members (N=114) to breast cancer bulletin boards completed measures of depression (CES-D), growth (PTGI) and psychosocial wellbeing (FACT-B). Improvement was statistically significant on all three measures. This serves as a first validation of Internet bulletin boards as a source of support and help for breast cancer patients. These boards are of particular interest because they are free, accessible and support comes from peers and not from professional facilitators.

Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

Energy Technology Data Exchange (ETDEWEB)

Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song [Henan Univ., Henan (China)

2014-02-15

Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S.

Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

International Nuclear Information System (INIS)

Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song

2014-01-01

Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S

Effects of precursors on the crystal structure and photoluminescence of CdS nanocrystalline

International Nuclear Information System (INIS)

Fu Zuoling; Zhou Shihong; Shi Jinsheng; Zhang Siyuan

2005-01-01

A series of cadmium sulfide (CdS) nanocrystalline were synthesized by precipitation from a mixture of aqueous solutions of cadmium salts and sulfur salts without adding any surface-termination agent. Their crystal structures and particle sizes were determined by X-ray diffraction (XRD). The CdS nanocrystalline precipitated from different precursors exhibited three cases: cubic phase, hexagonal phase and a hybrid of cubic and hexagonal phases. The photoluminescence (PL) of cadmium salt precursors and CdS nanocrystalline is also analyzed. Similar spectral band structure of cadmium salt precursors and CdS nanocrystalline is found. The PL of 3.4, 2.4 and 2.0 nm sized CdS nanocrystalline with the same crystal structure indicated quantum confinement effect

Development and preliminary testing of a web-based, self-help application for disaster-affected families.

Science.gov (United States)

Yuen, Erica K; Gros, Kirstin; Welsh, Kyleen E; McCauley, Jenna; Resnick, Heidi S; Danielson, Carla K; Price, Matthew; Ruggiero, Kenneth J

2016-09-01

Technology-based self-help interventions have the potential to increase access to evidence-based mental healthcare, especially for families affected by natural disasters. However, development of these interventions is a complex process and poses unique challenges. Usability testing, which assesses the ability of individuals to use an application successfully, can have a significant impact on the quality of a self-help intervention. This article describes (a) the development of a novel web-based multi-module self-help intervention for disaster-affected adolescents and their parents and (b) a mixed-methods formal usability study to evaluate user response. A total of 24 adolescents were observed, videotaped, and interviewed as they used the depressed mood component of the self-help intervention. Quantitative results indicated an above-average user experience, and qualitative analysis identified 120 unique usability issues. We discuss the challenges of developing self-help applications, including design considerations and the value of usability testing in technology-based interventions, as well as our plan for widespread dissemination. © The Author(s) 2015.

Hexagonal pencil-like CdS nanorods: Facile synthesis and enhanced visible light photocatalytic performance

Science.gov (United States)

An, Liang; Wang, Guanghui; Zhao, Lei; Zhou, Yong; Gao, Fang; Cheng, Yang

2015-07-01

In the present study, hexagonal pencil-like CdS nanorods have been successfully synthesized through a typical facile and economical one-step hydrothermal method without using any surfactant or template. The product was characterized by X-ray powder diffraction (XRD), field-emission scanning electron microscopy (FE-SEM) and energy dispersive analysis of X-ray (EDX). The results revealed that the prepared CdS photocatalyst consisted of a large quantity of straight and smooth solid hexagonal nanorods and a few nanoparticles. The photocatalytic activities of CdS nanorods and commercial CdS powders were investigated by the photodegradation of Orange II (OII) in aqueous solution under visible light, and the CdS nanorods presented the highest photocatalytic activity. Its photocatalytic efficiency enhancement was attributed to the improved transmission of photogenerated electron-hole pairs in the CdS nanostructures. The present findings may provide a facile approach to synthesize high efficient CdS photocatalysts.

Clinical guideline representation in a CDS: a human information processing method.

Science.gov (United States)

Kilsdonk, Ellen; Riezebos, Rinke; Kremer, Leontien; Peute, Linda; Jaspers, Monique

2012-01-01

The Dutch Childhood Oncology Group (DCOG) has developed evidence-based guidelines for screening childhood cancer survivors for possible late complications of treatment. These paper-based guidelines appeared to not suit clinicians' information retrieval strategies; it was thus decided to communicate the guidelines through a Computerized Decision Support (CDS) tool. To ensure high usability of this tool, an analysis of clinicians' cognitive strategies in retrieving information from the paper-based guidelines was used as requirements elicitation method. An information processing model was developed through an analysis of think aloud protocols and used as input for the design of the CDS user interface. Usability analysis of the user interface showed that the navigational structure of the CDS tool fitted well with the clinicians' mental strategies employed in deciding on survivors screening protocols. Clinicians were more efficient and more complete in deciding on patient-tailored screening procedures when supported by the CDS tool than by the paper-based guideline booklet. The think-aloud method provided detailed insight into users' clinical work patterns that supported the design of a highly usable CDS system.

50 WOMEN SELF HELP INITIATIVES: A PARADIGMATIC SHIFT IN ...

African Journals Online (AJOL)

of significant positive relationship between women self help projects and rural ... portable water, light, good health, basic education, clean environment as well as ... These concerned ... endowed with natural resources like: granite, gmelina, lime stone, rubber, .... conducted in Central Senatorial District of Cross River State.

Nurturing a Self-Help Group

Directory of Open Access Journals (Sweden)

Marsha A. Schubert

2015-04-01

Full Text Available In April 1987, the parent of a child who was both learning disabled and intellectually gifted and talented and a professional educator (the author founded Parents of Gifted and Learning-Disabled Students of Northern Virginia, a self-help group for people who were dealing with the challenges posed by such children. The article begins with a background explaining the need for such a group followed by a history of the group and a description of how it functioned. It then details ways in which the author and the group interacted over the course of 5 years. A major component of this interaction was the members’ partnering in a research study with the author—a process now known as participatory action research (PAR—and the outcomes of that partnership.

Internet-based guided self-help for posttraumatic stress disorder (PTSD): Randomized controlled trial.

Science.gov (United States)

Lewis, Catrin E; Farewell, Daniel; Groves, Vicky; Kitchiner, Neil J; Roberts, Neil P; Vick, Tracey; Bisson, Jonathan I

2017-06-01

There are numerous barriers that limit access to evidence-based treatment for posttraumatic stress disorder (PTSD). Internet-based guided self-help is a treatment option that may help widen access to effective intervention, but the approach has not been sufficiently explored for the treatment of PTSD. Forty two adults with DSM-5 PTSD of mild to moderate severity were randomly allocated to internet-based self-help with up to 3 h of therapist assistance, or to a delayed treatment control group. The internet-based program included eight modules that focused on psychoeducation, grounding, relaxation, behavioural activation, real-life and imaginal exposure, cognitive therapy, and relapse prevention. The primary outcome measure was reduction in clinician-rated traumatic stress symptoms using the clinician administered PTSD scale for DSM-V (CAPS-5). Secondary outcomes were self-reported PTSD symptoms, depression, anxiety, alcohol use, perceived social support, and functional impairment. Posttreatment, the internet-based guided self-help group had significantly lower clinician assessed PTSD symptoms than the delayed treatment control group (between-group effect size Cohen's d = 1.86). The difference was maintained at 1-month follow-up and dissipated once both groups had received treatment. Similar patterns of difference between the two groups were found for depression, anxiety, and functional impairment. The average contact with treating clinicians was 2½ h. Internet-based trauma-focused guided self-help for PTSD is a promising treatment option that requires far less therapist time than current first line face-to-face psychological therapy. © 2017 Wiley Periodicals, Inc.

Chemically deposited TiO2/CdS bilayer system for ...

Indian Academy of Sciences (India)

FTO/TiO2/CdS bilayers system showed improved performance of PEC properties over individual ... form distribution of nanocrystalline CdS on TiO2 and this is unfavourable for the ... (TEA), the pH of the solution maintained at 12·0 by drop.

The effectiveness of self help technologies for emotional problems in adolescents: a systematic review

Directory of Open Access Journals (Sweden)

Bower Peter

2008-07-01

Full Text Available Abstract Background Adolescence is a transition period that involves physiological, psychological, and social changes. Emotional problems such as symptoms of anxiety and depression may develop due to these changes. Although many of these problems may not meet diagnostic thresholds, they may develop into more severe disorders and may impact on functioning. However, there are barriers that may make it difficult for adolescents to receive help from health professionals for such problems, one of which is the limited availability of formal psychological therapy. One way of increasing access to help for such problems is through self help technology (i.e. delivery of psychological help through information technology or paper based formats. Although there is a significant evidence base concerning self help in adults, the evidence base is much weaker in adolescents. This study aims to examine the effectiveness of self help technology for the treatment of emotional problems in adolescents by conducting a systematic review of randomized and quasi-experimental evidence. Methods Five major electronic databases were searched: Medline, PsycInfo, Embase, Cochrane Controlled Trials Register and CINAHL. In addition, nine journals were handsearched and the reference lists of all studies were examined for any additional studies. Fourteen studies were identified. Effect sizes were calculated across 3 outcome measures: attitude towards self (e.g. self esteem; social cognition (e.g. self efficacy; and emotional symptoms (i.e. depression and anxiety symptoms. Results Meta analysis showed small, non-significant effect size for attitude towards self (ES = -0.14, 95% CI = -0.72 to 0.43, a medium, non-significant effect size for social cognition (ES = -0.49, 95% CI = -1.23 to 0.25 and a medium, non-significant effect size for emotional symptoms (ES = -0.47, 95% CI = -1.00 to 0.07. However, these findings must be considered preliminary, because of the small number of

Predictors of dropout from internet-based self-help cognitive behavioral therapy for insomnia.

Science.gov (United States)

Yeung, Wing-Fai; Chung, Ka-Fai; Ho, Fiona Yan-Yee; Ho, Lai-Ming

2015-10-01

Dropout from self-help cognitive-behavioral therapy for insomnia (CBT-I) potentially diminishes therapeutic effect and poses clinical concern. We analyzed the characteristics of subjects who did not complete a 6-week internet-based CBT-I program. Receiver operator characteristics (ROC) analysis was used to identify potential variables and cutoff for predicting dropout among 207 participants with self-report insomnia 3 or more nights per week for at least 3 months randomly assigned to self-help CBT-I with telephone support (n = 103) and self-help CBT-I (n = 104). Seventy-two participants (34.4%) did not complete all 6 sessions, while 42 of the 72 (56.9%) dropped out prior to the fourth session. Significant predictors of non-completion are total sleep time (TST) ≥ 6.82 h, Hospital Anxiety and Depression Scale depression score ≥ 9 and Insomnia Severity Index score dropout. Longer TST and less severe insomnia predict dropout in this study of self-help CBT-I, in contrast to shorter TST as a predictor in 2 studies of face-to-face CBT-I, while greater severity of depression predicts dropout in both this study and a study of face-to-face CBT-I. Strategies for minimizing dropout from internet-based CBT-I are discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

In situ coating multiwalled carbon nanotubes with CdS nanoparticles

International Nuclear Information System (INIS)

Liu Yangqiao; Gao Lian

2005-01-01

CdS nanoparticles were homogeneously coated on multiwalled carbon nanotubes by an in situ method through introducing thiol groups onto the tube wall using a novel method. A cationic polyelectrolyte containing reactive imine groups, polyethyleneimine (PEI), was firstly adsorbed on the surface of nanotubes. 3-Mercaptopropionic acid (MPA) was then anchored by an amidation reaction between its carboxyl group and the imine group of the polyelectrolyte under the activation of carbodiimide reagents. These -SH terminated MWCNTs were coated with CdS nanoparticles by an in situ method. The phase composition, microstructure, and the UV-vis properties of the CdS coated MWCNTs were characterized. The addition of the carbodiimide reagents played an important role in linking the MPA with PEI covalently and subsequently coating the MWCNTs with CdS homogeneously. A blue shift in the absorption edge was observed for the MWCNTs-CdS hybrid material due to the quantum size effect

Nanoniobia modification of CdS photoanode for an efficient and stable photoelectrochemical cell.

Science.gov (United States)

Pareek, Alka; Paik, Pradip; Borse, Pramod H

2014-12-30

Herein we report the surface modification of a CdS film by niobia nanoparticles via thioglycerol as an organic linker and thus fabricate an efficient and a stable photoanode for a photoelectrochemical (PEC) cell. We have synthesized three differenly sized (∼3, ∼6 ,and ∼9 nm) niobia nanoparticles by a hydrothermal synthesis approach and have further investigated the particle-size-dependent PEC performance of the nanoparticle-modified CdS photoanode. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS) confirm the formation of Nb2O5 nanoparticles that are prepared via decomposition of the niobium peroxo complex during the hydrothermal reaction and reveal the presence of surface OH(-) groups over niobia nanoparticles that impart a high catalytic property to a material. The nano-Nb2O5-modified photoanode displayed a 23-fold higher power conversion efficiency compared to that of CdS. This modified structure increases the open circuit voltage (OCV) from 0.65 to 0.77 V, which is attributed to the nano-Nb2O5-induced surface passivation effect over bare CdS. Linking of nanoparticles on the CdS surface improves the photocorrosion stability of the CdS photoanode for even longer than 4 h in contrast to the tens of minutes for the base CdS surface. The uniform coverage of the CdS photoanode surface by niobia nanoparticles is thus found to be the controlling parameter for achieving a higher PEC performance and stability of the photoanode. This finding directed us to design an improved CdS photoanode for efficient and prolonged PEC hydrogen generation from a PEC cell.

Tanker self-help spill recovery systems

Energy Technology Data Exchange (ETDEWEB)

Smedley, J B; Wainwright, J G; Ehman, T K

1991-12-01

An investigation was conducted of the circumstances in which oil spills occur from tankers at sea by analyzing available historical oil spill data. A data base of marine oil spills greater than 134 tonnes occurring from 1974 and June 1990, included in an appendix, was among the information analyzed. The analysis showed that marine oil spills of 5,000 tonnes and greater account for 39.4% of the accidents yet 94.7% of the total spilled quantity; 84% of those spills occur in vessels of 20,000 deadweight tonnes and larger. Of spills over 5,000 tonnes, 78.5% occur outside of harbor or pier areas where spill response equipment may not be readily available. Over 50% of spills are caused by groundings or collisions where the vessel crew might be able to respond in mitigating and controlling the outflow of oil. The review suggested that tanker self-help systems warrant serious consideration. Potential self-help systems are described, ranging from additives such as bioremediation, dispersants, and solidifiers to equipment such as portable pumps, booms, and skimmers. Candidate systems were examined in terms of their safety, ease of operation, practicability, and effectiveness. Their possible performance was then assessed for the case of major marine oil spills that have occurred in Canadian waters. Four systems are identified as potential candidates for further evaluation and possible implementation: internal oil transfer, hydrostatic loading, external oil lightering, and contingency planning. A system design is evaluated and its benefits and possible implementation are outlined, based on integration of the preferred attributes of the above four options. Recommendations for implementation are also provided. 28 refs., 6 figs., 33 tabs.

Brief Online Self-help Exercises for Postnatal Women to Improve Mood: A Pilot Study.

Science.gov (United States)

Ayers, Susan; Fitzgerald, Gemima; Thompson, Susan

2015-11-01

Giving birth and adjusting to a new baby can be difficult and stressful for new mothers. Negative mood may occur during this time and can affect women, their parenting and the infant's development. This pilot study evaluated a brief online self-help intervention designed to promote positive mood in mothers of babies and toddlers. Women in the UK who had given birth within the previous 18 months were randomly allocated to the online self-help intervention (n = 40) or active comparison group exercise (n = 40) which was matched for time and structure. Mood was measured before and after the intervention. Acceptability was examined at the end of the trial. The self-help intervention was acceptable to the majority of women and significantly increased positive mood compared to the comparison condition. This effect persisted after controlling for self-esteem, anxiety and depression. These results suggest that a simple self-help intervention focused on changing beliefs about oneself as a mother can have an immediate impact on women's mood. Further research is need to see whether these improvements continue long-term and what processes underlie these improvements.

Book Review: Book review

Science.gov (United States)

Wegener, Daan

Writing a biography of a complex personality and mastermind like Albert Einstein is a daunting task for any historian of science. Yet the sheer temptation of writing his biography has apparently helped to overcome scholarly scruples, as biographies of Einstein have appeared quite regularly on the market. One of them is Einstein: his Life and Universe by journalist Walter Isaacson. It is a best-seller, which is one of the reasons the book deserves a critical evaluation. Isaacson is a man of considerable repute: he has been the chairman of CNN and managing editor of Time magazine. Isaacson's Einstein is written in a style that is accessible to a wide audience. Scholars who are already familiar with Einstein's physics may still enjoy the parts of the book that deal with the relation between Einstein and the press. Indeed, the breadth of its scope is the book's major merit, as it connects the personal, scientific, public and political dimensions of Einstein's life. In this review, I discuss Isaacson's treatment of these dimensions one-by-one.

Asking for help online: Lesbian, gay, bisexual and trans youth, self-harm and articulating the 'failed' self.

Science.gov (United States)

McDermott, Elizabeth

2015-11-01

International evidence suggests that young people are less likely to seek help for mental health problems in comparison with adults. This study focused on lesbian, gay, bisexual and trans young people who are a population group with an elevated risk of suicide and self-harm, and little is known about their help-seeking behaviour. Utilising qualitative virtual methods, lesbian, gay, bisexual and trans youth web-based discussions about seeking help for suicidal feelings and self-harming were investigated. Findings from a thematic analysis indicate that these young people wanted assistance but found it difficult to (1) ask for help, (2) articulate emotional distress and (3) 'tell' their selves as 'failed'. This analysis suggests that key to understanding these problems are emotions such as shame which arise from negotiating norms connected to heterosexuality, adolescence and rationality. I argue that these norms act to regulate what emotions it is possible to feel, what emotions it is possible to articulate and what type of young lives that can be told. The future development of health and social care interventions which aim to reduce lesbian, gay, bisexual and trans youth suicide and self-harm need to work with a nuanced understanding of the emotional life of young people if they are to be effective. © The Author(s) 2014.

CdS films deposited by chemical bath under rotation

International Nuclear Information System (INIS)

Oliva-Aviles, A.I.; Patino, R.; Oliva, A.I.

2010-01-01

Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl 2 , KOH, NH 4 NO 3 and CS(NH 2 ) 2 as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

CdS films deposited by chemical bath under rotation

Energy Technology Data Exchange (ETDEWEB)

Oliva-Aviles, A.I., E-mail: aoliva@mda.cinvestav.mx [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico); Patino, R.; Oliva, A.I. [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico)

2010-08-01

Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl{sub 2}, KOH, NH{sub 4}NO{sub 3} and CS(NH{sub 2}){sub 2} as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

Toxicity of cadmium sulfide (CdS) nanoparticles against Escherichia coli and HeLa cells

International Nuclear Information System (INIS)

Hossain, Sk Tofajjen; Mukherjee, Samir Kumar

2013-01-01

Highlights: • Toxic effect of CdS NPs on the growth and cell division in E. coli was studied. • CdS NPs affected cell surface topology and cell division. • Downregulation of both FtsZ and FtsQ was observed due to NPs exposure. • CdS NPs affected HeLa cell morphology with fragmented nuclei. • All such effects might be due to elevated oxidative stress. -- Abstract: The present study endeavours to assess the toxic effect of synthesized CdS nanoparticles (NPs) on Escherichia coli and HeLa cells. The CdS NPs were characterized by DLS, XRD, TEM and AFM studies and the average size of NPs was revealed as ∼3 nm. On CdS NPs exposure bacterial cells changed morphological features to filamentous form and damage of the cell surface was found by AFM study. The expression of two conserved cell division components namely ftsZ and ftsQ in E. coli was decreased both at transcriptional and translational levels upon CdS NPs exposure. CdS NPs inhibited proper cell septum formation without affecting the nucleoid segregation. Viability of HeLa cells declined with increasing concentration of CdS NPs and the IC 50 value was found to be 4 μg/mL. NPs treated HeLa cells showed changed morphology with condensed and fragmented nuclei. Increased level of reactive oxygen species (ROS) was found both in E. coli and HeLa cells on CdS NPs exposure. The inverse correlation between declined cell viabilities and elevated ROS level suggested that oxidative stress seems to be the key event by which NPs induce toxicity both in E. coli and HeLa cells

Anodic Titania Nanotube Arrays Sensitized with Mn- or Co-Doped CdS Nanocrystals

International Nuclear Information System (INIS)

Smith, York R.; Gakhar, Ruchi; Merwin, Augustus; Mohanty, Swomitra K.; Chidambaram, Dev; Misra, Mano

2014-01-01

Highlights: • Mn or Co doped CdS where synthesized and deposited onto TiO 2 nanotubular arrays. • Synthesis and deposition were achieved simultaneously using SILAR method. • Various characterization techniques demonstrate lattice incorporation of dopant. • Photoelectrochemical performance was analyzed using AM 1.5 irradiation. • Dopants increases depletion width of CdS and increase photoelectrochemical responses. - Abstract: The use of doped luminescent nanocrystals or quantum dots have mainly been explored for imaging applications; however, recently they have gained interest in solar energy conversion applications due to long electron lifetimes, tunable band gaps and emission by compositional control. In this study, we have examined the application of Mn or Co doped CdS nanocrystals as a sensitizing layer over titania nanotubular arrays synthesized via electrochemical anodization in photoelectrochemical applications. The doped and undoped CdS nanocrystals were simultaneously synthesized and deposited onto the titania surface by adoption of a successive ion layer adsorption-reaction (SILAR) method. Various characterization methods indicate lattice incorporation of the dopant within CdS. The addition of dopants to CdS was found to improve the photoelectrochemical performance by increasing the depletion width of the CdS nanocrystals and reducing recombination losses of charge carriers

Implementing 'self-help friendliness' in German hospitals: a longitudinal study.

Science.gov (United States)

Trojan, Alf; Nickel, Stefan; Kofahl, Christopher

2016-06-01

In Germany, the term 'self-help friendliness' (SHF) describes a strategy to institutionalize co-operation of healthcare institutions with mutual aid or self-help groups of chronically ill patients. After a short explanation of the SHF concept and its development, we will present findings from a longitudinal study on the implementation of SHF in three German hospitals. Specifically, we wanted to know (i) to what degree SHF had been put into practice after the initial development phase in the pilot hospitals, (ii) whether it was possible to maintain the level of implementation of SHF in the course of at least 1 year and (iii) which opinions exist about the inclusion of SHF criteria in quality management systems. With only minor restrictions, the findings provide support for the usefulness, practicability, sustainability and transferability of SHF. Limitations of our empirical study are the small number of hospitals, the above average motivation of their staff, the small response rate in the staff-survey and the inability to get enough data from members of self-help groups. The research instrument for measuring SHF was adequate and fulfils the most important scientific quality criteria in a German context. We conclude that the implementation of SHF leads to more patient-centredness in healthcare institutions and thus improves satisfaction, self-management, coping and health literacy of patients. SHF is considered as an adequate approach for reorienting healthcare institutions in the sense of the Ottawa Charta, and particularly suitable for health promoting hospitals. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

New session of “CERN Document Server (CDS), Inspire and Library Services”

CERN Multimedia

Technical Training

2013-01-01

The training course is given by members of CERN’s CDS Team (IT-CIS group) and the Library Services (GIS SIS group) and is intended for all CERN members of personnel.   This course will present CDS, inspirehep.net, and the content, scope and scientific information available in or with CDS, as well as the classification and organisation of the documents. It is intended to give you the training to use CDS efficiently and, in particular, covers:
 the main characteristics and advanced features for the search of documents (scientific, multimedia, etc)
, the collaborative tools: baskets, alerts, comments, evaluation, etc.
 the submission of documents in CDS and examples of workflows.   An important part of the training will be the various exercises, designed to give participants the ability to work with CDS in real life cases, including with the most advanced features. Don’t wait! Sign up for the training course directly through the CERN Training Catal...

Mesoporous structured MIPs@CDs fluorescence sensor for highly sensitive detection of TNT.

Science.gov (United States)

Xu, Shoufang; Lu, Hongzhi

2016-11-15

A facile strategy was developed to prepare mesoporous structured molecularly imprinted polymers capped carbon dots (M-MIPs@CDs) fluorescence sensor for highly sensitive and selective determination of TNT. The strategy using amino-CDs directly as "functional monomer" for imprinting simplify the imprinting process and provide well recognition sites accessibility. The as-prepared M-MIPs@CDs sensor, using periodic mesoporous silica as imprinting matrix, and amino-CDs directly as "functional monomer", exhibited excellent selectivity and sensitivity toward TNT with detection limit of 17nM. The recycling process was sustainable for 10 times without obvious efficiency decrease. The feasibility of the developed method in real samples was successfully evaluated through the analysis of TNT in soil and water samples with satisfactory recoveries of 88.6-95.7%. The method proposed in this work was proved to be a convenient and practical way to prepare high sensitive and selective fluorescence MIPs@CDs sensors. Copyright © 2016 Elsevier B.V. All rights reserved.

[Self-help groups--a fashion trend or objective requirement?].

Science.gov (United States)

Horvat, M; Gospocić, G; Gospocić, S

1989-01-01

The role and the significance of the self-help groups in the modern medicine are described. The authors propose that the medical profession should actively support the formation and the activity of such groups with the aim to improve the quality of life of many groups of patients.

MacBook Teach Yourself VISUALLY

CERN Document Server

Miser, Brad

2010-01-01

Like the MacBook itself, Teach Yourself VISUALLY MacBook, Second Edition is designed to be visually appealing, while providing excellent functionality at the same time. By using this book, MacBook users will be empowered to do everyday tasks quickly and easily. From such basic steps as powering on or shutting down the MacBook, working on the Mac desktop with the Dashboard and its widgets to running Windows applications, Teach Yourself VISUALLY MacBook, Second Edition covers all the vital information and provides the help and support a reader needs—in many ways it's like having a Mac Genius at

Single-Source Molecular Precursor for Synthesis of CdS Nanoparticles and Nanoflowers

Science.gov (United States)

Salavati-Niasari, Masoud; Sobhani, Azam

2012-04-01

CdS Semiconductor nanostructures were synthesized by using two different methods. Using triphenylphosphine (C18H15P) and oleylamine (C18H37N) as surfactant, CdS semiconductor nanocrystals with a size ranging from 30 to 90 nm can be synthesized by thermal decomposition of precursor [bis(thiosemicarbazide)cadmium(II)]. CdS nanoflowers were synthesized via hydrothermal decomposition of [bis(thiosemicarbazide) cadmium(II)] without any surfactant. X-ray diffraction (XRD) patterns confirm that the resulting samples were a pure hexagonal phase of CdS. The optical property test indicates that the absorption peak of the samples shifts towards short wavelength, and the blue shift phenomenon might be ascribed to the quantum effect.

Fullerene (C{sub 60})/CdS nanocomposite with enhanced photocatalytic activity and stability

Energy Technology Data Exchange (ETDEWEB)

Cai, Qiang [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Hu, Zhuofeng, E-mail: st04hzhf@gmail.com [Department of Chemistry, The Chinese University of Hong Kong, Shatin, New Territories, Hong Kong (China); Zhang, Qian; Li, Boyuan [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Shen, Zhurui, E-mail: shenzhurui@tju.edu.cn [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China)

2017-05-01

Highlights: • C{sub 60}/CdS nanocomposite has been fabricated as a novel visible-light-driven photocatalyst. • It exhibits enhanced photocatalytic activity and photostability than that of pure CdS reference. • The C{sub 60} improved the charge separation and transfer of nanocomposite due to its high electron affinity. - Abstract: Herein, the fullerene (C{sub 60})/CdS nanocomposite has been fabricated by a facile one-pot hydrothermal method. Its photocatatlytic hydrogen (H{sub 2}) evolution rate and degradation efficiency of Rhodamine B (Rh B) are evaluated under visible light irradiation (λ ≥ 420 nm). The content of C{sub 60} has been changed from 0.4 wt% to 8 wt%, and the optimal value for photocatalytic activity is determined to be 0.4 wt%. The H{sub 2} evolution rate over this optimal sample reaches 1.73 mmol h{sup −1} g{sup −1} and its apparent degradation rate of Rh B is 0.089 min{sup −1} (degradation efficiency of 97% within 40 min), which is 2.3 times and 1.5 times compared to that of pure CdS reference. Moreover, the photocorrosion of CdS in composite is effectively suppressed, and its photocatalytic activity can be well maintained after three recycles (97.8% retaining for composite vs. 84.4% retaining for CdS). Then, the enhanced photocatalytic activity and stability of C{sub 60}/CdS nanocomposite are further studied by spectroscopic and electrochemical methods. Results show that the C{sub 60} species covering on the surface of CdS can efficiently accelerate the separation and transfer of photoexcited charge carriers, which can improve its activity, and reduce the photocorrosion of CdS.

Simulation of sovereign CDS market based on interaction between market participant

Science.gov (United States)

Ko, Bonggyun; Kim, Kyungwon

2017-08-01

A research for distributional property of financial asset is the subject of intense interest not only for financial theory but also for practitioner. Such respect is no exception to CDS market. The CDS market, which began to receive attention since the global financial debacle, is not well researched despite of the importance of research necessity. This research introduces creation of CDS market and use Ising system utilizing occurrence characteristics (to shift risk) as an important factor. Therefore the results of this paper would be of great assistance to both financial theory and practice. From this study, not only distributional property of the CDS market but also various statistics like multifractal characteristics could promote understanding about the market. A salient point in this study is that countries are mainly clustering into 2 groups and it might be because of market situation and geographical characteristics of each country. This paper suggested 2 simulation parameters representing this market based on understanding such CDS market situation. The estimated parameters are suitable for high and low risk event of CDS market respectively and these two parameters are complementary and can cover not only basic statistics but also multifractal properties of most countries. Therefore these estimated parameters can be used in researches preparing for a certain event (high or low risk). Finally this research will serve as a momentum double-checking indirectly the performance of Ising system based on these results.

Baseline depression levels do not affect efficacy of cognitive-behavioral self-help treatment for insomnia

NARCIS (Netherlands)

Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

2013-01-01

Background: Cognitive-behavioral therapy can effectively treat insomnia (CBT-I). Randomized controlled trials have shown efficacy of self-help CBT-I, but unclear is whether excluding depressive patients boosted treatment effects. Method: We administered unsupported self-help CBT-I to insomnia

The effect of different pH modifier on formation of CdS nanoparticles

International Nuclear Information System (INIS)

Ren Xiaoxiao; Zhao Gaoling; Li Hong; Wu Wei; Han Gaorong

2008-01-01

CdS nanoparticles were prepared by hydrothermal method. The effects of pH modifier on the properties of CdS particles were studied. NaOH and NH 4 OH were chosen as the pH modifier. The morphology and optical properties of CdS particles were characterized by transmitted electron microscope (TEM) and optical absorption spectra analysis, respectively. The particle size of the samples whose pH modifier is NaOH was smaller than that of the CdS samples with NH 4 OH at the same pH value. Optical absorption edge of CdS shifted to longer wavelength with increasing pH value. Optical absorption edge of the samples with NH 4 OH as pH modifier shifted to the longer wavelength more significantly than that of those samples with NaOH as pH modifier. When CdS particles were adsorbed to the TiO 2 electrodes, the photoelectrochemical property of CdS-sensitized TiO 2 electrode showed that the samples with NH 4 OH as pH modifier had higher photocurrent than those samples with NaOH

Prospective, randomized, controlled trial using best-selling smoking-cessation book.

Science.gov (United States)

Foshee, James P; Oh, Anita; Luginbuhl, Adam; Curry, Joseph; Keane, William; Cognetti, David

2017-07-01

Our prospective, randomized, controlled trial aimed to evaluate the efficacy of the self-help book, The Easy Way to Stop Smoking, by Allen Carr, in promoting smoking cessation in patients with head and neck cancer. We assessed active smokers for their willingness to read a smoking cessation book. Participants were randomized to either receive the book from our department or recommended to purchase the book. All patients received smoking cessation counseling at recruitment. Phone surveys were conducted at short- and long-term intervals to determine if the patients had purchased and/or read the book and whether they were still smoking. One hundred twelve patients were recruited, 52 of whom completed follow-up surveys. Those who received the book for free were more likely to read the book (p = 0.05). Reading the book did not correlate with successful smoking cessation (p = 0.81). Some 26% of the 27 patients who received the book quit smoking compared with 32% of the 25 patients who were recommended the book (p = 0.76). Patients who indicated motivation to quit smoking were more likely to succeed. In our study, smoking cessation did not appear to be influenced by reading The Easy Way to Stop Smoking. Despite 80.8% of the cohort indicating at least a readiness to quit smoking at recruitment, only 28.8% of patients managed to achieve successful smoking cessation at long-term follow-up. Patient motivation remains an important factor in achieving long-term smoking abstinence. Quitting smoking remains a daunting challenge for patients, with multiple interventions likely needed to achieve cessation.

Help-seeking behavior among Japanese school students who self-harm: results from a self-report survey of 18,104 adolescents

Directory of Open Access Journals (Sweden)

Furukawa TA

2012-11-01

Full Text Available Norio Watanabe,1,* Atsushi Nishida,2,* Shinji Shimodera,3 Ken Inoue,4 Norihito Oshima,5 Tsukasa Sasaki,6 Shimpei Inoue,3 Tatsuo Akechi,1 Toshi A Furukawa,7 Yuji Okazaki81Department of Psychiatry and Cognitive-Behavioral Medicine, Nagoya City University Graduate School of Medical Sciences, Nagoya, 2Department of Schizophrenia Research, Tokyo Institute of Psychiatry, Tokyo, 3Department of Neuropsychiatry, Kochi Medical School, Kochi, 4Department Public Health, Fujita Health University School of Medicine, Aichi, 5Office for Mental Health Support, Division for Counseling and Support, University of Tokyo, Tokyo, 6Health Service Center, University of Tokyo, Tokyo, 7Department of Cognitive-Behavioral Medicine, Kyoto University Graduate School of Medicine/School of Public Health, Kyoto, 8Department of Psychiatry, Tokyo Metropolitan Matsuzawa Hospital, Tokyo, Japan *These authors contributed equally to this workBackground: The aim of this study was to determine the prevalence of and factors associated with poor help-seeking among adolescents who self-harm and to explore the resources used for help.Methods: A cross-sectional survey using an anonymous questionnaire was conducted in 47 junior and 30 senior high schools in Japan. Adolescent self-harm was defined as an adolescent who had harmed himself or herself in the previous year, as in previous studies reported in Western countries. Poor help-seeking was defined as not consulting anyone despite reporting current psychological or somatic complaints. Information about sociodemographic and psychological factors possibly associated with help-seeking, such as suicidal thoughts, depression, anxiety, and psychotic-like experiences, was also collected. Regression analyses were performed to examine associated factors.Results: A total of 18,104 students (8620 aged 12–15 years, 9484 aged 15–18 years, accounting for 93% of all students in the relevant student classes, participated in the study. Two hundred and

Synthesis and photoluminescence properties of comb-like CdS nanobelt/ZnO nanorod heterostructures

International Nuclear Information System (INIS)

Lan Changyong; Gong Jiangfeng; Liu Chunming

2012-01-01

Highlights: ► Comb-like CdS nanobelt/ZnO nanorod heterostructures were synthesized. ► ZnO nanorods epitaxially grew on the (1 0 0) surface of the CdS nanobelts along [1 0 0]. ► A preliminary growth mechanism was proposed. - Abstract: Comb-like CdS nanobelt/ZnO nanorod heterostructures were synthesized by a two-stage method. X-ray diffractometer, scanning electron microscopy, transmission electron microscopy were used to characterize and analyze the as-synthesized products. The results demonstrate that the CdS nanobelt backbones grow along [2 1 0] and the ZnO nanorod branches epitaxially grow on the (0 0 1) surface of the CdS nanobelt with a growth direction of [0 0 1]. The as-prepared heterostructures exhibit an important feature of single-crystallinity. At room temperature, the comb-like CdS nanobelt/ZnO nanorod heterostructures show strong green emission.

Baseline depression levels do not affect efficacy of cognitive-behavioral self-help treatment for insomnia

NARCIS (Netherlands)

Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

2013-01-01

Background Cognitive-behavioral therapy can effectively treat insomnia (CBT-I). Randomized controlled trials have shown efficacy of self-help CBT-I, but unclear is whether excluding depressive patients boosted treatment effects. Method We administered unsupported self-help CBT-I to insomnia patients

The Briefing Book Concept.

Science.gov (United States)

Minix, Dean A.

1990-01-01

Describes an open admissions program, a public university's nontraditional population, and their unique academic needs. Provides a political science briefing book assignment in which students research and write about one country. Claims the book is effective in helping students to organize and focus their thoughts and to improve their research and…

Exploring Multicultural Themes through Picture Books.

Science.gov (United States)

Farris, Pamela J.

1995-01-01

Advocates inclusion of multicultural picture books in social studies instruction to offer different outlooks and visions in a short format. Describes selection of picture books with multicultural themes and those that represent various cultures, gender equity, and religious themes. Suggests that picture books may help students develop better…

Optimal Financing with CDS Markets

NARCIS (Netherlands)

Matta, R.

2013-01-01

One could argue that CDSs improve risk sharing, hence credit supply and financing terms for firms. Accordingly, one would expect risky borrowers to benefit the most from CDS insurance. This is in contrast, however, with recent empirical evidence (Ashcraft and Santos (2009) and Hirtle (2009)). This

Development of a Higher Fidelity Model for the Cascade Distillation Subsystem (CDS)

Science.gov (United States)

Perry, Bruce; Anderson, Molly

2014-01-01

Significant improvements have been made to the ACM model of the CDS, enabling accurate predictions of dynamic operations with fewer assumptions. The model has been utilized to predict how CDS performance would be impacted by changing operating parameters, revealing performance trade-offs and possibilities for improvement. CDS efficiency is driven by the THP coefficient of performance, which in turn is dependent on heat transfer within the system. Based on the remaining limitations of the simulation, priorities for further model development include: center dot Relaxing the assumption of total condensation center dot Incorporating dynamic simulation capability for the buildup of dissolved inert gasses in condensers center dot Examining CDS operation with more complex feeds center dot Extending heat transfer analysis to all surfaces

MacBook for dummies

CERN Document Server

Chambers , Mark L

2014-01-01

Make friends with your MacBook the fun and easy way! Ultra-light, ultra-fast, and ultra-powerful, the MacBook is the coolest laptop in town, and longtime Mac guru Mark L. Chambers is just the guy to help you get to know your MacBook in no time. Take a closer look at the latest features, get the lowdown on OS X, unleash your creative forces with iLife, take care of business with the iWork applications, and sync it all with iCloud with the expert advice in this bestselling MacBook guide. Whether this is your first MacBook or your first laptop, period, you''ll learn to navigate the Mac desktop, c

Magnetodielectric effect in CdS nanosheets grown within Na-4 mica

Science.gov (United States)

Mandal, Amrita; Mitra, Sreemanta; Datta, Anindya; Banerjee, Sourish; Chakravorty, Dipankar

2012-04-01

CdS nanosheets of thickness 0.6 nm were grown within the interlayer spaces of Na-4 mica. Magnetization measurements carried out in the temperature range 2-300 K showed the composites to have weak ferromagnetic-like properties even at room temperature. The saturation magnetization (MS) at room temperature was found to be higher than that reported for CdS nanoparticles. The higher value of MS may be ascribed to the presence of a large number defects in the present CdS system, due to a large surface to volume ratio in the nanosheets as compared to that of CdS nanoparticles. The nanocomposites exhibited a magnetodielectric effect with a dielectric constant change of 5.3% for a magnetic field of 0.5 T. This occurred due to a combination of magnetoresistance and Maxwell-Wagner effect as delineated in the model developed by Catalan.

Books that Focus on Family.

Science.gov (United States)

Winfield, Evelyn T.

1989-01-01

Twelve books which touch upon family relationships are reviewed in this article. These books show how families can build positive relationships among their members in a variety of situations. Issues include self-concept, health, sibling rivalry, the generation gap, divorce, and death. (IAH)

Optical sensor based on a single CdS nanobelt.

Science.gov (United States)

Li, Lei; Yang, Shuming; Han, Feng; Wang, Liangjun; Zhang, Xiaotong; Jiang, Zhuangde; Pan, Anlian

2014-04-23

In this paper, an optical sensor based on a cadmium sulfide (CdS) nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT) method. X-Ray Diffraction (XRD) and Transmission Electron Microscopy (TEM) results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL) technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 10⁴, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

Compton profiles and band structure calculations of CdS and CdTe

International Nuclear Information System (INIS)

Heda, N.L.; Mathur, S.; Ahuja, B.L.; Sharma, B.K.

2007-01-01

In this paper we present the isotropic Compton profiles of zinc-blende CdS and CdTe measured at an intermediate resolution of 0.39 a.u. using our 20 Ci 137 Cs Compton spectrometer. The electronic band structure calculations for both the zinc-blende structure compounds and also wurtzite CdS have been undertaken using various schemes of ab-initio linear combination of atomic orbitals calculations implemented in CRYSTAL03 code. The band structure and Mulliken's populations are reported using density functional scheme. In case of wurtzite CdS, our theoretical anisotropies in directional Compton profiles are compared with available experimental data. In case of both the zinc-blende compounds, the isotropic experimental profiles are found to be in better agreement with the present Hartree-Fock calculations. A study of the equal-valence-electron-density experimental profiles of zinc-blende CdS and CdTe shows that the CdS is more ionic than CdTe. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Comparison of Six- and Eight-Session Cognitive Guided Self-Help for Bulimia Nervosa

Science.gov (United States)

Furber, Gareth; Steele, Anna; Wade, Tracey D.

2004-01-01

A previous case-series evaluation of a six-session guided self-help (GSH) approach with 15 people with bulimia nervosa (BN) showed significant reductions across all measures, including binge eating, self-induced vomiting, weight concern, shape concern and dietary restraint. However, the reduction of binge eating and self-induced vomiting was…

Internet-delivered or mailed self-help treatment for insomnia?: a randomized waiting-list controlled trial

NARCIS (Netherlands)

Lancee, J.; van den Bout, J.; van Straten, A.; Spoormaker, V.I.

2012-01-01

Cognitive Behavioral Therapy (CBT) is effective in reducing insomnia complaints, but the effects of self-help CBT have been inconsistent. The aim of this study was to determine the effectiveness of self-help for insomnia delivered in either electronic or paper-and-pencil format compared to a

Sjogren's Syndrome: A Place to Begin

Medline Plus

Full Text Available ... Sheets Books, CDs & More! Donate Today Your support will help us continue to meet the needs of ... don't know where to begin. This program will introduce you to three Sjögren’s patients who will ...

The effect of different pH modifier on formation of CdS nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Xiaoxiao, Ren [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Zhao Gaoling [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)], E-mail: glzhao@zju.edu.cn; Hong, Li; Wei, Wu; Gaorong, Han [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)

2008-10-06

CdS nanoparticles were prepared by hydrothermal method. The effects of pH modifier on the properties of CdS particles were studied. NaOH and NH{sub 4}OH were chosen as the pH modifier. The morphology and optical properties of CdS particles were characterized by transmitted electron microscope (TEM) and optical absorption spectra analysis, respectively. The particle size of the samples whose pH modifier is NaOH was smaller than that of the CdS samples with NH{sub 4}OH at the same pH value. Optical absorption edge of CdS shifted to longer wavelength with increasing pH value. Optical absorption edge of the samples with NH{sub 4}OH as pH modifier shifted to the longer wavelength more significantly than that of those samples with NaOH as pH modifier. When CdS particles were adsorbed to the TiO{sub 2} electrodes, the photoelectrochemical property of CdS-sensitized TiO{sub 2} electrode showed that the samples with NH{sub 4}OH as pH modifier had higher photocurrent than those samples with NaOH.

Synthesis, optical, structural, and electrical properties of single-crystalline CdS nanobelts

Energy Technology Data Exchange (ETDEWEB)

Alqahtani, Mohammed S. [King Saud University, Department of Physics and Astronomy, Riyadh (Saudi Arabia); Hadia, N.M.A.; Mohamed, S.H. [Sohag University, Physics Department, Faculty of Science, Sohag (Egypt)

2017-04-15

CdS nanobelts (NBs) were synthesized by vapor transport of CdS powders. The growth was carried out without any catalyst on quartz and Si (100) substrates. The synthesized CdS NBs were examined by transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM) and selected area electron diffraction (SAED), high-resolution transmission electron microscopy (HR-TEM), X-ray powder diffraction (XRD), energy dispersion analysis of X-ray (EDAX), spectrophotometer, and photoluminescence spectroscopy. CdS NBs were indexed as hexagonal wurtzite structure. The growth was via vapor-solid growth mechanism and along the [100] direction. The refractive index was evaluated in the transparent region, as suggested by Swanepoel, using the envelope method. The refractive index values and the extinction coefficient were decreased by increasing the wavelength. The calculated optical band gap was 2.50 eV. The photoluminescence (PL) spectrum of the synthesized CdS NBs exhibited a green emission peak at 510 nm and a broad red emission peak at 696 nm. The conductivity measurements were achieved, in the temperature range from 300 to 600 K, using the conventional two-probe technique. Two different slopes with different activation energies of 0.618 and 0.215 eV were obtained. The CdS NBs are likely being novel functional materials. Thus, they can be used in the manufacture of innovative optoelectronic nanodevices. (orig.)

Role of Self-help Groups in Promoting Inclusion and Rights of Persons with Disabilities

Directory of Open Access Journals (Sweden)

K P Kumaran

2011-10-01

Full Text Available Purpose:This study examined the role of self help groups in addressing some of the problems faced by persons with disabilities such as social exclusion, discrimination, lack of awareness about their rights and privileges, and absence of livelihood programmes.Method: One hundred persons with disabilities were randomly drawn for the study from 50 self help groups in 2 districts that were covered under a popular poverty alleviation programme implemented by the state of Andhra Pradesh  in India.  An interview schedule was used to collect information.Results: Before joining the group, some of the persons with disabilities were mostly confined to their houses, and viewed as less productive and incapable of leading a ‘normal’ life. After joining the groups, they came out of their seclusion and started to work together for their collective welfare and development. They gained knowledge about their rights and privileges and started income generation activities with the help of loans made available to them.  They gained better acceptance within their families, but attitudes of their communities was slower to change. A feeling that “disability is not inability” seemed to have been internalized among the members of the groups.Conclusion: Self-help groups can be very effective in helping persons with disabilities to come out of their isolation and in promoting their participation and inclusion in societal mainstream.Key Words: Self-help group, persons with disabilitiesdoi 10.5463/DCID.v22i2.78

Nano-architecture based photoelectrochemical water oxidation efficiency enhancement by CdS photoanodes

Science.gov (United States)

Pareek, Alka; Kim, Hyun Gyu; Paik, Pradip; Joardar, Joydip; Borse, Pramod H.

2017-02-01

In the present work, 2D nanostructuring has been utilized to impart an efficiency improvement to the hexagonal phase CdS films for the photoelectrochemical (PEC) cells those were deposited by spray pyrolysis technique. By controlling the aerosol droplet- size, population and impingement time during the spray pyrolysis deposition, various nano-features viz. randomly aligned nanorods, nanotubes and nanowires of CdS has been demonstrated for the first time. A growth mechanism has been proposed to predict the temporal evolution of the nanostructures. The prominent nanoscale structures show improved optical properties in the visible range of solar spectrum. The structural studies validate the morphological differences of nanostructures in terms of the texture coefficient analysis as well as 2D micro x-ray diffraction imaging. Electrochemical characterization is carried out to understand the effect of nanostructuring on the PEC performance of the CdS photoanodes in the sulphide (0.1 M Na2S  +  0.02 M Na2SO3) electrolyte at applied bias of 0.2 V (versus SCE). The evolution of morphology from randomly aligned rods to nanowire is responsible for improved photocurrent (3.5 times). CdS film morphology can be tuned to nanotubes, nano- rose buds and nanorod bunches even by doping Zn2+ ions in CdS lattice. Nano-structuring of doped CdS has shown enhanced performance of the photoanodes. The nanotubes structures yielded highest photocurrent density of 1.6 mA cm-2. Whereas modifying the 2D-nanostructured CdS film by simple MoO3 spray coating yields the photocurrent enhancement to 2.1 mA cm-2.

Book Ownership and Young Children's Learning

Science.gov (United States)

Tadesse, Selamawit; Washington, Patsy

2013-01-01

Research indicates that there are positive effects when young children read and explore books for pleasure, as such activities help build the skills and knowledge that are critical to schooling. Reading for pleasure is facilitated when children have access to books in their own homes. There are great variations in children's book ownership…

Thermal and Optical Properties of CdS Nanoparticles in Thermotropic Liquid Crystal Monomers

Directory of Open Access Journals (Sweden)

Marc Alnot

2010-03-01

Full Text Available Two new mesogenic monomers, namely 3,3’-dimethoxy-4,4’-di(hydroxyhexoxy-N-benzylidene-o-Tolidine (Ia and 4,4’-di(6-hydroxyhexoxy-N-benzylidene-o-Tolidine (IIa, were reacted with cadmium sulfide (CdS via an in situ chemical precipitation method in ethanol to produce CdS nanocomposites. A series of different mass compositions of CdS with Ia and IIa ranging from 0.1:1.0 to 1.0:1.0 (w/w were prepared and characterized using X-ray Diffraction (XRD, Raman spectroscopy, Fourier Transform Infrared Spectroscopy (FT-IR, Transmission Electron Microscopy (TEM, Polarizing Optical Microscopy (POM and Differential Scanning Calorimetry (DSC, X-ray Photoelectron Spectroscopy (XPS and Photoluminescence Spectroscopy (PL. XRD showed that the broad peaks are ascribed to the formation of cubic CdS nanoparticles in both Ia and IIa. The average particle size for both nanocomposites was less than 5 nm with a narrower size distribution when compared with pure CdS nanoparticles. The analyses from POM and DSC demonstrated that mass composition from 0.1:1.0 up to 0.5:1.0 of CdS:Ia nanocomposites showed their enantiotropic nematic phase. On the other hand, polarizing optical microscopy (POM for IIa nanocomposites showed that the liquid crystal property vanished completely when the mass composition was at 0.2:1.0. PL emissions for CdS: Ia or IIa nanocomposites indicated deep trap defects occurred in these both samples. The PL results revealed that addition of CdS to Ia monomers suppressed the photoluminescence intensity of Ia. However, the introduction of CdS to IIa monomers increased the photoluminescence and was at a maximum when the mass composition was 0.3:1.0, then decreased in intensity as more CdS was added. The XPS results also showed that the stoichiometric ratios of S/Cd were close to 1.0:1.0 for both types of nanocomposites for a mass composition of 1.0:1.0 (CdS:matrix.

Once Upon an HRD Book Club.

Science.gov (United States)

Bonner, Dede; Tarner, Liz

1999-01-01

Shares experiences of a human resource development (HRD) book group. Offers practical startup tips, descriptions of different types of book groups, and lessons learned about such groups. Suggests that membership on an HRD book group is an opportunity for self-directed learning in a social context, and it fosters a mindset for lifelong learning.…

Theoretical investigation of the structural, electronic, and thermodynamic properties of CdS1-xSex alloys

Science.gov (United States)

Long, Debing; Li, Mingkai; Meng, Dongxue; Ahuja, Rajeev; He, Yunbin

2018-03-01

In this work, the structural, electronic, and thermodynamic properties of wurtzite (WZ) and zincblende (ZB) CdS1-xSex alloys are investigated using the density functional theory (DFT) and the cluster expansion method. A special quasirandom structure containing 16 atoms is constructed to calculate the band structures of random alloys. The band gaps of CdS1-xSex alloys are direct and decrease as the Se content increases. The delta self-consistent-field method is applied to correct band gaps that are underestimated by DFT. The band offsets clearly reflect the variation in valence band maxima and conduction band minima, thus providing information useful to the design of relevant quantum well structures. The positive formation enthalpies of both phases imply that CdS1-xSex is an immiscible system and tends to phase separate. The influence of lattice vibrations on the phase diagram is investigated by calculating the phonon density of states. Lattice vibration effects can reduce the critical temperature Tc and increase alloy solid solubilities. This influence is especially significant in the ZB structure. When only chemical interactions are present, the Tc values for WZ- and ZB-CdS1-xSex are 260 K and 249 K, respectively. The lattice vibration enthalpy and entropy lower the Tc to 255 K and 233 K, respectively.

Mixed-solvothermal synthesis of CdS micro/nanostructures and their optical properties

International Nuclear Information System (INIS)

Zhong Shengliang; Zhang Linfei; Huang Zhenzhong; Wang Shangping

2011-01-01

Several novel cadmium sulfide (CdS) micro/nanostructures, including cauliflower-like microspheres, football-like microspheres, tower-like microrods, and dendrites were controllably prepared via an oxalic acid-assisted solvothermal route using ethylene glycol (EG) and H 2 O as pure and mixed solvents with different S sources. The as-prepared products were characterized by X-ray powder diffraction (XRD), scanning electronic microscope (SEM) and UV-vis spectrophotometer (UV). It was found that CdS micro/nanostructures can be selectively obtained by varying the composition of solvent, concentration of oxalic acid, and sulfur sources. UV-vis absorption spectra reveal that their absorption properties are shape-dependent. The possible formation process of the CdS micro/nanostructures was briefly discussed. This route provides a facile way to tune the morphologies of CdS over a wide range.

Rapid synthesis of triangular CdS nanocrystals without any trap emission

International Nuclear Information System (INIS)

Poulose, Aby Cheruvathoor; Veeranarayanan, Srivani; Yoshida, Yasuhiko; Maekawa, Toru; Sakthi Kumar, D.

2012-01-01

Nanocrystals (NCs) with anisotropic dimensions display polarized emission compared to nano dots. Triangular prisms are good candidates for polarized optical properties and monodisperse triangular NCs are ideal for developing building blocks for novel three-dimensional superlattices due to its anisotropic dimension. Among triangular nanocrystals, CdS nanocrystals are less discussed for the past one decade of research due to the difficulty in its processing method. Though well studied very few methods for developing CdS triangular nanocrystals have been reported, and most are having drawbacks either due to the time consuming process or the products are combination of triangular as well as many other shaped NC or with trap emissions due to defects which are comparable to band emissions limits its applications in full scale. Here, we are presenting a novel method to develop 7 nm CdS triangular NCs that can solve the above mentioned problems, which would augment the usage of CdS triangular crystals for many applications, based on its anisotropic properties.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement protein..., putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative ...

Design reflowable digital book template

Science.gov (United States)

Prasetya, Didik Dwi; Widiyaningtyas, Triyanna; Arifin, M. Zainal; Wahyu Sakti G., I.

2017-09-01

Electronic books (e-books or digital books) increasingly in demand and continue to grow in the form of future books. One of the standard format electronic books that potential is EPUB (electronic publication) published by the International Digital Publishing Forum (IDPF). This digital book has major advantages are able to provide interactive and reflowable content, which are not found in another book format, such as PDF. Reflowable content allows the book can be accessed through a variety of reader device, like desktop and mobile with a fit and comfort view. However, because the generating process of an EPUB digital book is not as easy a PDF, so this format is less popular. Therefore, in order to help overcome the existing problems, this paper develops digital reflowable text book templates to support electronic learning, especially in Indonesia. This template can be used by anyone to produce a standard digital book quickly and easily without requiring additional specialized knowledge.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >1sg6B 30 343 72 371 7e-54 ... dbj|BAD07382.1| putative 2-epi-5-epi-valiolone synthase [Actinopla...nes sp. A40644] ... Length = 300 ... Query: 89 ... SRRFCVVDDSVWAIYGEKLKAYFDERNIASK

Optical Sensor Based on a Single CdS Nanobelt

Directory of Open Access Journals (Sweden)

Lei Li

2014-04-01

Full Text Available In this paper, an optical sensor based on a cadmium sulfide (CdS nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT method. X-Ray Diffraction (XRD and Transmission Electron Microscopy (TEM results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 104, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

E-Books: Are We on the Same Page?

Science.gov (United States)

Bozarth, Sandra; Zhong, Ying

2016-01-01

Libraries are making great efforts acquiring, maintaining, and promoting electronic book (e-book) collections; therefore, understanding what preference users have regarding e-books will help with current and future collection-development decisions. For librarians to provide e-book resources and services effectively, a thorough understanding of…

Self-Help Training System for Nursing Students to Learn Patient Transfer Skills

Science.gov (United States)

Huang, Zhifeng; Nagata, Ayanori; Kanai-Pak, Masako; Maeda, Jukai; Kitajima, Yasuko; Nakamura, Mitsuhiro; Aida, Kyoko; Kuwahara, Noriaki; Ogata, Taiki; Ota, Jun

2014-01-01

This paper describes the construction and evaluation of a self-help skill training system for assisting student nurses in learning skills involving the transfer of patients from beds to wheelchairs. We have proposed a feedback method that is based on a checklist and video demonstrations. To help trainees efficiently check their performance and…

Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

International Nuclear Information System (INIS)

Gonzalez, G.; Krishnan, B.; Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K.; Shaji, S.

2011-01-01

Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

2011-08-31

Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

Health education in self-help groups to promote healthy lifestyles

Directory of Open Access Journals (Sweden)

Bruno López de la Vega

2012-12-01

Full Text Available In this review we discuss the formation of self-help groups (GAM in order to help to counteract diseases, illnesses or conditions assertively, effective and above all positive, this in order to integrate health education in its multidisciplinary approach to create GAM that provide viable alternatives to modify unhealthy lifestyles or unhealthy. It is important the introduction of health education in the creation and sustenance of the same, as it provides a different perspective on the implementation of plans, programs and projects open to meet learning needs and changes in lifestyle with the help of support networks and psycho-emotional aspects intervention, which aims to achieve stability at individual and collective level.

Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

Science.gov (United States)

Kalaycı, Özlem A.; Duygulu, Özgür; Hazer, Baki

2013-01-01

This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na2S and Cd(CH3COO)2 simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether-THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV-vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV-vis absorbance spectra and fluorescence emission spectra.

Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

Energy Technology Data Exchange (ETDEWEB)

Kalayc Latin-Small-Letter-Dotless-I , Oezlem A. [Bulent Ecevit University, Department of Physics (Turkey); Duygulu, Oezguer [TUBITAK Marmara Research Center, Materials Institute (Turkey); Hazer, Baki, E-mail: bkhazer@karaelmas.edu.tr [Bulent Ecevit University, Department of Chemistry (Turkey)

2013-01-15

This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na{sub 2}S and Cd(CH{sub 3}COO){sub 2} simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether-THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV-vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV-vis absorbance spectra and fluorescence emission spectra.

Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

International Nuclear Information System (INIS)

Kalaycı, Özlem A.; Duygulu, Özgür; Hazer, Baki

2013-01-01

This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na 2 S and Cd(CH 3 COO) 2 simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether–THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV–vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV–vis absorbance spectra and fluorescence emission spectra.

Study of optical phonon modes of CdS nanoparticles using Raman

Indian Academy of Sciences (India)

In this paper we report the study of optical phonon modes of nanoparticles of CdS using Raman spectroscopy. Nanoparticle sample for the present study was synthesized through chemical precipitation technique. The CdS nanoparticles were then subjected to heat treatment at low temperature (150°C) for extended time ...

Enhancing inpatient psychotherapeutic treatment with online self-help: study protocol for a randomized controlled trial.

Science.gov (United States)

Zwerenz, Rüdiger; Becker, Jan; Knickenberg, Rudolf J; Hagen, Karin; Dreier, Michael; Wölfling, Klaus; Beutel, Manfred E

2015-03-17

Depression is one of the most debilitating and costly mental disorders. There is increasing evidence for the efficacy of online self-help in alleviating depression. Knowledge regarding the options of combining online self-help with inpatient psychotherapy is still limited. Therefore, we plan to evaluate an evidence-based self-help program (deprexis®; Gaia AG, Hamburg, Germany) to improve the efficacy of inpatient psychotherapy and to maintain treatment effects in the aftercare period. Depressed patients (n = 240) with private internet access aged between 18 and 65 are recruited during psychosomatic inpatient treatment. Participants are randomized to an intervention or control group at the beginning of inpatient treatment. The intervention group (n = 120) is offered an online self-help program with 12 weekly tasks, beginning during the inpatient treatment. The control group (n = 120) obtains access to an online platform with weekly updated information on depression for the same duration. Assessments are conducted at the beginning (T0) and the end of inpatient treatment (T1), at the end of intervention (T2) and 6 months after randomization (T3). The primary outcome is the depression score measured by the Beck Depression Inventory-II at T2. Secondary outcome measures include anxiety, self-esteem, quality of life, dysfunctional cognitions and work ability. We expect the intervention group to benefit from additional online self-help during inpatient psychotherapy and to maintain the benefits during follow-up. This could be an important approach to develop future concepts of inpatient psychotherapy. ClinicalTrials.gov Identifier: NCT02196896 (registered on 16 July 2014).

Self-help group and the quality of life of patients with multiple sclerosis - Pilot study

Directory of Open Access Journals (Sweden)

Anna Eliášová

2015-12-01

Full Text Available Aim: The goal of the pilot study was to compare the quality of life of patients with multiple sclerosis in the Presov region with or without the support of a self-help group. Design: The character of this pilot study on patients with MS was related to the use of self-help groups and their impact on the assessment of the quality of life of the respondents, with the help of a questionnaire (WHOQOL-BREF. Methods: The research was carried out in the Prešov region with the help of the standardized WHOQOL-BREF questionnaire. Ninety-one patients with MS participated in the pilot study (46 respondents attended a self-help group and 35 did not. Results: The groups, when compared, aided by the statistically evaluated WHOQOL-BREF domains, were found to show significant differences in their evaluation of quality of life in three domains: domain one: physical health; domain two: surviving; domain three: social relations. Better scores were achieved in these domains by those who attended a group. In the physical sphere, we noticed significant differences in sleep quality, and sexual satisfaction (p < 0.001, while in social and economic areas, there were significant differences in satisfaction with personal relationships (p < 0.001, and economic circumstances (p < 0.01, self-contentment (p < 0.01, and coping with negative feelings (p < 0.05. Conclusion: Patients with multiple sclerosis can live normal lives provided they are supported by their families, friends, health care professionals, and self-help groups.

CDS User survey

CERN Multimedia

CERN Document Service

2011-01-01

  The CERN Document Server is launching a user survey in order to collect information relative to its search engine, submission interfaces, collaborative features and content organisation. With the view of re-shaping its collections and interfaces and to better integrate with the new INSPIRE platform that serves all HEP literature, CERN Document Server team invites you to take part in the survey. Your input is essential to provide us with useful information before setting up the new service and improve your interactions with CDS. Thanks for participating !  

Mixed-solvothermal synthesis of CdS micro/nanostructures and their optical properties

Energy Technology Data Exchange (ETDEWEB)

Zhong Shengliang, E-mail: zslxhx@yahoo.com.cn [College of Chemistry and Chemical Engineering, Jiangxi Normal University, Nanchang 330022 (China); Zhang Linfei; Huang Zhenzhong; Wang Shangping [College of Chemistry and Chemical Engineering, Jiangxi Normal University, Nanchang 330022 (China)

2011-01-15

Several novel cadmium sulfide (CdS) micro/nanostructures, including cauliflower-like microspheres, football-like microspheres, tower-like microrods, and dendrites were controllably prepared via an oxalic acid-assisted solvothermal route using ethylene glycol (EG) and H{sub 2}O as pure and mixed solvents with different S sources. The as-prepared products were characterized by X-ray powder diffraction (XRD), scanning electronic microscope (SEM) and UV-vis spectrophotometer (UV). It was found that CdS micro/nanostructures can be selectively obtained by varying the composition of solvent, concentration of oxalic acid, and sulfur sources. UV-vis absorption spectra reveal that their absorption properties are shape-dependent. The possible formation process of the CdS micro/nanostructures was briefly discussed. This route provides a facile way to tune the morphologies of CdS over a wide range.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION LICENSING... FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING FACTOR ...

MacBook Pro Portable Genius

CERN Document Server

Miser, Brad

2012-01-01

Discover loads of tips and techniques for the newest MacBook Pro You're already ahead of the game with a MacBook Pro. Now you can get even more out the popular Apple notebook with the new edition of this handy, compact book. Crammed with savvy insights and tips on key tools and shortcuts, this book will help you increase your productivity and keep your Apple digital lifestyle on track. From desktop sharing and wireless networking to running Windows applications, this book avoids fluff, doesn't skimp on the essentials, saves you time and hassle, and shows you what you most want to know. Include

Microwave Synthesized Monodisperse CdS Spheres of Different Size and Color for Solar Cell Applications

Directory of Open Access Journals (Sweden)

Carlos A. Rodríguez-Castañeda

2015-01-01

Full Text Available Monodisperse CdS spheres of size of 40 to 140 nm were obtained by microwave heating from basic solutions. It is observed that larger CdS spheres were formed at lower solution pH (8.4–8.8 and smaller ones at higher solution pH (10.8–11.3. The color of CdS products changed with solution pH and reaction temperature; those synthesized at lower pH and temperature were of green-yellow color, whereas those formed at higher pH and temperature were of orange-yellow color. A good photovoltage was observed in CdS:poly(3-hexylthiophene solar cells with spherical CdS particles. This is due to the good dispersion of CdS nanoparticles in P3HT solution that led to a large interface area between the organic and inorganic semiconductors. Higher photocurrent density was obtained in green-yellow CdS particles of lower defect density. The efficient microwave chemistry accelerated the hydrolysis of thiourea in pH lower than 9 and produced monodisperse spherical CdS nanoparticles suitable for solar cell applications.

Getting Along with Others: An Activity Book. Charts and Tips To Help You Teach Social Skills to Children and Reward Their Good Behavior. Grades Pre K-6.

Science.gov (United States)

Herron, Ron

Noting that children need to learn to cooperate with peers, older children, adults, and parents, this activity book presents 30 charts to help parents help their children learn and practice social skills. The illustrations, coloring activities, and rewards for parents to offer are designed to keep children entertained and motivated. The book…

Optical properties of CdS thin films by (SILAR) method

International Nuclear Information System (INIS)

Ates, A.; Gurbulak, B.; Yildirim, M.

2004-01-01

Full text: CdS thin film was grown by Successive ionic layer adsorption and reaction (SILAR) technique on quartz substrate. The film homogeneous of film is good and the film colour obtained as orange. Optical properties of CdS thin film has been investigated as a function of temperature in the temperature range 10-320 K with 10 K steps. The band gap energy decreased with increasing temperature

Investigation of the photoluminescence properties of thermochemically synthesized CdS nanocrystals

Directory of Open Access Journals (Sweden)

M. Molaei

2011-03-01

Full Text Available In this work we have synthesized CdS nanocrystals with thermochemical method. CdSO4 and Na2S2O3 were used as the precursors and thioglycolic acid (TGA was used as capping agent molecule. The structure and optical property of the nanocrystals were characterized by means of XRD, TEM, UV-visible optical spectroscopy and photoluminescence (PL. X-ray diffraction (XRD and TEM analyses demonstrated hexagonal phase CdS nanocrystals with an average size around 2 nm. Synthesized nanocrystals exhibited band gap of about 3.2 eV and showed a broad band emission from 400-750 nm centered at 504 nm with a (0.27, 0.39 CIE coordinate. This emission can be attributed to recombination of an electron in conduction band with a hole trapped in Cd vacancies near to the valance band of CdS. The best attained photoluminescence quantum yield of the nanocrystals was about 12%, this amount is about 20 times higher than that for thioglycerol (TG capped CdS nanocrystals.

Amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution

Energy Technology Data Exchange (ETDEWEB)

Li, Xiaofang; Tang, Chaowan; Zheng, Qun; Shao, Yu; Li, Danzhen, E-mail: dzli@fzu.edu.cn

2017-02-15

Loading cocatalyst on semiconductors was crucially necessary for improving the photocatalytic hydrogen evolution. Amorphous MoS{sub x} as a novel and noble metal-free cocatalyst was loaded on CdS nanorods by a simple photodeposition method. Efficient hydrogen evolution with amount of 15 mmol h{sup −1} g{sup −1} was observed over the MoS{sub x} modified CdS nanorods, which was about 6 times higher than that by using Pt as cocatalyst. Meanwhile, with MoS{sub x} cocatalyst, the efficiency of CdS nanorods was superior to that of CdS nanoparticles and bulk CdS. No deactivation could be observed in the efficiency of MoS{sub x} modified CdS nanorods under irradiation for successive 10 h. Further experimental results indicated that the efficient electrons transfer, low overpotential of hydrogen evolution and active S atoms over the MoS{sub x} modified CdS nanorods were responsible for the higher efficiency. Our results provided guidance for synthesizing noble metal-free materials as cocatalyst for photocatalytic hydrogen evolution. - Graphical abstract: Photodeposition of amorphous MoS{sub x} on CdS nanorods for highly efficient photocatalytic hydrogen evolution. - Highlights: • Amorphous MoSx cocatalyst was loaded on CdS NRs by a simple photodeposition. • MoS{sub x}/CdS NRs exhibited 6 times higher hydrogen evolution efficiency than Pt/CdS NRs. • The hydrogen evolution of MoS{sub x}/CdS NRs linearly increased with prolonging time. • Lower overpotential and efficient electron transfer were observed over MoS{sub x}/CdS NRs.

Microstructural and optical properties of CdS nanoparticles synthesized by sol gel method

Science.gov (United States)

Mahdi, Hadeel Salih; Parveen, Azra; Agrawal, Shraddha; Azam, Ameer

2018-05-01

Semiconductor nanoparticles of CdS are of great interest for both fundamental research and industrial development due to their unique size-dependent optical and electronic properties and their exciting utilization in the fields of light-emitting diode, electro-chemical cells, laser, hydrogen producing catalyst, biological label. We present a scheme to measure the optical properties of CdS nanoparticles The peaks were indexed by powder-x software. The XRD pattern analysis showed that CdS composition was found to have hexagonal structure with well crystalline nature. the surface morphology and the composition of the samples were investigated by SEM (JEOL, japan). The image shows the presence of large spherical aggregates of smaller individual nanoparticles of various sizes for pure cds. to check the chemical composition of the material, energy dispersive X-ray (EDX) spectroscopic analysis was also performed which further confirmed the presence of cd and s ions in the matrix. The optical absorption spectra of CdS sample was recorded by uv-vis spectrophotometer in the range of 200 to 800 nm.

Photosensitization of TiO2 P25 with CdS Nanoparticles for Photocatalytic Applications

Directory of Open Access Journals (Sweden)

Trenczek-Zając A.

2017-06-01

Full Text Available A TiO2/CdS coupled system was prepared by mixing the TiO2 P25 with CdS synthesized by means of the precipitation method. It was found that the specific surface area (SSA of both components is extremely different and equals 49.5 for TiO2 and 145.4 m2·g−1 for CdS. The comparison of particle size distribution and images obtained by means of transmission electron microscopy (TEM showed agglomeration of nanocomposites. X-ray diffraction (XRD patterns suggest that CdS crystallizes in a mixture of cubic and hexagonal phases. Optical reflectance spectra revealed a gradual shift of the fundamental absorption edge towards longer wavelengths with increasing CdS molar fraction, which indicates an extension of the absorption spectrum of TiO2. The photocatalytic activity in UV and UV-vis was tested with the use of methyl orange (MO. The Langmuir–Hinshelwood model described well the photodegradation process of MO. The results showed that the photocatalytic behaviour of the TiO2/CdS mixture is significantly better than that of pure nanopowders.

Morphology, structure and optical properties of hydrothermally synthesized CeO2/CdS nanocomposites

Science.gov (United States)

Mohanty, Biswajyoti; Nayak, J.

2018-04-01

CeO2/CdS nanocomposites were synthesized using a two-step hydrothermal technique. The effects of precursor concentration on the optical and structural properties of the CeO2/CdS nanoparticles were systematically studied. The morphology, composition and the structure of the CeO2/CdS nanocomposite powder were studied by scanning electron microscopy (SEM), energy dispersive X-ray spectrum analysis (EDXA) and X-ray diffraction (XRD), respectively. The optical properties of CeO2/CdS nanocomposites were studied by UV-vis absorption and photoluminescence (PL) spectroscopy. The optical band gaps of the CeO2/CdS nanopowders ranged from 2.34 eV to 2.39 eV as estimated from the UV-vis absorption. In the room temperature photoluminescence spectrum of CeO2/CdS nanopowder, a strong blue emission band was observed at 400 nm. Since the powder shows strong visible luminescence, it may be used as a blue phosphor in future. The original article published with this DOI was submitted in error. The correct article was inadvertently left out of the original submission. This has been rectified and the correct article was published online on 16 April 2018.

41 CFR 102-75.595 - What responsibilities do landholding agencies have concerning properties to be used for self-help...

Science.gov (United States)

2010-07-01

... landholding agencies have concerning properties to be used for self-help housing or housing assistance use... Real Property Disposal Property for Providing Self-Help Housing Or Housing Assistance § 102-75.595 What responsibilities do landholding agencies have concerning properties to be used for self-help housing or housing...

Physical properties and characterization of Ag doped CdS thin films

International Nuclear Information System (INIS)

Shah, N.A.; Nazir, A.; Mahmood, W.; Syed, W.A.A.; Butt, S.; Ali, Z.; Maqsood, A.

2012-01-01

Highlights: ► CdS thin films were grown. ► By ion exchange, Ag was doped. ► Physical properties were investigated. - Abstract: Thin films of cadmium sulfide with very well defined preferential orientation and relatively high absorption coefficient were fabricated by thermal evaporation technique. The research is focused to the fabrication and characterization of the compositional data of CdS thin films obtained by using X-ray diffraction, scanning electron microscope along with energy dispersive X-ray spectroscopy. The optical properties were studied by using a UV-VIS-NIR spectrophotometer. The effects of silver-doping by ion exchange process on the properties of as-deposited CdS thin films have been investigated.

Synthesis of CdS hollow/solid nanospheres and their chain-structures by membrane technique

International Nuclear Information System (INIS)

Duan Shumin; Wu Qingsheng; Jia Runping; Liu Xinbo

2008-01-01

CdS hollow/solid nanospheres and their chain-structures were successfully synthesized through supporting liquid membrane (SLM) system with bio-membrane. X-ray powder diffraction (XRD), transmission electron microscopy (TEM), UV-Vis spectroscopy, and photoluminescence (PL) spectroscopy have been used for the characterization of the products. The average diameters of CdS solid/hollow spheres are about 10, 40 nm, respectively. The wall of the hollow spheres is about 5 nm. CdS products are all cubic face-centered structure with the cell constant a = 5.830 A. We also explore the morphology, structure and possible synthesis mechanism. A possible template mechanism has been proposed for the production of the hollow CdS nanocrystals, that is, CdS nanoparticles grow along the non-soakage interface between CHCl3 and reactant solution. During this process, the organic functional groups were crucial to the control of crystal morphologies

Public stigma and self-stigma: differential association with attitudes toward formal and informal help seeking.

Science.gov (United States)

Pattyn, Elise; Verhaeghe, Mieke; Sercu, Charlotte; Bracke, Piet

2014-02-01

Individuals in need of psychiatric treatment often avoid seeking help because of stigma. This study examined the impact of two stigma dimensions on help-seeking attitudes. Perceived public stigma refers to discrimination and devaluation by others, and anticipated self-stigma refers to internalization of negative stereotypes about people who seek help. Data were from the 2009 Stigma in a Global Context-Belgian Mental Health Study, in which face-to-face interviews were conducted with a representative sample of the general Belgian population. The study reported here included 728 respondents who received a vignette depicting major depression or schizophrenia. Perceived public stigma and anticipated self-stigma were measured with validated instruments. Respondents' attitudes toward help seeking were measured by the importance they assigned to care from formal and informal providers: general practitioners, psychiatrists, psychologists, family members, or friends. Multiple linear regression models were estimated. Respondents with higher levels of anticipated self-stigma attached less importance to care provided by general practitioners or psychiatrists, and those with higher levels of perceived public stigma rated informal help seeking as less important. The gender and the ethnicity of the person and respondents' sociodemographic characteristics had relatively little effect on help-seeking attitudes. Anticipated self-stigma and perceived public stigma appeared to have a differential impact on attitudes toward formal and informal help seeking. Internalization of negative stereotypes was negatively associated with the perceived importance of care from medical providers (general practitioners and psychiatrists). Awareness of stereotypes held by others deterred respondents from acknowledging the importance of informal care.

UNDERFLIGHT CALIBRATION OF SOHO/CDS AND HINODE/EIS WITH EUNIS-07

Energy Technology Data Exchange (ETDEWEB)

Wang Tongjiang; Brosius, Jeffrey W. [Institute for Astrophysics and Computational Sciences (IACS) in the Department of Physics, Catholic University of America, 620 Michigan Avenue NE, Washington, DC 20064 (United States); Thomas, Roger J.; Rabin, Douglas M.; Davila, Joseph M. [NASA Goddard Space Flight Center, Code 671, Greenbelt, MD 20771 (United States); Young, Peter R. [College of Science, George Mason University, 4400 University Drive, Fairfax, VA 22030 (United States); Del Zanna, Giulio, E-mail: tongjiang.wang@nasa.gov [DAMTP, Centre for Mathematical Sciences, University of Cambridge, Wilberforce Road, Cambridge, CB3 0WA (United Kingdom)

2011-12-01

Flights of Goddard Space Flight Center's Extreme Ultraviolet Normal Incidence Spectrograph (EUNIS) sounding rocket in 2006 and 2007 provided updated radiometric calibrations for Solar and Heliospheric Observatory/Coronal Diagnostic Spectrometer (SOHO/CDS) and Hinode/Extreme Ultraviolet Imaging Spectrometer (Hinode/EIS). EUNIS carried two independent imaging spectrographs covering wavebands of 300-370 A in first order and 170-205 A in second order. After each flight, end-to-end radiometric calibrations of the rocket payload were carried out in the same facility used for pre-launch calibrations of CDS and EIS. During the 2007 flight, EUNIS, SOHO/CDS, and Hinode/EIS observed the same solar locations, allowing the EUNIS calibrations to be directly applied to both CDS and EIS. The measured CDS NIS 1 line intensities calibrated with the standard (version 4) responsivities with the standard long-term corrections are found to be too low by a factor of 1.5 due to the decrease in responsivity. The EIS calibration update is performed in two ways. One uses the direct calibration transfer of the calibrated EUNIS-07 short wavelength (SW) channel. The other uses the insensitive line pairs, in which one member was observed by the EUNIS-07 long wavelength (LW) channel and the other by EIS in either the LW or SW waveband. Measurements from both methods are in good agreement, and confirm (within the measurement uncertainties) the EIS responsivity measured directly before the instrument's launch. The measurements also suggest that the EIS responsivity decreased by a factor of about 1.2 after the first year of operation (although the size of the measurement uncertainties is comparable to this decrease). The shape of the EIS SW response curve obtained by EUNIS-07 is consistent with the one measured in laboratory prior to launch. The absolute value of the quiet-Sun He II 304 A intensity measured by EUNIS-07 is consistent with the radiance measured by CDS NIS in quiet regions

An organizational typology for self-help groups.

Science.gov (United States)

Schubert, M A; Borkman, T J

1991-10-01

Those investigating the nature and functioning of self-help groups have been handicapped by the lack of a conceptual framework to bridge the diversity among such groups as well as to clarify the boundaries between consumer-owned and professionally owned groups. This paper describes a typology that classifies local units of these groups in terms of differences and similarities in their organizational structures. Rooted in organizational theory, it has two dimensions: external dependence upon resources and internal extent of experiential authority. Using it, the authors identified five types of groups, referred to as Unaffiliated, Federated, Affiliated, Hybrid, and Managed. The typology was validated with actual groups.

Diffusion mediated agglomeration of CdS nanoparticles via Langmuir–Blodgett technique

International Nuclear Information System (INIS)

Das, Nayan Mani; Roy, Dhrubojyoti; Gupta, P.S.

2013-01-01

Graphical abstract: - Highlights: • Diffusion mediated agglomeration of CdS nanoparticles are discussed. • Formation of CdS nanoparticles are confirmed by the change of chain length in XRD. • AFM shows the agglomeration of particles with a film swelling of about 5 Å. • UV–vis absorbance suggests that the grown particles show quantum confinement. • Hexagonal form of particle was confirmed by UV–vis reflectivity. - Abstract: We have reported a diffusion mediated agglomeration of cadmium sulphide (CdS) nanoparticles within cadmium arachidate (CdA 2 ) film matrix. The structural morphology and formation of CdS nanoparticles are characterized by X-ray diffraction (XRD), X-ray reflectivity (XRR), atomic force microscopy (AFM) and ultraviolet-visible spectroscopy techniques. X-ray diffraction (XRD) results show a change in bilayer difference from 53.04 Å to 43 Å after the sulphidation. An epitaxial growth of the films by ∼5 Å after sulphidation is confirmed from atomic force microscopy studies. The particle size calculated form UV–vis absorption edges are found to be varying from 2.6 nm to 3.3 nm for the different layers. A lateral dimension of 72–80 nm from AFM measurements and a size of 2.6–3.3 nm have confirmed one side flat pseudo two-dimensional disk-like nanoparticles. UV–vis reflectivity peak at E 1 (A) confirms the formation of hexagonal CdS nanoparticles along the c-axis

Beyond the therapeutic: A Habermasian view of self-help groups' place in the public sphere.

Science.gov (United States)

Chaudhary, Sarah; Avis, Mark; Munn-Giddings, Carol

2013-02-01

Self-help groups in the United Kingdom continue to grow in number and address virtually every conceivable health condition, but they remain the subject of very little theoretical analysis. The literature to date has predominantly focused on their therapeutic effects on individual members. And yet they are widely presumed to fulfil a broader civic role and to encourage democratic citizenship. The article uses Habermas' model of the public sphere as an analytical tool with which to reconsider the literature on self-help groups in order to increase our knowledge of their civic functions. In doing this it also aims to illustrate the continuing relevance of Habermas' work to our understanding of issues in health and social care. We consider, within the context of current health policies and practices, the extent to which self-help groups with a range of different forms and functions operate according to the principles of communicative rationality that Habermas deemed key to democratic legitimacy. We conclude that self-help groups' civic role is more complex than is usually presumed and that various factors including groups' leadership, organisational structure and links with public agencies can affect their efficacy within the public sphere.

Soft-template synthesis of single-crystalline CdS dendrites.

Science.gov (United States)

Niu, Haixia; Yang, Qing; Tang, Kaibin; Xie, Yi; Zhu, Yongchun

2006-01-01

The single-crystalline CdS dendrites have been fabricated from the reaction of CdCl2 and thiourea at 180 degrees C, in which glycine was employed as a soft template. The obtained products were explored by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, and selected area electronic diffraction. The optical properties of CdS dendrites have been investigated by ultraviolet and visible light (UV-vis) and photoluminescence techniques. The investigations indicated that the dendrites were grown due to the anisotropic properties enhanced by the use of Glycine in the route.

Structural, morphological and optical properties of Na and K dual doped CdS thin film

International Nuclear Information System (INIS)

Mageswari, S.; Dhivya, L.; Palanivel, Balan; Murugan, Ramaswamy

2012-01-01

Highlights: ► Effect of incorporation of Na, K and Na,K dual dopants into CdS thin film was investigated. ► Thin films were prepared by simple chemical bath deposition technique. ► The XRD analysis revealed cubic phase for all the investigated films. ► AFM analysis revealed uniform surface with crack free and densely packed morphology for CdS:Na,K film. ► The band gap value increases for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. - Abstract: CdS, sodium doped CdS (CdS:Na), potassium doped CdS (CdS:K) and sodium and potassium dual doped CdS (CdS:Na,K) thin films were deposited on glass substrate by chemical bath deposition (CBD) technique. Structural, morphological and optical properties of the as-grown films were characterised using X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDAX), atomic force microscopy (AFM) and ultraviolet visible (UV–VIS) spectroscopy. The XRD analysis revealed cubic phase for ‘as-deposited’ CdS, CdS:Na, CdS:K and CdS:Na,K dual doped thin films. AFM analysis revealed uniform film surface with crack free and densely packed morphology for CdS:Na,K film. The absorption edge in the optical absorption spectra shifts towards the shorter wavelength for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. The optical band gap of CdS, CdS:Na, CdS:K and CdS:Na,K thin films was found to be 2.31, 2.35, 2.38 and 2.34 eV, respectively.

Synthesis of water soluble CdS nanoparticles and study of their DNA damage activity

Directory of Open Access Journals (Sweden)

Kumar Suranjit Prasad

2017-05-01

Full Text Available This study reports a novel method for preparation of water soluble CdS nanoparticles using leaf extract of a plant, Asparagus racemosus. The extract of the leaf tissue which worked as a stabilizing and capping agent, assisted the formation of nanoparticles. Nanoparticles were characterized using a UV–vis spectrophotometer, Photoluminescence, TEM, EDAX, XRD and FT-IR. Transmission electron microscopy followed by selected area electron diffraction pattern analysis indicated the formation of spherical, polydispersed, crystalline, CdS of diameter ranging from 2 to 8 nm. X-ray diffraction studies showed the formation of 111, 220 and 311 planes of face-centered cubic (fcc CdS. EDAX analysis confirmed the presence of Cd and S in nanosphere. The cytotoxicity test using MTT assay as well as DNA damage analysis using comet assay revealed that synthesized nano CdS quantum dots (QDs caused less DNA damage and cell death of lymphocytes than pure CdS nanoparticles.

Preparation and Characterization of TiO2/CdS Layers as Potential Photoelectrocatalytic Materials

Directory of Open Access Journals (Sweden)

Teofil-Danut Silipas

2011-01-01

Full Text Available The TiO2/CdS semiconductor composites were prepared on
indium tin oxide (ITO substrates in di®erent mass proportions via wet-chemical techniques using bi-distilled water, acetyl-acetone, poly-propylene-glycol and Triton X-100 as additives. The composite layers were annealed in normal conditions at the temperature of 450±C, 120 min. with a rate of temperature increasing of 5±C/min. The structural and optical properties of all the TiO2/CdS ayers were characterized by X-ray di®raction, UV-VIS spectroscopy, spectrofluorimetry and FT/IR microscopy. The microstructural properties of the deposited TiO2/CdS layers can be modi¯ed by varying the mass proportions of TiO2:CdS. The good crystallinity level and the high optical adsorption of
the TiO2/CdS layers make them attractive for photoelectrochemical cell applications.

Structural and optical characterization of CdS nanorods synthesized by a PVA-assisted solvothermal method

International Nuclear Information System (INIS)

Wang Hongmei; Fang Pengfei; Chen Zhe; Wang Shaojie

2008-01-01

Cadmium sulphide (CdS) 1D nanocrystals were prepared using a simple poly(vinyl-alcohol) (PVA)-assisted solvothermal method which employed ethylenediamine (en) as solvent. The obtained nanorods were characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), ultraviolet-visible (UV-vis) absorption, and photoluminescence (PL) spectra. XRD results show that the nanorods are hexagonal phase. The TEM results indicate that the synthesized CdS nanorods with PVA-assisted showed larger aspect ratio and uniform faces compared with the sample prepared in the absence of PVA. The results of the photoluminescence and UV-vis spectroscopy measurements reveal that the as-prepared CdS nanorods show a quantum confinement effect. It is also found that the dosage of PVA is a vital factor in the morphology and optical properties of CdS nanorods. Moreover, when the best dosage of 3 g PVA/70 ml en was used, CdS nanorods with regular morphology and longer length were obtained. The probable mechanism for PVA-assisted solvothermal synthesis of CdS nanorods was also discussed

L1000CDS2: LINCS L1000 characteristic direction signatures search engine.

Science.gov (United States)

Duan, Qiaonan; Reid, St Patrick; Clark, Neil R; Wang, Zichen; Fernandez, Nicolas F; Rouillard, Andrew D; Readhead, Ben; Tritsch, Sarah R; Hodos, Rachel; Hafner, Marc; Niepel, Mario; Sorger, Peter K; Dudley, Joel T; Bavari, Sina; Panchal, Rekha G; Ma'ayan, Avi

2016-01-01

The library of integrated network-based cellular signatures (LINCS) L1000 data set currently comprises of over a million gene expression profiles of chemically perturbed human cell lines. Through unique several intrinsic and extrinsic benchmarking schemes, we demonstrate that processing the L1000 data with the characteristic direction (CD) method significantly improves signal to noise compared with the MODZ method currently used to compute L1000 signatures. The CD processed L1000 signatures are served through a state-of-the-art web-based search engine application called L1000CDS 2 . The L1000CDS 2 search engine provides prioritization of thousands of small-molecule signatures, and their pairwise combinations, predicted to either mimic or reverse an input gene expression signature using two methods. The L1000CDS 2 search engine also predicts drug targets for all the small molecules profiled by the L1000 assay that we processed. Targets are predicted by computing the cosine similarity between the L1000 small-molecule signatures and a large collection of signatures extracted from the gene expression omnibus (GEO) for single-gene perturbations in mammalian cells. We applied L1000CDS 2 to prioritize small molecules that are predicted to reverse expression in 670 disease signatures also extracted from GEO, and prioritized small molecules that can mimic expression of 22 endogenous ligand signatures profiled by the L1000 assay. As a case study, to further demonstrate the utility of L1000CDS 2 , we collected expression signatures from human cells infected with Ebola virus at 30, 60 and 120 min. Querying these signatures with L1000CDS 2 we identified kenpaullone, a GSK3B/CDK2 inhibitor that we show, in subsequent experiments, has a dose-dependent efficacy in inhibiting Ebola infection in vitro without causing cellular toxicity in human cell lines. In summary, the L1000CDS 2 tool can be applied in many biological and biomedical settings, while improving the extraction of

Enhanced photoelectrochemical properties of TiO2 nanorod arrays decorated with CdS nanoparticles

International Nuclear Information System (INIS)

Xie, Zheng; Wang, Weipeng; Liu, Can; Li, Zhengcao; Liu, Xiangxuan; Zhang, Zhengjun

2014-01-01

TiO 2 nanorod arrays (TiO 2 NRAs) sensitized with CdS nanoparticles were fabricated via successive ion layer adsorption and reaction (SILAR), and TiO 2 NRAs were obtained by oxidizing Ti NRAs obtained through oblique angle deposition. The TiO 2 NRAs decorated with CdS nanoparticles exhibited excellent photoelectrochemical and photocatalytic properties under visible light, and the one decorated with 20 SILAR cycles CdS nanoparticles shows the best performance. This can be attributed to the enhanced separation of electrons and holes by forming heterojunctions of CdS nanoparticles and TiO 2 NRAs. This provides a promising way to fabricate the material for solar energy conversion and wastewater degradation. (paper)

Literary reading and eating disorders: survey evidence of therapeutic help and harm.

Science.gov (United States)

Troscianko, Emily T

2018-01-01

There is growing evidence for the efficacy of self-help bibliotherapy as a treatment for eating disorders, although little understanding of how specific linguistic characteristics may enhance or constrain its effects. Meanwhile, 'creative bibliotherapy' (the therapeutic use of fiction, poetry, or sometimes film, rather than self-help books) is widely practised, but even more poorly understood than the self-help variety: although a range of theoretical models exist, claims of the healing power of literature are far more commonly made than tested. An online survey including quantitative (forced-choice) and qualitative (free-response) items was designed and administered in collaboration with the charity Beat to investigate the connections between respondents' reading habits and their mental health, with a focus on eating disorders, and attracted 885 respondents. Responses to two sequences of questions, exploring the differential effects of fiction about eating disorders versus respondents' preferred genre of other fiction on the dimensions of mood, self-esteem, feelings about one's body, and diet and exercise habits, were analysed using a 2 × 2 repeat measures factorial ANOVA design for each of the four dependent variables. Surprisingly, fiction about eating disorders was perceived by respondents as broadly detrimental to mood, self-esteem, feelings about their bodies, and diet and exercise habits, while respondents' preferred genre of other fiction was experienced as beneficial to mood and broadly neutral on the other three dimensions. The free-response data added detail to these core findings, as well as suggesting numerous other possible effects and mechanisms, drawing attention to the roles of positive and negative feedback structures and of highly selective interpretive filtering, and highlighting the dangers of 'self-triggering': using books to deliberately exacerbate an eating disorder. The findings directly challenge existing theoretical models of

Photovoltaic performance enhancement of CdS quantum dot-sensitized TiO2 photoanodes with plasmonic gold nanoparticles

International Nuclear Information System (INIS)

Liu, Aiping; Ren, Qinghua; Zhao, Ming; Xu, Tao; Yuan, Ming; Zhao, Tingyu; Tang, Weihua

2014-01-01

Highlights: • CdS QD-sensitized TiO 2 porous photoanode with plasmonic gold. • A prominent light absorption enhancement of hybrid was attained by gold plasmon. • The photovoltaic response of hybrid was tunable by CdS amount. • The Au/TiO 2 /CdS hybrid had a potential application in energy conversion devices. -- Abstract: The CdS quantum dot-sensitized TiO 2 films with plasmonic gold nanoparticles were designed as photoanodes by the electrodeposition of gold combined with the “successive ionic layer adsorption and reaction” (SILAR) method for CdS deposition on porous TiO 2 films. A prominent enhancement in light absorption of Au/TiO 2 /CdS hybrid was attained by efficient light scattering of gold plasmons as sub-wavelength antennas and concentrators. The photogenerated electron formed in the near-surface region of TiO 2 and CdS were facilitated to transfer to the plasmonic gold, resulting in the enhancement of photocurrent and incident photon-to-current conversion efficiency of hybrid photoanode upon photoirradiation. Furthermore, the photovoltaic response of hybrid was highly tunable with respect to the number of SILAR cycles applied to deposit CdS. The thicker absorber layer with less porous structure and larger CdS crystals might limit the electrolyte diffusion into the hybrid electrode and impose a barrier for electron tunneling and transferring. The highly versatile and tunable properties of Au/TiO 2 /CdS photoanodes demonstrated their potential application in energy conversion devices

Anodic stripping voltammetry of synthesized CdS nanoparticles at boron-doped diamond electrodes

Energy Technology Data Exchange (ETDEWEB)

Hayat, Mohammad; Ivandini, Tribidasari A., E-mail: ivandini.tri@sci.ui.ac.id; Saepudin, Endang [Department of Chemistry, FMIPA, Universitas Indonesia, Kampus UI Depok (Indonesia); Einaga, Yasuaki [Department of Chemistry, Keio University (Japan)

2016-04-19

Cadmium sulphide (CdS) nanoparticles were chemically synthesized using reverse micelles microreactor methods. By using different washing treatments, UV-Vis spectroscopy showed that the absorption peaks appeared at 465 nm, 462 nm, 460 nm, and 459 nm respectively for CdS nanoparticles without and with 1, 2, and 3 times washing treatments using pure water. In comparison with the absorbance peak of bulk CdS at 512 nm, the shifted absorption peaks, indicates that the different sizes of CdS can be prepared. Anodic stripping voltammetry of the CdS nanoparticles was then studied at a boron-doped diamond electrode using 0.1 M KClO{sub 4} and 0.1 M HClO{sub 4} as the electrolytes. A scan rate of 100 mV/s with a deposition potential of -1000 mV (vs. Ag/AgCl) for 60 s at a potential scan from -1600 mV to +800 mV (vs. Ag/AgCl) was applied as the optimum condition of the measurements. Highly-accurate linear calibration curves (R{sup 2} = 0.99) in 0.1 M HClO{sub 4} with the sensitivity of 0.075 mA/mM and the limit of detection of 81 µM in 0.1 M HClO{sub 4} can be achieved, which is promising for an application of CdS nanoparticles as a label for biosensors.

Size-dependent photodegradation of CdS particles deposited onto TiO2 mesoporous films by SILAR method

International Nuclear Information System (INIS)

Ahmed, Rasin; Will, Geoffrey; Bell, John; Wang Hongxia

2012-01-01

The particle size, size distribution and photostability of CdS nanoparticles incorporated onto mesoporous TiO 2 films by a successive ionic layer adsorption and reaction (SILAR) method were investigated by Raman spectroscopy, UV–Visible spectroscopy, transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS). High-resolution TEM indicated that the synthesized CdS particles were hexagonal phase and the particle sizes were less than 5 nm for up to nine SILAR deposition cycles. Quantum size effect was found with the CdS-sensitized TiO 2 films prepared with up to nine SILAR cycles. The band gap of CdS nanoparticles decreased from 2.65 to 2.37 eV with the increase of the SILAR cycles from 1 to 11. The investigation of the stability of the CdS/TiO 2 films in air under illumination (440.6 μW/cm 2 ) showed that the photodegradation rate was up to 85 % per day for the sample prepared with three SILAR cycles. XPS analysis indicated that the photodegradation was due to the oxidation of CdS, leading to the transformation from sulphide to sulphate (CdSO 4 ). Furthermore, the degradation rate was strongly dependent upon the particle size of CdS. Smaller particles showed faster degradation rate. The size-dependent photo-induced oxidization was rationalized with the variation of size-dependent distribution of surface atoms of CdS particles. Molecular dynamics-based theoretical calculation has indicated that the surface sulphide anion of a large CdS particle such as CdS made with 11 cycles (CdS × 11, average particle size = 5.6 nm) accounts for 9.6 % of the material whereas this value is increased to 19.2 % for (CdS × 3)-based smaller particles (average particle size = 2.7 nm). The photostability of CdS nanoparticles was significantly enhanced when coated with ZnS particles deposited with four SILAR cycles. The growth mechanism of ZnS upon CdS nanoparticles was discussed.

Intrapersonal Resources and the Effectiveness of Self-Help Groups for Bereaved Older Adults.

Science.gov (United States)

Caserta, Michael S.; Lund, Dale A.

1993-01-01

Examined relative impact of 3 intrapersonal resources (self-esteem, competencies, and life satisfaction) and duration of self-help group intervention on levels of depression and grief over time among 295 recently widowed adults. Found that, in general, resources examined had greater direct influence on outcomes than did intervention. (Author/NB)

Gender, Self-Stigma, and Public Stigma in Predicting Attitudes toward Psychological Help-Seeking

Science.gov (United States)

Topkaya, Nursel

2014-01-01

Using a sample of university students (N = 362), the role of gender and both the self-stigma and public stigma associated with one's decision to seek psychological help in predicting attitudes toward psychological helpseeking were examined. Moreover, gender differences regarding both the self-stigma and the public stigma associated with…

A 256×256 low-light-level CMOS imaging sensor with digital CDS

Science.gov (United States)

Zou, Mei; Chen, Nan; Zhong, Shengyou; Li, Zhengfen; Zhang, Jicun; Yao, Li-bin

2016-10-01

In order to achieve high sensitivity for low-light-level CMOS image sensors (CIS), a capacitive transimpedance amplifier (CTIA) pixel circuit with a small integration capacitor is used. As the pixel and the column area are highly constrained, it is difficult to achieve analog correlated double sampling (CDS) to remove the noise for low-light-level CIS. So a digital CDS is adopted, which realizes the subtraction algorithm between the reset signal and pixel signal off-chip. The pixel reset noise and part of the column fixed-pattern noise (FPN) can be greatly reduced. A 256×256 CIS with CTIA array and digital CDS is implemented in the 0.35μm CMOS technology. The chip size is 7.7mm×6.75mm, and the pixel size is 15μm×15μm with a fill factor of 20.6%. The measured pixel noise is 24LSB with digital CDS in RMS value at dark condition, which shows 7.8× reduction compared to the image sensor without digital CDS. Running at 7fps, this low-light-level CIS can capture recognizable images with the illumination down to 0.1lux.

Observation of melting in 30 angstrom diameter CdS nanocrystals

International Nuclear Information System (INIS)

Goldstein, A.N.; Colvin, V.L.; Alivisatos, A.P.

1991-01-01

In this paper temperature dependent electron diffraction studies on 30 Angstrom diameter CdS nanocrystals are described. The linear thermal expansion coefficient of the nanocrystals is 2.75 * 10 -5 Angstrom/K, and the melting point is 575 K. These data are in contrast to bulk CdS which has a melting point of 1750 K and a linear expansion coefficient of 5.5 * 10 -6 Angstrom/K. The observed depression in the melting point of these semiconductor clusters is similar to effects observed in metals and molecular crystals, indicating that the phenomenon of reduced melting point in small systems is a general one regardless of the type of material. The observation of melting point depression in these clusters also has far reaching implications for the preparation of highly crystalline clusters of CdS, as well as for the use of these nanocrystals as precursors to thin films

Preliminary Results from Coordinated UVCS-CDS-Ulysses Observations

Science.gov (United States)

Parenti, S.; Bromage, B. J.; Poletto, G.; Suess, S. T.; Raymond, J. C.; Noci, G.; Bromage, G. E.; Rose, M. Franklin (Technical Monitor)

2001-01-01

The June 2000 quadrature between the Sun, Earth, and Ulysses took place with Ulysses at a distance of 3.35 AU from the Sun and at heliocentric latitude 58.2 deg south, in the southeast quadrant. This provided an opportunity to observe the corona close to the Sun with Coronal Diagnostic Spectrometer (CDS) and Ultraviolet Coronograph Spectrometer (UVCS) and, subsequently, to sample the same plasma when it reached Ulysses. Here we focus on simultaneous observations of UVCS and CDS made on June 12, 13, 16 and 17. The UVCS data were acquired at heliocentric altitudes ranging from 1.6 to 2.2 solar radii, using different grating positions, in order to get a wide wavelength range. CDS data consisted of Normal Incidence Spectrometer (NIS) full wavelength rasters of 120" x 150" centered at altitudes up to 1.18 solar radii, together with Grazing Incidence Spectrometer (GIS) 4" x 4" rasters within the same field of view, out to 1.2 solar radii. The radial direction to Ulysses passed through a high latitude streamer, throughout the 4 days of observations, Analysis of the spectra taken by UVCS shows a variation of the element abundances in the streamer over our observing interval: however, because the observations were in slightly different parts of the streamer on different days, the variation could be ascribed either to a temporal or spatial effect. The oxygen abundance, however, seems to increase at the edge of the streamer, as indicated by previous analyses. This suggests the variation may be a function of position within the streamer, rather than a temporal effect. Oxygen abundances measured by SWICS on Ulysses are compared with the CDS and UVCS results to see whether changes measured in situ follow the same pattern.

Electronic and optical properties of CdS films deposited by evaporation

Energy Technology Data Exchange (ETDEWEB)

Huang, L.; Wei, Z.L.; Zhang, F.M.; Wu, X.S., E-mail: xswu@nju.edu.cn

2015-11-05

CdS films grown by thermal evaporation on glass substrate under ultra-high vacuum are prepared with varying the growth temperature and atmosphere environment. The minimum resistivity of the films is as low as 2.0 Ω·cm, and the carrier density even reaches 1.6 × 10{sup 18} cm{sup −3}, which is much less than that prepared by the chemical bath deposition (CBD) method. The transmittance and band gap increase with the set the argon atmosphere and the growth temperature in the optimum value. Our results indicate the CdS films grown by evaporation at high vacuum may be more suitable for the application in optoelectronic devices, such as the solar cell materials. - Highlights: • CdS films are grown by the ultra-high vacuum evaporation. • CdS film here with the high carrier density reaches to 10{sup 18} cm{sup −3} is obtained. • The film has low resistivity, which is as low as 2 Ω∙ cm. • The optical band gap become wider from 2.42 eV to 2.54 eV.

BI Reporting, Data Warehouse Systems, and Beyond. CDS Spotlight Report. Research Bulletin

Science.gov (United States)

Lang, Leah; Pirani, Judith A.

2014-01-01

This Spotlight focuses on data from the 2013 Core Data Service [CDS] to better understand how higher education institutions approach business intelligence (BI) reporting and data warehouse systems (see the Sidebar for definitions). Information provided for this Spotlight was derived from Module 8 of CDS, which contains several questions regarding…

The Progress of Students Reading Comprehension through Wordless Picture Books

Directory of Open Access Journals (Sweden)

Romaida Lubis

2018-02-01

Full Text Available Wordless picture book is an unique book that could help the young learner to get their literacy. The content of the wordless picture book must be communicated through the visual of the illustration. This research discusses a case study of how a kid of six years old produce his narrative through wordless picture book. The kid allowed to see and say on the page and then write the words that he has mentioned. Practicing to read repeatedly which increase fluency will improve his reading comprehension and written expression. This research was conducted to make better understand about the sense - making process that happen when a child works with the wordless picture book. Most sentences or texts were made based on the references and experience from daily life either explicitly or implicitly. In reading wordless book, readers faced the variety of visual signs. These sign systems help reader form a type of framework that show their interpretation of the text and helps them build construction of the story. The researcher wanted to make the reader understand better about the strategies that the child use to make sense of wordless text. The reason of this study is to help how a six year old nonreader would give interpretation to visual cues in wordless picture books. Transacting with the visual text in the books helped the child to make sense of the stories. The data were analyzed based on the principles of qualitative content analysis that involve a systematic review of the data, coding, category construction and analysis. The result of this research is the wordless picture books give opportunity to the children to create the story on their own and to bring in their own understanding of the world to the text.

MacBook Pro Portable Genius

CERN Document Server

Miser, Brad

2011-01-01

Tips and techniques for forward-thinking MacBook Pro users Now that you have a MacBook Pro, you need just one more accessory, your very own copy of MacBook Pro Portable Genius, Third Edition. This handy, compact book lets you in on a wealth of tips and tricks, so you get the very most out of Apple's very popular notebook. Discover the latest on the most recent release of iLife, get the skinny on the new Intel Core i7 and i5 processors in the Pro, see how to go wireless in a smart way, and much more. The book is easy to navigate, doesn't skimp on the essentials, and helps you save time and avoi

MacBook All-in-One For Dummies

CERN Document Server

Chambers, Mark L

2011-01-01

Get comfortable and confident with your MacBook! Combining the fun-but-straightforward content of nine minibooks, this new edition of MacBook All-in-One For Dummies delivers helpful coverage of the rich features and essential tools you need to know to use the MacBook to its fullest potential. You'll learn an array of MacBook basics while veteran author Mark Chambers walks you through setting up your MacBook, running programs, finding files with Finder, searching with Spotlight, keeping track with Address Book, enjoying music with iTunes, creating cool multimedia projects with iLife, and more.

Weekly brief phone support in self-help cognitive behavioral therapy for insomnia disorder: Relevance to adherence and efficacy.

Science.gov (United States)

Ho, Fiona Yan-Yee; Chung, Ka-Fai; Yeung, Wing-Fai; Ng, Tommy Ho-Yee; Cheng, Sammy Kin-Wing

2014-12-01

Self-help cognitive-behavioral therapy for insomnia (CBT-I) is an acceptable, low-intensity treatment in a stepped care model for insomnia. We tested the application of self-help CBT-I in a Chinese population. 312 participants with self-report of insomnia associated with distress or daytime impairment 3 or more nights per week for at least 3 months were randomized to self-help CBT-I with telephone support (SHS), self-help CBT-I (SH) and waiting-list (WL). The program was Internet-based with treatment materials delivered once per week, and lasted for 6 consecutive weeks, while the telephone support was limited to 15 min weekly. Mixed-effects analyses found significant group by time interaction in sleep and sleep-related cognitions at immediate and 4-week posttreatment. Post-hoc pairwise comparison with WL revealed that both SHS and SH had significantly higher sleep efficiency at immediate (p = .004 and p = .03, respectively) and 4-week posttreatment (p = .002 and p = .02, respectively) and lower insomnia and dysfunctional beliefs scores. The SHS group had additional improvements in sleep onset latency and sleep quality. Benefits with self-help CBT-I were maintained at 12-week posttreatment, but attrition rate was about 35%. Internet-based self-help CBT-I was effective and acceptable for treating insomnia in the Chinese population. A brief telephone support further enhanced the efficacy. Copyright © 2014 Elsevier Ltd. All rights reserved.

Padres Maltratadores: Grupos de Autoayuda (Abusive Parents: Self-Help Groups).

Science.gov (United States)

Intebi, Irene V.; Groisman, Adriana E.

1991-01-01

Causes of child abuse by parents are discussed. A therapy program in Buenos Aires (Argentina) for abusive parents is described. The program utilizes self-help groups as part of the therapeutic plan and has found them to be promising. Referral, types of interactions with the groups, and short-, medium-, and long-term objectives are discussed. (BRM)

MacBook Pro portable genius

CERN Document Server

Gruman, Galen

2013-01-01

Learn the skills, tools and shortcuts you need in order to make the most of your MacBook Pro This easy-to-use, compact guide skips the fluff and gets right to the essentials so that you can maximize all the latest features of the MacBook Pro. Packed with savvy insights and tips on key tools and shortcuts, this handy book aims to help you increase your productivity and save you time and hassle. From desktop sharing and wireless networking to running Windows applications and more, this book shows you what you want to know. Includes the latest version of OS X, iCloud, FaceTime, and moreCovers al

Book Review: It's Not You, It's the Dishes: How to Minimize Conflict and Maximize Happiness in Your Relationship

Directory of Open Access Journals (Sweden)

Derek Lawson

2014-08-01

Full Text Available It’s Not You, It’s The Dishes brings economic principles and theory into the married life of couples. The authors simplify economics by providing fundamental concepts while removing technical jargon in a funny, yet intuitive way. Readers are introduced to the basics of comparative advantage, game theory, and eight other economic principles, all while learning lessons on how to resourcefully allocate their limited units of time, money, and energy to yield a better return on their biggest investment of their lives, their marriage. At its core, this is a self-help book aimed at married couples. Nevertheless, financial professionals and academics may benefit from reading the book, particularly because it may be beneficial helping to brainstorm potential solutions with their clients or as “homework” for client couples.

Development and Pilot Testing of an Internet-Based Self-Help Intervention for Depression for Indian Users

Directory of Open Access Journals (Sweden)

Seema Mehrotra

2018-03-01

Full Text Available There is a dearth of published research on uptake and utility of mental health apps in India, despite a rising global trend in the application of technology in the field of mental health. We describe the development and pilot testing of a self-help intervention for depression, PUSH-D (Practice and Use Self-Help for Depression for urban Indians. This guided self-help app, with essential and optional zone sections, was developed to provide a comprehensive coverage of therapeutic strategies drawn from cognitive behavior therapy, interpersonal therapy, supportive psychotherapy, and positive psychology. Pilot testing was carried out using a single group pre-, post- and follow-up design in 78 eligible participants. Participants were typically young adults with major depression or dysthymia and significant impairment in functioning. Almost two-thirds of the participants had never sought professional mental health help. Significant reductions in depression and improvement in the functioning and well-being were notedon standardized measures in participants completing all 10 essential zone sections. These gains were maintained at follow-up. The results were similar for partial completers, who completed fiveout of the 10 essential sections. PUSH-D is one of the first indigenously developed self-help apps for depression and it shows promise in reducing the treatment gap for depression in India.

Development and Pilot Testing of an Internet-Based Self-Help Intervention for Depression for Indian Users.

Science.gov (United States)

Mehrotra, Seema; Sudhir, Paulomi; Rao, Girish; Thirthalli, Jagadisha; Srikanth, T K

2018-03-22

There is a dearth of published research on uptake and utility of mental health apps in India, despite a rising global trend in the application of technology in the field of mental health. We describe the development and pilot testing of a self-help intervention for depression, PUSH-D (Practice and Use Self-Help for Depression) for urban Indians. This guided self-help app, with essential and optional zone sections, was developed to provide a comprehensive coverage of therapeutic strategies drawn from cognitive behavior therapy, interpersonal therapy, supportive psychotherapy, and positive psychology. Pilot testing was carried out using a single group pre-, post- and follow-up design in 78 eligible participants. Participants were typically young adults with major depression or dysthymia and significant impairment in functioning. Almost two-thirds of the participants had never sought professional mental health help. Significant reductions in depression and improvement in the functioning and well-being were notedon standardized measures in participants completing all 10 essential zone sections. These gains were maintained at follow-up. The results were similar for partial completers, who completed fiveout of the 10 essential sections. PUSH-D is one of the first indigenously developed self-help apps for depression and it shows promise in reducing the treatment gap for depression in India.

Effectiveness of a web-based self-help smoking cessation intervention: protocol of a randomised controlled trial

Directory of Open Access Journals (Sweden)

Brunsting Suzanne

2009-01-01

Full Text Available Abstract Background Cigarette smoking is a major risk factor for many chronic and fatal illnesses. Stopping smoking directly reduces those risks. The aim of this study is to investigate the effectiveness of a web-based interactive self-help programme for smoking cessation, known as the StopSite, by comparing it to an online self-help guide. Both interventions were based on cognitive-behavioural and self-control principles, but the former provided exercises, feedback and interactive features such as one-to-one chatrooms and a user forum, which facilitated mutual support and experience sharing. Methods and design We conducted a randomised controlled trial to compare the interactive intervention with the self-help guide. The primary outcome measure was prolonged abstinence from smoking. Secondary outcomes were point-prevalence abstinence, number of cigarettes smoked, and incidence of quit attempts reported at follow-up assessments. Follow-up assessments took place three and six months after a one-month grace period for starting the intervention after baseline. Analyses were based on intention-to-treat principles using a conservative imputation method for missing data, whereby non-responders were classified as smokers. Discussion The trial should add to the body of knowledge on the effectiveness of web-based self-help smoking cessation interventions. Effective web-based programmes can potentially help large numbers of smokers to quit, thus having a major public health impact. Trial registration ISRCTN74423766

76 FR 79729 - Self-Regulatory Organizations; ICE Clear Credit LLC; Order Approving Proposed Rule Change To...

Science.gov (United States)

2011-12-22

... plc as signatories. II. Self-Regulatory Organization's Statement of the Terms of Substance of the... is the recognition that CDS contracts cleared by ICC referencing broad-based securities indices are... would, among other things, decompose CDS contracts referencing broad-based [[Page 79730

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >1e79I 1 47 1 47 1e-07 ... pdb|1E79|I Chain I, Bovine F1-Atpase Inhibite...d By Dccd ... (Dicyclohexylcarbodiimide) pdb|1H8E|I Chain I, ... (Adp.Alf4)2(Adp.So4) Bovine F1-Atpase

Effect of annealing time on optical and electrical properties of CdS thin films

Science.gov (United States)

Soliya, Vanshika; Tandel, Digisha; Patel, Chandani; Patel, Kinjal

2018-05-01

Cadmium sulphide (CdS) is semiconductor compound of II-VI group. Thin film of CdS widely used in the applications such as, a buffer layer in copper indium diselenide (CIS) hetrojunction based solar cells, transistors, photo detectors and light emitting diodes. Because of the ease of making like chemical bath deposition (CBD), screen printing and thermal evaporation. It is extensively used in the CIS based solar cells as a buffer layers. The buffer layers usually used for reducing the interface recombination of the photo generated carriers by means of improving the lattice mismatch between the layers. The optimum thickness and the optoelectronics properties of CdS thin films like, optical band gap, electrical resistivity, structure, and composition etc., are to be considering for its use as a buffer layer. In the present study the CdS thin film were grown by simple dip coating method. In this method we had prepared 0.1M Cadmium-thiourea precursor solution. Before the deposition process of CdS, glass substrate has been cleaned using Methanol, Acetone, Trichloroethylene and De-ionized (DI) water. After coating of precursor layer, it was heated at 200 °C for themolysis. Then after CdS films were annealed at 200 °C for different time and studied its influence on the optical transmission, band gap, XRD, raman and the electrical resistivity. As increasing the annealing time we had observed the average transmission of the films was reduce after the absorption edge. In addition to the blue shift of absorption edge was observed. The observed optimum band gap was around 2.50 eV. XRD and raman analysis confirms the cubuc phase of CdS. Hot probe method confirms the n-type conductivity of the CdS film. Hall probe data shows the resistivity of the films was in the order of 103 Ωcm. Observed data signifies its future use in the many optoelectronics devices.

CdS loaded on coal based activated carbon nanofibers with enhanced photocatalytic property

Science.gov (United States)

Guo, Jixi; Guo, Mingxi; Jia, Dianzeng; Song, Xianli; Tong, Fenglian

2016-08-01

The coal based activated carbon nanofibers (CBACFs) were prepared by electrospinning a mixture of polyacrylonitrile (PAN) and acid treated coal. Cadmium sulfide (CdS) nanoparticles loaded on CBACFs were fabricated by solvothermal method. The obtained samples were characterized by FESEM, TEM, and XRD. The results reveal that the CdS nanoparticles are homogeneously dispersed on the surfaces of CBACFs. The CdS/CBACFs nanocomposites exhibited higher photoactivity for photodegradation of methyl blue (MB) under visible light irradiation than pure CdS nanoparticles. CBACFs can be used as low cost support materials for the preparation of nanocomposites with high photocatalytic activity.

New Software to Help EFL Students Self-Correct Their Writing

Science.gov (United States)

Lawley, Jim

2015-01-01

This paper describes the development of web-based software at a university in Spain to help students of EFL self-correct their free-form writing. The software makes use of an eighty-million-word corpus of English known to be correct as a normative corpus for error correction purposes. It was discovered that bigrams (two-word combinations of words)…

Preparation of flower-like CdS with SDBS as surfactant by hydrothermal method and its optical properties

Energy Technology Data Exchange (ETDEWEB)

Wang, Yongqian, E-mail: cugwyq@126.com [Faculty of Material Science and Chemistry, China University of Geosciences, Wuhan 430074 (China); Yang, Xiande; Ma, Qun; Kong, Junhan; Jia, Hanxiang; Wang, Zhengshu [Faculty of Material Science and Chemistry, China University of Geosciences, Wuhan 430074 (China); Yu, Meihua [School of Materials Science and Engineering, Guangxi University, Nanning 530004 (China)

2015-06-15

Graphical abstract: FESEM image of the CdS obtained by 0.01 mol Cd(NO{sub 3}){sub 2}·4H{sub 2}O, 0.03 mol thiourea and 0.5 g SDBS at 160 °C for 24 h. - Highlights: • The role of SDBS is to assemble CdS crystals together to form flower-like structures. • Both reaction time and temperature affect the morphology of flower-like structures. • The growth mechanism of flower-like structures is reasonable, clear and concise. • Its optical energy band gap is 2.50 eV, and it has absorption in visible region. • PL result of flower-like structures shows the max emission wavelength is 508.6 nm. - Abstract: In this article, the flower-like CdS have been prepared by hydrothermal method with thiourea as sulfur source and SDBS as surfactant. The effects of different experimental conditions on the morphology of CdS have been investigated. The performances of CdS have been analyzed by X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM), room temperature photoluminescence (PL) and UV–vis. The result of XRD indicates that CdS we prepared are highly crystallized, which are of hexagonal phase. The FE-SEM results indicate that the main role of SDBS is to make the CdS crystals assemble together to form the flower-like structures, and the reaction time affects the morphology of CdS, and the suitable reaction temperature is 160 °C. Its optical energy band gap is observed at 2.50 eV. The fluorescence spectrum shows that the flower-like CdS have a broad absorption peak and the max emission wavelength is 508.6 nm. The growth mechanism for the formation of CdS with flower-like structures is also described.

Hydrothermal synthesis of CdS nanoparticle/functionalized graphene sheet nanocomposites for visible-light photocatalytic degradation of methyl orange

International Nuclear Information System (INIS)

Yan, Shancheng; Wang, Bojun; Shi, Yi; Yang, Fan; Hu, Dong; Xu, Xin; Wu, Jiansheng

2013-01-01

CdS nanoparticle/functionalized graphene sheet (CdS NP/FGS) nanocomposites were successfully prepared in a one-step hydrothermal synthesis route. The samples were characterized by field emission scanning electron microscopy, transmission electron microscopy, X-ray diffraction, X-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy, photoluminescence spectroscopy, and Raman spectroscopy. In addition, the photocatalytic performance of CdS NP/FGS composites and pure CdS in the degradation of methyl orange (MO) was examined using visible light. Results show that the addition of FGS can enhance the photocatalytic performance of CdS NP/FGS composites with a maximum degradation efficiency of 98.1% under visible light irradiation as compared with pure CdS (60.1%). This finding can be attributed to three reasons. First is the strong redox ability of CdS in the nanocomposite with smaller crystal size. Second is the increase in specific surface area for more adsorbed MO. Third is the reduction in electron–hole pair recombination with the introduction of FGS. Based on their high photocatalytic activity, the CdS NP/FGS composites can be expected to be a practical visible light photocatalyst.

Hydrothermal synthesis of CdS nanoparticle/functionalized graphene sheet nanocomposites for visible-light photocatalytic degradation of methyl orange

Energy Technology Data Exchange (ETDEWEB)

Yan, Shancheng, E-mail: yansc@njupt.edu.cn [School of Geography and Biological Information, Nanjing University of Posts and Telecommunications, Nanjing 210046 (China); National Laboratory of Solid State Microstructures, School of Electronic Science and Engineering, Nanjing University, Nanjing 210093 (China); Wang, Bojun [School of Geography and Biological Information, Nanjing University of Posts and Telecommunications, Nanjing 210046 (China); Shi, Yi [National Laboratory of Solid State Microstructures, School of Electronic Science and Engineering, Nanjing University, Nanjing 210093 (China); Yang, Fan; Hu, Dong; Xu, Xin; Wu, Jiansheng [School of Geography and Biological Information, Nanjing University of Posts and Telecommunications, Nanjing 210046 (China)

2013-11-15

CdS nanoparticle/functionalized graphene sheet (CdS NP/FGS) nanocomposites were successfully prepared in a one-step hydrothermal synthesis route. The samples were characterized by field emission scanning electron microscopy, transmission electron microscopy, X-ray diffraction, X-ray photoelectron spectroscopy, Fourier transform infrared spectroscopy, photoluminescence spectroscopy, and Raman spectroscopy. In addition, the photocatalytic performance of CdS NP/FGS composites and pure CdS in the degradation of methyl orange (MO) was examined using visible light. Results show that the addition of FGS can enhance the photocatalytic performance of CdS NP/FGS composites with a maximum degradation efficiency of 98.1% under visible light irradiation as compared with pure CdS (60.1%). This finding can be attributed to three reasons. First is the strong redox ability of CdS in the nanocomposite with smaller crystal size. Second is the increase in specific surface area for more adsorbed MO. Third is the reduction in electron–hole pair recombination with the introduction of FGS. Based on their high photocatalytic activity, the CdS NP/FGS composites can be expected to be a practical visible light photocatalyst.

Formation of CdS nanoparticles using starch as capping agent

Energy Technology Data Exchange (ETDEWEB)

Rodriguez, P. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion 11500, Mexico D.F. (Mexico); Munoz-Aguirre, N. [Seccion de Estudios de Posgrado e Investigacion, ESIME-IPN Azcapotzalco, Av. Las Granjas 682, Col. Santa Catarina, 02550 Mexico D.F. (Mexico); Martinez, E. San-Martin [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada-IPN, Legaria 694, Col. Irrigacion 11500, Mexico D.F. (Mexico); Seccion de Estudios de Posgrado e Investigacion, ESIME-IPN Azcapotzalco, Av. Las Granjas 682, Col. Santa Catarina, 02550 Mexico D.F. (Mexico); Departamento de Fisica, CINVESTAV-IPN, Apartado Postal 14-740, 07000 Mexico D.F. (Mexico); Gonzalez, G. [Departamento de Fisica, CINVESTAV-IPN, Apartado Postal 14-740, 07000 Mexico D.F. (Mexico)], E-mail: bato@fis.cinvestav.mx; Zelaya, O.; Mendoza, J. [Departamento de Fisica, CINVESTAV-IPN, Apartado Postal 14-740, 07000 Mexico D.F. (Mexico)

2008-11-30

CdS nanoparticles have been synthesized using starch as capping agent in aqueous solution. The morphology and crystalline structure of such samples were measured by high-resolution transmission electron microscopy and X-ray diffraction, respectively. The average grain size of the nanoparticles determined by these techniques was of the order of 5 nm. Photoluminescence of CdS nanoparticles shows a strong emission peak below to the band gap bulk semiconductor attributed to center trap states, also the broadening peak was interpreted in terms of electron-phonon interaction.

The structure of social exchange in self-help support groups: development of a measure.

Science.gov (United States)

Brown, Louis D; Tang, Xiaohui; Hollman, Ruth L

2014-03-01

Self-help support groups are indigenous community resources designed to help people manage a variety of personal challenges, from alcohol abuse to xeroderma pigmentosum. The social exchanges that occur during group meetings are central to understanding how people benefit from participation. This paper examines the different types of social exchange behaviors that occur during meetings, using two studies to develop empirically distinct scales that reliably measure theoretically important types of exchange. Resource theory informed the initial measurement development efforts. Exploratory factor analyses from the first study led to revisions in the factor structure of the social exchange scales. The revised measure captured the exchange of emotional support, experiential information, humor, unwanted behaviors, and exchanges outside meetings. Confirmatory factor analyses from a follow-up study with a different sample of self-help support groups provided good model fit, suggesting the revised structure accurately represented the data. Further, the scales demonstrated good convergent and discriminant validity with related constructs. Future research can use the scales to identify aspects of social exchange that are most important in improving health outcomes among self-help support group participants. Groups can use the scales in practice to celebrate strengths and address weaknesses in their social exchange dynamics.

Photovoltaic performance enhancement of CdS quantum dot-sensitized TiO{sub 2} photoanodes with plasmonic gold nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Liu, Aiping, E-mail: liuaiping1979@gmail.com [Center for Optoelectronics Materials and Devices, Zhejiang Sci-Tech University, Hangzhou 310018 (China); State Key Laboratory of Silicon Materials, Zhejiang University, Hangzhou 310027 (China); Ren, Qinghua; Zhao, Ming; Xu, Tao; Yuan, Ming; Zhao, Tingyu [Center for Optoelectronics Materials and Devices, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Tang, Weihua [State Key Laboratory of Information Photonics and Optical Communication, Beijing University Posts and Telecommunications, Beijing 100876 (China)

2014-03-15

Highlights: • CdS QD-sensitized TiO{sub 2} porous photoanode with plasmonic gold. • A prominent light absorption enhancement of hybrid was attained by gold plasmon. • The photovoltaic response of hybrid was tunable by CdS amount. • The Au/TiO{sub 2}/CdS hybrid had a potential application in energy conversion devices. -- Abstract: The CdS quantum dot-sensitized TiO{sub 2} films with plasmonic gold nanoparticles were designed as photoanodes by the electrodeposition of gold combined with the “successive ionic layer adsorption and reaction” (SILAR) method for CdS deposition on porous TiO{sub 2} films. A prominent enhancement in light absorption of Au/TiO{sub 2}/CdS hybrid was attained by efficient light scattering of gold plasmons as sub-wavelength antennas and concentrators. The photogenerated electron formed in the near-surface region of TiO{sub 2} and CdS were facilitated to transfer to the plasmonic gold, resulting in the enhancement of photocurrent and incident photon-to-current conversion efficiency of hybrid photoanode upon photoirradiation. Furthermore, the photovoltaic response of hybrid was highly tunable with respect to the number of SILAR cycles applied to deposit CdS. The thicker absorber layer with less porous structure and larger CdS crystals might limit the electrolyte diffusion into the hybrid electrode and impose a barrier for electron tunneling and transferring. The highly versatile and tunable properties of Au/TiO{sub 2}/CdS photoanodes demonstrated their potential application in energy conversion devices.

Novel patterning of CdS / CdTe thin film with back contacts for photovoltaic application

Science.gov (United States)

Ilango, Murugaiya Sridar; Ramasesha, Sheela K.

2018-04-01

The heterostructure of patterned CdS / CdTe thin films with back contact have been devised with electron beam lithography and fabricated using sputter deposition technique. The metallic contacts for n-CdS and p-CdTe are patterned such that both are placed at the bottom of the cell. This avoids losses due to contact shading and increases absorption in the window layer. Patterning of the device surface helps in increasing the junction area which can modulate the absorption of more number of photons due to total internal reflection. Computing the surface area between a planar and a patterned device has revealed 133% increase in the junction area. The physical and optical properties of the sputter-deposited CdS / CdTe layers are also presented. J- V characteristics of the solar cell showed the fill factor to be 25.9%, open circuit voltage to be 17 mV and short-circuit current density to be 113.68 A/m2. The increase in surface area is directly related to the increase in the short circuit current of the photovoltaic cell, which is observed from the results of simulated model in Atlas / Silvaco.

Size-dependent photodegradation of CdS particles deposited onto TiO{sub 2} mesoporous films by SILAR method

Energy Technology Data Exchange (ETDEWEB)

Ahmed, Rasin; Will, Geoffrey; Bell, John; Wang Hongxia, E-mail: hx.wang@qut.edu.au [Queensland University of Technology, School of Chemistry, Physics and Mechanical Engineering (Australia)

2012-09-15

The particle size, size distribution and photostability of CdS nanoparticles incorporated onto mesoporous TiO{sub 2} films by a successive ionic layer adsorption and reaction (SILAR) method were investigated by Raman spectroscopy, UV-Visible spectroscopy, transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS). High-resolution TEM indicated that the synthesized CdS particles were hexagonal phase and the particle sizes were less than 5 nm for up to nine SILAR deposition cycles. Quantum size effect was found with the CdS-sensitized TiO{sub 2} films prepared with up to nine SILAR cycles. The band gap of CdS nanoparticles decreased from 2.65 to 2.37 eV with the increase of the SILAR cycles from 1 to 11. The investigation of the stability of the CdS/TiO{sub 2} films in air under illumination (440.6 {mu}W/cm{sup 2}) showed that the photodegradation rate was up to 85 % per day for the sample prepared with three SILAR cycles. XPS analysis indicated that the photodegradation was due to the oxidation of CdS, leading to the transformation from sulphide to sulphate (CdSO{sub 4}). Furthermore, the degradation rate was strongly dependent upon the particle size of CdS. Smaller particles showed faster degradation rate. The size-dependent photo-induced oxidization was rationalized with the variation of size-dependent distribution of surface atoms of CdS particles. Molecular dynamics-based theoretical calculation has indicated that the surface sulphide anion of a large CdS particle such as CdS made with 11 cycles (CdS Multiplication-Sign 11, average particle size = 5.6 nm) accounts for 9.6 % of the material whereas this value is increased to 19.2 % for (CdS Multiplication-Sign 3)-based smaller particles (average particle size = 2.7 nm). The photostability of CdS nanoparticles was significantly enhanced when coated with ZnS particles deposited with four SILAR cycles. The growth mechanism of ZnS upon CdS nanoparticles was discussed.

Biosynthesis of CdS nanoparticles: A fluorescent sensor for sulfate-reducing bacteria detection.

Science.gov (United States)

Qi, Peng; Zhang, Dun; Zeng, Yan; Wan, Yi

2016-01-15

CdS nanoparticles were synthesized with an environmentally friendly method by taking advantage of the characteristic metabolic process of sulfate-reducing bacteria (SRB), and used as fluorescence labels for SRB detection. The presence of CdS nanoparticles was observed within and immediately surrounded bacterial cells, indicating CdS nanoparticles were synthesized both intracellularly and extracellularly. Moreover, fluorescent properties of microbial synthesized CdS nanoparticles were evaluated for SRB detection, and a linear relationship between fluorescence intensity and the logarithm of bacterial concentration was obtained in the range of from 1.0×10(2) to 1.0×10(7)cfu mL(-1). The proposed SRB detection method avoided the use of biological bio-recognition elements which are easy to lose their specific recognizing abilities, and the bacterial detection time was greatly shortened compared with the widely used MPN method which would take up to 15 days to accomplish the detection process. Copyright © 2015 Elsevier B.V. All rights reserved.

Synthesis of CdS nanocrystals with different morphologies via an ultraviolet irradiation route

International Nuclear Information System (INIS)

Yao Suwei; Han Yuxin; Liu Weixing; Zhang Weiguo; Wang Hongzhi

2007-01-01

A simple ultraviolet photochemical reduction synthetic approach to preparing CdS nanocrystals with different morphologies is described. Sodium dodecyl sulfate (SDS) was used as soft template for the chemical synthesis of CdS nanocrystals in a mixture solution at room temperature. It was found that the magnetic force stirring and the volume proportions of C 2 H 5 OH and H 2 O had marked influences on the morphology of CdS nanocrystals (such as spherical, acicular-like, rod-like and worm-like shapes). The formation of CdS is via precipitation of Cd 2+ ions with the homogeneously released S 2- ions from decomposition of thioacetamide under ultraviolet irradiation source. X-ray diffraction (XRD), scanning electron microscopy (SEM) and the ultraviolet-visible (UV-vis) absorption spectra were employed to characterize the products. This novel method is expected to produce various semiconductor nanocrystals with potential applications in the fields of materials science and photovoltaic cells, etc

Surface modification effects on defect-related photoluminescence in colloidal CdS quantum dots.

Science.gov (United States)

Lee, TaeGi; Shimura, Kunio; Kim, DaeGwi

2018-05-03

We investigated the effects of surface modification on the defect-related photoluminescence (PL) band in colloidal CdS quantum dots (QDs). A size-selective photoetching process and a surface modification technique with a Cd(OH)2 layer enabled the preparation of size-controlled CdS QDs with high PL efficiency. The Stokes shift of the defect-related PL band before and after the surface modification was ∼1.0 eV and ∼0.63 eV, respectively. This difference in the Stokes shifts suggests that the origin of the defect-related PL band was changed by the surface modification. Analysis by X-ray photoelectron spectroscopy revealed that the surface of the CdS QDs before and after the surface modification was S rich and Cd rich, respectively. These results suggest that Cd-vacancy acceptors and S-vacancy donors affect PL processes in CdS QDs before and after the surface modification, respectively.

Validation of the visitor and resident framework in an e-book setting

DEFF Research Database (Denmark)

Engelsmann, Hazel C.; Greifeneder, Elke Susanne; Lauridsen, Nikoline D.

2014-01-01

Introduction. By applying the visitor and resident framework on e-book usage, the article explores whether the concepts of a resident and a visitor can help to explain e-book use, and can help to gain a better insight into users' motivations for e-book use. Method. A questionnaire and semi-struct...

Influential psychotherapy figures, authors, and books: An Internet survey of over 2,000 psychotherapists.

Science.gov (United States)

Cook, Joan M; Biyanova, Tatyana; Coyne, James C

2009-03-01

In a partial replication and extension of a survey conducted 25 years ago (Smith, 1982), over 2,400 North American psychotherapists completed a Web-based survey in which they identified prominent figures in the psychotherapy field who have most influenced their practice and the best psychotherapy books they had read in the past 3 years. There is a continued prominence to leaders of the field from 25 years ago but who are now deceased, notably the top-ranked Carl Rogers. Three books on the top-10 list represent empirically supported therapies (ESTs); two are treatment manuals for an EST, and one is a self-help book derived from an EST that has itself been shown to be efficacious bibliotherapy. Differences between psychologist and nonpsychologist therapists in the choice of influential figures, authors, and books are negligible. Implications are discussed in terms of the contemporary context into which therapeutic innovations are disseminated, as well as the conditions that may be necessary for successful dissemination. (PsycINFO Database Record (c) 2010 APA, all rights reserved).

Synthesis of uniform CdS nanowires in high yield and its single nanowire electrical property

International Nuclear Information System (INIS)

Yan Shancheng; Sun Litao; Qu Peng; Huang Ninping; Song Yinchen; Xiao Zhongdang

2009-01-01

Large-scale high quality CdS nanowires with uniform diameter were synthesized by using a rapid and simple solvothermal route. Field emission scan electron microscopy (FESEM) and transmission electron microscopy (TEM) images show that the CdS nanowires have diameter of about 26 nm and length up to several micrometres. High resolution TEM (HRTEM) study indicates the single-crystalline nature of CdS nanowires with an oriented growth along the c-axis direction. The optical properties of the products were characterized by UV-vis absorption spectra, photoluminescence spectra and Raman spectra. The resistivity, electron concentration and electron mobility of single NW are calculated by fitting the symmetric I-V curves measured on single NW by the metal-semiconductor-metal model based on thermionic field emission theory. - Graphical abstract: Large-scale high quality CdS nanowires (NWs) with uniform diameter were synthesized by using a rapid and simple solvothermal route. The reaction time is reduced to 2 h, comparing to other synthesis which needed long reaction time up to 12 h. In addition, the as-prepared CdS nanowires have more uniform diameter and high yield. More importantly, the I-V curve of present single CdS nanowire has a good symmetric characteristic as expected by the theory.

Solvothermally synthesized europium-doped CdS nanorods: applications as phosphors

International Nuclear Information System (INIS)

Kumar, Sunil; Jindal, Zinki; Kumari, Nitu; Verma, Narendra Kumar

2011-01-01

To exploit the photoluminescent behavior of CdS at nanoscale with different doping concentration of europium—a rare earth element, we report the synthesis of Eu-doped CdS nanorods by using low temperature solvothermal process by using ethylenediamine. The outcomes can have future applications as phosphors, photovoltaic cells, lasers, light emitting diodes, bio-imaging, and sensors. The doping was confirmed by electron dispersive spectroscopy supported by X-ray diffraction. From scanning electron microscopy and transmission electron microscopy analysis it was observed that the average diameter of the Cd 1−x Eu x S nanorods is about 10–12 nm having lengths in the range of 50–100 nm. UV–Visible spectroscopy study was carried out to determine the band gap of the nanorods and the absorbance peaks showed blue shift with respect to the bulk CdS. The blue shift was also observed as the doping concentration of Eu increases. From photoluminescence (PL) studies at λ ex = 450 nm, peaks at 528 and 540 nm were observed due to CdS, peak at 570 nm is due to defects related transitions, while the peak at 613 nm is due to Eu. As the doping concentration of Eu is increased the intensity of the luminescent peak at 613 nm is increased. Thermogravimetric analysis showed the nanorods are thermally stable up to 300 °C. The traces of impurities adsorbed on the nanorods were confirmed by Fourier transform infrared spectroscopy.

The Effects of Theory of Mind and Self-Regulation Skills on Helping Behaviors in 3-4-Year-Old Children

Directory of Open Access Journals (Sweden)

Muhammed Sukru Aydin

2016-12-01

Full Text Available The aim of this study is to examine the effects of theory of mind and self-regulation skills on children’s helping behavior. Total of 104 children aging between 36-59 months, participated in the study. Helping behavior was measured with an instrumental helping task. Scaling of Theory-of-Mind tasks were used in measuring theory of mind. As for measuring self-regulation, peg tapping task were used. In order to control receptive language abilities of children, Turkish Expressive and Receptive Language Test (TIFALDI was applied. Results of the analyses indicated that there were significant relations between theory of mind and selfregulation skills and helping behavior, however, multiple regression analyses showed that the main predictor of helping behavior was theory of mind, but not self-regulation skills after controlling for age and receptive language. Results were discussed with respect to the literature, in relation to the role of theory of mind and self-regulation skills in explaining helping behavior.

A controlled trial of an expert system and self-help manual intervention based on the stages of change versus standard self-help materials in smoking cessation.

Science.gov (United States)

Aveyard, Paul; Griffin, Carl; Lawrence, Terry; Cheng, K K

2003-03-01

To examine the population impact and effectiveness of the Pro-Change smoking cessation course based on the Transtheoretical Model (TTM) compared to standard self-help smoking cessation literature. Randomized controlled trial. Sixty-five West Midlands general practices. Randomly sampled patients recorded as smokers by their general practitioners received an invitation letter and 2471 current smokers agreed. Responders were randomized to one of four interventions. The control group received standard self-help literature. In the Manual intervention group, participants received the Pro-Change system, a self-help workbook and three questionnaires at 3-monthly intervals, which generated individually tailored feedback. In the Phone intervention group, participants received the Manual intervention plus three telephone calls. In the Nurse intervention group, participants received the Manual intervention plus three visits to the practice nurse. Biochemically confirmed point prevalence of being quit and 6-month sustained abstinence, 12 months after study commencement. A total of 9.1% of registered current smokers participated, of whom 83.0% were not ready to quit. Less than half of participants returned questionnaires to generate second and third individualized feedback. Telephone calls reached 75% of those scheduled, but few participants visited the nurse. There were small differences between the three Pro-Change arms. The odds ratio (95% confidence intervals) for all Pro-Change arms combined versus the control arm were 1.50 (0.85-2.67) and 1.53 (0.76-3.10), for point prevalence and 6-month abstinence, respectively. This constitutes 2.1% of the TTM group versus 1.4% of the control group achieving confirmed 6-month sustained abstinence. There was no statistically significant benefit of the intervention apparent in this trial and the high relapse of quitters means that any population impact is small.

A study of size dependent structure, morphology and luminescence behavior of CdS films on Si substrate

International Nuclear Information System (INIS)

Kaushik, Diksha; Singh, Ragini Raj; Sharma, Madhulika; Gupta, D.K.; Lalla, N.P.; Pandey, R.K.

2007-01-01

Size tunable cadmium sulfide (CdS) films deposited by a dip coating technique on silicon (100) and indium tin oxide/glass substrates have been characterized using X-ray diffraction, X-ray reflectivity, transmission electron microscopy, atomic force microscopy and photoluminescence spectroscopy. The structural characterization indicated growth of an oriented phase of cadmium sulfide. Transmission electron microscopy used to calculate the particle size indicated narrow size dispersion. The tendency of nanocrystalline CdS films to form ordered clusters of CdS quantum dots on silicon (100) substrate has been revealed by morphological studies using atomic force microscopy. The photoluminescence emission spectroscopy of the cadmium sulfide films has also been investigated. It is shown that the nanocrystalline CdS exhibit intense photoluminescence as compared to the large grained polycrystalline CdS films. The effect of quantum confinement also manifested as a blue shift of photoluminescence emission. It is shown that the observed photoluminescence behavior of CdS is substantially enhanced when the nanocrystallites are assembled on silicon (100) substrate

E-Books and New Library Service Models: An Analysis of the Impact of E-Book Technology on Academic Libraries.

Science.gov (United States)

Jantz, Ronald

2001-01-01

Analyzes the implications of electronic book technology (e-books) on academic libraries. Discusses new business models for publishers, including self-publishing, Internet publishing, and partnerships with libraries as publishers; impact on library services, including cataloging, circulation, and digital preservation; user benefits; standards;…

The Untapped Potential of Picture Books

Science.gov (United States)

Hager, Stephanie

2015-01-01

This article discusses the role picture books play in helping young writers. Third-grade students were read engaging picture books for the sole purpose of noticing and naming different features they encountered during the read-alouds. Students were able to recognize the tools many authors and illustrators use such as onomatopoeia, varied font…

Effect of protic solvents on CdS thin films prepared by chemical bath deposition

Energy Technology Data Exchange (ETDEWEB)

Yao, Pin-Chuan, E-mail: pcyao@mail.dyu.edu.tw; Chen, Chun-Yu

2015-03-31

In this study, cadmium sulfide (CdS) thin films are grown on glass substrates by chemical bath deposition (CBD) in an aqueous bath containing 10–20 vol.% alcohol. The roles of ethanol as a protic solvent that substantially improves the quality of films are explored extensively. The deposited films in an alcohol bath are found to be more compact and smoother with smaller CdS grains. The X-ray diffractograms of the samples confirm that all films were polycrystalline with mixed wurtzite (hexagonal) and zinkblende (cubic) phases. Raman spectra indicate that, for a film deposited in an alcohol bath, the position of 1LO is closer to the value for single crystal CdS, indicating that these films have a high degree of crystallinity. The as-deposited CdS thin films in a 10 vol.% alcohol bath were found to have the highest visible transmittance of 81.9%. XPS analysis reveals a stronger signal of C1s for samples deposited in the alcohol baths, indicating that there are more carbonaceous residues on the films with protic solvent than on the films with water. A higher XPS S/Cd atomic ratio for films deposited in an alcohol bath indicates that undesirable surface reactions (leading to sulfur containing compounds other than CdS) occur less frequently over the substrates. - Highlights: • Study of CBD-CdS films grown in an alcohol-containing aqueous bath is reported. • The deposited films in an alcohol bath are more compact with smaller CdS grains. • Raman spectra show that in an alcohol bath, the CdS film has a better crystallinity. • XPS reveals more carbon residues remain on the films deposited using alcohol bath. • In an alcohol bath, the undesirable surface reactions with Cd ions were hindered.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available cds gnl|CMER >1a320 1 85 35 119 3e-17 ... gb|AAK39926.1| plastidal 30S ribosomal prot...ein S15 [Guillardia theta] pir||G90099 ... plastidal 30S ribosomal protein S15 [imported] - ... ... ... Guillardia theta nucleomorph ref|NP_113370.1| plastidal ... 30S ribosomal protein S15 [Guillardia t

The Angst of Youth in Post-Industrial Japan: A Narrative Self-help Approach

Directory of Open Access Journals (Sweden)

Rie Kido

2016-07-01

Full Text Available This paper explores the experience of angst (ikizurasa among youth in long- term unemployment in post-industrial Japan, and proposes a model for supporting them. Currently, the dominant model for unemployment support consists of activation policies, which assume that users can identify their problems and clarify their needs in job seeking. However, for youth in situations of long-term unemployment, the effectiveness of these policies is limited. This paper argues that indirect support which focuses on (reconstructing human relationships through sharing narratives is a more effective way to help such youth mitigate their angst. In-depth interviews with two participants in a Self-Help Group for youth affected by long-term unemployment, as well as participant observations of the group, reveal how a narrative approach allowed participants to build new senses of self founded in realities shared by others. The analysis shows how these developments were crucial to helping the participants to find employment that suited their situations and needs.

Effect of the sulfur and fluorine concentration on physical properties of CdS films grown by chemical bath deposition

Directory of Open Access Journals (Sweden)

K.E. Nieto-Zepeda

Full Text Available Undoped and F-doped CdS thin films were grown on glass slides by chemical bath deposition using thiourea, cadmium acetate and ammonium fluoride as sulfur, cadmium, and fluorine sources, respectively. Undoped CdS films were deposited varying the concentration of thiourea. Once the optimal thiourea concentration was determined, based on the crystalline quality of the samples, this concentration was maintained and ammonium fluoride was added at different concentrations in order to explore the effect of the F nominal concentration on properties of CdS films. Undoped and F-doped CdS films were characterized by X-ray diffraction, UV–Vis, room temperature photoluminescence, and four probe resistivity measurements. Results showed highly transparent F-doped CdS films with strong PL and low resistivity were obtained. Keywords: CdS films, F-doped CdS films, Chemical bath deposition, Optical properties, Room temperature photoluminescence

Luminescence in Mn-doped CdS nanocrystals

Indian Academy of Sciences (India)

Wintec

and the Mn d levels occur at two different energies, allowed us to study the PL lifetime decay behaviour of both kinds of .... seen from the XRD analysis, the size of the nanocrystals .... levels couple to the CdS electronic states and the excited.

Tau mRNA 3'UTR-to-CDS ratio is increased in Alzheimer disease.

Science.gov (United States)

García-Escudero, Vega; Gargini, Ricardo; Martín-Maestro, Patricia; García, Esther; García-Escudero, Ramón; Avila, Jesús

2017-08-10

Neurons frequently show an imbalance in expression of the 3' untranslated region (3'UTR) relative to the coding DNA sequence (CDS) region of mature messenger RNAs (mRNA). The ratio varies among different cells or parts of the brain. The Map2 protein levels per cell depend on the 3'UTR-to-CDS ratio rather than the total mRNA amount, which suggests powerful regulation of protein expression by 3'UTR sequences. Here we found that MAPT (the microtubule-associated protein tau gene) 3'UTR levels are particularly high with respect to other genes; indeed, the 3'UTR-to-CDS ratio of MAPT is balanced in healthy brain in mouse and human. The tau protein accumulates in Alzheimer diseased brain. We nonetheless observed that the levels of RNA encoding MAPT/tau were diminished in these patients' brains. To explain this apparently contradictory result, we studied MAPT mRNA stoichiometry in coding and non-coding regions, and found that the 3'UTR-to-CDS ratio was higher in the hippocampus of Alzheimer disease patients, with higher tau protein but lower total mRNA levels. Our data indicate that changes in the 3'UTR-to-CDS ratio have a regulatory role in the disease. Future research should thus consider not only mRNA levels, but also the ratios between coding and non-coding regions. Copyright © 2017 Elsevier B.V. All rights reserved.

Radiative recombination process of high density excitons in CdS crystals

Energy Technology Data Exchange (ETDEWEB)

Dneprovskij, V.S.; Klimov, V.I.; Martynenko, E.D.; Stadnik, V.A.

1983-11-01

The behaviour of the P-, E-, L- and Q-lines of luminescence in CdS is compared with calculated results for the processes of exciton-exciton scattering, exciton-electron scattering, annihilation of equilibrium electron-hole fluid (EHF), annihilation of electron-hole plasma (processes of amplification and reabsorption are taken into account). The comparison permitted to determine parameters of high density exciton gas and EHF. Spectral-kinetic properties of generation are investigated, and amplification factor in CdS is estimated.

Study on the fluorescence resonance energy transfer between CdS quantum dots and Eosin Y.

Science.gov (United States)

Yan, Zhengyu; Zhang, Zhengwei; Yu, Yan; Chen, Jianqiu

2015-03-01

Water-soluble CdS quantum dots (QDs) were prepared using mercaptoacetic acid (TGA) as the stabilizer in an aqueous system. A fluorescence resonance energy transfer (FRET) system was constructed between water-soluble CdS QDs (donor) and Eosin Y (acceptor). Several factors that impacted the fluorescence spectra of the FRET system, such as pH (3.05-10.10), concentration of Eosin Y (2-80 mg/L) and concentration of CdS QDs (2-80 mg/L), were investigated and refined. Donor-to-acceptor ratios, the energy transfer efficiency (E) and the distance (r) between CdS QDs and Eosin Y were obtained. The results showed that a FRET system could be established between water-soluble CdS QDs and Eosin Y at pH 5.0; donor-to-acceptor ratios demonstrated a 1: 8 proportion of complexes; the energy transfer efficiency (E) and the distance (r) between the QDs and Eosin Y were 20.07% and 4.36 nm,respectively. Copyright © 2014 John Wiley & Sons, Ltd.

Expanding the Boundaries of Kindergartners' E-Book Reading: Metacognitive Guidance for E-Book Support among Young Children at Risk for Learning Disabilities

Science.gov (United States)

Shamir, Adina

2017-01-01

The increasing range and number of electronic books (e-books) available in the children's book market has motivated educators and researchers to investigate how well these platforms can contribute to advancing emergent literacy. Such research has nonetheless been conducted on a much smaller scale in the area of self-regulated learning (SRL) with…

Schottky junction photovoltaic devices based on CdS single nanobelts.

Science.gov (United States)

Ye, Y; Dai, L; Wu, P C; Liu, C; Sun, T; Ma, R M; Qin, G G

2009-09-16

Schottky junction photovoltaic (PV) devices were fabricated on single CdS nanobelts (NBs). Au was used as the Schottky contact, and In/Au was used as the ohmic contact to CdS NB. Typically, the Schottky junction exhibits a well-defined rectifying behavior in the dark with a rectification ratio greater than 10(3) at +/- 0.3 V; and the PV device exhibits a clear PV behavior with an open circuit photovoltage of about 0.16 V, a short circuit current of about 23.8 pA, a maximum output power of about 1.6 pW, and a fill factor of 42%. Moreover, the output power can be multiplied by connecting two or more of the Schottky junction PV devices, made on a single CdS NB, in parallel or in series. This study demonstrates that the 1D Schottky junction PV devices, which have the merits of low cost, easy fabrication and material universality, can be an important candidate for power sources in nano-optoelectronic systems.

Effect of temperature, precursor concentration and capping group on the shape of Cds nanoparticles

CSIR Research Space (South Africa)

Moloto, N

2009-01-01

Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

Arabidopsis CDS blastp result: AK068433 [KOME

Lifescience Database Archive (English)

Full Text Available AK068433 J013156D16 At1g20620.2 catalase 3 (SEN2) almost identical to catalase 3 SP...:Q42547, GI:3123188 from [Arabidopsis thaliana]; identical to catalase 3 (SEN2) mRNA, partial cds GI:3158369 1e-63 ...

The Five Ancestors--Book 1: Tiger

Science.gov (United States)

Stone, Jeff

2004-01-01

Losing a job is an awfully low point--until it turns into the opportunity to pursue writing full time, and a book like "The Five Ancestors: Tiger" results. Jeff Stone looks back to his own experience as a young reader and taps that experience to help frame his own writing. An intriguing snapshot of his new book follows.

Helping Self-Harming Students

Science.gov (United States)

Selekman, Matthew D.

2009-01-01

Approximately 14 to 17 percent of adolescents today self-harm, deliberately cutting, burning, or bruising themselves. Most self-harming adolescents use the behavior as a coping strategy to get immediate relief from emotional distress or other stressors in their lives. Stressors include fitting in with peers, activity and homework overload, fears…

EPR and photoluminescence properties of Mn2+ doped CdS nanoparticles synthesized via co-precipitation method.

Science.gov (United States)

Gupta, Atul K; Kripal, Ram

2012-10-01

The structural properties of Mn doped CdS (Mn:CdS) nanoparticles (NPs) are studied using X-ray diffraction (XRD), Transmission electron microscopy (TEM), Ultraviolet-visible (UV-vis), Photoluminescence (PL), Raman and Electron paramagnetic resonance (EPR) spectroscopy. XRD analysis shows the nanostructure with 2-4 nm of average crystallite size. The planes (110), (103) and (112) in XRD pattern distinguish the wurtzite structure of the Mn:CdS NPs. The intensity of the plane (102) increases as the doping concentration of Mn(2+) increases. UV-vis absorption spectra show blue shift as compared to bulk CdS. The optical band gap energy of Mn(2+) (0, 0.35, 0.70 and 1.35 at.%) doped CdS NPs corresponding to absorption edge are found to be 5.29, 5.28, 5.25 and 5.21 eV, respectively. The intensity of luminescence is changing with the concentration of Mn(2+) doped in CdS NPs. Raman spectra show blue shift in fundamental optical phonon mode (1LO) as well as second optical phonon mode (2LO) as compared to bulk CdS. The intensity ratio of the 2LO to 1LO modes slightly decreases as Mn(2+) concentration increases. EPR shows the existence of Mn(2+) with different local structures in CdS nanoparticles. The values of spectroscopic splitting factor (g) and hyperfine interaction constant (A) decrease as Mn(2+) concentration increases in CdS NPs. Copyright © 2012 Elsevier B.V. All rights reserved.

Optimization of deposition conditions of CdS thin films using response surface methodology

Energy Technology Data Exchange (ETDEWEB)

Yücel, Ersin, E-mail: dr.ersinyucel@gmail.com [Department of Physics, Faculty of Arts and Sciences, Mustafa Kemal University, 31034 Hatay (Turkey); Güler, Nuray [Department of Physics, Faculty of Arts and Sciences, Mustafa Kemal University, 31034 Hatay (Turkey); Yücel, Yasin [Department of Chemistry, Faculty of Arts and Sciences, Mustafa Kemal University, 31034 Hatay (Turkey)

2014-03-15

Highlights: • Statistical methods used for optimization of CdS deposition parameters. • The morphology of the films was smooth, homogeneous and continuous. • Optimal conditions found as pH 11, stirring speed:361 rpm and deposition time: 55 min. • CdS thin film band gap value was 2.72 eV under the optimum conditions. -- Abstract: Cadmium sulfide (CdS) thin films were prepared on glass substrates by chemical bath deposition (CBD) technique under different pH, stirring speed and deposition time. Response Surface Methodology (RSM) and Central Composite Design (CCD) were used to optimization of deposition parameters of the CdS thin films. RSM and CCD were also used to understand the significance and interaction of the factors affecting the film quality. Variables were determined as pH, stirring speed and deposition time. The band gap was chosen as response in the study. Influences of the variables on the band gap and the film quality were investigated. 5-level-3-factor central composite design was employed to evaluate the effects of the deposition conditions parameters such as pH (10.2–11.8), stirring speed (132–468 rpm) and deposition time (33–67 min) on the band gap of the films. The samples were characterized using X-ray diffraction (XRD), scanning electron microscope (SEM) and ultraviolet–visible spectroscopy (UV–vis) measurements. The optimal conditions for the deposition parameters of the CdS thin films have been found to be: pH 11, 361 of stirring speed and 55 min of deposition time. Under the optimal conditions theoretical (predicted) band gap of CdS (2.66 eV) was calculated using optimal coded values from the model and the theoretical value is good agreement with the value (2.72 eV) obtained by verification experiment.

CdS nanoparticle sensitized titanium dioxide decorated graphene for enhancing visible light induced photoanode

International Nuclear Information System (INIS)

Yousefzadeh, S.; Faraji, M.; Nien, Y.T.; Moshfegh, A.Z.

2014-01-01

Highlights: • CdS nanoparticles were deposited on TiO 2 /graphene film by different SILAR cycles. • The visible light absorption increased due to graphene and CdS nanoparticles. • The highest photocurrent density was achieved for nanocomposite with 30 CdS cycles. • A mechanism has been suggested for nanocomposite photoanodes, significantly. - Abstract: CdS/TiO 2 /graphene (CTG) nanocomposite thin films were synthesized by a facile production route. The TiO 2 /graphene (TG) nanocomposite was initially fabricated by sol-gel method in such a way that TiO 2 nanoparticles loaded on graphene oxide (GO) sheet via photocatalytic process. Then, CdS nanoparticles were deposited on the TG thin film by successive ion layer adsorption and reaction process (SILAR) approach. Based on atomic force microscopy (AFM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses, the TG thin film possessed a larger surface area as compared with the pure TiO 2 thin film due to presence of graphene sheet. UV/visible spectroscopy exhibited that visible absorption of the CTG samples increased with increasing CdS SILAR deposition cycle (n). Enhanced photocurrent response of the CTG(n) photoanodes measured as compared with the TG and T photoanodes due to good electrical conductivity and large surface area of graphene as well as the visible light-harvesting ability of CdS nanoparticles. Maximum photocurrent density of about 4.5 A/m 2 and electron life time of about 5 s was measured for the CTG(30) photoanodes

CdS nanoparticle sensitized titanium dioxide decorated graphene for enhancing visible light induced photoanode

Energy Technology Data Exchange (ETDEWEB)

Yousefzadeh, S.; Faraji, M. [Physics Department, Sharif University of Technology, P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Nien, Y.T. [Department of Materials Science and Engineering, National Formosa University, Taiwan (China); Moshfegh, A.Z., E-mail: moshfegh@sharif.edu [Physics Department, Sharif University of Technology, P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology, P.O. Box 14588-89694, Tehran (Iran, Islamic Republic of)

2014-11-30

Highlights: • CdS nanoparticles were deposited on TiO{sub 2}/graphene film by different SILAR cycles. • The visible light absorption increased due to graphene and CdS nanoparticles. • The highest photocurrent density was achieved for nanocomposite with 30 CdS cycles. • A mechanism has been suggested for nanocomposite photoanodes, significantly. - Abstract: CdS/TiO{sub 2}/graphene (CTG) nanocomposite thin films were synthesized by a facile production route. The TiO{sub 2}/graphene (TG) nanocomposite was initially fabricated by sol-gel method in such a way that TiO{sub 2} nanoparticles loaded on graphene oxide (GO) sheet via photocatalytic process. Then, CdS nanoparticles were deposited on the TG thin film by successive ion layer adsorption and reaction process (SILAR) approach. Based on atomic force microscopy (AFM), scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses, the TG thin film possessed a larger surface area as compared with the pure TiO{sub 2} thin film due to presence of graphene sheet. UV/visible spectroscopy exhibited that visible absorption of the CTG samples increased with increasing CdS SILAR deposition cycle (n). Enhanced photocurrent response of the CTG(n) photoanodes measured as compared with the TG and T photoanodes due to good electrical conductivity and large surface area of graphene as well as the visible light-harvesting ability of CdS nanoparticles. Maximum photocurrent density of about 4.5 A/m{sup 2} and electron life time of about 5 s was measured for the CTG(30) photoanodes.

Building Self-Esteem: A Self-Help Guide

Science.gov (United States)

... ways you can help yourself to feel better. Charles G. Curie, M.A., A.C.S.W. Administrator ... Thoughts About Yourself to Positive Ones Activities That Will Help You Feel Good About Yourself In Conclusion ...

Is technology assisted guided self-help successful in treating female adolescents with bulimia nervosa?

Science.gov (United States)

Wagner, Gudrun; Wagner, Gudrun; Penelo, Eva; Nobis, Gerald; Mayerhofer, Anna; Schau, Johanna; Spitzer, Marion; Imgart, Hartmut; Karwautz, Andreas

2013-01-01

This study aims to evaluate the long-term outcome of new technology assisted guided self-help in adolescents with bulimia nervosa (BN). One hundred and twenty-six patients with BN (29 adolescents and 97 adults) were randomly allocated to a cognitive behavioural therapy-based self-help program delivered by the Internet or bibliotherapy, both accompanied by e-mail guidance. Outcomes were assessed at baseline, month 4, 7 and 18 including remission rates and eating disorder associated psychopathology. In all, 44% of adolescents vs. 38.7% of adults were in remission at month 7, and 55% of adolescents vs. 62.5% of adults were in remission at follow-up. Objective binge eating and compensatory behaviour improved significantly over time in both groups, with the highest decrease during the first 4 months. A significant decrease over time and no group differences have been found in almost all EDI-2 subscales. E-mail guided self-help (delivered via the Internet or bibliotherapy) is equally effective for adolescents as for adults with BN, and can be recommended as an initial step of treatment for this younger age group.

A comparison of online versus workbook delivery of a self-help positive parenting program.

Science.gov (United States)

Sanders, Matthew R; Dittman, Cassandra K; Farruggia, Susan P; Keown, Louise J

2014-06-01

A noninferiority randomized trial design compared the efficacy of two self-help variants of the Triple P-Positive Parenting Program: an online version and a self-help workbook. We randomly assigned families of 193 children displaying early onset disruptive behavior difficulties to the online (N = 97) or workbook (N = 96) interventions. Parents completed questionnaire measures of child behavior, parenting, child maltreatment risk, personal adjustment and relationship quality at pre- and post-intervention and again at 6-month follow up. The short-term intervention effects of the Triple P Online program were not inferior to the workbook on the primary outcomes of disruptive child behavior and dysfunctional parenting as reported by both mothers and fathers. Both interventions were associated with significant and clinically meaningful declines from pre- to post-intervention in levels of disruptive child behavior, dysfunctional parenting styles, risk of child maltreatment, and inter-parental conflict on both mother and father report measures. Intervention effects were largely maintained at 6-month follow up, thus supporting the use of self-help parenting programs within a comprehensive population-based system of parenting support to reduce child maltreatment and behavioral problems in children.

Large-scale preparation of CdS quantum dots by direct thermolysis of a single-source precursor

Energy Technology Data Exchange (ETDEWEB)

Li Zhiguo; Cai Wei; Sui Jiehe [School of Material Science and Engineering, Harbin Institute of Technology, Harbin, Heilongjiang 150001 (China)

2008-01-23

CdS quantum dots (QDs) have been synthesized on a large scale, based on the direct thermolysis of one single-source precursor (Me{sub 4}N){sub 4}[S{sub 4}Cd{sub 10}(SPh){sub 16}], in hexadecylamine (HDA). Transmission electron microscopy (TEM) observations show that the CdS QDs are well-defined, nearly spherical particles. The clear lattice fringes in high-resolution TEM (HRTEM) images confirm the crystalline nature of the QDs. The broad diffraction in the x-ray diffraction (XRD) pattern and diffuse diffraction rings of the selected-area electron diffraction (SAED) pattern are typical of nanomeric-size particles and indicative of the hexagonal phase of CdS QDs. The absorption spectra confirm quantum confinement of CdS QDs. The synthesis process for CdS QDs was investigated by ultraviolet-visible (UV-vis) absorption spectroscopy. The results demonstrate that the nucleation and growth stages were separated automatically in a homogeneous system.

Synthesis and crystalline properties of CdS incorporated polyvinylidene fluoride (PVDF) composite film

Science.gov (United States)

Patel, Arunendra Kumar; Sunder, Aishwarya; Mishra, Shweta; Bajpai, Rakesh

2018-05-01

This paper gives an insight on the synthesis and crystalline properties of Polyvinylidene Fluoride (PVDF) (host matrix) composites impregnated with Cadmium Sulphide (CdS) using Dimethyl formamide (DMF) as the base, prepared by the well known solvent casting technique. The effect of doping concentration of CdS in to the PVDF matrix was studied using X-ray diffraction technique. The structural properties like crystallinity Cr, interplanar distance d, average size of the crystalline region (D), and average inter crystalline separation (R) have been estimated for the developed composite. The crystallinity index, crystallite size and inter crystalline separation is increasing with increase in the concentration of CdS in to the PVDF matrix while the interplanar distance d is decreasing.

Influence of Irradiation Time on properties of CdS Nanoparticles Synthesized using Microwave Irradiation

International Nuclear Information System (INIS)

Nayereh Soltani; Elias SSaion; Maryam Erfani; Mohd Zobir Hussein; Robiah Yunus

2011-01-01

Different sizes of cadmium sulfide nanoparticles which exhibit obvious quantum confinement effect have been synthesized of cadmium chloride and thioacetamide through the simple and rapid microwave method. The properties of these CdS nanoparticles were examined with varying irradiation time from 10 to 40 min using a pulse regime. The obtained CdS particles were characterized by X-ray diffraction (XRD), transition electron microscopy (TEM) and UV-visible (UV-Vis) spectroscopy. The effects of irradiation time on the size, degree of crystallinity, yield of reaction and optical band gap of CdS nanoparticles are investigated. (author)

How does social comparison within a self-help group influence adjustment to chronic illness? A longitudinal study.

Science.gov (United States)

Dibb, Bridget; Yardley, Lucy

2006-09-01

Despite the growing popularity of self-help groups for people with chronic illness, there has been surprisingly little research into how these may support adjustment to illness. This study investigated the role that social comparison, occurring within a self-help group, may play in adjustment to chronic illness. A model of adjustment based on control process theory and response shift theory was tested to determine whether social comparisons predicted adjustment after controlling for the catalyst for adjustment (disease severity) and antecedents (demographic and psychological factors). A sample of 301 people with Ménière's disease who were members of the Ménière's Society UK completed questionnaires at baseline and 10-month follow-up assessing adjustment, defined for this study as functional and goal-oriented quality of life. At baseline, they also completed measures of the predictor variables i.e. the antecedents (age, sex, living circumstances, duration of self-help group membership, self-esteem, optimism and perceived control over illness), the catalyst (severity of vertigo, tinnitus, hearing loss and fullness in the ear) and mechanisms of social comparison within the self-help group. The social comparison variables included the extent to which self-help group resources were used, and whether reading about other members' experiences induced positive or negative feelings. Cross-sectional results showed that positive social comparison was indeed associated with better adjustment after controlling for all the other baseline variables, while negative social comparison was associated with worse adjustment. However, greater levels of social comparison at baseline were associated with a deteriorating quality of life over the 10-month follow-up period. Alternative explanations for these findings are discussed.

Glycolthermal synthesis and characterization of hexagonal CdS round microparticles in flower-like clusters

International Nuclear Information System (INIS)

Phuruangrat, Anukorn; Ekthammathat, Nuengruethai; Thongtem, Titipun; Thongtem, Somchai

2011-01-01

Highlights: → CdS as one of II-VI semiconducting materials. → Lab-made Teflon-lined stainless steel autoclaves enable us to form hexagonal CdS. → By 100-200 deg. C processing, round microparticles in flower clusters were synthesized. → A promising material for multiple potential applications. - Abstract: Hexagonal CdS round microparticles in flower-like clusters were synthesized by glycolthermal reactions of CdCl 2 and thiourea as cadmium and sulphur sources in 1,2-propylene glycol (PG) at 100-200 deg. C for 10-30 h. Phase and morphology were detected using X-ray diffraction (XRD), and scanning and transmission electron microscopy (SEM, TEM). The products were pure phase of hexagonal wurtzite CdS. The quantitative elemental analysis of Cd:S ratio was detected using energy dispersive X-ray (EDX) analyzer. Raman spectrometer revealed the presence of fundamental and overtone modes at 296 and 595 cm -1 , corresponding to the strong 1LO and weak 2LO modes, respectively. Photonic properties were investigated using UV-visible and photoluminescence (PL) spectroscopy. They showed the same absorption at 493-498 nm, and emission at 431 nm due to the excitonic recombination process. A possible formation mechanism was also proposed, according to experimental results.

Glycolthermal synthesis and characterization of hexagonal CdS round microparticles in flower-like clusters

Energy Technology Data Exchange (ETDEWEB)

Phuruangrat, Anukorn, E-mail: phuruangrat@hotmail.com [Department of Materials Science and Technology, Faculty of Science, Prince of Songkla University, Hat Yai, Songkhla 90112 (Thailand); Ekthammathat, Nuengruethai [Department of Chemistry, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thongtem, Titipun, E-mail: ttpthongtem@yahoo.com [Department of Chemistry, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Materials Science Research Center, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thongtem, Somchai [Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Materials Science Research Center, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand)

2011-10-13

Highlights: > CdS as one of II-VI semiconducting materials. > Lab-made Teflon-lined stainless steel autoclaves enable us to form hexagonal CdS. > By 100-200 deg. C processing, round microparticles in flower clusters were synthesized. > A promising material for multiple potential applications. - Abstract: Hexagonal CdS round microparticles in flower-like clusters were synthesized by glycolthermal reactions of CdCl{sub 2} and thiourea as cadmium and sulphur sources in 1,2-propylene glycol (PG) at 100-200 deg. C for 10-30 h. Phase and morphology were detected using X-ray diffraction (XRD), and scanning and transmission electron microscopy (SEM, TEM). The products were pure phase of hexagonal wurtzite CdS. The quantitative elemental analysis of Cd:S ratio was detected using energy dispersive X-ray (EDX) analyzer. Raman spectrometer revealed the presence of fundamental and overtone modes at 296 and 595 cm{sup -1}, corresponding to the strong 1LO and weak 2LO modes, respectively. Photonic properties were investigated using UV-visible and photoluminescence (PL) spectroscopy. They showed the same absorption at 493-498 nm, and emission at 431 nm due to the excitonic recombination process. A possible formation mechanism was also proposed, according to experimental results.

Sjogren's Syndrome: A Place to Begin

Medline Plus

Full Text Available ... Involved Video: A Place to Begin Family & Friends Information Sjögren’s FAQs Glossary Sjögren’s Tip Survival Tips Brochures & Resource Sheets Books, CDs & More! Donate Today Your support will help us continue to meet the needs of millions of people with Sjögren's and those ...

A CDO option market model on standardized CDS index tranches

DEFF Research Database (Denmark)

Dorn, Jochen

We provide a market model which implies a dynamic for standardized CDS index tranche spreads. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling emerging options on struc- tured credit derivatives. With the upcoming regulation of the CDS market...... in perspective, the model presented here is also an attempt to face the e ects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke tenors/tranche subordination to market data obtained by more liquid Index Tranche Options...

A randomised controlled trial of face to face versus pure online self-help cognitive behavioural treatment for perfectionism.

Science.gov (United States)

Egan, Sarah J; van Noort, Emily; Chee, Abby; Kane, Robert T; Hoiles, Kimberley J; Shafran, Roz; Wade, Tracey D

2014-12-01

Previous research has shown cognitive-behavioural treatment (CBT) to be effective in reducing perfectionism. The present study investigated the efficacy of two formats of CBT for perfectionism (CBT-P), face-to-face and pure online self-help, in reducing perfectionism and associated psychological symptoms. Participants were randomly allocated to face-to-face CBT-P (n = 18), pure online self-help CBT-P (n = 16), or a waitlist control period (n = 18). There was no significant change for the waitlist group on any of the outcome measures at the end of treatment. Both the face-to-face and pure online self-help groups reported significant reductions at the end of treatment for the perfectionism variables which were maintained at the 6-month follow-up. The face-to-face group also reported significant reductions over this time in depression, anxiety, and stress, and a significant pre-post increase in self-esteem, all of which were maintained at the 6-month follow-up. In contrast, the pure online self-help group showed no significant changes on these outcomes. The face-to-face group was statistically superior to the pure online self-help group at follow-up on the perfectionism measures, concern over mistakes and personal standards. The results show promising evidence for CBT for perfectionism, especially when offered face to face, where sustained benefit across a broad range of outcomes can be expected. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.

Fabrication of CDs/CdS-TiO2 ternary nano-composites for photocatalytic degradation of benzene and toluene under visible light irradiation

Science.gov (United States)

Wang, Meng; Hua, Jianhao; Yang, Yaling

2018-06-01

An efficient cadmium sulfide quantum-dots (CdS QDs) and carbon dots (CDs) modified TiO2 photocatalyst (CdS/CDs-TiO2) was successfully fabricated. The as-prepared ternary nano-composites simultaneously improved the photo-corrosion of CdS and amplified its photocatalytic activity. The introduction of CdS QDs and CDs could enhance more absorbance of light, prevent the undesirable electron/hole recombination, and promote charge separation, which was important for the continuous formation of rad OH and rad O2- radicals. When the optimal mass ratio of CdS QDs to CDs was 3:1, above 90% degradation efficiencies were achieved for benzene within 1 h and toluene in 2 h, while that of pure TiO2 (P25), CdS QDs-TiO2, CDs-TiO2 nano-composites was around 15%. Owing to the symmetric structure and conjugation of methyl with benzene ring, the degradation of toluene was more difficult than benzene to carry on. The new fabricated nano-composites showed good prospective application of cleaning up refractory pollutants and the resource utilization.

"Write a chapter and change the world". How the Boston Women's Health Book Collective transformed women's health then--and now.

Science.gov (United States)

Heather, Stephenson; Zeldes, Kiki

2008-10-01

Working together informally, the core group of women who would later form the Boston Women's Health Book Collective wrote a book that would become the bible of women's health, selling more than 4 million copies. They also created an organization that would carry their mission forward. From the first newsprint edition of Our Bodies, Ourselves, which became an underground sensation, to the brand new book, Our Bodies, Ourselves: Pregnancy and Birth, released in March 2008, the group has educated women and men, critiqued the medical system, examined inequalities based on gender, race, sexual orientation, class, and other categories, and urged readers to move from individual self-help to collective action promoting social policies that support the health of women and communities.

User-experiences with a web-based self-help intervention for partners of cancer patients based on acceptance and commitment therapy and self-compassion: a qualitative study

Directory of Open Access Journals (Sweden)

Nadine Köhle

2017-02-01

Full Text Available Abstract Background Partners of cancer patients are the cornerstone of supportive cancer care. They assume different roles and responsibilities that optimally support the patient. Such support is highly demanding, and many partners report (mental health problems. However, many of them do not use professional supportive care themselves. Offering a Web-based self-help intervention based on Acceptance and Commitment Therapy (ACT and self-compassion could be an important resource to support this group. This qualitative study aimed to examine user-experiences with a Web-based self-help intervention based on ACT and self-compassion among partners of cancer patients. Methods Individual in-depth interviews, about partners’ appreciation of the intervention and lessons learned, were conducted with 14 partners of cancer patients who used the Web-based self-help intervention. Interviews were audio-recorded, transcribed verbatim and analyzed by three independent coders both deductively and inductively. Results In general, partners appreciated the intervention, however, they also expressed ambivalent feelings towards peer support, the content of the feedback of their counselor, and the ‘tunneled’ structure of the intervention. The majority of the partners reported being more self-compassionate accepting that they experienced negative thoughts and feelings, they reported that they learned to increase the distance between their thoughts and themselves, they indicated being more aware of their personal values, and they thought that they were better able to commit to those values. They also reported other (non-specific helpful processes such as insight and acknowledgement, positivity, the possibility to tell their story, time for themselves, and feeling closer and more connected with their partner (the patient. Conclusions Partners of cancer patients indicated to appreciate the Web-based self-help intervention based on ACT and self-compassion. They felt

Analysis of syntax and word use to predict successful participation in guided self-help for anxiety and depression

DEFF Research Database (Denmark)

Zinken, Jörg; Zinken, Katarzyna; Wilson, J. Clare

2010-01-01

This study investigated whether an analysis of narrative style (word use and cross-clausal syntax) of patients with symptoms of generalised anxiety and depression disorders can help predict the likelihood of successful participation in guided self-help. Texts by 97 people who had made contact...... with a primary care mental health service were analysed. Outcome measures were completion of the guided self-help programme, and change in symptoms assessed by a standardised scale (CORE-OM). Regression analyses indicated that some aspects of participants' syntax helped to predict completion of the programme...

An improved pyrolysis route to synthesize carbon-coated CdS quantum dots with fluorescence enhancement effect

International Nuclear Information System (INIS)

Zhang Kejie; Liu Xiaoheng

2011-01-01

Well-dispersed carbon-coated CdS (CdS-C) quantum dots were successfully prepared via the improved pyrolysis of bis(1-dodecanethiol)-cadmium(II) under nitrogen atmosphere. This simple method effectively solved the sintered problem resulted from conventional pyrolysis process. The experimental results indicated that most of the as-prepared nanoparticles displayed well-defined core-shell structures. The CdS cores with diameter of ∼5 nm exhibited hexagonal crystal phase, the carbon shells with thickness of ∼2 nm acted as a good dispersion medium to prevent CdS particles from aggregation, and together with CdS effectively formed a monodisperse CdS-Carbon nanocomposite. This composite presented a remarkable fluorescence enhancement effect, which indicated that the prepared nanoparticles might be a promising photoresponsive material or biosensor. This improved pyrolysis method might also offer a facile way to prepare other carbon-coated semiconductor nanostructures. - Graphical abstract: We demonstrated a facile approach to synthesize well-dispersed carbon-coated CdS quantum dots. The as-prepared nanoparticles presented remarkable fluorescence enhancement effect. Highlights: → Carbon-coated CdS quantum dots were synthesized by an one-step pyrolysis method. → Well-dispersed CdS-carbon nanoparticles were obtained by an acid treatment process. → As-prepared nanoparticles presented remarkable fluorescence enhancement effect.

Effects of Different Doping Ratio of Cu Doped CdS on QDSCs Performance

Directory of Open Access Journals (Sweden)

Xiaojun Zhu

2015-01-01

Full Text Available We use the successive ionic layer adsorption and reaction (SILAR method for the preparation of quantum dot sensitized solar cells, to improve the performance of solar cells by doping quantum dots. We tested the UV-Vis absorption spectrum of undoped CdS QDSCs and Cu doped CdS QDSCs with different doping ratios. The doping ratios of copper were 1 : 100, 1 : 500, and 1 : 1000, respectively. The experimental results show that, under the same SILAR cycle number, Cu doped CdS quantum dot sensitized solar cells have higher open circuit voltage, short circuit current density photoelectric conversion efficiency than undoped CdS quantum dots sensitized solar cells. Refinement of Cu doping ratio are 1 : 10, 1 : 100, 1 : 200, 1 : 500, and 1 : 1000. When the proportion of Cu and CdS is 1 : 10, all the parameters of the QDSCs reach the minimum value, and, with the decrease of the proportion, the short circuit current density, open circuit voltage, and the photoelectric conversion efficiency are all increased. When proportion is 1 : 500, all parameters reach the maximum values. While with further reduction of the doping ratio of Cu, the parameters of QDSCs have a decline tendency. The results showed that, in a certain range, the lower the doping ratio of Cu, the better the performance of quantum dot sensitized solar cell.

Synthesis and characterization of TiO2/CdS core–shell nanorod arrays and their photoelectrochemical property

International Nuclear Information System (INIS)

Cao Chunlan; Hu Chenguo; Shen Weidong; Wang, Shuxia; Tian Yongshu; Wang Xue

2012-01-01

Highlights: ► TiO 2 /CdS core–shell nanorod arrays were fabricated by spin-SILAR method. ► The enhanced photocurrent was found in the TiO 2 /CdS core–shell nanorod arrays. ► The CdS coated on TiO 2 increases the e-h separation and enlarges light absorption range. - Abstract: TiO 2 /CdS core–shell nanorod arrays have been fabricated via a two-step method. Vertically aligned TiO 2 nanorod arrays (NRs) were synthesized by a facile hydrothermal method, and followed by depositing CdS nanoparticles on TiO 2 NRs by spin-coating successive ion layer adsorption and reaction (spin-SILAR) method. The surface morphology, structure, optical and photoelectrochemical behaviors of the core–shell NRs films are considered. The UV–vis absorption spectrum results suggested that the absorption peak of the TiO 2 /CdS core–shell NRs shifts from the ultraviolet region to the visible region in comparison to that of the pure TiO 2 NRs. The obviously enhanced photoelectrochemical (PEC) performances of the heterojunction NRs were found under illumination of the simulated sunlight in comparison with that of the TiO 2 NRs. The enhanced PEC performance and formation mechanism of TiO 2 /CdS core–shell NRs were discussed in detail.

Effect of Ag doping on opto-electrical properties of CdS thin films for solar cell applications

International Nuclear Information System (INIS)

Nazir, Adnan; Toma, Andrea; Shah, Nazar Abbas; Panaro, Simone; Butt, Sajid; Sagar, Rizwan ur Rehman; Raja, Waseem; Rasool, Kamran; Maqsood, Asghari

2014-01-01

Highlights: • Polycrystalline CdS thin films are fabricated by means of Close Spaced Sublimation technique. • Ag is doped by simple ion-exchange technique in order to reduce resistivity of CdS thin films. • Remarkable reduction in resistivity without introducing many transparency losses. - Abstract: Cadmium sulfide (CdS) polycrystalline thin films of different thicknesses (ranging from 370 nm to 750 nm) were fabricated on corning glass substrates using Close Spaced Sublimation (CSS) technique. Optical and electrical investigation revealed that CdS thin films show an appreciable transparency (50–70% transmission) in visible range and a highly resistive behavior (10 6 Ω cm). Samples were doped by silver (Ag) at different concentrations, using ion exchange technique, in order to reduce the resistivity of CdS thin films and to improve their efficiency as a window layer for solar cell application. The doping of Ag in pure CdS thin films resulted into an increase of surface roughness and a decrease both in electrical resistivity and in transparency. By optimizing annealing parameters, we were able to properly control the optical properties of the present system. In fact, the Ag doping of pure CdS films has led to a decrease of the sample resistivity by three orders of magnitude (10 3 Ω cm) against a 20% cut in optical transmission

Electroluminescent Cu-doped CdS quantum dots

NARCIS (Netherlands)

Stouwdam, J.W.; Janssen, R.A.J.

2009-01-01

Incorporating Cu-doped CdS quantum dots into a polymer host produces efficient light-emitting diodes. The Cu dopant creates a trap level that aligns with the valence band of the host, enabling the direct injection of holes into the quantum dots, which act as emitters. At low current densities, the

Characterization of chemically synthesized CdS nanoparticles

Indian Academy of Sciences (India)

Similar to the effects of charge carriers on optical properties, confinement of optical and acoustic phonons leads to interesting changes in the phonon spectra. In the present work, we have synthesized nanoparticles of CdS using chemical precipitation technique. The crystal structure and grain size of the particles are studied ...

In vitro and in vivo assessment of nanotoxicity of CdS quantum dot/aminopolysaccharide bionanoconjugates

International Nuclear Information System (INIS)

2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil); Department of Physiology and Biophysics, ICB, UFMG (Brazil))" data-affiliation=" (Center of Nanoscience, Nanotechnology, and Innovation-CeNano2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil); Department of Physiology and Biophysics, ICB, UFMG (Brazil))" >Carvalho, S.M. de; 2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil))" data-affiliation=" (Center of Nanoscience, Nanotechnology, and Innovation-CeNano2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil))" >Mansur, A.A.P.; 2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil))" data-affiliation=" (Center of Nanoscience, Nanotechnology, and Innovation-CeNano2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil))" >Mansur, H.S.; Guedes, M.I.M.C.; Lobato, Z.I.P.; Leite, M.F.

2017-01-01

The nanotoxicity of Cd-containing quantum dots (QDs) for biomedical applications is very controversial and not completely understood. In this study, we evaluated the cytotoxicity of surface-biofunctionalized CdS QDs with chitosan directly synthesized via aqueous route at room temperature. These core-shell CdS-chitosan nanoconjugates showed different degrees of cytotoxic responses using MTT cell proliferation assay toward three human cell cultures, human osteosarcoma cell line (SAOS), non-Hodgkin's B cell lymphoma (Toledo), and human embryonic kidney cell line (HEK293T), under three exposure times (1, 3, and 5 days) and three colloidal concentrations (10 nM, 50 nM, and 100 nM). The results clearly demonstrated that the CdS QDs, regardless to the fact that they were coated with a biocompatible aminopolysaccharide shell, induced a severe dose- and time-dependent inhibition of cell viability. In addition, the HEK293T and SAOS cell lines showed much more sensitive response compared to Toledo, which indicated that the cytotoxicity was also cell-type dependent. The exceptional resistance of Toledo cells to toxic effects of CdS nanoconjugates even at severe test conditions was assigned to specific role of B-lineage cells of the immune defense system. Remarkably, no conclusive evidence of toxicity of CdS nanoconjugates was observed in vivo using intravenous injections of CdS nanoconjugates in BALB/c mouse animal models for 30 days, but localized fluorescence was detected in ex-vivo liver tissue samples. Therefore, these results prove that there is no guarantee of “risk-free” use of CdS nanoconjugates for in vivo applications, even when functionalized with biopolymer ligands, as they can pose an excessive threat due to unpredicted and uncorrelated responses under in vitro and in vivo biological assays with highly toxic cadmium ions. - Graphical abstract: Biocompatible surface functionalization with aminopolysaccharide is not enough for assuring safe biomedical

In vitro and in vivo assessment of nanotoxicity of CdS quantum dot/aminopolysaccharide bionanoconjugates

Energy Technology Data Exchange (ETDEWEB)

Carvalho, S.M. de [Center of Nanoscience, Nanotechnology, and Innovation-CeNano" 2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil); Department of Physiology and Biophysics, ICB, UFMG (Brazil); Mansur, A.A.P. [Center of Nanoscience, Nanotechnology, and Innovation-CeNano" 2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil); Mansur, H.S., E-mail: hmansur@demet.ufmg.br [Center of Nanoscience, Nanotechnology, and Innovation-CeNano" 2I, Department of Metallurgical and Materials Engineering, Federal University of Minas Gerais, UFMG (Brazil); Guedes, M.I.M.C.; Lobato, Z.I.P. [Department of Preventive Veterinary Medicine, Veterinary School, UFMG (Brazil); Leite, M.F. [Department of Physiology and Biophysics, ICB, UFMG (Brazil)

2017-02-01

The nanotoxicity of Cd-containing quantum dots (QDs) for biomedical applications is very controversial and not completely understood. In this study, we evaluated the cytotoxicity of surface-biofunctionalized CdS QDs with chitosan directly synthesized via aqueous route at room temperature. These core-shell CdS-chitosan nanoconjugates showed different degrees of cytotoxic responses using MTT cell proliferation assay toward three human cell cultures, human osteosarcoma cell line (SAOS), non-Hodgkin's B cell lymphoma (Toledo), and human embryonic kidney cell line (HEK293T), under three exposure times (1, 3, and 5 days) and three colloidal concentrations (10 nM, 50 nM, and 100 nM). The results clearly demonstrated that the CdS QDs, regardless to the fact that they were coated with a biocompatible aminopolysaccharide shell, induced a severe dose- and time-dependent inhibition of cell viability. In addition, the HEK293T and SAOS cell lines showed much more sensitive response compared to Toledo, which indicated that the cytotoxicity was also cell-type dependent. The exceptional resistance of Toledo cells to toxic effects of CdS nanoconjugates even at severe test conditions was assigned to specific role of B-lineage cells of the immune defense system. Remarkably, no conclusive evidence of toxicity of CdS nanoconjugates was observed in vivo using intravenous injections of CdS nanoconjugates in BALB/c mouse animal models for 30 days, but localized fluorescence was detected in ex-vivo liver tissue samples. Therefore, these results prove that there is no guarantee of “risk-free” use of CdS nanoconjugates for in vivo applications, even when functionalized with biopolymer ligands, as they can pose an excessive threat due to unpredicted and uncorrelated responses under in vitro and in vivo biological assays with highly toxic cadmium ions. - Graphical abstract: Biocompatible surface functionalization with aminopolysaccharide is not enough for assuring safe biomedical

A systematic review comparing open-book and closed-book examinations: Evaluating effects on development of critical thinking skills.

Science.gov (United States)

Johanns, Beth; Dinkens, Amber; Moore, Jill

2017-11-01

The advantages of using traditional closed-book examinations are closely compared to the advantages of using open-book examinations for the development of critical thinking skills in nursing students. The use of critical thinking skills is vital among nurses to assess patient needs and modify standard approaches to individualize care for better patient outcomes. The following areas are compared and contrasted for both closed-book and open-book examinations: examination preparation, rote memorization versus active learning, intellectual engagement, simulation of working environment, higher order thinking skills, anxiety reduction and student satisfaction. During investigation of closed-book examinations and open-book examinations, the use of collaborative testing was unveiled. Collaborative testing combines areas from both closed-book and open-book examinations. Based on the systematic review of literature, the recommendation is to use a mixed method of examination types throughout the course of the nursing program. Each type of examination helps develop different skill sets in the nursing student. Copyright © 2017 Elsevier Ltd. All rights reserved.

Cutting edge intermediate : student's book

CERN Document Server

Cunningham, Sarah

2004-01-01

A focus on high-frequency useful vocabulary helps students say what they want to say. Regular, well-structured speaking tasks encourage students to express themselves more extensively and fluently. ‘Do You Remember’ sections in every unit and extra. Consolidation modules provide regular review and consolidation Student Books include Mini-Dictionary to help learners study independently.

Planar heterojunction perovskite solar cell based on CdS electron transport layer

KAUST Repository

Abulikemu, Mutalifu

2017-07-02

We report on planar heterojunction perovskite solar cells employing a metal chalcogenide (CdS) electron transport layer with power conversion efficiency up to 10.8%. The CdS layer was deposited via solution-process chemical bath deposition at low-temperature (60°C). Pinhole-free and uniform thin films were obtained with good structural, optical and morphological properties. An optimal layer thickness of 60nm yielded an improved open-circuit voltage and fill factor compared to the standard TiO2-based solar cells. Devices showed a higher reproducibility of the results compared to TiO2-based ones. We also tested the effect of annealing temperature on the CdS film and the effect of CdCl2 treatment followed by high temperature annealing (410°C) that is expected to passivate the surface, thus eliminating eventual trap-states inducing recombination.

Planar heterojunction perovskite solar cell based on CdS electron transport layer

KAUST Repository

Abulikemu, Mutalifu; Barbe, Jeremy; El Labban, Abdulrahman; Eid, Jessica; Del Gobbo, Silvano

2017-01-01

We report on planar heterojunction perovskite solar cells employing a metal chalcogenide (CdS) electron transport layer with power conversion efficiency up to 10.8%. The CdS layer was deposited via solution-process chemical bath deposition at low-temperature (60°C). Pinhole-free and uniform thin films were obtained with good structural, optical and morphological properties. An optimal layer thickness of 60nm yielded an improved open-circuit voltage and fill factor compared to the standard TiO2-based solar cells. Devices showed a higher reproducibility of the results compared to TiO2-based ones. We also tested the effect of annealing temperature on the CdS film and the effect of CdCl2 treatment followed by high temperature annealing (410°C) that is expected to passivate the surface, thus eliminating eventual trap-states inducing recombination.

Enhanced Photovoltaic Properties of the Solar Cells Based on Cosensitization of CdS and Hydrogenation

Directory of Open Access Journals (Sweden)

Hongcai He

2015-01-01

Full Text Available The hydrogenated TiO2 porous nanocrystalline film is modified with CdS quantum dots by successive ionic layer adsorption and reaction (SILAR method to prepare the cosensitized TiO2 solar cells by CdS quantum dots and hydrogenation. The structure and topography of the composite photoanode film were confirmed by X-ray diffraction and scanning electron microscopy. With deposited CdS nanoparticles, UV absorption spectra of H:TiO2 photoanode film indicated a considerably enhanced absorption in the visible region. The cosensitized TiO2 solar cell by CdS quantum dots and hydrogenation presents much better photovoltaic properties than either CdS sensitized TiO2 solar cells or hydrogenated TiO2 solar cells, which displays enhanced photovoltaic performance with power conversion efficiency (η of 1.99% (Jsc=6.26 mA cm−2, Voc=0.65 V, and FF = 0.49 under full one-sun illumination. The reason for the enhanced photovoltaic performance of the novel cosensitized solar cell is primarily explained by studying the Nyquist spectrums, IPCE spectra, dark current, and photovoltaic performances.

Dispelling Five Myths about E-books

Directory of Open Access Journals (Sweden)

James E. Gall

2005-03-01

Full Text Available Some considered 2000 the year of the e-book, and due tothe dot-com bust, that could have been the format’s highwater mark. However, the first quarter of 2004 saw thegreatest number of e-book purchases ever with more than$3 million in sales. A 2002 consumer survey found that67 percent of respondents wanted to read e-books; 62 percent wanted access to e-books through a library.Unfortunately, the large amount of information writtenon e-books has begun to develop myths around their use,functionality, and cost. The author suggests that thesemyths may interfere with the role of libraries in helpingto determine the future of the medium and access to it.Rather than fixate on the pros and cons of current versions of e-book technology, it is important for librarians tostay engaged and help clarify the role of digital documents in the modern library.

Internet-Based Self-Help Intervention for ICD-11 Adjustment Disorder: Preliminary Findings.

Science.gov (United States)

Eimontas, Jonas; Rimsaite, Zivile; Gegieckaite, Goda; Zelviene, Paulina; Kazlauskas, Evaldas

2018-06-01

Adjustment disorder is one of the most diagnosed mental disorders. However, there is a lack of studies of specialized internet-based psychosocial interventions for adjustment disorder. We aimed to analyze the outcomes of an internet-based unguided self-help psychosocial intervention BADI for adjustment disorder in a two armed randomized controlled trial with a waiting list control group. In total 284 adult participants were randomized in this study. We measured adjustment disorder as a primary outcome, and psychological well-being as a secondary outcome at pre-intervention (T1) and one month after the intervention (T2). We found medium effect size of the intervention for the completer sample on adjustment disorder symptoms. Intervention was effective for those participants who used it at least one time in 30-day period. Our results revealed the potential of unguided internet-based self-help intervention for adjustment disorder. However, high dropout rates in the study limits the generalization of the outcomes of the intervention only to completers.

Structural and optical properties of nano-structured CdS thin films prepared by chemical bath deposition

Energy Technology Data Exchange (ETDEWEB)

Bai, Rekha, E-mail: rekha.mittal07@gmail.com; Kumar, Dinesh; Chaudhary, Sujeet; Pandya, Dinesh K. [Thin Film Laboratory, Physics Department, Indian Institute of Technology Delhi, New Delhi-110016 (India)

2016-05-06

Cadmium sulfide (CdS) thin films have been deposited on conducting glass substrates by chemical bath deposition (CBD) technique. The effect of precursor concentration on the structural, morphological, compositional, and optical properties of the CdS films has been studied. Crystal structure of these CdS films is characterized by X-ray diffraction (XRD) and it reveals polycrystalline structure with mixture of cubic and wurtzite phases with grain size decreasing as precursor concentration is increased. Optical studies reveal that the CdS thin films have high transmittance in visible spectral region reaching 90% and the films possess direct optical band gap that decreases from 2.46 to 2.39 eV with decreasing bath concentration. Our study suggests that growth is nucleation controlled.

Chemical synthesis of CdS onto TiO2 nanorods for quantum dot sensitized solar cells

Science.gov (United States)

Pawar, Sachin A.; Patil, Dipali S.; Lokhande, Abhishek C.; Gang, Myeng Gil; Shin, Jae Cheol; Patil, Pramod S.; Kim, Jin Hyeok

2016-08-01

A quantum dot sensitized solar cell (QDSSC) is fabricated using hydrothermally grown TiO2 nanorods and successive ionic layer adsorption and reaction (SILAR) deposited CdS. Surface morphology of the TiO2 films coated with different SILAR cycles of CdS is examined by Scanning Electron Microscopy which revealed aggregated CdS QDs coverage grow on increasing onto the TiO2 nanorods with respect to cycle number. Under AM 1.5G illumination, we found the TiO2/CdS QDSSC photoelectrode shows a power conversion efficiency of 1.75%, in an aqueous polysulfide electrolyte with short-circuit photocurrent density of 4.04 mA/cm2 which is higher than that of a bare TiO2 nanorods array.

Structural and optical properties of nano-structured CdS thin films prepared by chemical bath deposition

International Nuclear Information System (INIS)

Bai, Rekha; Kumar, Dinesh; Chaudhary, Sujeet; Pandya, Dinesh K.

2016-01-01

Cadmium sulfide (CdS) thin films have been deposited on conducting glass substrates by chemical bath deposition (CBD) technique. The effect of precursor concentration on the structural, morphological, compositional, and optical properties of the CdS films has been studied. Crystal structure of these CdS films is characterized by X-ray diffraction (XRD) and it reveals polycrystalline structure with mixture of cubic and wurtzite phases with grain size decreasing as precursor concentration is increased. Optical studies reveal that the CdS thin films have high transmittance in visible spectral region reaching 90% and the films possess direct optical band gap that decreases from 2.46 to 2.39 eV with decreasing bath concentration. Our study suggests that growth is nucleation controlled.

Porous TiO_2 nanofibers decorated CdS nanoparticles by SILAR method for enhanced visible-light-driven photocatalytic activity

International Nuclear Information System (INIS)

Tian, Fengyu; Hou, Dongfang; Hu, Fuchao; Xie, Kui; Qiao, Xiuqing; Li, Dongsheng

2017-01-01

Graphical abstract: A heterojunction photocatalyst with CdS Nanoparticles self-assembled via SILAR Method at surfaces of electrospun TiO2 nanofibers shows enhanced visible-light photocatalytic activities. - Highlights: • Combined electrospinning and successive ionic layer adsorption and reaction process. • Pouous TiO_2 nanofibers decorated CdS nanoparticles. • Synergetic effect of photosensitization and heterojunction. - Abstract: 1D porous CdS nanoparticles/TiO_2 nanofibers heterostructure has been fabricated via simple electrospinning and a successive ionic layer adsorption and reaction (SILAR) process. The morphology, composition, and optical properties of the resulting CdS/TiO_2 heterostructures can be rationally tailored through changing the SILAR cycles. The photocatalytic hydrogen evolution and decomposition of rhodamine B (RhB) of the as-synthesized heterostructured photocatalysts were investigated under visible light irradiation. Compared to TiO_2 nanofibers，the as-obtained CdS/TiO_2 heterostructures exhibit enhanced photocatalytic activity for hydrogen production and decomposition of RhB under visible-light irradiation. The heterojunction system performs best with H_2 generation rates of 678.61 μmol h"−"1 g"−"1 under visible light irradiation which benefits from the two effects: (a) the 1D porous nanofibrous morphology contributes to not only more active sites but also more efficient transfer of the photogenerated charges (b) the synergetic effect of heterojunction and photosensitization reducing the recombination of photogenerated electrons and holes.

When Ideals Get in the Way of Self-Care: Perfectionism and Self-Stigma for Seeking Psychological Help among High School Students

Science.gov (United States)

Zeifman, Richard J.; Atkey, Sarah K.; Young, Rebecca E.; Flett, Gordon L.; Hewitt, Paul L.; Goldberg, Joel O.

2015-01-01

In the current study, we investigated whether adolescents high in perfectionism are prone to experiencing self-stigma for seeking psychological help. This work is based on the premise that the need to seek help for psychological difficulties is not consistent with idealistic personal goals of perfectionistic young people and their desire to retain…

English grammar in use a self-study reference and practice book for intermediate learners of English : with answers and CD-ROM

CERN Document Server

Murphy, Raymond

2012-01-01

English Grammar in Use Fourth edition is an updated version of the world's best-selling grammar title. It has a fresh, appealing new design and clear layout, with revised and updated examples, but retains all the key features of clarity and accessibility that have made the book popular with millions of learners and teachers around the world. The CD-ROM contains lots of additional practice exercises to consolidate learning, ideal for self-study but also suitable for reinforcement work in the classroom. An online version and book without answers are available separately.

The Progress of Students Reading Comprehension through Wordless Picture Books

Science.gov (United States)

Lubis, Romaida

2018-01-01

Wordless picture book is an unique book that could help the young learner to get their literacy. The content of the wordless picture book must be communicated through the visual of the illustration. This research discusses a case study of how a kid of six years old produce his narrative through wordless picture book. The kid was allowed to see and…

Book Review:

Science.gov (United States)

Chrusciel, P. T.

2006-06-01

academic curriculi that Chapter I is needed at all. This is in fact the chapter that I liked least in the book. The presentation has the right balance between formal definitions and introductory comments to make the book accessible for self-study. Most definitions are followed by excellent examples, though this is not uniform: more examples would have been helpful in several places, both in case of self-study and to make life easier for someone lecturing from this book. The most notable lacuna is (essentially) the lack of exercises: surely there would have been many worked out during the course at Imperial, and it is a pity that they have not been included in the book. I very much hope that there will be a further edition with lots of examples and exercises (note that the latter can also play the former role), making this work even more useful. The first chapter of the book is a crash course on topology, covering metric spaces, orders, lattices, convergence, compactness, as well as separation axioms. The introduction of filters might be seen as unnecessarily advanced, in view of a few notable gaps: the first of those concerns connectedness, which lies at the heart of many proofs, and which is only mentioned in a footnote on page 61; it deserves a small subsection of its own. The second gap is paracompactness, related to existence of partitions of unity, which is a key to several constructions on manifolds; again the notion only appears as a footnote on page 231. A short discussion of the Kuratowski Zorn lemma might have been useful. Fortunately, the students that are likely to come to my office will already be familiar with the material in this chapter (and more, as far as topology is concerned), so this is not really an issue from my point of view. On the other hand, it could be one for somebody lecturing from this book. In the two following chapters the notion of a manifold is introduced, with a careful discussion of tangent space, vector fields and their flows

Money and violence : financial self-help groups in a South African township

NARCIS (Netherlands)

Bähre, Erik

2007-01-01

This ethnography is about the way in which Xhosa migrants in the townships of Cape Town, South Africa, collectively manage their money in financial self-help groups, also known as financial mutuals. This is an umbrella term for a myriad of collective financial arrangements that are mostly informal.

The Influence of Student Learning Characteristics on Purchase of Paper Book and eBook for University Study and Personal Interest

Science.gov (United States)

Johnson, Genevieve Marie

2016-01-01

First-year university students (n = 199) completed an online questionnaire that queried their purchase of paper books and eBooks for university study and personal interest. The questionnaire also required students to rate their learning characteristics including reading strategies, study self-regulation, learning control beliefs and achievement…

Benefits of Giving (A Book Review Using Islamic Perspective

Directory of Open Access Journals (Sweden)

M. Hamdar Arraiyyah

2016-01-01

Full Text Available This writing is a book review. It discusses a book entitled Give and Take. The book introduces a new approach to success. It makes three categories of people in doing interaction or communication. They are takers, matchers, and givers. The writer of the book, Adam Grant, explains the principles and characteristics of each category. He shows a lot of facts to prove that being a giver brings benefits for people and the doer as well. The objects of giving here comprise different kinds help like wealth, ideas, knowledge, skills and information. Therefore, he motivates people to become givers. In this connection, the reviewer would like to show that Islamic religion also motivates its followers to give helps to others. Though, there are some similarities and differences between the benefits of giving mentioned in the book and the verses of the Holy Qur’an and the sayings of Prophet Muhammad Peace be upon him.

The structural properties of CdS deposited by chemical bath deposition and pulsed direct current magnetron sputtering

Energy Technology Data Exchange (ETDEWEB)

Lisco, F., E-mail: F.Lisco@lboro.ac.uk [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire, LE11 3TU (United Kingdom); Kaminski, P.M.; Abbas, A.; Bass, K.; Bowers, J.W.; Claudio, G. [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire, LE11 3TU (United Kingdom); Losurdo, M. [Institute of Inorganic Methodologies and of Plasmas, IMIP-CNR, via Orabona 4, 70126 Bari (Italy); Walls, J.M. [Centre for Renewable Energy Systems Technology (CREST), School of Electronic, Electrical and Systems Engineering, Loughborough University, Leicestershire, LE11 3TU (United Kingdom)

2015-05-01

Cadmium sulphide (CdS) thin films were deposited by two different processes, chemical bath deposition (CBD), and pulsed DC magnetron sputtering (PDCMS) on fluorine doped-tin oxide coated glass to assess the potential advantages of the pulsed DC magnetron sputtering process. The structural, optical and morphological properties of films obtained by CBD and PDCMS were investigated using X-ray photoelectron spectroscopy, X-ray diffraction, scanning and transmission electron microscopy, spectroscopic ellipsometry and UV-Vis spectrophotometry. The as-grown films were studied and comparisons were drawn between their morphology, uniformity, crystallinity, and the deposition rate of the process. The highest crystallinity is observed for sputtered CdS thin films. The absorption in the visible wavelength increased for PDCMS CdS thin films, due to the higher density of the films. The band gap measured for the as-grown CBD-CdS is 2.38 eV compared to 2.34 eV for PDCMS-CdS, confirming the higher density of the sputtered thin film. The higher deposition rate for PDCMS is a significant advantage of this technique which has potential use for high rate and low cost manufacturing. - Highlights: • Pulsed DC magnetron sputtering (PDCMS) of CdS films • Chemical bath deposition of CdS films • Comparison between CdS thin films deposited by chemical bath and PDCMS techniques • High deposition rate deposition for PDCMS deposition • Uniform, pinhole free CdS thin films.

The structural properties of CdS deposited by chemical bath deposition and pulsed direct current magnetron sputtering

International Nuclear Information System (INIS)

Lisco, F.; Kaminski, P.M.; Abbas, A.; Bass, K.; Bowers, J.W.; Claudio, G.; Losurdo, M.; Walls, J.M.

2015-01-01

Cadmium sulphide (CdS) thin films were deposited by two different processes, chemical bath deposition (CBD), and pulsed DC magnetron sputtering (PDCMS) on fluorine doped-tin oxide coated glass to assess the potential advantages of the pulsed DC magnetron sputtering process. The structural, optical and morphological properties of films obtained by CBD and PDCMS were investigated using X-ray photoelectron spectroscopy, X-ray diffraction, scanning and transmission electron microscopy, spectroscopic ellipsometry and UV-Vis spectrophotometry. The as-grown films were studied and comparisons were drawn between their morphology, uniformity, crystallinity, and the deposition rate of the process. The highest crystallinity is observed for sputtered CdS thin films. The absorption in the visible wavelength increased for PDCMS CdS thin films, due to the higher density of the films. The band gap measured for the as-grown CBD-CdS is 2.38 eV compared to 2.34 eV for PDCMS-CdS, confirming the higher density of the sputtered thin film. The higher deposition rate for PDCMS is a significant advantage of this technique which has potential use for high rate and low cost manufacturing. - Highlights: • Pulsed DC magnetron sputtering (PDCMS) of CdS films • Chemical bath deposition of CdS films • Comparison between CdS thin films deposited by chemical bath and PDCMS techniques • High deposition rate deposition for PDCMS deposition • Uniform, pinhole free CdS thin films

Growth of CdS thin films on indium coated glass substrates via chemical bath deposition and subsequent air annealing

Energy Technology Data Exchange (ETDEWEB)

Ghosh, Biswajit; Kumar, Kamlesh; Singh, Balwant Kr; Banerjee, Pushan; Das, Subrata, E-mail: neillohit@yahoo.co.in

2014-11-30

Graphical abstract: - Highlights: • CdS film grown on indium coated glass substrates via CBD and subsequent annealing. • Disappearance of the indium (1 1 2) peak confirms interdiffusion at 300 °C. • SIMS indicates the subsequent interdiffusion at progressively higher temperature. • Composite In–CdS layer showed lower photosensitivity compared to pure CdS. - Abstract: In the present work attempts were made to synthesize indium doped CdS films by fabricating In/CdS bilayers using CBD-CdS on vacuum evaporated In thin films and subsequent air annealing. 135 nm CdS films were grown onto 20 nm and 35 nm indium coated glass substrate employing chemical bath deposition technique. The In/CdS bilayers thus formed were subjected to heat treatment at the temperatures between 200 and 400 °C for 4 min in the muffle furnace to facilitate indium to diffuse into the CdS films. XRD pattern ascertained no noticeable shift in lattice constant implying grain boundary metal segregation, while secondary ion mass spectrometry indicated the diffusion profile of indium into CdS matrices. Mass spectrometry results showed that substantial diffusion of indium had been taken place within CdS at 400 °C. Dark and photocurrent with different illumination time were measured to ascertain the photosensitivity of pure and composite CdS films.

Synthesis of poly (3-hexyl thiophene-2,5-diyl) in presence of CdS nanoparticles: microscopic and spectroscopic studies

Energy Technology Data Exchange (ETDEWEB)

Nicho, M. E.; Jaimes, W. [Universidad Autonoma del Estado de Morelos, Centro de Investigacion en Ingenierias y Ciencias Aplicadas, Av. Universidad 1001, Col. Chamilpa, 62209 Cuernavaca, Morelos (Mexico); Rivas A, M. E.; Quevedo L, M. A. [University of Texas at Dallas, Department of Materials Science and Engineering, 800 West Campbell Road, Richardson, Texas 75252 (United States); Hu, H., E-mail: menicho@uaem.mx [UNAM, Instituto de Energias Renovables, 62580 Temixco, Morelos (Mexico)

2017-11-01

In this paper, the synthesis of nano composites of poly(3-hexyl thiophene-2,5-diyl) (P3HT) and cadmium sulfide (CdS) nanoparticles are reported. CdS nanoparticles were first synthesized using chemical precipitation. Then P3HT was synthesized by direct oxidation of 3-hexyl thiophene with FeCl{sub 3} as oxidant in presence of CdS nanoparticles. The goal of this work was to investigate the effect of the CdS nanoparticles during the synthesis of P3HT. The resulting films of P3HT/CdS nano composites were investigated by Fourier Transform Infrared Spectroscopy (Ft-IR), Ultraviolet-Visible Spectroscopy (UV-Vis), X-ray diffraction, Transmission electron microscopy (Tem), Atomic force microscopy (AFM) and Scanning electron microscopy (Sem). Homogeneous distribution of CdS nanoparticles in P3HT was demonstrated by Sem, AFM and Tem. Ft-IR analysis showed interaction between CdS and the S atoms of the thiophene rings. This result, together with UV-Vis spectra and XRD pattern suggest a better arrangement of the polymer chains. It is possible that the CdS nanoparticles are coupled with the unpaired electrons of S atoms in the thiophene rings through the positive delocalized charge, resulting in a more ordered P3HT polymer matrix with embedded CdS nanoparticles. (Author)

Effect of precursor concentration, temperature and capping group on the morphology of CdS nanoparticles

CSIR Research Space (South Africa)

Moloto, N

2008-01-01

Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

CdS nanobubbles and Cd-DMS nanosheets: solvothermal synthesis and formation mechanism.

Science.gov (United States)

Feng, Miao; Zhan, Hongbing

2013-02-01

CdS nanobubbles and Cd-DMS nanosheets have been prepared by a solvothermal method from a solution of Cd2+ in dimethyl sulfoxide in the absence of elemental S. A formation mechanism for the nanobubble morphology arising during the CdS nanocrystal growth has been proposed, based on the results of transmission electron microscopy and photoluminescence spectrophotometry. The correlation of the morphology with reaction time was also suggested, and may be applicable to the solvothermal synthesis of other nanomaterials.

When self-reliance is not safe: associations between reduced help-seeking and subsequent mental health symptoms in suicidal adolescents.

Science.gov (United States)

Labouliere, Christa D; Kleinman, Marjorie; Gould, Madelyn S

2015-04-01

The majority of suicidal adolescents have no contact with mental health services, and reduced help-seeking in this population further lessens the likelihood of accessing treatment. A commonly-reported reason for not seeking help is youths' perception that they should solve problems on their own. In this study, we explore associations between extreme self-reliance behavior (i.e., solving problems on your own all of the time), help-seeking behavior, and mental health symptoms in a community sample of adolescents. Approximately 2150 adolescents, across six schools, participated in a school-based suicide prevention screening program, and a subset of at-risk youth completed a follow-up interview two years later. Extreme self-reliance was associated with reduced help-seeking, clinically-significant depressive symptoms, and serious suicidal ideation at the baseline screening. Furthermore, in a subset of youth identified as at-risk at the baseline screening, extreme self-reliance predicted level of suicidal ideation and depressive symptoms two years later even after controlling for baseline symptoms. Given these findings, attitudes that reinforce extreme self-reliance behavior may be an important target for youth suicide prevention programs. Reducing extreme self-reliance in youth with suicidality may increase their likelihood of appropriate help-seeking and concomitant reductions in symptoms.

When Self-Reliance Is Not Safe: Associations between Reduced Help-Seeking and Subsequent Mental Health Symptoms in Suicidal Adolescents

Directory of Open Access Journals (Sweden)

Christa D. Labouliere

2015-04-01

Full Text Available The majority of suicidal adolescents have no contact with mental health services, and reduced help-seeking in this population further lessens the likelihood of accessing treatment. A commonly-reported reason for not seeking help is youths’ perception that they should solve problems on their own. In this study, we explore associations between extreme self-reliance behavior (i.e., solving problems on your own all of the time, help-seeking behavior, and mental health symptoms in a community sample of adolescents. Approximately 2150 adolescents, across six schools, participated in a school-based suicide prevention screening program, and a subset of at-risk youth completed a follow-up interview two years later. Extreme self-reliance was associated with reduced help-seeking, clinically-significant depressive symptoms, and serious suicidal ideation at the baseline screening. Furthermore, in a subset of youth identified as at-risk at the baseline screening, extreme self-reliance predicted level of suicidal ideation and depressive symptoms two years later even after controlling for baseline symptoms. Given these findings, attitudes that reinforce extreme self-reliance behavior may be an important target for youth suicide prevention programs. Reducing extreme self-reliance in youth with suicidality may increase their likelihood of appropriate help-seeking and concomitant reductions in symptoms.

Role for a sense of self-worth in weight-loss treatments: helping patients develop self-efficacy.

Science.gov (United States)

Cochrane, Gordon

2008-04-01

To recommend strategies for enhancing patients' sense of self-worth and self-efficacy in order to give them sufficient faith in themselves to make healthier choices about their weight. PubMed, PsycINFO, Google Scholar, and APA Journals Online were searched for original research articles on treatment models and outcome review articles from 1960 to the present. Key search terms were weight loss, weight-loss treatments, diets and weight loss, psychology and obesity, physiology and obesity, and exercise and weight loss. Most evidence was level I and level II. In spite of extensive research, there is widespread belief that the medical system has failed to stem the tide of weight gain in North America. The focus has been on physiologic, behavioural, and cultural explanations for what is seen as a relatively recent phenomenon, while the self-perception of overweight individuals has been largely overlooked. Professional treatments have consisted mainly of cognitive behavioural therapies and rest on the premise that overweight patients will effectively apply the cognitive behavioural therapy principles. In the long run, professional and commercial programs are often ineffective. We need treatments that include strategies to repair ego damage, enhance the sense of self-worth, and develop self-efficacy so that overweight patients can become the agents of change in their pursuit of well-being. Self-efficacy correlates positively with success in all realms of personal endeavour, and we can help our overweight patients become more self-reliant.

Enhanced Performance of DSSCs Based on the Insertion Energy Level of CdS Quantum Dots

Directory of Open Access Journals (Sweden)

Xiaoping Zou

2014-01-01

Full Text Available Cadmium sulfide (CdS quantum dots (QDs are assembled onto the TiO2 films by chemical bath deposition method (CBD. And the QDs size is controlled by the times of CBD cycles. They are characterized by UV-visible absorption. To avoid the photo corrosion and electrolyte corrosion, CdS and N719 are sequentially assembled onto the nanocrystalline TiO2 films to prepare a CdS/N719 cosensitized photo electrode for the dye-sensitized solar cells. In the structure of TiO2/CdS/N719 electrode, the reorganization of energy levels between CdS and N719 forms a stepwise structure of band-edge levels which is advantageous to the electron injection and hole recovery of CdS and N719 QDs. The open circuit voltage (Voc, short circuit current density (Jsc, and efficiency are increased.

Why Aren't E-Books Gaining More Ground in Academic Libraries? E-Book Use and Perceptions: A Review of Published Literature and Research

Science.gov (United States)

Slater, Robert

2010-01-01

E-books have yet to assume a significant place in academic library collections. This article focuses on extracting common themes from the literature that might help the reader better understand why e-books have not yet become the cornerstone of the academic library. Patrons do not use e-books because they find the experience of using e-books…

Complete electronics self-teaching guide with projects

CERN Document Server

Boysen, Earl

2012-01-01

An all-in-one resource on everything electronics-related! For almost 30 years, this book has been a classic text for electronics enthusiasts. Now completely updated for today's technology, this latest version combines concepts, self-tests, and hands-on projects to offer you a completely repackaged and revised resource. This unique self-teaching guide features easy-to-understand explanations that are presented in a user-friendly format to help you learn the essentials you need to work with electronic circuits. All you need is a general understanding of electronics concepts such as Oh

NJ transportation fact book, 2007

Science.gov (United States)

2010-01-01

The New Jersey Transportation Fact Book 2006-07 presents information about the New Jersey Department of Transportation : and other agencies that provide transportation services in New Jersey. We hope it will prove helpful.

Synthesis and characterization of CdS nanocrystallites and OMWCNT-supported cadmium sulfide composite and their photocatalytic activity under visible light irradiation

International Nuclear Information System (INIS)

Pawar, Amol S.; Garje, Shivram S.; Revaprasadu, Neerish

2016-01-01

CdS nanocrystallites and CdS- oxidized multiwalled carbon nanotubes (OMWCNT) composite were prepared by the solvothermal decomposition of a single-source molecular precursor, [Cd(pip.dtc) 2 ] (pip.dtc = piperidine dithiocarbamate) in the presence of ethylene glycol. The as prepared CdS nanocrystallites and CdS-OMWCNT composite were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDX), transmission electron microscopy (TEM), UV-vis and Raman spectroscopy. Peak broadening in the XRD shows the formation of nanocrystalline CdS. TEM images of CdS nanocrystallites revealed the nearly spherical shape morphology of the particles, whereas, TEM images of composite showed the deposition of CdS nanocrystallites on the OMWCNT. EDX measurements matches with a 1:1 stoichiometry of Cd and S in CdS nanocrystallites, whereas, that of the composite showed the presence of Cd and S along with C. The vibrational properties of CdS nanocrystallites and their composite with OMWCNT were studied by Raman spectroscopy. Furthermore, the photocatalytic activity studies for the degradation of methylene blue under visible light irradiation using these materials were carried out. The surface area calculated using BET surface analyzer for CdS-OMWCNT composite (148.31 m 2 /g) was found to be more compared to bare CdS nanocrystallites (56.78 m 2 /g). The CdS-OMWCNT composite exhibited very good photocatalytic activity for the degradation of methylene blue under visible light irradiation which has been attributed to the increased surface area and synergistic effect in the composite compared to bare CdS nanocrystallites. - Highlights: • The carbon based nanocomposite of CdS (CdS-OMWCNT) have been prepared. • Simple solvothermal decomposition method has been used. • Single-source molecular precursor in presence of carbon nanotubes has been employed. • The photocatalytic activity of CdS NPs and CdS-OMWCNT composite have been

Cross-Cultural Validity of the Self-Stigma of Seeking Help (SSOSH) Scale: Examination across Six Nations

Science.gov (United States)

Vogel, David L.; Armstrong, Patrick Ian; Tsai, Pei-Chun; Wade, Nathaniel G.; Hammer, Joseph H.; Efstathiou, Georgios; Holtham, Elizabeth; Kouvaraki, Elli; Liao, Hsin-Ya; Shechtman, Zipora; Topkaya, Nursel

2013-01-01

Researchers have found that the stigma associated with seeking therapy--particularly self-stigma--can inhibit the use of psychological services. Yet, most of the research on self-stigma has been conducted in the United States. This is a considerable limitation, as the role of self-stigma in the help-seeking process may vary across cultural groups.…

Au Nanoparticles as Interfacial Layer for CdS Quantum Dot-sensitized Solar Cells

Directory of Open Access Journals (Sweden)

Zhu Guang

2010-01-01

Full Text Available Abstract Quantum dot-sensitized solar cells based on fluorine-doped tin oxide (FTO/Au/TiO2/CdS photoanode and polysulfide electrolyte are fabricated. Au nanoparticles (NPs as interfacial layer between FTO and TiO2 layer are dip-coated on FTO surface. The structure, morphology and impedance of the photoanodes and the photovoltaic performance of the cells are investigated. A power conversion efficiency of 1.62% has been obtained for FTO/Au/TiO2/CdS cell, which is about 88% higher than that for FTO/TiO2/CdS cell (0.86%. The easier transport of excited electron and the suppression of charge recombination in the photoanode due to the introduction of Au NP layer should be responsible for the performance enhancement of the cell.

Enhancing Worker Health Through Clinical Decision Support (CDS): An Introduction to a Compilation.

Science.gov (United States)

Filios, Margaret S; Storey, Eileen; Baron, Sherry; Luensman, Genevieve B; Shiffman, Richard N

2017-11-01

This article outlines an approach to developing clinical decision support (CDS) for conditions related to work and health. When incorporated in electronic health records, such CDS will assist primary care providers (PCPs) care for working patients. Three groups of Subject Matter Experts (SMEs) identified relevant clinical practice guidelines, best practices, and reviewed published literature concerning work-related asthma, return-to-work, and management of diabetes at work. SMEs developed one recommendation per topic that could be supported by electronic CDS. Reviews with PCPs, staff, and health information system implementers in five primary care settings confirmed that the approach was important and operationally sound. This compendium is intended to stimulate a dialogue between occupational health specialists and PCPs that will enhance the use of work information about patients in the primary care setting.

Shape and phase control of CdS nanocrystals using cationic surfactant in noninjection synthesis

Directory of Open Access Journals (Sweden)

Zou Yu

2011-01-01

Full Text Available Abstract Monodispersed CdS nanocrystals with controllable shape and phase have been successfully synthesized in this study by adding cationic surfactant in noninjection synthesis system. With the increase of the amount of cetyltrimethylammonium chloride (CTAC added, the shape of the CdS nanocrystals changed from spherical to multi-armed, and the phase changed from zinc-blende to wurtzite. It was found that halide ion Cl- plays a key role in the transformation, and other halide ions such as Br- can also induce similar transformation. We proposed that the strong binding between Cd2+ and halide ions reduced the reactivity of the precursors, decreased the nuclei formed in the nucleation stage, and led to the high concentration of precursor in the growth stage, resulting in the increase of size and phase transformation of CdS nanocrystals. In addition, it was found that the multi-armed CdS nanocrystals lost quantum confinement effect because of the increase of the size with the increase of the concentration of CTAC.

Help from home for depression: A randomised controlled trial comparing internet-delivered cognitive behaviour therapy with bibliotherapy for depression

Directory of Open Access Journals (Sweden)

Jessica Smith

2017-09-01

Full Text Available Major Depressive Disorder (MDD is a leading cause of the Global Burden of Disease. Cognitive Behavioural Therapy (CBT is an effective treatment for MDD, but access can be impaired due to numerous barriers. Internet-delivered CBT (iCBT can be utilised to overcome treatment barriers and is an effective treatment for depression, but has never been compared to bibliotherapy. This Randomised Controlled Trial (RCT included participants meeting diagnostic criteria for MDD (n = 270 being randomised to either: iCBT (n = 61, a CBT self-help book (bCBT (n = 77, a meditation self-help book (bMED (n = 64 or wait-list control (WLC (n = 68. The primary outcome was the Patient Health Questionnaire 9-item scale (PHQ-9 at 12-weeks (post-treatment. All three active interventions were significantly more effective than WLC in reducing depression at post-treatment, but there were no significant differences between the groups. All three interventions led to large within-group reductions in PHQ-9 scores at post-treatment (g = 0.88–1.69, which were maintained at 3-month follow-up, although there was some evidence of relapse in the bMED group (within-group g [post to follow-up] = 0.09–1.04. Self-help based interventions could be beneficial in treating depression, however vigilance needs to be applied when selecting from the range of materials available. Replication of this study with a larger sample is required.

Chemical Bath Deposition and Characterization of CdS layer for CZTS Thin Film Solar Cell

OpenAIRE

Kamal, Tasnim; Parvez, Sheikh; Matin, Rummana; Bashar, Mohammad Shahriar; Hossain, Tasnia; Sarwar, Hasan; Rashid, Mohammad Junaebur

2016-01-01

CZTS is a new type of an absorber and abundant materials for thin film solar cells (TFSC). Cadmium sulfide (CdS) is the n-type buffer layer of it with band gap of 2.42 eV. Cadmium sulfide (CdS) buffer layer of CZTS solar cell was deposited on soda-lime glass substrates by the Chemical Bath Deposition(CBD) method, using anhydrous Cadmium chloride(CdCl_2) and Thiourea (CS(NH_2)_2). Deposition of CdS using CBD is based on the slow release of Cd^ ions and S^ ions in an alkaline bath which is achi...

Help Helps, but Only so Much: Research on Help Seeking with Intelligent Tutoring Systems

Science.gov (United States)

Aleven, Vincent; Roll, Ido; McLaren, Bruce M.; Koedinger, Kenneth R.

2016-01-01

Help seeking is an important process in self-regulated learning (SRL). It may influence learning with intelligent tutoring systems (ITSs), because many ITSs provide help, often at the student's request. The Help Tutor was a tutor agent that gave in-context, real-time feedback on students' help-seeking behavior, as they were learning with an ITS.…

5G heterogeneous networks self-organizing and optimization

CERN Document Server

Rong, Bo; Kadoch, Michel; Sun, Songlin; Li, Wenjing

2016-01-01

This SpringerBrief provides state-of-the-art technical reviews on self-organizing and optimization in 5G systems. It covers the latest research results from physical-layer channel modeling to software defined network (SDN) architecture. This book focuses on the cutting-edge wireless technologies such as heterogeneous networks (HetNets), self-organizing network (SON), smart low power node (LPN), 3D-MIMO, and more. It will help researchers from both the academic and industrial worlds to better understand the technical momentum of 5G key technologies.

A comparative study of thermal annealing effects under various atmospheres on nano-structured CdS thin films prepared by CBD

Energy Technology Data Exchange (ETDEWEB)

Kong, Lingjun; Li, Jianmin; Chen, Guilin; Zhu, Changfei, E-mail: cfzhu@ustc.edu.cn; Liu, Weifeng, E-mail: liuwf@ustc.edu.cn

2013-10-05

Highlights: •Smooth and uniform CdS thin films were deposited successfully by CBD method. •The influence of CdCl{sub 2}-assisted annealing under various atmospheres of CdS films has been investigated. •We gave a more detailed research on annealing temperature after identified the most optimal annealing method. •High quality CdS films were obtained with air–CdCl{sub 2}-assisted treatments at 400 °C for 0.5 h. •GIXRD was used as a new analysis method of CdS in this paper. -- Abstract: Cadmium sulfide (CdS) nanofilms have been deposited on the glass substrate using the chemical bath technique. The effects of CdCl{sub 2}-assisted annealing under different atmosphere (vacuum, Ar and air) on the structural, morphological and optical properties of CdS nanofilms have been studied. After identifying the optimal annealing atmosphere, we also investigated the CdS thin film annealed at different annealing temperature (300, 400 and 500 °C). Films have been characterized by GI-XRD analysis, scanning electron microscopy, and UV–Vis–NIR spectrophotometer. The as-deposited CdS films have been found to be nanocrystalline in nature with a mixture of two crystallographic phases: a hexagonal phase and a cubic phase. After annealed in air with a CdCl{sub 2} coating layer at 400 °C, the films showed pure hexagonal phase, indicating the phase transition of CdS. It was found that the treatment in air with a CdCl{sub 2} coating layer increased the crystallinity and the mean grain size of CdS film, which are advantageous to the application in solar cells as a window layer material.

In situ generated CdS nanostructure induced enhanced photoluminescence from Dy{sup 3+} ions doped dielectric nanocomposites

Energy Technology Data Exchange (ETDEWEB)

Dey, Chirantan; Karmakar, Basudeb [Glass Science and Technology Section, Glass Division, CSIR-Central Glass and Ceramic Research Institute, Kolkata (India)

2017-08-15

We report CdS nanostructure induced enhanced photoluminescence (PL) from Dy{sup +3}:CdS co-doped dielectric-nanocomposites synthesized by the conventional melt-quench technique. CdS nanocrystals (NCs) were synthesized as in situ within the dielectric medium and their growth was controlled by heat treatment duration. Nanoparticles were investigated with absorption spectroscopy, X-ray diffraction (XRD), transmission electron microscopy (TEM), field emission scanning electron microscopy (FESEM), and Raman spectroscopy. The experimentally obtained sizes of the NCs are found to increase from 5-11 nm to 50-80 nm. Bandgap enhancement for the carrier confinement was found to alter within the range of 0.20-0.38 eV. Phonon confinement effect has been confirmed by blue shifting of Raman peak for CdS NCs at 303 cm{sup -1}. Enhanced highly intense sharp PL peak at 576 nm was detected, and different parameters associated with the PL enhancement including energy transfer from CdS NCs to Dy{sup 3+} ions have been studied. This PL enhancement was steered by varying CdS NC sizes. Enhanced PL of these nanocomposites finds their potential applications as gain medium in the field of solid state lasers. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

A DFT study of the effects of Sc doping on electronic and optical properties of CdS nanoparticles

Directory of Open Access Journals (Sweden)

Ur Rehman Shafiq

2015-12-01

Full Text Available In the present work a systematic study was carried out to understand the influence of Sc doping on electronic and optical properties of CdS nanoparticles. The geometry optimization and symmetry computation for CdS and Sc doped CdS nanoparticles using Density Functional Theory (DFT on B3LYP level with the QZ4P for Cd and DZ2P for sulphur and Sc were performed by Amsterdam Density Functional (ADF. The results show that HOMO-LUMO gap as well as electronic and optical properties of CdS clusters vary with Sc doping. The HOMO-LUMO gap is affected by the dopant and its value decreases to 0.6 eV. Through considering the numerical integration scheme in the ADF package, we investigated different vibrational modes and our calculated Raman and IR spectra are consistent with the reported result. The calculated IR and Raman peaks of CdS and Sc doped CdS clusters were in the range of 100 to 289 cm−1, 60 cm−1 to 350 cm−1 and 99 cm−1 to 282 cm−1, 60 cm−1 to 350 cm−1, respectively, which was also confirmed by experiment as well as a blue shift occurrence. Subsequently, for deeper research of pure and doped CdS clusters, their absorption spectra were calculated using time-dependent DFT method.

ICT in higher education: an experience with e-books

OpenAIRE

González Ramírez, María Reyes; Gascó Gascó, José Luis; Llopis Taverner, Juan

2014-01-01

The present paper seeks to explain the diverse advantages of virtual books and also the main barriers that make it difficult their implementation in the classroom. A brief review of the literature on ICT, e-learning, distance education and e-books will be complemented with a case study about the preparation, development and implementation of an e-book. The paper could be helpful both for systems analysts and for teachers when they are developing and implementing e-books.

Surface dependent behaviour of CdS LO-phonon mode

International Nuclear Information System (INIS)

Molina-Contreras, J R; Medina-Gutierrez, C; Frausto-Reyes, C; Trejo-Vazquez, R; Villalobos-Pina, F J; Romo-Luevano, G; Calixto, S

2007-01-01

In this paper, we develop a sensitive optical method to monitor the surface roughness in the investigation of surfaces. By applying this method to measure the RMS surface roughness of various surfaces, we found RMS values which are comparable to those obtained by atomic force microscopy measurements. In addition, we present a simple empirical model to calculate the RMS surface roughness which shows very good agreement with the surface roughness measurements taken by the method reported in this paper. Finally, the application of our method to the study of the LO-phonon mode of CdS suggests that its intensity is dominated by the surface roughness. This roughness dependent behaviour of the CdS LO-phonon mode is experimentally confirmed by using an excitation wavelength near its E 0 transition

Hydrothermal synthesis and sol-gel methods for CdS particle production in different morphologies and their use in wastewater applications

OpenAIRE

Tuncer, Cansel

2018-01-01

In this study, CdSnanoparticles were synthesized in different sizes and morphologies using twodifferent methods. First, the synthesis of both cauliflower-type CdS microspheresand CdS nanoflower-type microstructures by hydrothermal synthesis was carriedout in a steel reactors with teflon chamber. While polyethylene glycol andthioacetamide were used in the synthesis of cauliflower-type CdS microspheres,thiourea was used as a sulfur source in the synthesis of nanoflower CdS microstructures.Spher...

Controllable synthesis and characterization of CdS quantum dots by a microemulsion-mediated hydrothermal method

Energy Technology Data Exchange (ETDEWEB)

Chen, Rongrong; Han, Boning; Yang, Lin, E-mail: yanglin@hbu.edu.cn; Yang, Yanmin; Xu, Ying; Mai, Yaohua, E-mail: yaohuamai@hbu.edu.cn

2016-04-15

CdS QDs were successfully synthesized through a chemical reaction between cadmium acetate dehydrate and thioacetamide by using a microemulsion-mediated hydrothermal method. The properties of as-prepared CdS QDs can be controlled by using Emulsifier OP and CTAB surfactant, which produce a universal cubic phase and an unusual hexagonal phase, respectively. As a comparison, CdS QDs prepared by CTAB exhibit a better crystallinity and dispersibility. A possible mechanism involving the critical role of surfactant in the formation of crystal structure has also been explored in this paper. It is also found that the crystal size gradually increase with the increase of temperature, and the observation of red-shift in the absorption and emission peaks gives a clear evidence of the quantum confinement effect. All the desired properties of CdS QDs synthesized in this study imply the possibility of the preparation of high quality QDs under the appropriate reaction conditions.

Synthesis of CdS nanocrystals in polymeric films studied by in-situ GID and GISAXS

KAUST Repository

Di Luccio, Tiziana; Carbone, Dina; Masala, Silvia; Ramachandran, Karthik; Kornfield, Julie

2015-01-01

In this work, we describe the synthesis of CdS nanocrystals in thin polymeric films by in-situ Grazing Incidence Diffraction (GID) and Grazing Incidence Small Angle Scattering (GISAXS). The 2D GISAXS patterns indicate how the precursor structure is altered as the temperature is varied from 25°C to 300°C. At 150°C, the CdS nanocrystals start to arrange themselves in a hexagonal lattice with a lattice parameter of 27 A. The diffraction intensity from the hexagonal lattice reaches a maximum at 170"C and decreases steadily upon further heating above 220°C indicating loss of symmetry. Correspondingly, the GID scans at 170°C show strong crystalline peaks from cubic CdS nanocrystals that are about 2 nm size. The results indicate that a temperature of 170°C is sufficient to synthesize CdS nanocrystals without degradation of the polymer matrix (Topas) in thin films (about 30nm). © 2015 Materials Research Society.

Surface-modified CdS nanoparticles as a fluorescent probe for the selective detection of cysteine

International Nuclear Information System (INIS)

Negi, Devendra P S; Chanu, T Inakhunbi

2008-01-01

We present a novel method for the selective detection of cysteine, a sulfur-containing amino acid, which plays a crucial role in many important biological functions such as protein folding. Surface-modified colloidal CdS nanoparticles have been used as a fluorescent probe to selectively detect cysteine in the presence of other amino acids in the micromolar concentration range. Cysteine quenches the emission of CdS in the 0.5-10 μM concentration range, whereas the other amino acids do not affect its emission. Among the other amino acids, histidine is most efficient in quenching the emission of the CdS nanoparticles. The sulfur atom of cysteine plays a crucial role in the quenching process in the 0.5-10 μM concentration range. Cysteine is believed to quench the emission of the CdS nanoparticles by binding to their surface via its negatively charged sulfur atom. This method can potentially be applied for its detection in biological samples.

Synthesis of CdS nanocrystals in polymeric films studied by in-situ GID and GISAXS

KAUST Repository

Di Luccio, Tiziana

2015-07-07

In this work, we describe the synthesis of CdS nanocrystals in thin polymeric films by in-situ Grazing Incidence Diffraction (GID) and Grazing Incidence Small Angle Scattering (GISAXS). The 2D GISAXS patterns indicate how the precursor structure is altered as the temperature is varied from 25°C to 300°C. At 150°C, the CdS nanocrystals start to arrange themselves in a hexagonal lattice with a lattice parameter of 27 A. The diffraction intensity from the hexagonal lattice reaches a maximum at 170"C and decreases steadily upon further heating above 220°C indicating loss of symmetry. Correspondingly, the GID scans at 170°C show strong crystalline peaks from cubic CdS nanocrystals that are about 2 nm size. The results indicate that a temperature of 170°C is sufficient to synthesize CdS nanocrystals without degradation of the polymer matrix (Topas) in thin films (about 30nm). © 2015 Materials Research Society.

Synthesis of CdS flower-like hierarchical microspheres as electrode material for electrochemical performance

International Nuclear Information System (INIS)

Kaviyarasu, K.; Manikandan, E.; Maaza, M.

2015-01-01

We report in this paper, a facile hydrothermal route for the preparation of CdS nanocrystals at room temperature (RT). Composition, structure and morphology of the products were analyzed and characterized by X-ray diffraction (XRD) confirms that the hydrothermal treatment at 180 °C for periods ranging from 0 to 1440 min caused no significant modification of the long range order structure subjected to hydrothermal treatment. From the XRD analysis the diffraction peaks pertaining to 26.75°, 43.89° and 52.34° are attributed to the (111), (220) and (311) planes of cubic zinc blende structure. The Photoluminescence (PL) spectra are dominated by a strong narrow band edge emission tunable in the blue region of the visible spectra indicating the narrow size distribution of CdS nanocrystals. TEM observation shows that the CdS nanocrystals synthesized by hydrothermal synthesis are well dispersed and the average crystallite size was found to be ∼10 nm. The confocal microscopic studies reveal that each flower like spheres is due to Ostwald's ripening with numerous nanoparticles aggregating a surface. - Highlights: • The adjacent particle coalesces together forming spherical particles. • The average crystalline size of CdS nanoparticles was found to be ∼3 nm. • In the case of spherical crystallite, is given by L = 3/4 D. • The CdS nanocrystal exhibits a direct band gap of 2.4 eV. • The microspheres are dispersed with good monodispersity

Growth kinetics and long-term stability of CdS nanoparticles in aqueous solution under ambient conditions

International Nuclear Information System (INIS)

Mullaugh, Katherine M.; Luther, George W.

2011-01-01

The ubiquity of naturally occurring nanoparticles in the aquatic environment is now widely accepted, but a better understanding of the conditions that promote their formation and persistence is needed. Using cadmium sulfide (CdS) as a model metal sulfide species, thiolate-capped CdS nanoparticles were prepared in the laboratory to evaluate how aquatic conditions influence metal sulfide nanoparticle growth and stability. This work examines CdS nanoparticle growth directly in aqueous solution at room temperature by utilizing the size-dependent spectroscopic properties of semiconductors detectable by UV/vis. CdS nanoparticle growth was governed by oriented attachment, a non-classical mechanism of crystallization in which small precursor nanoparticles coalesce to form larger nanoparticle products. Nanoparticle growth was slowed with increasing capping agent and decreasing ionic strength. In addition to examining the short-term (hours) growth of the nanoparticles, a long-term study was conducted in which cysteine-capped CdS nanoparticles were monitored over 3 weeks in solutions of various ionic strengths. The long-term study revealed an apparent shift from small nanoparticles to nanoparticles twice their original size, suggesting nanoparticle growth may continue through oriented attachment over longer time scales. High-ionic strength solutions resulted in salt-induced aggregation and eventual settling of nanoparticles within days, whereas low-ionic strength solutions were stable against settling over the course of the experiment. Sulfide recovery from cysteine-capped CdS nanoparticles as acid volatile sulfide was nearly quantitative after 2 weeks in fully oxygenated water, demonstrating significantly slowed oxidation of sulfide when complexed to Cd(II) within CdS nanoparticles. The nanoparticles were also shown to be resistant to oxidation by Fe(III) (hydr)oxide. This study illustrates that aggregation, rather than chemical oxidation, is likely more important to the

Porous TiO{sub 2} nanofibers decorated CdS nanoparticles by SILAR method for enhanced visible-light-driven photocatalytic activity

Energy Technology Data Exchange (ETDEWEB)

Tian, Fengyu; Hou, Dongfang, E-mail: dfhouok@126.com; Hu, Fuchao; Xie, Kui; Qiao, Xiuqing; Li, Dongsheng, E-mail: lidongsheng1@126.com

2017-01-01

Graphical abstract: A heterojunction photocatalyst with CdS Nanoparticles self-assembled via SILAR Method at surfaces of electrospun TiO2 nanofibers shows enhanced visible-light photocatalytic activities. - Highlights: • Combined electrospinning and successive ionic layer adsorption and reaction process. • Pouous TiO{sub 2} nanofibers decorated CdS nanoparticles. • Synergetic effect of photosensitization and heterojunction. - Abstract: 1D porous CdS nanoparticles/TiO{sub 2} nanofibers heterostructure has been fabricated via simple electrospinning and a successive ionic layer adsorption and reaction (SILAR) process. The morphology, composition, and optical properties of the resulting CdS/TiO{sub 2} heterostructures can be rationally tailored through changing the SILAR cycles. The photocatalytic hydrogen evolution and decomposition of rhodamine B (RhB) of the as-synthesized heterostructured photocatalysts were investigated under visible light irradiation. Compared to TiO{sub 2} nanofibers，the as-obtained CdS/TiO{sub 2} heterostructures exhibit enhanced photocatalytic activity for hydrogen production and decomposition of RhB under visible-light irradiation. The heterojunction system performs best with H{sub 2} generation rates of 678.61 μmol h{sup −1} g{sup −1} under visible light irradiation which benefits from the two effects: (a) the 1D porous nanofibrous morphology contributes to not only more active sites but also more efficient transfer of the photogenerated charges (b) the synergetic effect of heterojunction and photosensitization reducing the recombination of photogenerated electrons and holes.

A photoelectrochemical study of CdS modified TiO2 nanotube arrays as photoanodes for cathodic protection of stainless steel

International Nuclear Information System (INIS)

L, Jing; Lin Changjian; Li Juntao; Lin Zequan

2011-01-01

An electrodeposited CdS nanoparticles-modified highly-ordered TiO 2 nanotube arrays (CdS-TNs) photoelectrode and its performance of photocathodic protection are reported. The self-organized TiO 2 nanotube arrays are fabricated by electrochemical anodization in an organic-inorganic mixed electrolyte and sensitized with CdS nanoparticles by electrodeposition via a single-step direct current. The morphology, crystalline phase, and composition of the CdS-TNs films were characterized systematically by scanning electron microscopy, X-ray diffraction, X-ray photoelectron spectroscopy, and ultraviolet-visible (UV-Vis) spectroscopy, respectively. The photoelectrochemical performances of the CdS-TNs film under illumination and dark conditions in 0.5 M NaCl solution were evaluated through the electrochemical measurements. It is indicated that the TNs incorporated by CdS effectively harvest solar light in the UV as well as the visible light (up to 480 nm) region. It is supposed that the high photoelectro-response activity of the CdS-TNs is attributed to the increased efficiency of charge separation and transport of electrons. The electrode potentials of 304 stainless steel coupled with the CdS-TNs is found to be negatively shifted for about 246 mV and 215 mV under UV and white light irradiation, respectively, which can be remained for 24 h even in darkness. It is implied that the CdS-TNs are able to effectively function a photogenerated cathodic protection for metals both under the UV and visible light illumination.

Increases in individualistic words and phrases in American books, 1960-2008.

Science.gov (United States)

Twenge, Jean M; Campbell, W Keith; Gentile, Brittany

2012-01-01

Cultural products such as song lyrics, television shows, and books reveal cultural differences, including cultural change over time. Two studies examine changes in the use of individualistic words (Study 1) and phrases (Study 2) in the Google Books Ngram corpus of millions of books in American English. Current samples from the general population generated and rated lists of individualistic words and phrases (e.g., "unique," "personalize," "self," "all about me," "I am special," "I'm the best"). Individualistic words and phrases increased in use between 1960 and 2008, even when controlling for changes in communal words and phrases. Language in American books has become increasingly focused on the self and uniqueness in the decades since 1960.

In-situ boron doping of chemical-bath deposited CdS thin films

International Nuclear Information System (INIS)

Khallaf, Hani; Park, S.; Schulte, Alfons; Chai, Guangyu; Lupan, Oleg; Chow, Lee; Heinrich, Helge

2009-01-01

In-situ boron doping of CdS using chemical-bath deposition (CBD) is reported. The effect of B doping on optical properties, as well as electrical properties, crystal structure, chemistry, and morphology of CdS films is studied. We present a successful approach towards B doping of CdS using CBD, where a resistivity as low as 1.7 x 10 -2 Ωcm and a carrier density as high as 1.91 x 10 19 cm -3 were achieved. The bandgap of B-doped films was found to slightly decrease as the[B]/[Cd] ratio in the solution increases. X-ray diffraction studies showed B 3+ ions likely enter the lattice substitutionally. A phase transition, due to annealing, as well as induced lattice defects, due to B doping, were detected by micro-Raman spectroscopy and transmission electron microscopy. The chemistry and morphology of films were unaffected by B doping. (copyright 2009 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Education Faculty Students' Views About Use of E-Books

Directory of Open Access Journals (Sweden)

Murat YALMAN

2015-01-01

Full Text Available Parallel to technological developments, numerous new tools are now available for people’s use. Societies adapt these tools to their professional lives by learning how to use them. In this way, they try to establish more comfortable working environments. Universities giving vocational education are supposed to teach these new technologies to their students to help them become successful in their future profession. Books that serve as the basic sources of information for education faculty students are increasingly being transformed into e-books parallel to these new technologies. In line with these developments, identifying students’ approaches and preferences regarding e-book could help determine the needs regarding this type of new technologies. In line with this purpose, the present study aimed at determining the views and preferences of preservice teachers regarding e-book as well as their levels of general knowledge about this technology. The participants of the study were 1179 students attending an education faculty (660 female, 519 male. In the study, qualitative and quantitative methods were used together. The results revealed that the students did not have sufficient knowledge about e-book and that they regarded any digital source on the Internet as e-book. Of all the participating preservice teachers, only 6% of them had sufficient knowledge about e-book.

Electrophoretic deposition of CdS coatings and their photocatalytic activities in the degradation of tetracycline antibiotic

Energy Technology Data Exchange (ETDEWEB)

Vázquez, A., E-mail: alejandro.lqi@gmail.com [Universidad Autónoma de Nuevo León, Facultad de Ciencias Químicas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico); Hernández-Uresti, D.B., E-mail: ing.dianahdz@gmail.com [Universidad Autónoma de Nuevo León, CICFIM–Facultad de Ciencias Físico Matemáticas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico); Obregón, S. [Universidad Autónoma de Nuevo León, CICFIM–Facultad de Ciencias Físico Matemáticas, Av. Universidad S/N, San Nicolás de los Garza, 66455 Nuevo León (Mexico)

2016-11-15

Highlights: • CdS photocatalyst was prepared by electrophoretic deposition. • The CdS coating was used in the photodegradation of antibiotics. • O{sub 2}{sup −} and ·OH radicals were responsible for the degradation of tetracycline. - Abstract: The photocatalytic activities of CdS coatings formed by electrophoretic deposition (EPD) were evaluated through the photodegradation of an antibiotic, tetracycline. First, CdS nanoparticles were synthesized under microwave irradiation of aqueous solutions containing the cadmium and sulfur precursors at stoichiometric amounts and by using trisodium citrate as stabilizer. Microwave irradiation was carried out in a conventional microwave oven at 2.45 GHz and 1650 W of nominal power, for 60 s. The CdS nanoparticles were characterized by UV–vis spectrophotometry, photoluminescence and X-ray diffraction. Electrophoretic deposition parameters were 300 mV, 600 mV and 900 mV of applied voltage between aluminum plates separated by 1 cm. The fractal dimensions of the surfaces were evaluated by atomic force microscopy and correlated to the morphological and topographic characteristics of the coatings. The photocatalytic activity of the CdS coatings was investigated by means the photodegradation of the tetracycline antibiotic under simulated sunlight irradiation. According to the results, the photoactivity of the coatings directly depends on the concentration of the precursors and the applied voltage during the deposition. The material obtained at 600 mV showed the best photocatalytic behavior, probably due to its physical properties, such as optimum load and suitable aggregate size.

Turning “on” and “off” nucleation and growth: Microwave assisted synthesis of CdS clusters and nanoparticles

International Nuclear Information System (INIS)

Ferrer, Edmy; Nater, Sariann; Rivera, Daniel; Colon, Jean Marie; Zayas, Francisco; Gonzalez, Miguel; Castro, Miguel E.

2012-01-01

Graphical abstract: Display Omitted Highlights: ► Cadmium acetate and DMSO were employed as ion precursors. ► New approach to controlled CdS nanoparticle synthesis. ► CdS clusters and nanoparticles synthesis achieved using microwave irradiation. ► Microwave irradiation turns on and off nanoparticle growth. ► The formation of clusters, embryos and nanoparticles studied with optical spectroscopy. -- Abstract: We report here on the formation of CdS NP from the microwave assisted reaction of Cd(CH 3 CO 2 ) 2 with dimethylsulfoxide (DMSO). DMSO serves as the solvent and a controlled source of sulfide ions to form (CdS) 1≤n≤5 clusters at the early stages of the process. The clusters grow into CdS nanoparticles, with diameters that range from 1.6 nm up to over 250 nm, with microwave heating. The time dependence of the onset of light absorption and absorbance are consistent with a concurrent nucleation and growth processes. The formation of clusters and nuclei and their subsequent reactions is controlled by turning on and off the energy supply consistent with an energy barrier to the formation of CdS nanostructures.

How To Teach "Dirty" Books in High School.

Science.gov (United States)

O'Malley, William J.

1967-01-01

Today's self-centered, utopian attitudes toward sexual experience compel teachers to avoid both overcaution and over-indulgence in selecting controversial books for classroom use. One method of selection is to rank books in a gradual progression from those requiring little literary and sexual sophistication in the reader to those requiring much…

The Financial Management System: A Pivotal Tool for Fiscal Viability. CDS Spotlight. ECAR Research Bulletin

Science.gov (United States)

Lang, Leah; Pirani, Judith A.

2014-01-01

This spotlight focuses on data from the 2013 CDS to better understand how higher education institutions approach financial management systems. Information provided for this spotlight was derived from Module 8 of Core Data Service (CDS), which asked several questions regarding information systems and applications. Responses from 525 institutions…

Self-Disclosure and Spiritual Well-Being in Pastors Seeking Professional Psychological Help.

Science.gov (United States)

Salwen, Erik D; Underwood, Lee A; Dy-Liacco, Gabriel S; Arveson, Kathleen R

2017-01-01

Pastoral mental health is a topic that has only rarely been researched empirically in the psychological literature, yet a pastor's mental health can have a significant impact on churches, communities, and even nations (Royal and Thompson, Journal of Psychology and Christianity, 31 (3), 195-204, 2012). One of the thoughts prompting this research is that evangelical pastors might be expected to resist the findings of psychological research and lack understanding of specific mental illnesses they are potentially facing. Combined with historical and cultural dynamics that could influence resistance to professional psychological help, evangelical pastors have personal, internal factors that could also strengthen resistance, including the researched issues of self-disclosure flexibility and spiritual well-being. A correlational research design with multivariate regression was used to determine potentially significant or predictive relationships between the relevant factors. Among evangelical seminary students ( N  = 251) preparing for parish-based pastoral ministry, this research determined that no significant relationship, predictive or otherwise, existed between self-disclosure flexibility, spiritual well-being, and attitudes toward seeking professional psychological help. Implications include a shift in focus toward external factors influencing pastors' help-seeking attitudes, such as the need for the mental health community to develop connections with evangelical pastors and the development of more support for Christian mental health professionals in the larger evangelical community.

Cognitive Behavioral Guided Self-Help for the Treatment of Recurrent Binge Eating

Science.gov (United States)

Striegel-Moore, Ruth H.; Wilson, G. Terence; DeBar, Lynn; Perrin, Nancy; Lynch, Frances; Rosselli, Francine; Kraemer, Helena C.

2010-01-01

Objective: Despite proven efficacy of cognitive behavioral therapy (CBT) for treating eating disorders with binge eating as the core symptom, few patients receive CBT in clinical practice. Our blended efficacy-effectiveness study sought to evaluate whether a manual-based guided self-help form of CBT (CBT-GSH), delivered in 8 sessions in a health…

Structural and optical properties of Ni-doped CdS thin films prepared by chemical bath deposition method

Energy Technology Data Exchange (ETDEWEB)

Premarani, R. [Arumugam Pillai SeethaiAmmal College, Thiruppattur-630211 (India); Saravanakumar, S., E-mail: sarophy84@gmail.com; Chandramohan, R. [SreeSevuganAnnamalai College, Devakottai-630303 (India); Mahalingam, T. [Department of Electrical and Computer Engineering, Ajou University, Suwon 443-749 (Korea, Republic of)

2015-06-24

The structural and optical behavior of undoped Cadmiun Sulphide (CdS) and Ni-doped CdS thinfilms prepared by Chemical Bath Deposition (CBD) technique is reported. The crystallite sizes of the thinfilms have been characterized by X-ray diffraction pattern (XRD). The particle sizes increase with the increase of Ni content in the CdS thinfilms. Scanning Electron Microscope (SEM) results indicated that CdS thinfilms is made up of aggregate of spherical-like particles. The composition was estimated by Energy Dispersive Analysis of X-ray (EDX) and reported. Spectroscopic studies revealed considerable improvement in transmission and the band gap of the films changes with addition of Ni dopant that is associated with variation in crystallite sizes in the nano regime.

Sjogren's Syndrome: A Place to Begin

Medline Plus

Full Text Available ... Tips > Surgery Tips Survival Tips Brochures & Resource Sheets Books, CDs & More! About the Foundation Mission Breakthrough Goal > ... Social Network Host an SSF Event SSF Store - Books, CDs & More Faces of Sjögren's Wake Up, Koala! ...

Sleep education with self-help treatment and sleep health promotion for mental and physical wellness in Japan

OpenAIRE

Tanaka, Hideki; Tamura, Norihisa

2015-01-01

The purpose of this article was to provide an overview of the effects of the sleep education with self-help treatment for student, teacher, and local resident and sleep health promotion for mental and physical wellness for elderly with actual examples of public health from the community and schools. Sleep education with self-help treatment in schools revealed that delayed or irregular sleep/wake patterns were significantly improved. Also, it was effective for improving sleep-onset latency, sl...

DETERMINANTS OF WOMEN’S PARTICIPATION IN SELF HELP GROUP LED MICRO-FINANCING OF FARMS IN ISUIKWUATO LOCAL GOVERNMENT AREA OF ABIA STATE, NIGERIA

Directory of Open Access Journals (Sweden)

Chidozie Onyedikachi ANYIRO

2014-10-01

Full Text Available This research analyzed determinants of women’s participation in self help group-led micro-financing of farms in Isuikwuato Local Government Area of Abia State, Nigeria. The specific objectives were to; determine the level of women’s participation in self help group led micro financing of farms; determine the factors that influence women’s participation in self help group micro financing of farms; identify constraints of women participation in self help group micro financing of farms in the study area. Multistage random sampling technique was employed in collecting data from one hundred and twenty (120 members of women self help group using structured questionnaire. The data were analyzed using descriptive statistics, likert scale type and probit regression analysis. The research revealed that the women (respondents actively participated in self help group meetings ( = 3.07, financial and material contributions (= 3.33, self help group project (= 3.36 and recruitment of fresh members (= 3.16, because their calculated means were greater than the critical midpoint mean score (3.0. The study also showed that the women did not participate in committee membership ( = 2.54 and holding of official executive position (= 2.53 in self help group since the midpoint score (3.0 was greater than their calculated mean values. The result of probit regression analysis showed that women’s participation in self help group led micro financing of farms was influenced by household size, years of membership experience, access to credit, primary occupation, mode of entry and annual contribution. The model predicted 94.69 per cent of the sample correctly and posted a log likelihood value of -33.54958, a pseudo R2value of 0.3013 and a goodness of fit chi-square value of 32.10 which is statistically significant at 1.0% level. Meanwhile irregular monthly contribution and loan default were the major constraints of women’s participation in self help group led micro

Developing a self-help guide for traumatised university students in Iraq

OpenAIRE

Jaber, Saad Sabet

2012-01-01

Background: Iraqi people have been experiencing traumatic events continually for several decades. Consequently, high prevalence rates of trauma-related symptoms have been documented. In contrast, there is a clear lack in mental health services available for traumatised people. This study aimed to screen for PTSD, depression, and anxiety, assess related variables (e.g. coping strategies, posttraumatic cognitions, and social support), and develop a self-help guide (SHG) for traumatised universi...

Evolution of different morphologies of CdS nanoparticles by thermal decomposition of bis(thiourea)cadmium chloride in various solvents

International Nuclear Information System (INIS)

Gaur, Rama; Jeevanandam, P.

2015-01-01

CdS nanoparticles with different morphologies have been synthesized by thermal decomposition of bis(thiourea)cadmium chloride in different solvents without the use of any ligand/surfactant. CdS nanoparticles with pyramid, sponge-like and hexagonal disc-like morphologies were obtained in diphenyl ether (DPE), 1-octadecene (ODE) and ethylene glycol (EG), respectively. In addition, CdS nanoparticles with unique morphologies were obtained when the decomposition of the complex was carried out in mixed solvents (DPE–EG and ODE–EG). Extensive characterization of the CdS nanoparticles was carried out using powder X-ray diffraction, FT-IR spectroscopy, thermal analysis, field-emission scanning electron microscopy, diffuse reflectance spectroscopy and photoluminescence spectroscopy, and detailed mechanism of the formation of CdS nanoparticles with different morphologies in various solvents has been proposed

Cytotoxicity and cellular mechanisms involved in the toxicity of CdS quantum dots in hemocytes and gill cells of the mussel Mytilus galloprovincialis

Energy Technology Data Exchange (ETDEWEB)

Katsumiti, A. [CBET Research Group, Dept. Zoology and Animal Cell Biology, Faculty of Science and Technology and Research Centre for Experimental Marine Biology and Biotechnology PIE, University of the Basque Country UPV/EHU, Basque Country (Spain); Gilliland, D. [EU Commission–Joint Research Centre, Institute of Health and Consumer Protection, NSB Unit, Ispra (Italy); Arostegui, I. [Department of Applied Mathematics, Statistics and Operations Research, Faculty of Science and Technology, University of the Basque Country UPV/EHU, Leioa (Spain); Cajaraville, M.P., E-mail: mirenp.cajaraville@ehu.es [CBET Research Group, Dept. Zoology and Animal Cell Biology, Faculty of Science and Technology and Research Centre for Experimental Marine Biology and Biotechnology PIE, University of the Basque Country UPV/EHU, Basque Country (Spain)

2014-08-15

Highlights: • CdS QDs were cytotoxic for mussel hemocytes and gill cells in vitro. • Ionic Cd was the most toxic form, followed by CdS QDs and bulk CdS. • CdS QDs altered oxidative balance and caused DNA damage in mussel cells. • CdS QDs caused a particle-specific immunostimulation on phagocytosis of hemocytes. • Conceptual models for cellular handling and toxicity of CdS QDs are proposed. - Abstract: CdS quantum dots (QDs) show a great promise for treatment and diagnosis of cancer and for targeted drug delivery, due to their size-tunable fluorescence and ease of functionalization for tissue targeting. In spite of their advantages it is important to determine if CdS QDs can exert toxicity on biological systems. In the present work, cytotoxicity of CdS QDs (5 nm) at a wide range of concentrations (0.001–100 mg Cd/L) was screened using neutral red (NR) and thiazolyl blue tetrazolium bromide (MTT) assays in isolated hemocytes and gill cells of mussels (Mytilus galloprovincialis). The mechanisms of action of CdS QDs were assessed at sublethal concentrations (0.31–5 mg Cd/L) in the same cell types through a series of functional in vitro assays: production of reactive oxygen species (ROS), catalase (CAT) activity, DNA damage, lysosomal acid phosphatase (AcP) activity, multixenobiotic resistance (MXR) transport activity, Na-K-ATPase activity (only in gill cells) and phagocytic activity and damage to actin cytoskeleton (only in hemocytes). Exposures to CdS QDs lasted for 24 h and were performed in parallel with exposures to bulk CdS and ionic Cd. Ionic Cd was the most toxic form to both cell types, followed by CdS QDs and bulk CdS. ROS production, DNA damage, AcP activity and MXR transport were significantly increased in both cell types exposed to the 3 forms of Cd. CAT activity increased in hemocytes exposed to the three forms of Cd while in gill cells only in those exposed to ionic Cd. No effects were found on hemocytes cytoskeleton integrity. Effects on

Pattern and Determinants of Antenatal Booking at Abakaliki ...

African Journals Online (AJOL)

for pregnant women to enable them attain and maintain a state of good health throughout pregnancy and to improve ... subsidization of cost of medical services will help in reversing the trend of late antenatal booking. Keywords: Abakaliki, Antenatal booking, .... Artisan/fashion/ design. 10 (2.9). 3 (30). 7 (70). Civil servant.

Influence of Ag doping concentration on structural and optical properties of CdS thin film

International Nuclear Information System (INIS)

Kumar, Pragati; Saxena, Nupur; Gupta, Vinay; Agarwal, Avinash

2015-01-01

This work shows the influence of Ag concentration on structural properties of pulsed laser deposited nanocrystalline CdS thin film. X-ray photoelectron spectroscopy (XPS) studies confirm the dopant concentration in CdS films and atomic concentration of elements. XPS studies show that the samples are slightly sulfur deficient. GAXRD scan reveals the structural phase transformation from cubic to hexagonal phase of CdS without appearance of any phase of CdO, Ag 2 O or Ag 2 S suggesting the substitutional doping of Ag ions. Photoluminescence studies illustrate that emission intensity increases with increase in dopant concentration upto 5% and then decreases for higher dopant concentration

Influence of Ag doping concentration on structural and optical properties of CdS thin film

Energy Technology Data Exchange (ETDEWEB)

Kumar, Pragati, E-mail: pkumar.phy@gmail.com [Department of Physics, Bareilly College, Bareilly, 243 005, Uttar Pradesh (India); Department of Physics and Astrophysics, University of Delhi, Delhi, 110 007 (India); Saxena, Nupur; Gupta, Vinay [Department of Physics and Astrophysics, University of Delhi, Delhi, 110 007 (India); Agarwal, Avinash [Department of Physics, Bareilly College, Bareilly, 243 005, Uttar Pradesh (India)

2015-05-15

This work shows the influence of Ag concentration on structural properties of pulsed laser deposited nanocrystalline CdS thin film. X-ray photoelectron spectroscopy (XPS) studies confirm the dopant concentration in CdS films and atomic concentration of elements. XPS studies show that the samples are slightly sulfur deficient. GAXRD scan reveals the structural phase transformation from cubic to hexagonal phase of CdS without appearance of any phase of CdO, Ag{sub 2}O or Ag{sub 2}S suggesting the substitutional doping of Ag ions. Photoluminescence studies illustrate that emission intensity increases with increase in dopant concentration upto 5% and then decreases for higher dopant concentration.

The e-Book Apocalypse: A Survivor's Guide