
Sample records for seeds glycine max

  1. Genetic Analysis of Seed Isoflavones, Protein, and Oil Contents in Soybean [Glycine max (L.) Merr. (United States)


    and My Abdelmajid Kassem. Effect of Two Row Spaces on Several Agronomic Traits in Soy - bean [Glycine max (L.) Merr.], Atlas Journal of Plant Biology... SoyS - NP6K Illumina Infinium BeadChip Genotyping Array , Journal of Plant Genome Sciences (09 2013) Masum Akond1, Shiming Liu2, Melanie Boney1


    International Nuclear Information System (INIS)



    In this study, seeds of Glycine max Giza 122 were irradiated with gamma rays from 60 Co source at various doses (10 to 200 Gy), sterilized and soaked into an aerated solution of CaSO 4 (1 mmol and pH 6.5). The capacities of the released seed exudates (SEs) and root exudates (REs) to promote Rhizobium leguminosarum growth were investigated as well as biochemical analysis of the exudates was carried out. SE of both control and gamma irradiated seeds resulted in a higher Rhizobium population and polysaccharide production than RE. Relative to control, the highly effective doses in Rhizobium growth and polysaccharide production were 25 and 200 Gy; the former was a promoter while the later was an inhibitor. HPLC analysis of soluble carbohydrates revealed the presence of glucose (Glu), rhamnose (Rha) and fructose (Fru) in the SE and RE. Protein content in SE was lower than that in RE; the highest values were due to 10 Gy and 25 Gy in SE and RE, respectively. Free amino acids content in SE was increased up to 25 Gy then decreased while RE was increased by increasing gamma doses from 10 to 200 Gy

  3. Inoculation with Bradyrhizobium japonicum enhances the organic and fatty acids content of soybean (Glycine max (L.) Merrill) seeds. (United States)

    Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B


    Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Enhanced Single Seed Trait Predictions in Soybean (Glycine max) and Robust Calibration Model Transfer with Near-Infrared Reflectance Spectroscopy. (United States)

    Hacisalihoglu, Gokhan; Gustin, Jeffery L; Louisma, Jean; Armstrong, Paul; Peter, Gary F; Walker, Alejandro R; Settles, A Mark


    Single seed near-infrared reflectance (NIR) spectroscopy predicts soybean (Glycine max) seed quality traits of moisture, oil, and protein. We tested the accuracy of transferring calibrations between different single seed NIR analyzers of the same design by collecting NIR spectra and analytical trait data for globally diverse soybean germplasm. X-ray microcomputed tomography (μCT) was used to collect seed density and shape traits to enhance the number of soybean traits that can be predicted from single seed NIR. Partial least-squares (PLS) regression gave accurate predictive models for oil, weight, volume, protein, and maximal cross-sectional area of the seed. PLS models for width, length, and density were not predictive. Although principal component analysis (PCA) of the NIR spectra showed that black seed coat color had significant signal, excluding black seeds from the calibrations did not impact model accuracies. Calibrations for oil and protein developed in this study as well as earlier calibrations for a separate NIR analyzer of the same design were used to test the ability to transfer PLS regressions between platforms. PLS models built from data collected on one NIR analyzer had minimal differences in accuracy when applied to spectra collected from a sister device. Model transfer was more robust when spectra were trimmed from 910 to 1679 nm to 955-1635 nm due to divergence of edge wavelengths between the two devices. The ability to transfer calibrations between similar single seed NIR spectrometers facilitates broader adoption of this high-throughput, nondestructive, seed phenotyping technology.

  5. Soybean (Glycine max) WRINKLED1 transcription factor, GmWRI1a, positively regulates seed oil accumulation. (United States)

    Chen, Liang; Zheng, Yuhong; Dong, Zhimin; Meng, Fanfan; Sun, Xingmiao; Fan, Xuhong; Zhang, Yunfeng; Wang, Mingliang; Wang, Shuming


    Soybean is the world's most important leguminous crop producing high-quality protein and oil. Elevating oil accumulation in soybean seed is always many researchers' goal. WRINKLED1 (WRI1) encodes a transcription factor of the APETALA2/ethylene responsive element-binding protein (AP2/EREBP) family that plays important roles during plant seed oil accumulation. In this study, we isolated and characterized three distinct orthologues of WRI1 in soybean (Glycine max) that display different organ-specific expression patterns, among which GmWRI1a was highly expressed in maturing soybean seed. Electrophoretic mobility shift assays and yeast one-hybrid experiments demonstrated that the GmWRI1a protein was capable of binding to AW-box, a conserved sequence in the proximal upstream regions of many genes involved in various steps of oil biosynthesis. Transgenic soybean seeds overexpressing GmWRI1a under the control of the seed-specific napin promoter showed the increased total oil and fatty acid content and the changed fatty acid composition. Furthermore, basing on the activated expressions in transgenic soybean seeds and existence of AW-box element in the promoter regions, direct downstream genes of GmWRI1a were identified, and their products were responsible for fatty acid production, elongation, desaturation and export from plastid. We conclude that GmWRI1a transcription factor can positively regulate oil accumulation in soybean seed by a complex gene expression network related to fatty acid biosynthesis.

  6. Influence of pulsed magnetic field on soybean (Glycine max L.) seed germination, seedling growth and soil microbial population. (United States)

    Radhakrishnan, Ramalingam; Kumari, Bollipo Dyana Ranjitha


    The effects of pulsed magnetic field (PMF) treatment of soybean (Glycine max L. cv CO3) seeds were investigated on rate of seed germination, seedling growth, physico-chemical properties of seed leachates and soil microbial population under laboratory conditions. Seeds were exposed to PMF of 1500 nT at 0.1, 1.0 10.0 and 100.0 Hz for 5 h per day for 20 days, induced by enclosure coil systems. Non-treated seeds were considered as controls. All PMF treatments significantly increased the rate of seed germination, while 10 and 100 Hz PMFs showed the most effective response. The 1.0 and 10 Hz PMFs remarkably improved the fresh weight of shoots and roots, leaf area and plant height from seedlings from magnetically-exposed seeds compared to the control, while 10 Hz PMF increased the total soluble sugar, total protein and phenol contents. The leaf chlorophyll a, b and total chlorophyll were higher in PMF (10 and 100 Hz) pretreated plants, as compared to other treatments. In addition, activities of alpha-amylase, acid phosphatase, alkaline phosphatase, nitrate reductase, peroxidase and polyphenoloxidase were increased, while beta-amylase and protease activities were declined in PMF (10 Hz)-exposed soybean plants. Similarly, the capacity of absorbance of water by seeds and electrical conductivity of seed leachates were significantly enhanced by 10 Hz PMF exposure, whereas PMF (10 Hz) pretreated plants did not affect the microbial population in rhizosphere soil. The results suggested the potential of 10 Hz PMF treatment to enhance the germination and seedling growth of soybean.

  7. Meta-Analyses of QTLs Associated with Protein and Oil Contents and Compositions in Soybean [Glycine max (L.) Merr.] Seed. (United States)

    Van, Kyujung; McHale, Leah K


    Soybean [ Glycine max (L.) Merr.] is a valuable and nutritious crop in part due to the high protein meal and vegetable oil produced from its seed. Soybean producers desire cultivars with both elevated seed protein and oil concentrations as well as specific amino acid and fatty acid profiles. Numerous studies have identified quantitative trait loci (QTLs) associated with seed composition traits, but validation of these QTLs has rarely been carried out. In this study, we have collected information, including genetic location and additive effects, on each QTL for seed contents of protein and oil, as well as amino acid and fatty acid compositions from over 80 studies. Using BioMercator V. 4.2, a meta-QTL analysis was performed with genetic information comprised of 175 QTLs for protein, 205 QTLs for oil, 156 QTLs for amino acids, and 113 QTLs for fatty acids. A total of 55 meta-QTL for seed composition were detected on 6 out of 20 chromosomes. Meta-QTL possessed narrower confidence intervals than the original QTL and candidate genes were identified within each meta-QTL. These candidate genes elucidate potential natural genetic variation in genes contributing to protein and oil biosynthesis and accumulation, providing meaningful information to further soybean breeding programs.

  8. Physiological and transcriptomic responses in the seed coat of field-grown soybean (Glycine max L. Merr.) to abiotic stress. (United States)

    Leisner, Courtney P; Yendrek, Craig R; Ainsworth, Elizabeth A


    Understanding how intensification of abiotic stress due to global climate change affects crop yields is important for continued agricultural productivity. Coupling genomic technologies with physiological crop responses in a dynamic field environment is an effective approach to dissect the mechanisms underpinning crop responses to abiotic stress. Soybean (Glycine max L. Merr. cv. Pioneer 93B15) was grown in natural production environments with projected changes to environmental conditions predicted for the end of the century, including decreased precipitation, increased tropospheric ozone concentrations ([O 3 ]), or increased temperature. All three environmental stresses significantly decreased leaf-level photosynthesis and stomatal conductance, leading to significant losses in seed yield. This was driven by a significant decrease in the number of pods per node for all abiotic stress treatments. To understand the underlying transcriptomic response involved in the yield response to environmental stress, RNA-Sequencing analysis was performed on the soybean seed coat, a tissue that plays an essential role in regulating carbon and nitrogen transport to developing seeds. Gene expression analysis revealed 49, 148 and 1,576 differentially expressed genes in the soybean seed coat in response to drought, elevated [O 3 ] and elevated temperature, respectively. Elevated [O 3 ] and drought did not elicit substantive transcriptional changes in the soybean seed coat. However, this may be due to the timing of sampling and does not preclude impacts of those stresses on different tissues or different stages in seed coat development. Expression of genes involved in DNA replication and metabolic processes were enriched in the seed coat under high temperate stress, suggesting that the timing of events that are important for cell division and proper seed development were altered in a stressful growth environment.

  9. Evaluating effect of biofertilizer on nodulation and soybean (Glycine max L plants growth characteristics under water deficit stress of seed

    Directory of Open Access Journals (Sweden)

    M. Tajik Khaveh


    Full Text Available In order to evaluate the effects of biofertilizer on soybean (Glycine max L. seed vigor that produced under water deficit condition and related traits, an experiment was conducted in a factorial layout based of complete randomized block design with four replications at the research greenhouse of Aboureihan campus- Tehran University, Iran. Experimental treatments were include biofertilizer (seed inoculation with Bradyrhizobium japonicum, co-inoculation with Bradyrhizobium japonicum and Pseudomonas fluorescens, co-inoculation with Bradyrhizobium japonicum and Glomus mosseae, Cultivar (Zalta Zalha and Clark×Hobbit line and water deficit stress [irrigation plants after 50 (normal irrigation, 100 (medium stress, 150 (sever stress mm evaporation from pan class A, in parents field]. Results showed that the water deficit stress had negative effects on seed quality and seedling emergence percentage, mean daily seedling emergence, root, leaf and shoot dry weight, number of nodule were decreased. ZaltaZalha cultivar had higher shoot dry weight and number of leaf compared with other cultivars. Applications of biofertilzer was effective on stem diameter, root, leaf and shoot dry weight, number of leaf and nodule and those attributes increased by co-inoculation of Bradyrhizobium japonicum and Glomus mosseae. Also, use of biofertilizer in stress levels was effective on stem dry weight. Stem dry weight was increased by Co-inoculation of cultivar seeds with Bradyrhizobium japonicum and Glomus mosseae.


    Directory of Open Access Journals (Sweden)

    Luka Andrić


    Full Text Available Seed ageing is an important cause of low vigor and bad field emergence, especially in adverse seedbed conditions. Therefore, in this investigation, soybean seed vigor was tested by four laboratory tests (germination energy GE, standard germination SG, cold test CT, electrical conductivity EC and in field trial, as well (early planting dates Epd and optimal planting dates Opd. The soybean seed of 5 cultivars from Agricultural Institute Osijek, produced in the 3 years (1999., 2000., 2001. was used in the investigation. The seed was stored in a warehouse conditions for 6, 18 or 30 months prior to testing. Tested soybean seed showed significant differences in seed vigor influenced by seed age, seed treatment with fungicide (Vitavax 200 FF, cultivar and planting date. High quality seed with GE and SG over 85%,performed quite well in both planting dates, as well as seeds with the CT over 70% or with EC under 42 μScm-1g-1. On the contrary, considering seed with reduced vigor there is a very great possibility of reduced FE especially in Epd. However, seed treatment with fungicide and sowing in optimal seedbed conditions can significantly contribute to improvement of soybean seed performance and stand establishment. Correlation analyses showed that all tested seed vigor parameters were significantly connected (sign. level 99%. At early planting, the strongest correlation was established between the field emergence and CT (untreated seed, r=0.949** and for treated seed r=0.951** whereas in optimal planting date was between the field emergence and SG (for untreated seed r=0. 938** and for treated seed r=0.942**. Laboratory seed health testing showed significant differences in fungal disease intensity influenced by fungicide seed treatment, cultivar and seed age. Total seed infection and infection with Fusarium spp. was adversely correlated with all vigor parameters. All tested vigor parameters of soybean seed had influence on grain yield indirectly by

  11. Multi-Population Selective Genotyping to Identify Soybean [Glycine max (L.) Merr.] Seed Protein and Oil QTLs. (United States)

    Phansak, Piyaporn; Soonsuwon, Watcharin; Hyten, David L; Song, Qijian; Cregan, Perry B; Graef, George L; Specht, James E


    Plant breeders continually generate ever-higher yielding cultivars, but also want to improve seed constituent value, which is mainly protein and oil, in soybean [Glycine max (L.) Merr.]. Identification of genetic loci governing those two traits would facilitate that effort. Though genome-wide association offers one such approach, selective genotyping of multiple biparental populations offers a complementary alternative, and was evaluated here, using 48 F2:3 populations (n = ∼224 plants) created by mating 48 high protein germplasm accessions to cultivars of similar maturity, but with normal seed protein content. All F2:3 progeny were phenotyped for seed protein and oil, but only 22 high and 22 low extreme progeny in each F2:3 phenotypic distribution were genotyped with a 1536-SNP chip (ca 450 bimorphic SNPs detected per mating). A significant quantitative trait locus (QTL) on one or more chromosomes was detected for protein in 35 (73%), and for oil in 25 (52%), of the 48 matings, and these QTL exhibited additive effects of ≥ 4 g kg(-1) and R(2) values of 0.07 or more. These results demonstrated that a multiple-population selective genotyping strategy, when focused on matings between parental phenotype extremes, can be used successfully to identify germplasm accessions possessing large-effect QTL alleles. Such accessions would be of interest to breeders to serve as parental donors of those alleles in cultivar development programs, though 17 of the 48 accessions were not unique in terms of SNP genotype, indicating that diversity among high protein accessions in the germplasm collection is less than what might ordinarily be assumed. Copyright © 2016 Phansak et al.

  12. Evaluation of the Protective Role of Glycine max Seed Extract (Soybean Oil) in Drug-Induced Nephrotoxicity in Experimental Rats. (United States)

    Ramasamy, Anand; Jothivel, Nandhakumar; Das, Saibal; Swapna, A; Albert, Alice Padmini; Barnwal, Preeti; Babu, Dinesh


    This study was conducted to evaluate the nephroprotective effect of Glycine max seed extract (soybean oil) against gentamicin- and rifampicin-induced nephrotoxicity in Sprague-Dawley rats and to compare its effects with those of vitamin E, which has well-established antioxidant and nephroprotective effects. Sixty male Sprague-Dawley rats (body weight 150-210 g) were divided into 10 groups. The first five groups were treated for 14 consecutive days with normal saline (5 ml/kg, by mouth [p.o.]); gentamicin (80 mg/kg intraperitoneally [i.p.]); gentamicin (80 mg/kg, i.p.) + vitamin E (250 mg/kg p.o.); gentamicin (80 mg/kg i.p.) + soybean oil (2.5 ml/kg p.o.); and gentamicin (80 mg/kg, i.p.) + soybean oil (5 ml/kg p.o.), respectively. For the next five groups, the same group allocation was done, but gentamicin was replaced with rifampicin (1 g/kg i.p.). Various biomarkers for nephrotoxicity in serum and urine were evaluated along with histopathological examination of kidneys. Analysis of variance (ANOVA) was done following Tukey's multiple comparison test; p Soybean oil in both doses significantly (p Soybean oil also showed strong antioxidant effects, causing significant (p Soybean oil demonstrated good nephroprotective activity due to antioxidant effects.

  13. Genome-wide association study, genomic prediction and marker-assisted selection for seed weight in soybean (Glycine max). (United States)

    Zhang, Jiaoping; Song, Qijian; Cregan, Perry B; Jiang, Guo-Liang


    Twenty-two loci for soybean SW and candidate genes conditioning seed development were identified; and prediction accuracies of GS and MAS were estimated through cross-validation and validation with unrelated populations. Soybean (Glycine max) is a major crop for plant protein and oil production, and seed weight (SW) is important for yield and quality in food/vegetable uses of soybean. However, our knowledge of genes controlling SW remains limited. To better understand the molecular mechanism underlying the trait and explore marker-based breeding approaches, we conducted a genome-wide association study in a population of 309 soybean germplasm accessions using 31,045 single nucleotide polymorphisms (SNPs), and estimated the prediction accuracy of genomic selection (GS) and marker-assisted selection (MAS) for SW. Twenty-two loci of minor effect associated with SW were identified, including hotspots on Gm04 and Gm19. The mixed model containing these loci explained 83.4% of phenotypic variation. Candidate genes with Arabidopsis orthologs conditioning SW were also proposed. The prediction accuracies of GS and MAS by cross-validation were 0.75-0.87 and 0.62-0.75, respectively, depending on the number of SNPs used and the size of training population. GS also outperformed MAS when the validation was performed using unrelated panels across a wide range of maturities, with an average prediction accuracy of 0.74 versus 0.53. This study convincingly demonstrated that soybean SW is controlled by numerous minor-effect loci. It greatly enhances our understanding of the genetic basis of SW in soybean and facilitates the identification of genes controlling the trait. It also suggests that GS holds promise for accelerating soybean breeding progress. The results are helpful for genetic improvement and genomic prediction of yield in soybean.

  14. Entomofauna associated to soybean [Glycine max (L. Merr.] in direct seeding and conventional tillage

    Directory of Open Access Journals (Sweden)

    Arahis Cruz Limonte


    Full Text Available The main purpose of this research work was to investigate the effect of the direct seeding and conventional tillage of soybean on the incidence of plagues and natural enemies. The study was carried out on the farm “Día y Noche” of the Basic Unit of Cooperative Production “28 de Octubre” (UBPC, for its Spanish acronym, and in the Laboratories of the Agricultural Research Center of Central University of Las Villas. Field experiments were conducted on an Inceptisol, since November 2013 to May 2014. The soybean cultivar Incasoy – 27 was used. The insects in relation to the development stages of the plant were identified and quantified. In both systems 10 species of phytophagous insects and one of entomophagous insects were quantified; Hedylepta indicata L. stands out with more presence in the direct seeding, while Diabrotica balteata LeConte and the species belong to the family Pentatomidae caused most damage to the plants in conventional tillage.

  15. Impact of Environment on the Biomass Composition of Soybean (Glycine max) seeds. (United States)

    McClure, Tamara; Cocuron, Jean-Christophe; Osmark, Veronika; McHale, Leah K; Alonso, Ana Paula


    Factors including genetics, fertilization, and climatic conditions, can alter the biomass composition of soybean seeds, consequently impacting their market value and usage. This study specifically determined the content of protein and oil, as well as the composition of proteinogenic amino acids and fatty acids in seeds from 10 diverse soybean cultivars grown in four different sites. The results highlighted that different environments produce a different composition for the 10 cultivars under investigation. Specifically, the levels of oleic and linoleic acids, important contributors to oil stability, were negatively correlated. Although the protein and oil contents were higher in some locations, their "quality" was lower in terms of composition of essential amino acids and oleic acid, respectively. Finally, proteinogenic histidine and glutamate were the main contributors to the separation between Central and Northern growing sites. Taken together, these results can guide future breeding and engineering efforts aiming to develop specialized soybean lines.

  16. Effects of proton beam irradiation on seed germination and growth of soybean ( Glycine max L. Merr.) (United States)

    Im, Juhyun; Kim, Woon Ji; Kim, Sang Hun; Ha, Bo-Keun


    The present study aimed to evaluate the morphological effects of proton beam irradiation on the seed germination, seedling survival, and plant growth of soybean. Seeds of three Korean elite cultivars (Kwangankong, Daepungkong, and Pungsannamulkong) were irradiated with a 57-MeV proton beam in the range of 50 - 400 Gy. The germination rates of all the varieties increased to > 95%; however, the survival rates were significantly reduced. At doses of > 300 Gy irradiation, the Daepungkong, Kwangankong, and Pungsannamulkong cultivars exhibited 39, 75, and 71% survival rates, respectively. In addition, plant height and the fresh weight of shoots and roots were significantly decreased by doses of > 100 Gy irradiation, as were the dry weights of the shoots and roots. However, SPAD values increased with increasing doses of irradiation. Abnormal plants with atypically branched stems, modified leaves, and chlorophyll mutations were observed. Based on the survival rate, plant growth inhibition, and mutation frequency, it appears that the optimum dosage of proton beam irradiation for soybean mutation breeding is between 250 and 300 Gy.

  17. Effect of cobalt-60 gamma irradiation on viability of soybean (glycine max. l) seed

    International Nuclear Information System (INIS)

    Addai, Isaac Kwahene


    The rapid rate of deterioration and low viability of soybean seeds particularly in storage is a major constraint to its production in the subtropical and tropical areas. Various approaches have been made to solve this problem but they have centred mainly on the control of the environment. Experimental mutagenesis is one of the ways by which genetic variability could be created to serve as basis for selection. In this study, induced mutations were used to create genetic variation and mutants with improved storability selected to provide a more lasting solution to this problem. Seeds of three soybean varieties - Gmx 92-6-10, Gmx 92-5-4E and TGX 87D- 1303 were subjected to four (4) months ambient storage and three accelerated ageing tests. The germination percentages computed 7 days after planting showed that 20% ethanol solution better mimicked ambient storage than 20% methanol solution and the 75°C hot water. In the radiation dosage response studies, dry seeds containing 10% moisture from the three varieties were subjected to 0, 50, 100, 150, 200 and 250 Gy doses of 60Co gamma rays at Ghana Atomic Energy Commission, Kwabenya and sown. The 250 Gy dose reduced both germination percentage and plant height by about 50% relative to the control and was used as the dosage appropriate for induced mutations for the varieties. Five thousand M2 plants were harvested and screened individually for improved storability using 20% ethanol solution, storing threshed seeds at ambient condition and storing seeds in pods also at ambient conditions. The 20% ethanol solution was less effective in selecting putative in mutants compared to the two ambient storage screening methods, but could be used as an initial screening method. The variety Gmx 92-6-10 was generally considered to give the greatest response to irradiation because it produce the largest proportion of putative mutant improved storability in two out of the three screening methods used at the M2 generation. Since TGX 87D 1

  18. Soybean ( Glycine max ) as a versatile biocatalyst for organic ...

    African Journals Online (AJOL)

    A series of aliphatic and aromatic aldehydes and ketones were reduced using plant cell preparations of Glycine max seeds (soybean). The biotransformation of five aromatic aldehydes in water, at room temperature afforded the corresponding alcohols in excellent yields varying from 89 to 100%. Two prochiral aromatic ...

  19. The Effects of Seed Inoculation with Rhizobium and Nitrogen Application on Yield and some Agronomi Characterstics of Soybean (Glycine max L. under Ardabil Condition

    Directory of Open Access Journals (Sweden)

    M.N Seiedi


    Full Text Available In order to study the effects of seed inoculation with rhizobium and nitrogen application on yield and some agronomic characterstics of soybean (Glycine max L., a spilt plot experiment based on randomized complete block design with three replications was conducted in 2011 at the research farm of the Islamic Azad University, Ardabil Branch. Factors were inorganic nitrogen fertilizer urea at four levels (0, 30, 60 and 90 kg urea/ha in the main plot and two levels of inoculation with Rhizobium japanicum bacteria (with and without inoculation assigned to the sub plots. Study the growth indices showed that the maximum total dry matter (435.4 gr/m2 , crop growth rate (6.75 gr/ and relative growth rate (0.1003 gr/ were obtained from compound of treatments high levels of urea application × inoculation with rhizobium while, the minimum values of these indices recorded in without nitrogen application×non inoculation with rhizobium. The highest plant height, number of pod per plant and grain yield were obtained from the highest level of nitrogen fertilizer (90 kg/ha urea and seed inoculation with rhizobium. Number and dry weight of nodules per plant increased significantly with increasing nitrogen application till 60 kg/ha in seed inoculation with rhizobium. The lowest values of these traits recorded in non application of urea×non inoculation with rhizobium. Inoculation with rhizobium bacteria increased the number and dry weight of nodules per plant. Thus, it can be suggested that in order to increasing of grain yield, seed can be inoculated with rhizobium bacteria × application of 60 kg urea/ha in conditions of Ardabil region.

  20. Induced mutation in soybean (Glycine max L.) breeding

    International Nuclear Information System (INIS)

    Tulmann Neto, A.; Menten, J.O.M.; Ando, A.


    The induced mutation in soybean (Glycine max, L.) breeding is studied. Seed treatment with gamma-rays or methanesulfonic acid ethyl ester (EMs) is used in the following varieties: Parana, Santa Rosa, UFV-1, Foscarin 31 and IAC-8. The study to obtain resistance to the soybean bud blight virus and mutants resistant to rust was done. Early mutants are also researched. (M.A.C.) [pt

  1. Effects of elevated CO2 concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr

    International Nuclear Information System (INIS)

    Rodriguez, J.H.; Klumpp, A.; Fangmeier, A.; Pignata, M.L.


    The carbon dioxide (CO 2 ) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO 2 and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO 2 regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO 2 and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO 2 than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO 2 and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO 2 and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human health.

  2. Chemical Composition, Antioxidant and Biological Activities of the Essential Oil and Extract of the Seeds of Glycine max (Soybean) from North Iran. (United States)

    Ghahari, Somayeh; Alinezhad, Heshmatollah; Nematzadeh, Ghorban Ali; Tajbakhsh, Mahmood; Baharfar, Robabeh


    Glycine max (L.) Merrill (soybean) is a major leguminous crop, cultivated globally as well as in Iran. This study examines the chemical composition of soybean essential oil, and evaluates the antioxidant and antimicrobial activities of seeds on various plant pathogens that commonly cause irreparable damages to agricultural crops. The essential oil of soybean seeds was analyzed by gas chromatography coupled to mass spectrometry. Antimicrobial activity was tested against 14 microorganisms, including three gram-positive, five gram-negative bacteria, and six fungi, using disk diffusion method and the Minimum Inhibitory Concentration technique. The soybean seeds were also subjected to screening for possible antioxidant activity by using catalase, peroxidase, superoxide dismutase, and 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay. Forty components were identified, representing 96.68% of the total oil. The major constituents of the oil were carvacrol (13.44%), (E,E)-2,4-decadienal (9.15%), p-allylanisole (5.65%), p-cymene (4.87%), and limonene (4.75%). The oil showed significant activity against Pseudomonas syringae subsp. syringae, Rathayibacter toxicus with MIC = 25 µg/mL, and Pyricularia oryzae with MIC = 12.5 µg/mL. In addition, the free radical scavenging capacity of the essential oil was determined with an IC 50 value of 162.35 µg/mL. Our results suggest that this plant may be a potential source of biocide, for economical and environmentally friendly disease control strategies. It may also be a good candidate for further biological and pharmacological investigations.

  3. Non-destructive technique for determining the viability of soybean (Glycine max) seeds using FT-NIR spectroscopy. (United States)

    Kusumaningrum, Dewi; Lee, Hoonsoo; Lohumi, Santosh; Mo, Changyeun; Kim, Moon S; Cho, Byoung-Kwan


    The viability of seeds is important for determining their quality. A high-quality seed is one that has a high capability of germination that is necessary to ensure high productivity. Hence, developing technology for the detection of seed viability is a high priority in agriculture. Fourier transform near-infrared (FT-NIR) spectroscopy is one of the most popular devices among other vibrational spectroscopies. This study aims to use FT-NIR spectroscopy to determine the viability of soybean seeds. Viable and artificial ageing seeds as non-viable soybeans were used in this research. The FT-NIR spectra of soybean seeds were collected and analysed using a partial least-squares discriminant analysis (PLS-DA) to classify viable and non-viable soybean seeds. Moreover, the variable importance in projection (VIP) method for variable selection combined with the PLS-DA was employed. The most effective wavelengths were selected by the VIP method, which selected 146 optimal variables from the full set of 1557 variables. The results demonstrated that the FT-NIR spectral analysis with the PLS-DA method that uses all variables or the selected variables showed good performance based on the high value of prediction accuracy for soybean viability with an accuracy close to 100%. Hence, FT-NIR techniques with a chemometric analysis have the potential for rapidly measuring soybean seed viability. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  4. Gamma-ray induction of a mutant soybean [Glycine max (L.) Merrill] line lacking all seed lipoxygenases

    International Nuclear Information System (INIS)

    Hajika, Makita; Suda, Ikuo; Sakai, Shinji; Takahashi, Masakazu


    Induction of a soybean line lacking all isozymes of seed lipoxygenase was attempted using γ-radiation and of 1,813 seeds in M 3 generation, only one was identified as a seed lacking all the isozymes by SDS-PAGE. This line did not present any physiological abnormality over 10 generations or more (M 4 -M 14 ) and no significant influence of the enzyme on the agricultural traits was observed during the performance test in fields. In the resistance test against insect pests, significant differences were not found among the varieties and the lines tested. These results suggest that deletion of all lipoxygenase isozymes would not affect the soybean production in practice. The lipoxygenase activity was not detected in the leaves as well as the seeds of this line, suggesting that this enzyme are not indispensable for the soybean growth. The validity of this line in food processing fields was examined through determining the levels of hexanal production and DETBA. This line was found able to improve the taste of soybean cookies and use in combination with other materials as flour, egg, etc. because the line has no lipoxygenase activity. (M.N.)


    Directory of Open Access Journals (Sweden)

    Milan Macak


    Full Text Available Field experiment was carry out at experimental farm Oponice West Slovakia, 48 28 N, 18 9E in 2004 2007. The aim of the work was to evaluate the influence of nitrogen fertilization treatments on yield and yield component and selected quality parameters proteins, oil, fibre, isoflavones of soybeen seeds variety Korada, in agri environmental condition of western part of Slovakia. The fertilization treatments were as follows I unfertilized treatment; II application of nitrogen fertilizers LAV 27 ammonium nitrate with lime 40 kg ha 1 nitrogen in the vegetative stage V2; III Humix complet in split application of total dose 4 +4 L ha 1 applied in growth stage of V2 and in reproductive growth stage of R1 beginning bloom. Humix complet contain bioactive ingredient and nutrients for plant nutrition with 2.5 of humic acids, 4.0 total N, 0.5 P2O5, 3 K2O, and micronutrients. Result showed the highest variation of pods per plant in dependence of year condition range 17.8-24.7. No significant differences between numbers of seeds were noted 2.13-2.29. The split application of Humic complet significantly influence the higher number of pods per plant 24.8 while keeping the number of seeds per pod 2.13. The yield of seeds was significantly influenced by weather conditions 2.84 t ha 1 4.68 t ha 1 and by fertilization treatments. Supplemental ammonium nitrate with lime treatments II in the vegetative stage of V2 or Humix complet treatment III applied in V2 and R1 stages significantly increased yield of soybean seeds up to 3.91 t ha 1 and 4.27 t ha 1 with comparison to control treatment 3.49 t ha 1. Content of protein, oil and fibre was not significantly differing between fertilization treatments. In spite of significantly higher soybean yield in Humic complet treatment, content of protein 37.67, oil 15.83 and fibre 9.47 was at the same level as lower yielded treatments. Soybean seeds from higher yielded fertilization treatments have significantly less content of

  6. Determination and Comparison of Seed Oil Triacylglycerol Composition of Various Soybeans (Glycine max (L. Using 1H-NMR Spectroscopy

    Directory of Open Access Journals (Sweden)

    Won Woo Kim


    Full Text Available Seed oil triacylglycerol (TAG composition of 32 soybean varieties were determined and compared using 1H-NMR. The contents of linolenic (Ln, linoleic (L, and oleic (O ranged from 10.7% to 19.3%, 37.4%–50.1%, and 15.7%–34.1%, respectively. As is evident, linoleic acid was the major fatty acid of soybean oil. Compositional differences among the varieties were observed. Natural oils containing unsaturated groups have been regarded as important nutrient and cosmetic ingredients because of their various biological activities. The TAG profiles of the soy bean oils could be useful for distinguishing the origin of seeds and controlling the quality of soybean oils. To the best of our knowledge, this is the first study in which the TAG composition of various soybean oils has been analyzed using the 1H-NMR method.

  7. Determination and comparison of seed oil triacylglycerol composition of various soybeans (Glycine max (L.)) using ¹H-NMR spectroscopy. (United States)

    Kim, Won Woo; Rho, Ho Sik; Hong, Yong Deog; Yeom, Myung Hun; Shin, Song Seok; Yi, Jun Gon; Lee, Min-Seuk; Park, Hye Yoon; Cho, Dong Ha


    Seed oil triacylglycerol (TAG) composition of 32 soybean varieties were determined and compared using ¹H-NMR. The contents of linolenic (Ln), linoleic (L), and oleic (O) ranged from 10.7% to 19.3%, 37.4%-50.1%, and 15.7%-34.1%, respectively. As is evident, linoleic acid was the major fatty acid of soybean oil. Compositional differences among the varieties were observed. Natural oils containing unsaturated groups have been regarded as important nutrient and cosmetic ingredients because of their various biological activities. The TAG profiles of the soy bean oils could be useful for distinguishing the origin of seeds and controlling the quality of soybean oils. To the best of our knowledge, this is the first study in which the TAG composition of various soybean oils has been analyzed using the ¹H-NMR method.



    Macák, Milan; Candráková, Eva


    Field experiment was carry out at experimental farm Oponice (West Slovakia, 48° 28´N, 18° 9´E) ) in 2004-2007. The aim of the work was to evaluate the influence of nitrogen fertilization treatments on yield and yield component and selected quality parameters (proteins, oil, fibre, isoflavones) of soybeen seeds variety Korada, in agri-environmental condition of western part of Slovakia. The fertilization treatments were as follows: (I) unfertilized treatment; (II) application of nitrogen ferti...

  9. Effects of two low phytic acid mutations on seed quality and nutritional traits in soybean (Glycine max L. Merr). (United States)

    Yuan, Feng-Jie; Zhu, Dan-Hua; Deng, Bo; Fu, Xu-Jun; Dong, De-Kun; Zhu, Shen-Long; Li, Bai-Quan; Shu, Qing-Yao


    Reduction of phytic acid in soybean seeds has the potential to improve the nutritional value of soybean meal and lessen phosphorus pollution in large scale animal farming. The objective of this study was to assess the effect of two new low phytic acid (LPA) mutations on seed quality and nutritional traits. Multilocation/season comparative analyses showed that the two mutations did not affect the concentration of crude protein, any of the individual amino acids, crude oil, and individual saturated fatty acids. Among other traits, Gm-lpa-TW75-1 had consistently higher sucrose contents (+47.4-86.1%) and lower raffinose contents (-74.2 to -84.3%) than those of wild type (WT) parent Taiwan 75; Gm-lpa-ZC-2 had higher total isoflavone contents (3038.8-4305.4 microg/g) than its parent Zhechun # 3 (1583.6-2644.9 microg/g) in all environments. Further tests of homozygous F(3) progenies of the cross Gm-lpa-ZC-2 x Wuxing # 4 (WT variety) showed that LPA lines had a mean content of total isoflavone significantly higher than WT lines. This study demonstrated that two LPA mutant genes have no negative effects on seed quality and nutritional traits; they instead have the potential to improve a few other properties. Therefore, these two mutant genes are valuable genetic resources for breeding high quality soybean varieties.

  10. QTLs for resistance to Phomopsis seed decay are associated with days to maturity in soybean (Glycine max). (United States)

    Sun, Suli; Kim, Moon Young; Van, Kyujung; Lee, Yin-Won; Li, Baodu; Lee, Suk-Ha


    Phomopsis seed decay (PSD), primarily caused by Phomopsis longicolla, is a major contributor to poor soybean seed quality and significant yield loss, particularly in early maturing soybean genotypes. However, it is not yet known whether PSD resistance is associated with early maturity. This study was conducted to identify quantitative trait loci (QTLs) for resistance to PSD and days to maturity using a recombinant inbred line (RIL) population derived from a cross between the PSD-resistant Taekwangkong and the PSD-susceptible SS2-2. Based on a genetic linkage map incorporating 117 simple sequence repeat markers, QTL analysis revealed two and three QTLs conferring PSD resistance and days to maturity, respectively, in the RIL population. Two QTLs (PSD-6-1 and PSD-10-2) for PSD resistance were identified in the intervals of Satt100-Satt460 and Sat_038-Satt243 on chromosomes 6 and 10, respectively. Two QTLs explained phenotypic variances in PSD resistance of 46.3 and 14.1 %, respectively. At the PSD-6-1 QTL, the PSD-resistant cultivar Taekwangkong contributed the allele with negative effect decreasing the infection rate of PSD and this QTL does not overlap with any previously reported loci for PSD resistance in other soybean genotypes. Among the three QTLs for days to maturity, two (Mat-6-2 and Mat-10-3) were located at positions similar to the PSD-resistance QTLs. The identification of the QTLs linked to both PSD resistance and days to maturity indicates a biological correlation between these two traits. The newly identified QTL for resistance to PSD associated with days to maturity in Taekwangkong will help improve soybean resistance to P. longicolla.

  11. Effects of elevated CO2 concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr. (United States)

    Rodriguez, J H; Klumpp, A; Fangmeier, A; Pignata, M L


    The carbon dioxide (CO(2)) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO(2) and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO(2) regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO(2) and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO(2) than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO(2) and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO(2) and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human health. Copyright © 2010

  12. Diversity of endophytic fungi in Glycine max. (United States)

    Fernandes, Elio Gomes; Pereira, Olinto Liparini; da Silva, Cynthia Cânedo; Bento, Claudia Braga Pereira; de Queiroz, Marisa Vieira


    Endophytic fungi are microorganisms that live within plant tissues without causing disease during part of their life cycle. With the isolation and identification of these fungi, new species are being discovered, and ecological relationships with their hosts have also been studied. In Glycine max, limited studies have investigated the isolation and distribution of endophytic fungi throughout leaves and roots. The distribution of these fungi in various plant organs differs in diversity and abundance, even when analyzed using molecular techniques that can evaluate fungal communities in different parts of the plants, such as denaturing gradient gel electrophoresis (DGGE). Our results show there is greater species richness of culturable endophytic filamentous fungi in the leaves G. max as compared to roots. Additionally, the leaves had high values for diversity indices, i.e. Simpsons, Shannon and Equitability. Conversely, dominance index was higher in roots as compared to leaves. The fungi Ampelomyces sp., Cladosporium cladosporioides, Colletotrichum gloeosporioides, Diaporthe helianthi, Guignardia mangiferae and Phoma sp. were more frequently isolated from the leaves, whereas the fungi Fusarium oxysporum, Fusarium solani and Fusarium sp. were prevalent in the roots. However, by evaluating the two communities by DGGE, we concluded that the species richness was higher in the roots than in the leaves. UPGMA analysis showed consistent clustering of isolates; however, the fungus Leptospora rubella, which belongs to the order Dothideales, was grouped among species of the order Pleosporales. The presence of endophytic Fusarium species in G. max roots is unsurprising, since Fusarium spp. isolates have been previously described as endophyte in other reports. However, it remains to be determined whether the G. max Fusarium endophytes are latent pathogens or non-pathogenic forms that benefit the plant. This study provides a broader knowledge of the distribution of the fungal

  13. Evaluation of Seed Germination and Seed Vigor of Different Soybean (Glycine max (L. Merr. Cultivars Under Different Planting Dates in Gorgan

    Directory of Open Access Journals (Sweden)

    M Gorzin


    Full Text Available Introduction Soybean seed germination and seed vigor potential is lower compared with other crops, and it often greatly reduces at the planting time. The occurrence of unfavorable conditions during seed formation in field causes severe deterioration of seeds and reduces the seed quality. Planting date is one of the most important influencing factors on seed quality of soybean in field conditions. Since planting date affect seed quality by changing the environmental conditions including temperature, relative humidity and rainfall during seed development and maturation. Materials and Methods To evaluate the seed germination and seed vigor of soybean seeds wshich were obtained from various planting dates, a field experiment was conducted with a split plot arrangement in a randomized complete block design in three replications in Gorgan University of Agricultural Sciences and Natural Resources in 2011. Main plot included five planting dates April 20, May 13, June 3, June 29 and July 22, and sub plot consisted of three cultivars (Williams, Sahar and DPX. About 50 plants were selected and harvested during R7 (physiological maturity stage from each plot, and their pods were removed by hand. Then, pods were dried in shade. To avoid mechanical damage, the seeds were removed by hand from the pods. Ultimately, seed quality was assessed by seed germination and seed vigor including accelerated aging, seedling growth rate (SGR and electrical conductivity tests. Results and Discussion According to obtained results, the use of different planting dates caused the change at the beginning and ending time of seed filling period (R5-R7 of all three cultivars. This event in turn leads to creation different conditions in terms of temperature, rainfall and relative humidity during seed filling period in all three cultivars. Therefore Williams cultivar coincided with high temperatures more than two other cultivars, especially in the early planting dates. While DPX that

  14. Efficient production of transgenic soybean (Glycine max [L] Merrill ...

    African Journals Online (AJOL)

    Efficient production of transgenic soybean (Glycine max [L] Merrill) plants mediated via whisker-supersonic (WSS) method. MM Khalafalla, HA El-Shemy, SM Rahman, M Teraishi, H Hasegawa, T Terakawa, M Ishimoto ...

  15. Metabolic and Transcriptional Reprogramming in Developing Soybean (Glycine max Embryos

    Directory of Open Access Journals (Sweden)

    Ruth Grene


    Full Text Available Soybean (Glycine max seeds are an important source of seed storage compounds, including protein, oil, and sugar used for food, feed, chemical, and biofuel production. We assessed detailed temporal transcriptional and metabolic changes in developing soybean embryos to gain a systems biology view of developmental and metabolic changes and to identify potential targets for metabolic engineering. Two major developmental and metabolic transitions were captured enabling identification of potential metabolic engineering targets specific to seed filling and to desiccation. The first transition involved a switch between different types of metabolism in dividing and elongating cells. The second transition involved the onset of maturation and desiccation tolerance during seed filling and a switch from photoheterotrophic to heterotrophic metabolism. Clustering analyses of metabolite and transcript data revealed clusters of functionally related metabolites and transcripts active in these different developmental and metabolic programs. The gene clusters provide a resource to generate predictions about the associations and interactions of unknown regulators with their targets based on “guilt-by-association” relationships. The inferred regulators also represent potential targets for future metabolic engineering of relevant pathways and steps in central carbon and nitrogen metabolism in soybean embryos and drought and desiccation tolerance in plants.

  16. Germinação de sementes e crescimento de plântulas de soja (Glycine max L. Merrill sob cobertura vegetal = Soybean (Glycine max L. Merrill seed germination and plantlet growth under vegetation cover

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Pereira Nóbrega


    Full Text Available A eficiência do sistema de rotação de cultura requer, entre outrostratamentos, a escolha adequada das espécies a serem instaladas. Culturas vegetais podem apresentar compostos aleloquímicos, os quais são liberados por meio de pelos radiculares, sementes, raízes, colmos e folhas, em quantidades variáveis, capazes de interferir nas culturas subsequentes, comprometendo a produção. Assim, este estudoanalisou o potencial alelopático de aveia-preta (Avena strigosa Schreb (AP, nabo forrageiro (Raphanus sativus L. (NF, ervilhaca (Vicia sativa L. (ER, azevém (Lolium multiflorum Lam. (AZ e consórcio (CO - AP+ER+NF na germinação de sementes e crescimento de plântulas de soja. O experimento foi em laboratório, com substrato deareia, onde foram cultivadas plantas de cobertura, por 30 dias, mantendo os restos radiculares das plantas com e sem restos de parte aérea. Observou-se redução na emergência de plântulas de soja sob CO, AZ e AP. O índice de velocidade de emergência (IVE, a porcentagem de emergência em areia (EA e a massa fresca de hipocótilo (MFH foram afetados negativamente pelas plantas de cobertura.In order to be efficient, the crop rotation system requires, among other factors, an adequate choice of species to be installed. Vegetalcultures can feature allelochemical compounds, released by root hairs, roots, stems and leaves in variable amounts, which are able to interfere on subsequent cultures, as well as cause a delay in their production. Thus, this study analyzed the allelopathic potentialof black oat (Avena strigosa Schreb (BO, forage turnip (Raphanus sativus L. (FT, vetch (Vicia sativa L. (V, ryegrass (Lolium multiflorum Lam. (RG and consortium (CO - BO+V+FT on soybean seed germination and plantlet growth. This trial was carried out in a laboratory, with sand substrate, where coverage plants were grown, during 30 days. The remaining root portions of plants were kept with and without the remaining aerial part portions

  17. Effects of long-term storage on the quality of soybean, Glycine max ...

    African Journals Online (AJOL)

    Soybean, Glycine max (L.) Merrill, is one of the five most important legumes in the tropics and provides the protein eaten by most people in the region. One of the major constraints to soybean production is that the seed quality deteriorates rapidly during storage. This study was undertaken to assess the effect of some storage ...

  18. Effects of substituting roasted soybean (Glycine max seeds by those of cowpea (Vigna unguiculata, and of the protein level in the diet, on growth performance and profitability of local-breed chickens (Gallus gallus in Burkina

    Directory of Open Access Journals (Sweden)

    S. Ouattara


    Full Text Available This study aimed to evaluate the effects of substituting roasted seeds of soya (Glycine max by those of cowpea (Vigna unguiculata, and of the protein level in the diet, on growth performance and economic profitability of local-breed chickens (Gallus gallus in Burkina Faso. Three hundred 12-day-old chicks were divided into 12 batches of 25 chicks each. Four diets incorporating seeds of cowpea or soya, with different protein levels for starting and growing/finishing, were prepared. Data on various parameters (body weight, weight gain, intake and feed conversion, mortality were recorded once every two weeks from the 12th to the 138th day of age. At the 138th day, four chickens (two males and two females from each batch were slaughtered to assess the characteristics of carcasses and selected organs. The comparative profitability of the different treatments was evaluated. Results indicate that the substitution of roasted seeds of soya by those of cowpea had no devaluing effect on growth performance nor on carcass characteristics of the local chicken. In addition, the use of these seeds did not decrease profitability. Lastly, increasing the protein level in the diets significantly (p ≤ 0.05 improved weight gains and reduced the duration of the breeding period by two weeks.

  19. Reaction of some selected soybean varieties ( Glycine max (L) Merril)

    African Journals Online (AJOL)

    In nematode endemic ecological zones, TGX-1985 – 8F is therefore recommended as it proved to contain some specialized genes that conferred a higher level of tolerance against root- knot nematode, Meloidogyne incognita. Key Words: Glycine max, root – knot nematode, Dominant loci, Mi – 1.2, leucine zipper and R ...

  20. Biofertilisasi bakteri rhizobium pada tanaman kedelai (Glycine max (L MERR.

    Directory of Open Access Journals (Sweden)

    Tini Surtiningsih


    Full Text Available The aim of this research want to know the influence of the addition Rhizobium bacteria species, dose and combination both ofthem, on growth and production of soybean plant (Glycine max (L Merr.. The experimental design of this research was factorial design4×2, 4 species of Rhizobium are R1 = Rhizobium japonicum, R2 = R. phaseoli, R3 = R. leguminosarum, R4 = mixture of R1, R2 andR3, and 2 dose of inoculan Rhizobium (D1 = 5 m/plant, and D2 = 10 ml/plant with 1010 sel bacteria/ml and 5 replications. Independentvariable is species of Rhizobium, dose of inoculan Rhizobium and combination both of them. Dependent variable is dry matter, weightof nodules and dry weight of seeds. The harvest data was analyzed by Kruskal-Wallis Test using 5% level (a = 0.05 followed by Mann-Whitney Test. The result of this research show that species of Rhizobium, dose of inoculan Rhizobium and combination both of thempresent insignificant result (a > 0.05 on soybean growth and production, but the mixture of Rhizobium species with high level doseof bacteria, present better result than single species with low dose of bacteria.

  1. Teste de lixiviação de potássio para avaliação do vigor de sementes de soja [Glycine max (L.Merril] Potassium leaching test for the evaluation of soybean seed vigour

    Directory of Open Access Journals (Sweden)

    D.C.F.S. Dias


    Full Text Available O presente trabalho teve como objetivo principal investigar a possibilidade de se obter indicações rápidas sobre a qualidade fisiológica de sementes de soja através do teste de lixiviação de potássio, cuja eficiência foi avaliada comparativamente as informações fornecidas por outros métodos considerados adequados para a determinação do vigor. Para tanto, utilizou-se quatro lotes de sementes de soja dos cultivares IAC-8 e IAC-15 que foram submetidos aos testes de germinação, primeira contagem de germinação, envelhecimento artificial, condutividade elétrica e determinação do grau de umidade. Além destes foram conduzidos estudos de lixiviação de potássio utilizando-se amostras de sementes não danificadas e de sementes fisicamente puras. A quantidade de potássio lixiviado foi avaliada em fotômetro de chama após 60, 90, 120 e 150 minutos de embebição a 30ºC. As avaliações feitas aos 60, 90 e 120 minutos mostraram-se adequadas para a identificação de lotes com diferentes níveis de vigor, constituindo-se em um método simples e rápido para a avaliação da qualidade fisiológica das sementes.This work was performed to investigate the possibilities of providing rapid indications on the physiological quality of seeds through the potassium leaching test. Four lots of soybean (Glycine max (L. Merrill seeds, cultivars IAC-8 and IAC-15 were submitted to germination, first count, accelerated aging, electrical conductivity and seed moisture tests. In addition, studies on potassium leaching were conducted with samples of selected non damaged seeds and with pure seeds. The amount of leached potassium was evaluated in a flame photometer after a 60, 90, 120 and 150 minute imbibition at 30°C. The evaluations after 60, 90 and 120 minutes were suitable for the identification of lots with different levels of vigour, thus proving to be a simple and rapid method for seed vigour evaluation.

  2. Effects of Nano-Zinc oxide and Seed Inoculation by Plant Growth Promoting Rhizobacteria (PGPR on Yield, Yield Components and Grain Filling Period of Soybean (Glycine max L.

    Directory of Open Access Journals (Sweden)

    R. Seyed Sharifi


    Full Text Available Introduction Utilizing biological fertilizer is a proper and cheap method for crop production. Potentially, soybean can be used as biological fertilizers and seed inoculation. Zinc is an essential element that have positive effects on plant growth and its development. Canola, sunflower, soybean and safflower are the main cultivated oilseeds in Iran. Soybean production in Iran is very low as compared to other countries. One of the most effective factor in increasing the soybean yield is seed inoculation with plant growth promoting rhizobacteria (PGPR and application of Zinc fertilizer. Some of the benefits provided by PGPR are the ability to produce gibberellic acid, cytokinins and ethylene, N2 fixation, solubilization of mineral phosphates and other nutrients (56. Numerous studies have shown a substantial increase in dry matter accumulation and seed yield following inoculation with PGPR. Seyed Sharifi (45 reported that seed inoculation with Azotobacter chroococcum strain 5 increased all of the growth indices such as total dry matter, crop growth rate and relative growth rate. Increasing and extending the role of biofertilizers such as Rhizobium can reduce the need for chemical fertilizers and decrease adverse environmental effects. Therefore, in the development and implementation of sustainable agricultural techniques, biofertilization has great importance in alleviating environmental pollution and deterioration of the nature. As a legume, soybean can obtain a significant portion (4-85% of its nitrogen requirement through symbiotic N2 fixation when grown in association with effective and compatible Rhizobium strains. Since there is little available information on nano-zinc oxide and seed inoculation by plant growth promoting rhizobacteria (PGPR on yield in the agro-ecological growing zones of Ardabil province of Iran. Therefore, this research was conducted to investigate the effects of nano-zinc oxide and seed inoculation with plant growth

  3. Effect of gamma irradiation on lipoxygenases, trypsin inhibitor, raffinose family oligosaccharides and nutritional factors of different seed coat colored soybean (Glycine max L.)

    Energy Technology Data Exchange (ETDEWEB)

    Kumar Dixit, Amit [School of Biochemistry, Devi Ahilya University, Khandwa Road, Indore-452017 (India); Kumar, Vineet; Rani, Anita [National Research Centre for Soybean, Khandwa Road, Indore-452017 (India); Manjaya, J.G. [Board of Research in Nuclear Sciences, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Bhatnagar, Deepak, E-mail: [School of Biochemistry, Devi Ahilya University, Khandwa Road, Indore-452017 (India)


    Three soybean genotypes Kalitur, Hara soya and NRC37 with black, green and yellow seed coat color, respectively, were gamma irradiated at 0.5, 2.0 and 5.0 kGy and tested for antinutritional and nutritional factors. Gamma irradiation at all doses reduced the level of lipoxygenase isomers, trypsin inhibitor (TI) and ascorbic acid in all the 3 soybean genotypes as compared to the unirradiated control. However, irradiation dose of 5.0 kGy increased the sucrose content of the soybean genotypes. No significant change was observed in oil, protein fatty acids and total tocopherol content of the 3 genotypes at any irradiation dose. It is suggested that inhibition of lipoxygenase, reduction in TI and ascorbic acid may be due to the breakage or oxidation of protein structure by the gamma irradiation. Similarly, gamma irradiation at higher doses may break glycosidic linkages in oligosaccharides to produce more sucrose and decrease the content of flatulence causing oligosaccharides.

  4. Effect of gamma irradiation on lipoxygenases, trypsin inhibitor, raffinose family oligosaccharides and nutritional factors of different seed coat colored soybean (Glycine max L.)

    International Nuclear Information System (INIS)

    Kumar Dixit, Amit; Kumar, Vineet; Rani, Anita; Manjaya, J.G.; Bhatnagar, Deepak


    Three soybean genotypes Kalitur, Hara soya and NRC37 with black, green and yellow seed coat color, respectively, were gamma irradiated at 0.5, 2.0 and 5.0 kGy and tested for antinutritional and nutritional factors. Gamma irradiation at all doses reduced the level of lipoxygenase isomers, trypsin inhibitor (TI) and ascorbic acid in all the 3 soybean genotypes as compared to the unirradiated control. However, irradiation dose of 5.0 kGy increased the sucrose content of the soybean genotypes. No significant change was observed in oil, protein fatty acids and total tocopherol content of the 3 genotypes at any irradiation dose. It is suggested that inhibition of lipoxygenase, reduction in TI and ascorbic acid may be due to the breakage or oxidation of protein structure by the gamma irradiation. Similarly, gamma irradiation at higher doses may break glycosidic linkages in oligosaccharides to produce more sucrose and decrease the content of flatulence causing oligosaccharides.

  5. Effects of elevated CO{sub 2} concentrations and fly ash amended soils on trace element accumulation and translocation among roots, stems and seeds of Glycine max (L.) Merr

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, J.H. [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina); Klumpp, A.; Fangmeier, A. [Institute of Landscape and Plant Ecology (320), Plant Ecology and Ecotoxicology, Universitaet Hohenheim, August-von-Hartmann-Str. 3, 70599 Stuttgart (Germany); Pignata, M.L., E-mail: [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina)


    The carbon dioxide (CO{sub 2}) levels of the global atmosphere and the emissions of heavy metals have risen in recent decades, and these increases are expected to produce an impact on crops and thereby affect yield and food safety. In this study, the effects of elevated CO{sub 2} and fly ash amended soils on trace element accumulation and translocation in the root, stem and seed compartments in soybean [Glycine max (L.) Merr.] were evaluated. Soybean plants grown in fly ash (FA) amended soil (0, 1, 10, 15, and 25% FA) at two CO{sub 2} regimes (400 and 600 ppm) in controlled environmental chambers were analyzed at the maturity stage for their trace element contents. The concentrations of Br, Co, Cu, Fe, Mn, Ni, Pb and Zn in roots, stems and seeds in soybeans were investigated and their potential risk to the health of consumers was estimated. The results showed that high levels of CO{sub 2} and lower concentrations of FA in soils were associated with an increase in biomass. For all the elements analyzed except Pb, their accumulation in soybean plants was higher at elevated CO{sub 2} than at ambient concentrations. In most treatments, the highest concentrations of Br, Co, Cu, Fe, Mn, and Pb were found in the roots, with a strong combined effect of elevated CO{sub 2} and 1% of FA amended soils on Pb accumulation (above maximum permitted levels) and translocation to seeds being observed. In relation to non-carcinogenic risks, target hazard quotients (TQHs) were significant in a Chinese individual for Mn, Fe and Pb. Also, the increased health risk due to the added effects of the trace elements studied was significant for Chinese consumers. According to these results, soybean plants grown for human consumption under future conditions of elevated CO{sub 2} and FA amended soils may represent a toxicological hazard. Therefore, more research should be carried out with respect to food consumption (plants and animals) under these conditions and their consequences for human

  6. Growth and nitrogen dynamics of glycine max inoculated with bradyrhizobium japonicum and exposed to elevated atmospheric carbon dioxide

    International Nuclear Information System (INIS)

    Rehman, A.; Hamid, N.; Jawaid, F.


    Seeds of Glycine max (soybean) were inoculated with N-fixing bacterium Bradyrhizobium japonicum and grown in growth chamber to investigate interactive effects of atmospheric CO/sub 2/ and plants Nitrogen status on root and shoot length and biomass, nodule formation and Nitrogen concentration. Plants were grown with CO/sub 2/ at 3500 and 1000 ppm with or without Bradyrhizobium japonicum inoculation. Root and shoot length and dry mass of Glycine max increased significantly with CO/sub 2/ enrichment provided with Bradyrhizobium japonicum as compared to deficient Nitrogen fixing bacterium. While ambient and enriched CO/sub 2/ levels resulted in increased Nitrogen concentration of Glycine max shoot and root which is inoculated with N-fixing bacterium. Nodule formation was also enhanced in plants supplied with Bradyrhizobium japonicum as compared to plants which is Bradyrhizobium japonicum deficient at both CO/sub 2/ concentrations. (author)

  7. Enteromorpha intestinalis Derived Seaweed Liquid Fertilizers as Prospective Biostimulant for Glycine max

    Directory of Open Access Journals (Sweden)

    Chetna Mathur


    Full Text Available ABSTRACT In the present study, the potential of seaweed liquid fertilizer (SLF of marine algae Enteromorpha intestinalis was evaluated for its effect on seed germination, yield, biochemical parameters and pigment characteristics of Glycine maxE. intestinalis was collected form Mandapam coast of Gulf of Mannar, Tamil Nadu, and the dried seaweeds were used for the preparation of SLF. G. max seeds were germinated with four different concentrations (20, 40, 60, and 100% of SLF; its growth and yield parameters were evaluated and compared with chemical fertilizer and control. The morphological and bio-chemical parameters such as seed germination (100%, root (6.6cm and shoot length (5.4 cm, carbohydrates (0.098 mg/g, protein (0.56 mg/g, pigment (0.444 mg/g chl a; 1.073 mg/g chl b; 3.70 mg/g carotenoids of the plant was found maximum at a concentration of 60% SLF. The phenol content (3.25 mg/g was maximum in 40% SLF. The GC-MS analysis of SLF revealed the presence of notable benzoic compounds involved in plant growth promotion. Results showed thatE. intestinalis derived SLF was potential biostimulant forG. max. Thus, marine algae based fertilizer could be an effective and alternate to the chemical fertilizers emphasizing the need for systematic evaluation programme for SLF on various crops.


    Directory of Open Access Journals (Sweden)

    Marius Stefan


    Full Text Available Now it is an accepted fact that plant growth-promoting rhizobacteria (PGPR can increase the productivity of several crops. The main objective of the present study was to find if there are any differences in protein content in the seeds of soybean (Glycine max L. MERR.. Using spectrophotometric methods for analyzing the protein contents and electrophoretic methods for qualitative analysis it was observed that no major modifications occur in protein spectrum. Looking at the quantitative side there was a small improvement in protein quantity.

  9. Elevated carbon dioxide increases salicylic acid in Glycine max. (United States)

    Casteel, Clare L; Segal, Lauren M; Niziolek, Olivia K; Berenbaum, May R; DeLucia, Evan H


    Concentrations of carbon dioxide (CO(2)) are increasing in the atmosphere, affecting soybean (Glycine max L.) phytohormone signaling and herbivore resistance. Whether the impact of elevated CO(2) on phytohormones and induced defenses is a generalized response within this species is an open question. We examined jasmonic acid (JA) and salicylic acid (SA) under ambient and elevated CO(2) concentrations with and without Japanese beetle (Popillia japonica Newman) damage and artificial damage across six soybean cultivars (HS93-4118, Pana, IA 3010, Loda, LN97-15076, and Dwight). Elevated CO(2) reduced constitutive levels of JA and related transcripts in some but not all soybean cultivars. In contrast to the variation in JA, constitutive levels of salicylic were increased universally among soybean cultivars grown under elevated CO(2). Variation in hormonal signaling may underpin observed variation in the response of insect herbivores and pathogens to plants grown under elevated CO(2).

  10. Effect of tillage system on yield and weed populations of soybean ( Glycin Max L.). (United States)

    Hosseini, Seyed Z; Firouzi, Saeed; Aminpanah, Hashem; Sadeghnejhad, Hamid R


    Field experiment was conducted at Agricultural and Natural Resources Research Center of Golestan Province, Iran, to determine the effects of tillage system and weed management regime on yield and weed populations in soybean ( Glycin max L.). The experimental design was a split plot where the whole plot portion was a randomized complete block with three replicates. Main plots were tillage system: 1- No-till row crop seeding, 2- No-till seed drilling, 3- Tillage with disc harrow and drill planting, 4- Tillage with chisel packer and drill planting. The subplots were weed management regimes: 1-Weed control with herbicide application, 2- Hand weeding, 3- Herbicide application plus hand weeding, and 4- Non-weeding. Results indicated that the main effects of tillage system and weed management regime were significant for seed yield, pod number per plant, seed number per pod, weed density and biomass, while their interaction were significant only for weed density, weed biomass, and seed number per pod. The highest grain yields (3838 kg ha-1) were recorded for No-till row crop seeding. The highest seed yield (3877 kg ha-1) also was recorded for weed control with herbicide and hand weeding treatment, followed by hand weeding (3379 kg ha-1).

  11. RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

    Directory of Open Access Journals (Sweden)

    Severin Andrew J


    Full Text Available Abstract Background Next generation sequencing is transforming our understanding of transcriptomes. It can determine the expression level of transcripts with a dynamic range of over six orders of magnitude from multiple tissues, developmental stages or conditions. Patterns of gene expression provide insight into functions of genes with unknown annotation. Results The RNA Seq-Atlas presented here provides a record of high-resolution gene expression in a set of fourteen diverse tissues. Hierarchical clustering of transcriptional profiles for these tissues suggests three clades with similar profiles: aerial, underground and seed tissues. We also investigate the relationship between gene structure and gene expression and find a correlation between gene length and expression. Additionally, we find dramatic tissue-specific gene expression of both the most highly-expressed genes and the genes specific to legumes in seed development and nodule tissues. Analysis of the gene expression profiles of over 2,000 genes with preferential gene expression in seed suggests there are more than 177 genes with functional roles that are involved in the economically important seed filling process. Finally, the Seq-atlas also provides a means of evaluating existing gene model annotations for the Glycine max genome. Conclusions This RNA-Seq atlas extends the analyses of previous gene expression atlases performed using Affymetrix GeneChip technology and provides an example of new methods to accommodate the increase in transcriptome data obtained from next generation sequencing. Data contained within this RNA-Seq atlas of Glycine max can be explored at

  12. Comparative mapping of the wild perennial Glycine latifolia and soybean (G. max reveals extensive chromosome rearrangements in the genus Glycine.

    Directory of Open Access Journals (Sweden)

    Sungyul Chang

    Full Text Available Soybean (Glycine max L. Mer., like many cultivated crops, has a relatively narrow genetic base and lacks diversity for some economically important traits. Glycine latifolia (Benth. Newell & Hymowitz, one of the 26 perennial wild Glycine species related to soybean in the subgenus Glycine Willd., shows high levels of resistance to multiple soybean pathogens and pests including Alfalfa mosaic virus, Heterodera glycines Ichinohe and Sclerotinia sclerotiorum (Lib. de Bary. However, limited information is available on the genomes of these perennial Glycine species. To generate molecular resources for gene mapping and identification, high-density linkage maps were constructed for G. latifolia using single nucleotide polymorphism (SNP markers generated by genotyping by sequencing and evaluated in an F2 population and confirmed in an F5 population. In each population, greater than 2,300 SNP markers were selected for analysis and segregated to form 20 large linkage groups. Marker orders were similar in the F2 and F5 populations. The relationships between G. latifolia linkage groups and G. max and common bean (Phaseolus vulgaris L. chromosomes were examined by aligning SNP-containing sequences from G. latifolia to the genome sequences of G. max and P. vulgaris. Twelve of the 20 G. latifolia linkage groups were nearly collinear with G. max chromosomes. The remaining eight G. latifolia linkage groups appeared to be products of multiple interchromosomal translocations relative to G. max. Large syntenic blocks also were observed between G. latifolia and P. vulgaris. These experiments are the first to compare genome organizations among annual and perennial Glycine species and common bean. The development of molecular resources for species closely related to G. max provides information into the evolution of genomes within the genus Glycine and tools to identify genes within perennial wild relatives of cultivated soybean that could be beneficial to soybean


    Directory of Open Access Journals (Sweden)

    Nyimas Sa’diyah


    Full Text Available Heritability, potential ratio, and heterosis of soybean (Glycine max [L.] Merrill resistance to soybean mosaic virus. The use of soybean cultivars with resistance to SMV is a way for controlling soybean mosaic disease. The objective of this research was to estimate the disease severity, the narrow sense heritability, potential ratio and heterosis of resistance character and number of pithy pods, number of healthy seeds, and healthy seeds weight per plant of ten F1 populations of soybean crossing result to SMV infection. The experiment was arranged in a randomized complete block design in two replications. Observed characters were disease severity, number of pithy pods, number of healthy seeds, and healthy seeds weight per plant. The result of this research showed that 1 the crossing combinations those which were resistant to SMV (lower disease severity were Yellow Bean x Tanggamus, Tanggamus x Orba, and Tanggamus x Taichung, 2 the narrow sense heritability of disease severity was included in medium criteria, 3 number of pithy pods belonged to high criteria, and 4 number of healthy seeds and healthy seeds weight per plant were included in low criteria. The crossing combinations that had low estimation value of heterosis and heterobeltiosis of resistance to SMV infection were Yellow Bean x Taichung, Bean x Tanggamus and Tanggamus x B3570. Disease severity or resistance to SMV is influenced by genetic and environmental factors.

  14. Anatomical Study of Somatic Embryogenesis in Glycine max (L. Merrill

    Directory of Open Access Journals (Sweden)

    Juliana Aparecida Fernando


    Full Text Available A comparative anatomical analysis of somatic embryogenesis in two soybean (Glycine max (L. Merrill genotypes was carried out. The somatic embryos were originated from cotyledonary explants obtained from immature zygotic embryos. The medium used for somatic embryogenesis induction was Murashige and Skoog, 1962, salts and Gamborg et al., 1968, vitamins (MSB supplemented with 0.8 mg.L-1 of 2,4-D for genotype PI 123439 and 40 mg.L-1 of 2,4-D for ‘Williams 82’. Globular structures, constituted by meristematic cells, originated from subepidermal cell divisions of the cotyledonary mesophyll. In PI 123439, the globular structures presented tracheary differentiation among meristematic cells and they could follow distinct morphogenetic process depending on their location along the explant. For ‘Williams 82’ it was observed globular structures along the cotyledonary explant surface. They gave rise to somatic embryos. These embryos showed different morphologies and they were classified based on their shape and number of cotyledons. The ability of these morphological types to convert to plantlets was discussed.Realizou-se uma análise anatômica comparativa da embriogênese somática em dois genótipos de soja (Glycine max (L. Merrill. Os embriões somáticos foram obtidos a partir de explantes cotiledonares excisados de embriões zigóticos imaturos do genótipo PI 123439, adaptado às condições tropicais, e ‘Williams 82’. O meio utilizado para indução da embriogênese somática constituiu-se de sais de Murashige e Skoog,1962, e vitaminas de Gamborg et al., 1968 (MSB suplementado com 0,8 mg.L-1 de 2,4-D (PI 123439 e 40 mg.L-1 (‘Williams 82’. Estruturas globulares originaram-se a partir de divisões celulares nas camadas subepidérmicas do mesofilo cotiledonar e foram constituídas por células meristemáticas. No genótipo PI 123439, as estruturas globulares apresentaram diferenciação traqueal entre as células meristemáticas e

  15. Sur quelques aspects de la production du soja (Glycine max L. au Congo : essais préliminaires

    Directory of Open Access Journals (Sweden)

    Mandimba, GR.


    Full Text Available About some cropping systems of soybean (Glycine max. L. in Congo : first results. Field experiments were conducted to assess the response of soybean Glycine max cv. FN3 to N fertilization and inoculation respectively. In the first experiment, the effects of different levels of N fertilizer (0 ; 20 ; 40 and 80 kg N/ha with or without liming were studied. Soybean podyield were related to N fertilization only when liming was added to the soil In the second one, the effects of four Bradyrhizobium japonicum strains F A3 ; 3-40 ; SA 1 and G3S on nodulation and yields were also studied. Inoculation has significant effect on nodulation and plant top dry weight at full bloom, and seed yield at harvest when compared to the control. However, the Bradyrhizobium japonicum strains tested had various symbiotic effectiveness on Glycine max cv. FN3. In addition, soybean plants inoculated with G3S strain and those fertilized with 100 kg N/ha produced similar seed yield. Our study illustrated that G3S strain had the better adaptability in environmental conditions of Congo soil.

  16. Nutrient Management practices for enhancing Soybean (Glycine max L. production

    Directory of Open Access Journals (Sweden)



    La soya (Glycine max L., es el cultivo de legumbres más importante en el mundo. La magnitud de las pérdidas en el rendimientode la soya debido a deficiencias varía dependiendo de los nutrientes. Las deficiencias de N, P, Fe, B y S pueden causar pérdidas en rendimiento de hasta 10 %, 29-45 %, 22-90 %, 100 % y 16-30 %, respectivamente, en la soya dependiendo de la fertilidad del suelo, clima y factores intrínsecos a las plantas. La textura de los suelos utilizados en el cultivo de soya varía entre arenosa y arcillosa. La salinidad del suelo es uno de los mayores factores limitantes en la producción del cultivo en regiones semiáridas, y la salinidad por cloro tiene un mayor efecto en la disminución del rendimiento que la salinidad por sulfatos. Los granos de soya son una gran fuente de energía que contienen 40 % de proteína y 19 % de aceite. El éxito del manejo de nutrientes es maximizar la productividad del cultivo mientras se minimizan los impactos ambientales. Las prácticas de manejo de nutrientes balanceadas y reguladas en el tiempo contribuyen a un crecimiento sostenido del rendimiento y la calidad, influencian la salud de las plantas y reducen los riesgos ambientales. Una nutrición balanceada con fertilizantes minerales puede ayudar en el manejo integrado de plagas para reducir los daños causados por las infestaciones de pestes y enfermedades y reducir los insumos requeridos para su control. Una fertilización balanceada genera mayores ganancias para los agricultores, no necesariamente por reducción de los insumos. El papel de la educación y la extensión en la difusión del conocimiento actual sobre manejo de nutrientes es crucial, desafiante y continuo.

  17. Growth and quality of soybean sprouts (Glycine max L. Merrill) as affected by gamma irradiation (United States)

    Yun, Juan; Li, Xihong; Fan, Xuetong; Li, Weili; Jiang, Yuqian


    In this study, soybean seeds and sprouts (Glycine max L. Merrill) were exposed to radiation doses up to 3.0 kGy. The irradiated and non-irradiated seeds were germinated, and then germination rate, sprouts length, vitamin C content, antioxidants and visual and olfactory quality were determined after irradiation. Results indicated that there was no significant difference in the germination rate and sprouts length between the control and 0.3 kGy treated soybeans, however, the reductions in sprouts length of the 1.0 kGy and 3.0 kGy treated samples were quite significant with reductions of 20.4% and 58.8%, respectively. Irradiated sprouts had similar visual and olfactory quality as the non-irradiated one. Therefore, irradiation of seeds alone would have limited value in terms of commercial use due to reduced germination and length of sprouts. However, irradiation of sprouts at doses up to 3.0 kGy was feasible to enhance microbial safety of sprouts.

  18. Growth and quality of soybean sprouts (Glycine max L. Merrill) as affected by gamma irradiation

    International Nuclear Information System (INIS)

    Yun, Juan; Li, Xihong; Fan, Xuetong; Li, Weili; Jiang, Yuqian


    In this study, soybean seeds and sprouts (Glycine max L. Merrill) were exposed to radiation doses up to 3.0 kGy. The irradiated and non-irradiated seeds were germinated, and then germination rate, sprouts length, vitamin C content, antioxidants and visual and olfactory quality were determined after irradiation. Results indicated that there was no significant difference in the germination rate and sprouts length between the control and 0.3 kGy treated soybeans, however, the reductions in sprouts length of the 1.0 kGy and 3.0 kGy treated samples were quite significant with reductions of 20.4% and 58.8%, respectively. Irradiated sprouts had similar visual and olfactory quality as the non-irradiated one. Therefore, irradiation of seeds alone would have limited value in terms of commercial use due to reduced germination and length of sprouts. However, irradiation of sprouts at doses up to 3.0 kGy was feasible to enhance microbial safety of sprouts. - Highlights: ► Investigated the germination rate and the sprouts length after irradiation. ► Indicated the effect of irradiation on the antioxidants of the soybean sprouts. ► Evaluated the visual and olfactory quality of irradiated samples.

  19. Ectopic phytocystatin expression leads to enhanced drought stress tolerance in soybean (Glycine max) and Arabidopsis thaliana through effects on strigolactone pathways and can also result in improved seed traits. (United States)

    Quain, Marian D; Makgopa, Matome E; Márquez-García, Belén; Comadira, Gloria; Fernandez-Garcia, Nieves; Olmos, Enrique; Schnaubelt, Daniel; Kunert, Karl J; Foyer, Christine H


    Ectopic cystatin expression has long been used in plant pest management, but the cysteine protease, targets of these inhibitors, might also have important functions in the control of plant lifespan and stress tolerance that remain poorly characterized. We therefore characterized the effects of expression of the rice cystatin, oryzacystatin-I (OCI), on the growth, development and stress tolerance of crop (soybean) and model (Arabidopsis thaliana) plants. Ectopic OCI expression in soybean enhanced shoot branching and leaf chlorophyll accumulation at later stages of vegetative development and enhanced seed protein contents and decreased the abundance of mRNAs encoding strigolactone synthesis enzymes. The OCI-expressing A. thaliana showed a slow-growth phenotype, with increased leaf numbers and enhanced shoot branching at flowering. The OCI-dependent inhibition of cysteine proteases enhanced drought tolerance in soybean and A. thaliana, photosynthetic CO2 assimilation being much less sensitive to drought-induced inhibition in the OCI-expressing soybean lines. Ectopic OCI expression or treatment with the cysteine protease inhibitor E64 increased lateral root densities in A. thaliana. E64 treatment also increased lateral root densities in the max2-1 mutants that are defective in strigolactone signalling, but not in the max3-9 mutants that are defective in strigolactone synthesis. Taken together, these data provide evidence that OCI-inhibited cysteine proteases participate in the control of growth and stress tolerance through effects on strigolactones. We conclude that cysteine proteases are important targets for manipulation of plant growth, development and stress tolerance, and also seed quality traits. © 2014 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  20. Purification and characterization of an iron-induced ferritin from soybean (Glycine max) cell suspensions. (United States)

    Lescure, A M; Massenet, O; Briat, J F


    Ferric citrate induces ferritin synthesis and accumulation in soybean (Glycine max) cell suspension cultures [Proudhon, Briat & Lescure (1989) Plant Physiol. 90, 586-590]. This iron-induced ferritin has been purified from cells grown for 72 h in the presence of either 100 microM- or 500 microM-ferric citrate. It has a molecular mass of about 600 kDa and is built up from a 28 kDa subunit which is recognized by antibodies raised against pea (Pisum sativum) seed ferritin and it has the same N-terminal sequence as this latter, except for residue number 3, which is alanine in pea seed ferritin instead of valine in iron-induced soybean cell ferritin. It contains an average of 1800 atoms of iron per molecule whatever the ferric citrate concentration used to induce its synthesis. It is shown that the presence of 100 microM- or 500 microM-ferric citrate in the culture medium leads respectively to an 11- and 28-fold increase in the total intracellular iron concentration and to a 30- and 60-fold increase in the ferritin concentration. However, the percentage of iron stored in the mineral core of ferritin remains constant whatever the ferric citrate concentration used and represents only 5-6% of cellular iron.

  1. Effects of glyphosate on the mineral content of glyphosate-resistant soybeans (Glycine max). (United States)

    Duke, Stephen O; Reddy, Krishna N; Bu, Kaixuan; Cizdziel, James V


    There are conflicting claims as to whether treatment with glyphosate adversely affects mineral nutrition of glyphosate-resistant (GR) crops. Those who have made claims of adverse effects have argued links between reduced Mn and diseases in these crops. This article describes experiments designed to determine the effects of a recommended rate (0.86 kg ha(-1)) of glyphosate applied once or twice on the mineral content of young and mature leaves, as well as in seeds produced by GR soybeans (Glycine max) in both the greenhouse and field using inductively coupled plasma mass spectrometry (ICP-MS). In the greenhouse, there were no effects of either one application (at 3 weeks after planting, WAP) or two applications (at 3 and 6 WAP) of glyphosate on Ca, Mg, Mn, Zn, Fe, Cu, Sr, Ba, Al, Cd, Cr, Co, or Ni content of young or old leaves sampled at 6, 9, and 12 WAP and in harvested seed. Se concentrations were too low for accurate detection in leaves, but there was also no effect of glyphosate applications on Se in the seeds. In the field study, there were no effects of two applications (at 3 and 6 WAP) of glyphosate on Ca, Mg, Mn, Zn, Fe, Cu, Sr, Ba, Al, Cd, Cr, Co, or Ni content of young or old leaves at either 9 or 12 WAP. There was also no effect on Se in the seeds. There was no difference in yield between control and glyphosate-treated GR soybeans in the field. The results indicate that glyphosate does not influence mineral nutrition of GR soybean at recommended rates for weed management in the field. Furthermore, the field studies confirm the results of greenhouse studies.


    Directory of Open Access Journals (Sweden)

    Irma Nofitahesti


    Full Text Available Abstract - Soybean (Glycine max (L. Merr is one of the most important food commodity to fulfill the protein necessity in Indonesia. Although Indonesia has many prime soybean seeds, it cannot fulfill the whole need of soybean and always rely on soybean import. This problem can be solved by increasing the quality and productivity of prime soybean seed by polyploidization with colchicine. This research aimed to study ploidy level and phenotype characters of Anjasmoro soybean which was induced by colchicine. The phenotype characters in this research were stomata size, plant height, total pod in one plant, total seed in one plant, weight of 100 seeds, flowering time, and ripening time of soybean. The ploidy level was analyzed with flow cytometry methode. The data was analyzed with one way ANOVA and Duncan test in SPSS 22 program. The result of this research showed that Anjasmoro soybean did not successfully induced by colchicine using concentration 0.01%, 0.02%, 0.025%, 0.05%, 0.075%, 0.1%, 0.15%, 0.2%, and 0.25% with duration of treatment 6, 8, 10, 12, 16, 18, and 24 hours. The treatment with colchicine concentration 0.01% and 0.02% with duration of treatment 10 hours effected the increasing of stomata size, the plant height, and the weight of 100 seeds.Key words : Soybean, polyploidization, colchicine, phenotypeAbstrak - Kedelai (Glycine max (L. Merr merupakan salah satu komoditas pangan penting sebagai sumber protein nabati yang kebutuhannya selalu mengalami peningkatan di Indonesia. Meskipun saat ini Indonesia memiliki banyak varietas kedelai unggul, namun Indonesia masih belum mampu mencukupi kebutuhan kedelai nasional sehingga terus bergantung pada impor kedelai. Permasalahan ini dapat diatasi dengan meningkatkan kualitas dan produktivitas varietas kedelai unggul yang sudah ada melalui teknik poliploidisasi dengan kolkisin. Penelitian ini bertujuan untuk mengetahui derajat ploidi dan karakter fenotip pada kedelai Anjasmoro yang diinduksi dengan

  3. Gamma radiation effect on the anatomical structure of soybean (Glycine max. Merr)

    International Nuclear Information System (INIS)

    Bhikuningputra, W.


    Gamma radiation effects on soybean plant (Glycine max. Merr) have been studied by using radiation doses of 0, 20, 25, 30, and 35 Krad. Investigation is carried out after each treatment. It proves that each treatment causes different morphological changes on leaves, stems, roots, and fibres of the treated plants. (SMN)

  4. Distinct transcriptional profiles of ozone stress in soybean (Glycine max) flowers and pods (United States)

    Tropospheric ozone (O3) is a secondary air pollutant and anthropogenic greenhouse gas. Concentrations of tropospheric O3 ([O3] have more than doubled since the Industrial Revolution, and are high enough to damage plant productivity. Soybean (Glycine max L. Merr.) is the world's most important legume...

  5. Pengaruh Pemberian Pyraclotrobin Terhadap Efisiensi Penyerapan Nitrogen Dan Kualitas Hasil Tanaman Kedelai (Glycine Max L. Merr.)


    Mansur, Mansur; Ashari, Sumeru; Kuswanto, Kuswanto


    Kedelai (Glycine max (L.) Merr.) adalah tanaman kacang-kacangan (Leguminosae) yang menjadi komoditas tanaman pangan penting karena tingginya kandungan protein. Penelitian ini dilakukan untuk mengetahui pengaruh pemberian pyraclostrobin terhadap efisiensi penyerapan nitrogen, pertumbuhan tanaman dan hasil tanaman kedelai. Bahan penelitian yang digunakan adalah benih kedelai varietas wilis, pyraclostrobin dan pupuk urea 46% N. Rancangan yang digunakan adalah rancangan tersarang yang terdiri da...

  6. Comparative phytochemical profiling of different soybean (Glycine max (L. Merr genotypes using GC–MS

    Directory of Open Access Journals (Sweden)

    Salem S. Alghamdi


    Full Text Available This study aimed to estimate the proximate, phenolic and flavonoids contents and phytochemicals present in seeds of twenty four soybeans (Glycine max (L. Merr genotypes to explore their nutritional and medicinal values. Crude protein composition ranged between 35.63 and 43.13% in Argentinian and USA (Clark genotypes, respectively. Total phenolic content varied from 1.15 to 1.77 mg GAE/g, whereas flavonoids varied from 0.68 to 2.13 mg QE/g. The GC–MS analysis resulted identification of 88 compounds categorized into aldehydes (5, ketones (13, alcohols (5, carboxylic acids (7, esters (13, alkanes (2, heterocyclic compounds (19, phenolic compound (9, sugar moiety (7 ether (4 and amide (3, one Alkene and one fatty acid ester. Indonesian genotypes (Ijen and Indo-1 had the highest phenolic compounds than others genotype having antioxidant activities, while the Australian genotype contains the maximum in esters compounds. The major phytocompounds identified in majority of genotypes were Phenol, 2,6-dimethoxy-, 2-Methoxy-4-vinylphenol, 3,5-Dimethoxyacetophenone, 1,2-cyclopentanedione and Hexadecanoic acid, methyl ester. The presence of phytochemicals with strong pharmacological actions like antimicrobial and antioxidants activities could be considered as sources of quality raw materials for food and pharmaceutical industries. This study further set a platform for isolating and understanding the characteristics of each compound for it pharmacological properties.

  7. Soybean (Glycine max) oil bodies and their associated phytochemicals. (United States)

    Fisk, Ian D; Gray, David A


    Soybean oil bodies were isolated from 3 cultivars (Ustie, K98, and Elena) and the occurrence of 2 classes of phytochemicals (tocopherol isoforms and isoflavones) and strength of their association with isolated oil bodies was evaluated. Tocopherol is shown to be closely associated with soybean oil bodies; δ-tocopherol demonstrated a significantly greater association with oil bodies over other tocopherol isoforms. Isoflavones do not show a significant physical association with oil bodies, although there is some indication of a passive association of the more hydrophobic aglycones during oil body isolation. Oil bodies are small droplets of oil that are stored as energy reserves in the seeds of oil seeds, and have the potential to be used as future food ingredients. If oil body suspensions are commercialized on a large scale, knowledge of the association of phytochemicals with oil bodies will be valuable in deciding species of preference and predicting shelf life and nutritional value. © 2011 Institute of Food Technologists®

  8. Changes in RNA Splicing in Developing Soybean (Glycine max Embryos

    Directory of Open Access Journals (Sweden)

    Delasa Aghamirzaie


    Full Text Available Developing soybean seeds accumulate oils, proteins, and carbohydrates that are used as oxidizable substrates providing metabolic precursors and energy during seed germination. The accumulation of these storage compounds in developing seeds is highly regulated at multiple levels, including at transcriptional and post-transcriptional regulation. RNA sequencing was used to provide comprehensive information about transcriptional and post-transcriptional events that take place in developing soybean embryos. Bioinformatics analyses lead to the identification of different classes of alternatively spliced isoforms and corresponding changes in their levels on a global scale during soybean embryo development. Alternative splicing was associated with transcripts involved in various metabolic and developmental processes, including central carbon and nitrogen metabolism, induction of maturation and dormancy, and splicing itself. Detailed examination of selected RNA isoforms revealed alterations in individual domains that could result in changes in subcellular localization of the resulting proteins, protein-protein and enzyme-substrate interactions, and regulation of protein activities. Different isoforms may play an important role in regulating developmental and metabolic processes occurring at different stages in developing oilseed embryos.

  9. QTL that underlie seed protein, oil, fatty and amino acids content in the ‘Hamilton’ by ‘Spencer’ recombinant inbred line population of soybean [Glycine max (L.) Merr. (United States)

    Improving seed composition and quality, including protein, oil, fatty acids, and amino acids content is an important goal of soybean farmers and breeders. Our previous research identified novel QTLs associated with seed isoflavones. The aim of this study was to use the ‘Hamilton’ by ‘Spencer’ recomb...

  10. Mutants obtained by chronic gamma irradiation of soybean [Glycine Max (l.) Merrill]varieties

    International Nuclear Information System (INIS)

    Hajos Novak, M; Korosi, F.; Sipos, T.; Hodosne Kotvics, G.


    Soybean [Glycine max (L.) Merrill] is a wonder crop, containing about 20% oil and 40% high quality protein, having multiple uses such as food, fodder and industrial products. In Hungary in he last few years there has been a renewed interest in improving protein and oil content of the soybean crop. Selection for oil and/or protein content from segregating populations, derived from induced mutagenesis or hybridization, is known to be effective. Orf and Helms (1994) emphasized, that to fulfill demands of both sellers and purchasers, combined selection for yield components, yield, oil and/or protein content has to be carried out. For this purpose mutant soybean germplasm s were developed by pedigree method from a Carpathian-Ukrainian (KA) further more a Vietnamese (VL40) local variety adapted to Hungarian environmental conditions by 100-300 Gy chronic gamma irradiation. A function index was introduced to evaluate the genetic variability for the quality parameters and the most important agronomic traits. Chronic gamma irradiation increased the genetic variability of the oil content in the KA and of the protein content in the VL40 germplasm. Function index predicted up to 28% oil content in the KA mutant germplasm. Plants with 24.1 and 23.6% oil content were selected from the 150 Gy and the 100 Gy populations in the M4 generation. In the M5, progenies of a superior plant with 23.6% oil content were homozygous for this characteristics, while progenies of a superior plant with 24.1% oil content were segregating. Year can cause +-2.0-2.5% differences in the oil content of the seeds. Oil content had a moderate negative correlation with 1000-seed weight in both of the above mentioned generations .Seed samples with the highest oil content were analysed for fatty acid composition using gas-liquid chromatography. Their linoleic acid content ranged from 51.8 to 55.0%. Unfortunately, in M5 the linolenic acid content was higher than in M4, varying between 7.9% and 9.3%. The 200 Gy

  11. Induced mutation for the improvement of soybean (Glycine max L.)

    International Nuclear Information System (INIS)

    Asencion, A.B.; Lapade, A.G.; Grafia, A.O.; Barrida, A.C.; Veluz, A.M.; Marbella, L.J.


    A study on the use of gamma radiation in the induction of mutations in eight varieties of soybean was conducted. The radiosensitivity of the seeds of both local and introduced soybean varieties was determined. The effects of gamma radiation in the M1 generation were evaluated. Percentage germination was not affected by doses of 200 and 250 Gy gamma radiation in all the eight soybean varieties. No significant differences in seedling height were observed at 200 Gy and the control except for the 250 Gy in BPI-Sy4, PSB-Sy4 and PSB-Sy5. In the Vietnamese varieties, significant differences in seedling height were obtained in doses of 200, 250 Gy and the control except for the variety AKO 6. There was significant difference in plant height of mature plants between the control and treatment dose of 250 Gy in varieties DT 95 and AKO 6. Likewise, significant differences in mature plant height were noted between the control and those at 250 Gy in local varieties BPI-Sy4, PSB-Sy5 and NSIC-Sy8. The number of days to flower was not affected by gamma radiation in both the local and introduced varieties. There were significant differences in the number of pods per plant between the control and a low dose of 200 Gy in Vietnamese variety DT 96 and the local varieties PSB-Sy4, PSB-Sy5 and NSIC-Sy8. The 3 types of chlorophyll mutation induced by gamma rays in the local varieties were: chlorina, striatia,and spotted yellow. Only chlorina mutant was induced in the introduced varieties. Desirable mutants that are early and high yielding were selected. Results of the drought tolerance tests indicated that the number of days to flowering of the control and 8 varieties was not affected by the duration of irrigation withdrawals 20,30,40 and 50 days after planting. Significant differences in seed weight among the different varieties were noted only in 20 and 30 day irrigation withdrawal treatment. When the effects of the different treatments were analyzed on a per variety bases, some of the

  12. Radiation induced mutagenesis in soybean (Glycine Max L. Merrill)

    International Nuclear Information System (INIS)

    Wakode, M.M.; Nandanwar, R.S.; Patil, G.P.


    The mutagenic effects of gamma rays (10, 20 and 30 kR) on some biological parameter in M1 generation and frequency and spectrum of chlorophyll and morphological mutations in five cultivars of soybean viz. JS-8021, JS-335, JS- 7105, Monetta and PKV -1 have been studied. A dose dependant decrease was noticed in most of the characters like root length, shoot length, germination, plant height, plant survival and pollen sterility. While seedling height, number of seeds per pod and number of branches per plant were not affected significantly. The highest frequency and spectrum of chlorophyll and morphological mutations was noticed in variety JS-8021 in which 20 different gene loci for various characters were mutated. However variety JS- 7105 showed less radio sensitive response for different traits in which only 12 different loci were mutated. While JS-335, monetta and PKV-I showed moderate response to frequency and spectrum of various mutations. These varieties showed differential response to radio sensitivity, some useful mutations included, high yielding mutant in 20 kR, non shattering mutant in 30 kR and vine type mutant in 10 kR in variety monetta. Extra early type, erect and high branched type mutant were recorded with high frequency in 10 and 20 kR respectively in variety JS-8021. In general, 20 kR dose was found more effective in all the varieties studied. (author)

  13. The antioxidative response system in Glycine max (L.) Merr. exposed to Deltamethrin, a synthetic pyrethroid insecticide

    International Nuclear Information System (INIS)

    Bashir, Fozia; Mahmooduzzafar; Siddiqi, T.O.; Iqbal, Muhammad


    Forty-five-day-old plants of Glycine max (soybean) were exposed to several Deltamethrin (synthetic pyrethroid insecticide) concentrations (0.00 %, 0.05 %, 0.10 %, 0.15 % and 0.20 %) through foliar spray in the field conditions. In the treated plants, as observed at the pre-flowering (10 DAT), flowering (45 DAT) and post-flowering (70 DAT) stages, lipid peroxidation, proline content and total glutathione content increased, whereas the total ascorbate content decreased, as compared with the control. Among the enzymatic antioxidants, activity of superoxide dismutase, ascorbate peroxidase and glutathione reductase increased significantly whereas that of catalase declined markedly in relation to increasing concentration of Deltamethrin applied. The changes observed were dose-dependent, showing a strong correlation with the degree of treatment. - The Deltamethrin-induced oxidative stress alters the ascorbate-glutathione cycle in Glycine max

  14. Analysis of embryo, cytoplasm and maternal effects on fatty acid components in soybean (Glycine max Merill.)

    Institute of Scientific and Technical Information of China (English)

    NING Hailong; LI Wenxia; LI Wenbin


    The quality of oil determined by the constituents and proportion of fatty acid components,and the understanding of heredity of fatty acid components are of importance to breeding good quality soybean varieties.Embryo,cytoplasmic and maternal effects and genotype×environment interaction effects for quality traits of soybean [Glycine max (L.) Merrill.] seeds were analyzed using a general genetic model for quantitative traits of seeds with parents,F1 and F2,of 20 crosses from a diallel mating design of five parents planted in the field in 2003 and 2004 in Harbin,China.The interaction effects of palmitic,stearic,and linoleic acid contents were larger than the genetic main effects,while the genetic main effects were equal to interaction effects for linolenic and oleic acid content.Among all kinds of genetic main effects,the embryo effects were the largest for palmitic,stearic,and linoleic acids,while the cytoplasm effects were the largest for oleic and linolenic acids.Among all kinds of interaction effects,the embryo interaction effects were the largest for fatty acids.The sum of additive and additive× environment effects were larger than that of dominance and dominance×environment effects for the linolenic acid content,but not for other quality traits.The general heritabilities were the main parts of heritabilities for palmitic and oleic acid contents,but the interaction was more important for stearic,linoleic,and linolenic acid contents.For the general heritability,maternal and cytoplasm heritabilities were the main components for palmitic,oleic,and linolenic acid contents.It was shown for the interaction heritabilities that the embryo interaction heritabilities were more important for oleic and linolenic acid contents,while the maternal interaction heritabilities were more important for linoleic acid content.Among selection response components,the maternal and cytoplasm general responses and/or interaction responses were more important for palmitic

  15. Genome-wide identification and evolution of the PIN-FORMED (PIN) gene family in Glycine max. (United States)

    Liu, Yuan; Wei, Haichao


    Soybean (Glycine max) is one of the most important crop plants. Wild and cultivated soybean varieties have significant differences worth further investigation, such as plant morphology, seed size, and seed coat development; these characters may be related to auxin biology. The PIN gene family encodes essential transport proteins in cell-to-cell auxin transport, but little research on soybean PIN genes (GmPIN genes) has been done, especially with respect to the evolution and differences between wild and cultivated soybean. In this study, we retrieved 23 GmPIN genes from the latest updated G. max genome database; six GmPIN protein sequences were changed compared with the previous database. Based on the Plant Genome Duplication Database, 18 GmPIN genes have been involved in segment duplication. Three pairs of GmPIN genes arose after the second soybean genome duplication, and six occurred after the first genome duplication. The duplicated GmPIN genes retained similar expression patterns. All the duplicated GmPIN genes experienced purifying selection (K a /K s genome sequence of 17 wild and 14 cultivated soybean varieties. Our research provides useful and comprehensive basic information for understanding GmPIN genes.

  16. Glycine max

    African Journals Online (AJOL)



    May 29, 2013 ... obvious, such as cross incompatibility and sterility of either hybrids or their ... ficulty in producing fertile hybrids and progeny by cros- sing genotypes .... Analysis of recombination rate in female and male gametogenesis in ...

  17. Ulex europaeus I and glycine max bind to the human olfactory bulb. (United States)

    Nagao, M; Oka, N; Kamo, H; Akiguchi, I; Kimura, J


    The distribution of binding sites for the fucose-selective lectin Ulex europaeus I and the terminal N-acetylgalactosamine-selective lectin glycine max in the human olfactory bulb were studied. These lectins bound to primary olfactory axons in the olfactory nerve layer and the glomerular layer. They also bound to fibers located in the deeper layers such as the external plexiform layer and the granular layer. Furthermore they projected to the olfactory stalk but not in the cerebrum. The deeper projections of the lectin binding fibers may affect the function of the olfactory bulb in humans.



    Mohammad Reza Mahmoodabadi; Abdol-majid Ronaghi; Mehdi Khayyat; Gholamreza Hadarbadi


      There are areas in the world which are polluted by trace metals some of which may not be degraded by biotic process. Some of these metals might enter into surface and/or underground water resources thus causing serious human and animal health problems. In recent years, natural amendments, such as the use of zeolite, have been widely used to address trace metals contamination. In the present study the effect of zeolite on the growth and nodulation of soybean (Glycine max L.) was evaluat...

  19. Deteksi senyawa isoflavon daidzein dan genistein pada kultur invitro kalus kedelai Glycine max Merr

    Directory of Open Access Journals (Sweden)

    Tintrim Rahayu


    Full Text Available The aim of this research is to identify the isofl avon compounds in the in-vitro cultured callus of soybean (Glycine max Merr.. This is an explorative research, in which callus were cultured in the B5 medium supplemented with 2 ppm 2,4 D. The friable callus were found when it was cultured in the solid medium containing 8 g/l agar and 20 g/l sucrose. When the callus and soybean were extracted with ethanol, a yellow colored substance appeared. If further analysis was done with thin layer chromatography (TLC method employing 0,2 mm thin layer silica gel 60 F254 (DC-Plastikfolien Schicht-dicke, and eluent consisting n-Butanol - HCL 0.1 N (1:1, six light blue color nodes appeared under 366 nm UV light. The nodes have the following Rf: 0,14; 0,30; 0,52; 0,63; 0,79 and 0,92 respectively. This TLC result is comparable with the TLC result from soybeans since they have two nodes with the same Rf and color, namely blue color at Rf 0,81 and 0,92 respectively. Further confi rmation using HPLC (High Performance Liquid Chromatography equipped with UVvis detector and Lichrospher 100RP–18, (10 μm colom, as well as Hitachi D–2500 Chromato-integrator indicated that those similar two nodes identifi ed in the TLC were either daidzein or genistein. They can be detected by HPLC at 250 nm and 260 nm, when they were eluated at the 80% metanol. The HPLC quantitative calculation indicated that concentration of daidzein is four time higher as it was compared with the daidzein concentration in the bean. The concentration of daidzein in the callus remained high up to 4–5 weeks after plantation. It’s concentration will decrease when the callus reached 6 weeks after plantation. Genistein as another component of isofl avon is not appear upon callus, while on soybean seeds extracts, both daidzen and genistein are detected.

  20. Development of a reduced linolenate soy [Glycine max] mutant by re-irradiation and its genetic analysis

    International Nuclear Information System (INIS)

    Takagi, Y.; Rahman, S.M.; Anai, T.; Wasala, S.K.; Kinoshita, T.; Khalekuzzaman, M.


    A high content of linolenic acid leads to reduction of keeping quality and frying stability of cooking oil. The present study was conducted to obtain a further reduction of linolenic acid in soybean [Glycine max (L.) Merr.] oil by re-irradiation of M-5 and determine its genetic system. M-5 is a mutant with 4.5% linolenic acid content, derived from the cultivar Bay (8.0% linolenic acid). A seed lot from line M-5 was treated with X-ray irradiation and M2 plants were obtained from randomly selected seeds of M1 plants. The M-2 plants were screened for reduced linolenic acid. One plant was found with 3.0% linolenic acid content and was named MS382. The M3 and M1 generations of this line proved that the character was fixed and significantly lower than the M-5 control. For inheritance studies, MS382 was reciprocally crossed with M-5 (fan) and LOLL [fanfanx-a, a recombinant of M-5 (fan) x M24 (fanx-a)]. The F2 segregation ratio and the segregation of F3 seeds from F2 plants of MS382 x M-5 indicated that reduced linolenic acid in MS382 was conbindly controlled by fan (M-5) and an additional gene. To determine if this additional gene was similar with the fanx-a gene in LOLL, F2 seeds and F3 seeds from each F2 plant of MS382 x LOLL were evaluated. No transgressive segregation for linolenic acid was found in this cross, indicating the genes for reduced linolenic acid content in MS382 and LOLL were identical. However, the mutant MS382 was developed by re-irradiation which indicates the practicability of this technique to develop new gene for further reduction of linolenic acid in soybean oil

  1. Direct growth of vertically aligned carbon nanotubes on silicon substrate by spray pyrolysis of Glycine max oil

    Directory of Open Access Journals (Sweden)

    K. T. Karthikeyan


    Full Text Available Vertically aligned carbon nanotubes have been synthesized by spray pyrolysis from Glycine max oil on silicon substrate using ferrocene as catalyst at 650 °C. Glycine max oil, a plant-based hydrocarbon precursor was used as a source of carbon and argon as a carrier gas. The as-grown vertically aligned carbon nanotubes were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, X-ray diffraction, thermogravimetric analysis, and Raman spectroscopy. Scanning electron microscopic images reveal that the dense bundles of aligned carbon nanotubes. High resolution transmission electron microscopy and Raman spectroscopy observations indicate that as-grown aligned carbon nanotubes are well graphitized.

  2. Effects of soil tillage on the energy budget of soybean (Glycine max (L.) Merr.)

    International Nuclear Information System (INIS)

    Casa, R.; Cascio, B. lo


    The different terms of the energy budget were measured by the Bowen ratio method on soybean (Glycine max (L.) Merr.) grown on a conventional tillage and a direct drilling system. The differences found in the energy budgets varied according to the degree of fractional ground cover and of soil water availability. Soil heat flux was greater for the direct drilling treatment, although soil heating was slower as compared to the conventional tillage. Comparisons for well watered and dry conditions revealed that the conventional tillage system used as latent heat a fraction of net radiation greater than the direct drilling treatment only in well watered conditions. In dry conditions the differences in latent heat fluxes and canopy resistances between the two tillage systems were smaller [it

  3. Phenolics in the seed coat of wild soybean (Glycine soja) and their significance for seed hardness and seed germination. (United States)

    Zhou, San; Sekizaki, Haruo; Yang, Zhihong; Sawa, Satoko; Pan, Jun


    Hardseededness in annual wild soybean (Glycine soja Sieb. Et Zucc.) is a valuable trait that affects the germination, viability, and quality of stored seeds. Two G. soja ecotypes native to Shandong Province of China have been used to identify the phenolics in the seed coat that correlate with the seed hardness and seed germination. Three major phenolics from the seed coat were isolated and identified as epicatechin, cyanidin 3-O-glucoside, and delphinidin 3-O-glucoside. Of the three phenolics, only the change of epicatechin exhibited a significant positive correlation with the change of hard seed percentages both under different water conditions during seed development and under different gas conditions during seed storage. Epicatechin also reveals a hormesis-like effect on the seed germination of G. soja. Epicatechin is suggested to be functionally related to coat-imposed hardseededness in G. soja.

  4. Soybean [Glycine max (L.) Merrill] rhizobial diversity in Brazilian oxisols under various soil, cropping, and inoculation managements

    NARCIS (Netherlands)

    Loureiro, M.D.; Kaschuk, G.; Alberton, O.; Hungria, M.


    In this study, soybean nodules were collected from 12 sites in the State of Mato Grosso, in the Brazilian Cerrados, where both exotic soybean [Glycine max (L.) Merrill] and bradyrhizobial strains have been introduced from 1 to 18 years before. All soils were originally devoid of rhizobia capable of

  5. Soyasaponin Bh, a Triterpene Saponin Containing a Unique Hemiacetal-Functional Five-Membered Ring from Glycine max (Soybeans) (United States)

    Soybeans (Glycine max L. Merill) and soy-based food products are major dietary sources of saponins. An oleanane triterpenoid saponin, soyasaponin Bh (1) containing a unique five-membered ring with a hemiacetal functionality together with seven known saponins were isolated from soybeans. Their struct...

  6. Effect of gamma irradiation on microbial load, physicochemical and sensory characteristics of soybeans (Glycine max L. Merrill) (United States)

    Gamma irradiation is highly effective in inactivating microorganisms in various foods and offers a safe alternative method of food decontamination. In the present study, soybeans (Glycine max L. Merrill) were treated with 0, 1.0, 3.0, 5.0 and 10.0 KGy of gamma irradiation. Microbial populations on s...

  7. Soybean (Glycine max) SWEET gene family: insights through comparative genomics, transcriptome profiling and whole genome re-sequence analysis. (United States)

    Patil, Gunvant; Valliyodan, Babu; Deshmukh, Rupesh; Prince, Silvas; Nicander, Bjorn; Zhao, Mingzhe; Sonah, Humira; Song, Li; Lin, Li; Chaudhary, Juhi; Liu, Yang; Joshi, Trupti; Xu, Dong; Nguyen, Henry T


    SWEET (MtN3_saliva) domain proteins, a recently identified group of efflux transporters, play an indispensable role in sugar efflux, phloem loading, plant-pathogen interaction and reproductive tissue development. The SWEET gene family is predominantly studied in Arabidopsis and members of the family are being investigated in rice. To date, no transcriptome or genomics analysis of soybean SWEET genes has been reported. In the present investigation, we explored the evolutionary aspect of the SWEET gene family in diverse plant species including primitive single cell algae to angiosperms with a major emphasis on Glycine max. Evolutionary features showed expansion and duplication of the SWEET gene family in land plants. Homology searches with BLAST tools and Hidden Markov Model-directed sequence alignments identified 52 SWEET genes that were mapped to 15 chromosomes in the soybean genome as tandem duplication events. Soybean SWEET (GmSWEET) genes showed a wide range of expression profiles in different tissues and developmental stages. Analysis of public transcriptome data and expression profiling using quantitative real time PCR (qRT-PCR) showed that a majority of the GmSWEET genes were confined to reproductive tissue development. Several natural genetic variants (non-synonymous SNPs, premature stop codons and haplotype) were identified in the GmSWEET genes using whole genome re-sequencing data analysis of 106 soybean genotypes. A significant association was observed between SNP-haplogroup and seed sucrose content in three gene clusters on chromosome 6. Present investigation utilized comparative genomics, transcriptome profiling and whole genome re-sequencing approaches and provided a systematic description of soybean SWEET genes and identified putative candidates with probable roles in the reproductive tissue development. Gene expression profiling at different developmental stages and genomic variation data will aid as an important resource for the soybean research

  8. Ecological aspects study of replacement intercropping patterns of Soybean (Glycine max L. and Millet (Panicum miliaceum L.

    Directory of Open Access Journals (Sweden)

    Goudarz Ahmadvand


    Full Text Available Intercropping is considered for increasing and stability of yield in per unit. In order to study the effects of soybean (Glycine max L. and millet (Panicum miliaceum L. replacement intercropping on agronomic traits, diversity of weeds and soil biological activity, an experiment was conducted at the Research Station of Agricultural Faculty, of Bu-Ali Sina University, in 2014. The experiment was carried out as a randomized complete block design with three replications. The replacement intercropping series consisted of monoculture of soybean, monoculture of millet, 75% soybean+ 25% millet, 50% soybean+ 50% millet and 25% soybean+ 75% millet. The results showed that the highest seed yield of 219.8 and 171.9 gm-2 belonged to monoculture of soybean and monoculture of millet, respectively. Intercropping reduced maximum leaf area index of soybean and millet but leaf chlorophyll content of soybean and millet were increased. The highest number of pods per plant, number of seeds per plant in soybean and panicle number per plant in millet were obtained in 50S:50M ratio. Mean soil respiration rate in intercropping treatments was 4 and 8 % higher than the monoculture of soybean and millet, respectively. Intercropping patterns of 50S:50M and 25S:75M were successful in reducing weed plant density and diversity in comparison with soybean monoculture. Results showed that in all intercropping treatments, land equivalent ratio was more than one. Maximum value of land equivalent ratio (2.20 was achieved in 50S:50M treatment. Soybean and millet intercropping at different levels of replacement, didn’t have actual yield loss. Calculating the aggressivity showed that millet was more dominate than soybean. The maximum relative crowding coefficient of soybean was observed in 75S:25M, however that of millet was obtained in 25S:75M and 50S:50M intercroppings indicating that millet is more competitor than soybean.

  9. The Effect of using Quail Litter Biochar on Soybean (Glycine max L. Merr. Production Efecto del uso de Biocarbón de Lecho de Codorniz en la Producción de Soya (Glycine max L. Merr.

    Directory of Open Access Journals (Sweden)

    Tawadchai Suppadit


    Full Text Available Biochars can be used as soil amendments for improving soil properties and crop yield. The objective of this research was to study the plant growth, yield, yield components, and seed quality, including nutrients and heavy metals (Pb, Cd, and Hg, in the soybean plant (Glycine max L. Merr. and soil. The experiment was conducted from September 2010 to January 2011 in a greenhouse located in the Dan Khun Thot District, Nakhon Ratchasima Province, Thailand. The research comprised six treatments with four replicates in a completely randomized design. Quail litter biochar (QLB at rates of 0, 24.6, 49.2, 73.8, 98.4 and 123 g per pot mixture were provided to soybean cv. Chiang Mai 60. The results showed that QLB could be used as a soil fertility improvement and amendment for soybean production with an optimum rate of 98.4 g per pot mixture, which gave the best performance in terms of the number of nodes, height, DM accumulation, total yield, and seed quality. After the experiment, the nutrient contents in the soil increased as the QLB content increased, but the heavy metal residues in the leaves and seeds did not change. However, QLB at levels higher than 98.4 g per pot mixture is not advisable because QLB is alkaline in nature, which may affect soil pH.El biocarbón puede usarse como enmienda para mejorar las propiedades del suelo y el rendimiento del cultivo. El objetivo de esta investigación fue el estudio del crecimiento de la planta, rendimiento y sus características, así como la calidad de semilla, incluyéndose el estudio de nutrientes y metales pesados (Pb, Cd y Hg en la planta de soya (Glycine max L. Merr. y el suelo. La experimentación se realizó en condiciones de invernadero en el distrito de Dan Khun Thot, provincia de Nakhon Ratchasima, Tailandia, entre septiembre del 2010 y enero del 2011. La investigación constó de seis tratamientos con cuatro repeticiones en un diseño completamente al azar. Se administró biocarbón de lecho de

  10. In silico comparison of transcript abundances during Arabidopsis thaliana and Glycine max resistance to Fusarium virguliforme

    Directory of Open Access Journals (Sweden)

    Iqbal M Javed


    Full Text Available Abstract Background Sudden death syndrome (SDS of soybean (Glycine max L. Merr. is an economically important disease, caused by the semi-biotrophic fungus Fusarium solani f. sp. glycines, recently renamed Fusarium virguliforme (Fv. Due to the complexity and length of the soybean-Fusarium interaction, the molecular mechanisms underlying plant resistance and susceptibility to the pathogen are not fully understood. F. virguliforme has a very wide host range for the ability to cause root rot and a very narrow host range for the ability to cause a leaf scorch. Arabidopsis thaliana is a host for many types of phytopathogens including bacteria, fungi, viruses and nematodes. Deciphering the variations among transcript abundances (TAs of functional orthologous genes of soybean and A. thaliana involved in the interaction will provide insights into plant resistance to F. viguliforme. Results In this study, we reported the analyses of microarrays measuring TA in whole plants after A. thaliana cv 'Columbia' was challenged with fungal pathogen F. virguliforme. Infection caused significant variations in TAs. The total number of increased transcripts was nearly four times more than that of decreased transcripts in abundance. A putative resistance pathway involved in responding to the pathogen infection in A. thaliana was identified and compared to that reported in soybean. Conclusion Microarray experiments allow the interrogation of tens of thousands of transcripts simultaneously and thus, the identification of plant pathways is likely to be involved in plant resistance to Fusarial pathogens. Dissection of the set functional orthologous genes between soybean and A. thaliana enabled a broad view of the functional relationships and molecular interactions among plant genes involved in F. virguliforme resistance.

  11. Effects of Methanol Spraying on Qualitative traits, Yield and Yield Components of Soybean (Glycine max L. under Drought Stress Conditions

    Directory of Open Access Journals (Sweden)

    J Esazadeh Panjali Kharabasi


    Full Text Available Introduction Soybean (Glycin max L. is one of the most important oilseed crops in the world. It can provide oil and vegetable protein suitable for feeding humans as well as animals. The productivity Increasing of this crop in Iran has been the subject of continuous investigation over the past few years. It is well known that adequate water supply is considered as a very important factor to affect the accumulation of dry matter in the plant as well as vegetative growth of most crops. Irrigation is an important factor affecting soybean growth and yield and its related components. Exposing soybean plants to soil moisture stress at any phase of its life cycle may lead to a detrimental effect on growth, yield and its components. The methanol spraying can lead to increase in yield, expediting in maturity and reduction in drought stress impacts and water requirement of crops. Material and Methods The experiment was conducted as split plots based on randomized complete block design with three replications at the Research Farm, Faculty of Agriculture of Moghan, Iran, in 2011. Treatments included three levels of drought stress as follows irrigation after, 40 (control, 55 and 70 percentage of available soil moisture depletion as main plots, and four levels of methanol spraying including 0 (control, 7, 21 and 35 volumetric percentage as sub plots. The studied traits were included plant height, leaf area, number of pod and seed per plant, 1000 seed weight, biological and seed yield, stomatal conductance and proline contents. Statistical analysis was carried out using SAS version 9.1 software. Significant difference was set at p ≤ 0.05 by using Duncan’s multiple range test. Results and Discussion The results showed that the plant height, leaf area, number of pod and seed per plant, 1000 seed weight, biological and seed yield, stomatal conductance and proline contents as well as number of leaf per plant significantly affected by drought stress and methanol

  12. Molecular docking of Glycine max and Medicago truncatula ureases with urea; bioinformatics approaches. (United States)

    Filiz, Ertugrul; Vatansever, Recep; Ozyigit, Ibrahim Ilker


    Urease (EC is a nickel-dependent metalloenzyme catalyzing the hydrolysis of urea into ammonia and carbon dioxide. It is present in many bacteria, fungi, yeasts and plants. Most species, with few exceptions, use nickel metalloenzyme urease to hydrolyze urea, which is one of the commonly used nitrogen fertilizer in plant growth thus its enzymatic hydrolysis possesses vital importance in agricultural practices. Considering the essentiality and importance of urea and urease activity in most plants, this study aimed to comparatively investigate the ureases of two important legume species such as Glycine max (soybean) and Medicago truncatula (barrel medic) from Fabaceae family. With additional plant species, primary and secondary structures of 37 plant ureases were comparatively analyzed using various bioinformatics tools. A structure based phylogeny was constructed using predicted 3D models of G. max and M. truncatula, whose crystallographic structures are not available, along with three additional solved urease structures from Canavalia ensiformis (PDB: 4GY7), Bacillus pasteurii (PDB: 4UBP) and Klebsiella aerogenes (PDB: 1FWJ). In addition, urease structures of these species were docked with urea to analyze the binding affinities, interacting amino acids and atom distances in urease-urea complexes. Furthermore, mutable amino acids which could potentially affect the protein active site, stability and flexibility as well as overall protein stability were analyzed in urease structures of G. max and M. truncatula. Plant ureases demonstrated similar physico-chemical properties with 833-878 amino acid residues and 89.39-90.91 kDa molecular weight with mainly acidic (5.15-6.10 pI) nature. Four protein domain structures such as urease gamma, urease beta, urease alpha and amidohydro 1 characterized the plant ureases. Secondary structure of plant ureases also demonstrated conserved protein architecture, with predominantly α-helix and random coil structures. In

  13. Sulphur dioxide metabolism in soy-bean, Glycine max var. biloxi

    International Nuclear Information System (INIS)

    Garsed, S.G.; Read, D.J.


    First-trifoliate leaves of soybeans Glycine max (L.) Merr. were exposed to 35 SO 2 in the light or dark, and the chemical distribution of the radioactivity in the source leaves and in the remainder of the plant was determined after 1.5 and 24 h. Only 35 SO 4 2- was found in leachates in the light but substantial quantities of 35 SO 3 2- were present in the dark. Radioactivity was present in all fractions of the source leaves examined (insoluble, centrifuge pellet, soluble protein, chloroform-soluble and water-soluble). The main water-soluble compounds labelled were sulphate >glutathione >cysteine. Small quantities of sulphite were also recovered in the dark but not in the light. The ratio of soluble: insoluble radioactivity in the sink tissues was influenced more by leaf age than by light treatment. Sulphate, glutathione and cysteine were labelled in the petioles of the source leaves and 35 SO 4 2- was found in the nutrient solution after 1.5 h in both treatments. It is concluded that light is not necessary for the reduction of internal 35 SO 2 products. The results are discussed in relation to current knowledge of SO 2 metabolism. (author)

  14. Interference of Selected Palmer Amaranth (Amaranthus palmeri Biotypes in Soybean (Glycine max

    Directory of Open Access Journals (Sweden)

    Aman Chandi


    Full Text Available Palmer amaranth (Amaranthus palmeri S. Wats. has become difficult to control in row crops due to selection for biotypes that are no longer controlled by acetolactate synthase inhibiting herbicides and/or glyphosate. Early season interference in soybean [Glycine max (L. Merr.] for 40 days after emergence by three glyphosate-resistant (GR and three glyphosate-susceptible (GS Palmer amaranth biotypes from Georgia and North Carolina was compared in the greenhouse. A field experiment over 2 years compared season-long interference of these biotypes in soybean. The six Palmer amaranth biotypes reduced soybean height similarly in the greenhouse but did not affect soybean height in the field. Reduction in soybean fresh weight and dry weight in the greenhouse; and soybean yield in the field varied by Palmer amaranth biotypes. Soybean yield was reduced 21% by Palmer amaranth at the established field density of 0.37 plant m−2. When Palmer amaranth biotypes were grouped by response to glyphosate, the GS group reduced fresh weight, dry weight, and yield of soybean more than the GR group. The results indicate a possible small competitive disadvantage associated with glyphosate resistance, but observed differences among biotypes might also be associated with characteristics within and among biotypes other than glyphosate resistance.

  15. Effects of fluoride on mitochondrial activity in higher plants. [Glycine max, Zea mays

    Energy Technology Data Exchange (ETDEWEB)

    Miller, J E; Miller, G W


    The effects of fluoride on respiration of plant tissue and mitochondria were investigated. Fumigation of young soybean plants (Glycine max Merr. cm. Hawkeye) with 9-12 x m/sup -3/ HF caused a stimulation of respiration at about 2 days of treatment followed by inhibition 2 days later. Mitochondria isolated from the stimulated tissue had higher respiration rates, greater ATPase activity, and lower P/O ratios, while in mitochondria from inhibited tissue, all three were reduced. Treatment of etiolated soybean hypocotyl sections in Hoagland's solution containing KF for 3 to 10 h only resulted in inhibition of respiration. Mitochondria isolated from this tissue elicited increased respiration rates with malate as substrate and inhibited respiration with succinate. With both substrates respiratory control and ADP/O ratios were decreased. Direct treatment of mitochondria from etiolated soybean hypocotyl tissue with fluoride resulted in inhibition of state 3 respiration and lower ADP/O ratios with the substrates succinate, malate, and NADH. Fluoride was also found to increase the amount of osmotically induced swelling and cause a more rapid leakage of protein with mitochondria isolated from etiolated corn shoots (Zea mays L. cv. Golden Cross Bantam). 40 references, 1 figure, 5 tables.

  16. Physicochemical characteristics and functional properties of vitabosa (mucuna deeringiana and soybean (glycine max

    Directory of Open Access Journals (Sweden)

    Sandra Patricia Chaparro Acuña


    Full Text Available Physicochemical characteristics and functional properties of vitabosa flour (Mucuna deeringiana and soybean flour (Glycine max were determined. Oil absorption capacity was higher in vitabosa. Water absorption capacity was higher in soy and it was affected by the change in the ionic strength of the medium. Emulsifying Activity (EA decreased with increasing concentration of flour, while Emulsifying Stability (ES showed an increased. EA and ES of flours have more ionic strength in the range between 0.0 and 0.4 M, but it is reduced afterwards with the higher concentration of NaCl. Foaming stability varied with the concentration of flour solution reaching maximum values of 39 and 33% for vitabosa and soybean, respectively at 10% flour concentration.Vitabosa had the best foaming capacity (56% to 0.6 M compared with soybeans (47% to 0.4 M. Maximum capacity of gelation was observed in vitabosa at 10% flour concentration. Increases in ionic strength of the flour solution, at low salt concentrations (<0.4 M, improved the gelation of flours.


    Directory of Open Access Journals (Sweden)

    Mohammad Reza Mahmoodabadi


    Full Text Available   There are areas in the world which are polluted by trace metals some of which may not be degraded by biotic process. Some of these metals might enter into surface and/or underground water resources thus causing serious human and animal health problems. In recent years, natural amendments, such as the use of zeolite, have been widely used to address trace metals contamination. In the present study the effect of zeolite on the growth and nodulation of soybean (Glycine max L. was evaluated. Treatments consisted on factorial combination of three levels of zeolite (0, 2 and 5 g kg-1 and three levels of cadmium (0, 10 and 50 mg kg-1. Cadmium application significantly decreased shoot and root dry weight while its concentration in plant parts was increased. In addition, cadmium application decreased number and dry weight of nodules, and N, K, and Mn concentrations. On the other hand, zeolite application markedly increased number and dry weight of nodules and N, P, K concentrations in shoot, Mn and Cu concentrations in shoot and root. The results from the present study can be used for predicting the efficiency of zeolite application for the remediation of contaminated soils.

  18. The Effectiveness of Biofertilizer on Plant Growth Soyb Ea N “Edam Am E” (Glycin Max)


    Sudiarti, Diah


    This study aimed at determining the effectiveness of biofertilizer with different concentrations on plant growth of soybean “edamame” (glycin max). Biofertilizer in this study consists of microbial consortia (lactobacillus, pseudomonas, bacillus, saccharomyces, rhizobium, azotobacter, azospirillum, and cellulomonas). The treatment consists of 3 biofertilizer concentrations (25%, 50%, dan 75%), as well as the negative control and positive control (100% chemical fertilizer equivalent 5g/plant)....

  19. Peran Kedelai (Glycine max L. dalam Pencegahan Apoptosis pada Cedera Jaringan Hati

    Directory of Open Access Journals (Sweden)

    Maya Tejasari


    Soy (Glycine max L. Prevent Apoptotic Cells in Liver Tissue Injury Abstract In the state of liver injury by any cause there are numerous apoptotic cells influencing metabolic function of the liver.  Soy isoflavone (Glycine max L. known to have effect that inhibit apoptotic cells in follicle and osteoblast.  The aim of this study is to evaluate whether soy has anti apoptotic effect of  CCl4induced liver  injury in mice. This study use 30 male DDY mice 8─10 weeks old, divided into 6 groups.   Group I acted as positive control, received standard pellet for 3 weeks and induced by 0,2 mLCCl4per oral.  Group II, the negative control, received only standard pellet.  Group III─VI received standard pellet and treated by soybean extract 145.6 mg, 218.4 mg, 291.2 mg and 364 mg per day respectively administrated orally for 3 weeks and then induced by 0.2 ml CCl4 per oral.  After 4 days of CCl4 induced, the effect of soybean extract was evaluated using histo-chemistry evaluation Terminal deoxynucleotidyl transferase-mediated dUTP nick end labeling (TUNEL.  The identification and quantification of the apoptotic cells in mice liver tissue were done using light microscopy and showed that the TUNEL immune-histochemical examination. The results showed that the number of cells undergoing apoptosis in the group treated by soybean extract were less than the group that was not treated. The results enhanced by analysis of varians (ANOVA  between the groups showed a significant difference with p<0.05. In conclusion, soy administrated orally could  prevent apoptotic cells in liver tissue. Key words: Apoptotic, CCl4, isoflavone, liver injury, soybean, TUNEL

  20. Identification and colonization of endophytic fungi from soybean (Glycine max (L. Merril under different environmental conditions

    Directory of Open Access Journals (Sweden)

    Ida Chapaval Pimentel


    Full Text Available A total of 297 endophytic fungi were isolated from 1728 leaf and stem fragments collected about twenty and forty days after germination from soybean (Glycine max (L. Merril plants grown in the field and a greenhouse. The fungi belonged to eight groups, six dematiaceous genera (Alternaria, Cladosporium, Chaetomium, Curvularia, Drechslera and Scopulariopsis and the non-dematiaceous genera Acremonium, Aspergillus, Colletotrichum, Fusarium, Paecilomyces and Penicillium along with some Mycelia sterilia.. There were qualitative and quantitative differences in the type and number of isolates obtained from greenhouse and field-grown plants, with more isolates being obtained from the latter. No difference was found in the number of fungi isolated from leaves and stems irrespective of where the plants was grown. For was field-grown plants, the number of isolates decreased as the plants aged and more fungi were found in tissues near the soil, while for greenhouse-grown plants the number of isolates increased as the plants aged but in this case no more fungi were isolated from those tissues nearer the soil. These results could have biotechnological relevance for the biological control of pests or plant growth promotion.A partir de 1728 fragmentos de hastes e folhas de soja (Glycine max (L. Merril. provenientes de plantas do campo e de casa de vegetação, coletadas cerca de 20 e 40 dias após a germinação das sementes, 297 fungos endofíticos foram isolados. Os gêneros encontrados foram: Alternaria, Cladosporium, Curvularia, Chaetomium, Scopulariopsis, Drechslera (todos dematiáceos além de Colletotrichum, Fusarium, Acremonium, Aspergillus, Penicillium, Paecilomyces e Mycelia sterilia. Foram detectadas diferenças qualitativas e quantitativas entre os isolados, em relação a micobiota de hospedeiros provenientes do campo e de casa de vegetação com maior frequência de fungos isolados de plantas no campo em comparação com as de casa de vegeta

  1. Replicon-dependent differentiation of symbiosis-related genes in Sinorhizobium strains nodulating Glycine max. (United States)

    Guo, Hui Juan; Wang, En Tao; Zhang, Xing Xing; Li, Qin Qin; Zhang, Yan Ming; Tian, Chang Fu; Chen, Wen Xin


    In order to investigate the genetic differentiation of Sinorhizobium strains nodulating Glycine max and related microevolutionary mechanisms, three housekeeping genes (SMc00019, truA, and thrA) and 16 symbiosis-related genes on the chromosome (7 genes), pSymA (6 genes), and pSymB (3 genes) were analyzed. Five distinct species were identified among the test strains by calculating the average nucleotide identity (ANI) of SMc00019-truA-thrA: Sinorhizobium fredii, Sinorhizobium sojae, Sinorhizobium sp. I, Sinorhizobium sp. II, and Sinorhizobium sp. III. These species assignments were also supported by population genetics and phylogenetic analyses of housekeeping genes and symbiosis-related genes on the chromosome and pSymB. Different levels of genetic differentiation were observed among these species or different replicons. S. sojae was the most divergent from the other test species and was characterized by its low intraspecies diversity and limited geographic distribution. Intergenic recombination dominated the evolution of 19 genes from different replicons. Intraspecies recombination happened frequently in housekeeping genes and symbiosis-related genes on the chromosome and pSymB, whereas pSymA genes showed a clear pattern of lateral-transfer events between different species. Moreover, pSymA genes were characterized by a lower level of polymorphism and recombination than those on the chromosome and pSymB. Taken together, genes from different replicons of rhizobia might be involved in the establishment of symbiosis with legumes, but these symbiosis-related genes might have evolved differently according to their corresponding replicons.

  2. Effect of soaking and fermentation on content of phenolic compounds of soybean (Glycine max cv. Merit) and mung beans (Vigna radiata [L] Wilczek). (United States)

    María Landete, José; Hernández, Teresa; Robredo, Sergio; Dueñas, Montserrat; de Las Rivas, Blanca; Estrella, Isabel; Muñoz, Rosario


    Mung beans (Vigna radiata [L] Wilczek) purchased from a Spanish company as "green soybeans", showed a different phenolic composition than yellow soybeans (Glycine max cv. Merit). Isoflavones were predominant in yellow soybeans, whereas they were completely absent in the green seeds on which flavanones were predominant. In order to enhance their health benefits, both types of bean were subjected to technological processes, such as soaking and fermentation. Soaking increased malonyl glucoside isoflavone extraction in yellow beans and produced an increase in apigenin derivatives in the green beans. Lactobacillus plantarum CECT 748 T fermentation produced an increase in the bioactivity of both beans since a conversion of glycosylated isoflavones into bioactive aglycones and an increase of the bioactive vitexin was observed in yellow and green beans, respectively. In spite of potential consumer confusion, since soybean and "green soybean" are different legumes, the health benefits of both beans were enhanced by lactic fermentation.

  3. Intersubgeneric hybridization between Glycine max and G. tomentella: Production of F1, amphidiploid, BC1, BC2 BC3 and fertile soybean plants (United States)

    The genetic resources of the 26 species of the subgenus Glycine have not been exploited to broaden the genetic base of soybean (Glycine max; 2n = 40). Initially, we hybridized eight soybean cultivars with six accessions of 78- and one accession of 40-chromosome G. tomentella. One accession of G. arg...

  4. Floral biology and behavior of Africanized honeybees Apis mellifera in soybean (Glycine max L. Merril

    Directory of Open Access Journals (Sweden)

    Wainer César Chiari


    Full Text Available This research was carried out to evaluate the pollination by Africanized honeybees Apis mellifera, the floral biology and to observe the hoarding behavior in the soybean flowers (Glycine max Merril, var. BRS-133. The treatments were constituted of demarcated areas for free visitation of insects, covered areas by cages with a honeybee colony (A. mellifera and also covered areas by cage without insects visitation. All areas had 24 m² (4m x 6m. The soybean flowers stayed open for a larger time (82.82 ± 3.48 hours in covered area without honeybees. The stigma of the flowers was also more receptive (P=0.0021 in covered area without honeybees (87.3 ± 33.0% and at 10:42 o'clock was the schedule of greater receptivity. The pollen stayed viable in all treatments, the average was 99.60 ± 0.02%, which did not present differences among treatments. The percentage of abortion of the flowers was 82.91% in covered area without honeybees, this result was superior (P=0.0002 to the 52.66% and 53.95% of the treatments uncovered and covered with honeybees, respectively. Honeybees were responsible for 87.7% of the pollination accomplished by the insects. The medium amounts of total sugar and glucose measured in the nectar of the flowers were, 14.33 ± 0.96 mg/flower and 3.61 ± 0.36 mg/ flower, respectively, not showing differences (PEste experimento teve como objetivos avaliar a polinização realizada por abelhas Apis mellifera, estudar a biologia floral e observar o comportamento de coleta nas flores de soja (Glycine max L. Merril, variedade BRS-133 plantadas na região de Maringá-PR. Os tratamentos constituíram de áreas demarcadas de livre visitação por insetos, áreas cobertas por gaiolas, com uma colônia de abelhas (A. mellifera no seu interior e plantas também cobertas por gaiola que impedia a visitação por insetos. Todas as áreas possuíam 24 m² (4 m x 6 m. As flores de soja permaneceram abertas por um tempo maior (82,82 ± 3,48 horas no

  5. Bioactivity of flours of seeds of leguminous crops Pisum sativum ...

    African Journals Online (AJOL)

    Bioactivity of flours of seeds of leguminous crops Pisum sativum, Phaseolus vulgaris and Glycine max used as botanical insecticides against Sitophilus oryzae Linnaeus (Coleoptera: Curculionidae) on sorghum grains.

  6. Glycine

    DEFF Research Database (Denmark)

    Sabin, John R.; Oddershede, Jens; Sauer, Stephan P. A.


    With the advent of the use of precise ion accelerators for medical purposes, it becomes ever more important to understand the interaction of biomolecules with fast ions.  Glycine is both a protein component and a model biomolecule, and is thus an important test system.    In this report, we discu...

  7. Resposta da soja (Glycine max (L. Merrill à ação de bioestimulante = Soybean (Glycine max (L. Merrill response to biostimulant action

    Directory of Open Access Journals (Sweden)

    Celestina Alflen Klahold


    Full Text Available Objetivando verificar o efeito do bioestimulante, Stimulate®, aplicado via semente e pulverização foliar, na cultura da soja, conduziu-se um experimento sob ambiente protegido, em vasos. O delineamento foi de blocos casualizados, com 4 repetições. Os tratamentos constaram da combinação de doses de bioestimulate, aplicadas via semente (0, 3 e 5 mL kg-1 de sementes na semeadura e via foliar (0,0; 0,075; 0,150 e 0,225 mL L-1, aos 58 dias após a emergência (DAE. Realizaram-se coletas de plantas aos 73 e 129 DAE.Para algumas das variáveis estudadas, nas doses utilizadas, houve efeito negativo na resposta à aplicação de bioestimulante, para algumas doses testadas. Respostas positivas foram verificadas para massa seca de flores, raízes, razão raiz/parte aérea, número de flores, vagens e grãos e produção por planta. Destacaram-se positivamente os tratamentos: 0,0 mL 0,5 kg-1 (AS + 0,150 mL L-1 (APF; 3,0 mL 0,5 kg-1 (AS + 0,0 mL L-1 (APF; 3,0 mL 0,5 kg-1 (AS+ 0,225 mL L-1 (APF e 5,0 mL 0,5 kg-1 (AS + 0,075 mL L-1 (APF.Aiming to verify the effect of the bioestimulant, Stimulate®, applied saw by seed and leaf pulverization, in the culture of the soybean. It behaved an experiment under greenhouse, in vases. Randomized block experimental design was used, with four repetitions. The treatments consisted of the combination of bioestimulant doses: seed application (SA (0; 3; and 5 mL kg-1 of seeds in the sowing and leaf spray (LS (0.0; 0.075; 0.150; and 0.225 mL L- 1, to the 58 days after the emergency (DAE. Collections of plants were accomplished to the 73 and 129 DAE. For some of the studied variables, in the used doses, there was negative effect in the response of the biostimulant application, for some tested doses. Positives responses were verified for flowers and roots dry mass; root/shoot relation; flowers; beans and grains number; and yield for plant. They stood out the treatments: 0,0 mL 0.5 kg-1 (SA + 0.150 mL L-1 (LS; 3.0 mL 0.5 kg


    Directory of Open Access Journals (Sweden)

    Corneliu Tanase


    Full Text Available The aim of this study was to evaluate the effect of spruce bark aqueous extract and deuterium depleted water (DDW as bioregulators on the plant growth Glycine max L. and Helianthus annuus. The following specific parameteres were closely monitorised: germination energy and germination capacity, plants vegetative organelles growth and development and photoassimilatory pigments concentrations. The results have shown that DDW presents different effects depending on tested plant species. In the case of soybean, DDW presented stimulatory effects on both germination energy and capacity, radicles elongation, primary leaves growth and development but inhibitory effects on photoassimilatory pigments. Spruce bark extract reduced the germination capacity of soybean seeds, but accelerated the germination process of sunflower seeds and present stimulatory effects on plantlets biomass accumulation. The combination of DDW with Picea abies polyphenolic extract promoted soybean plantlet elongation, especially the rootlets ones and stimulated green biomass accumulation for both soybean and sunflower plantlets. Analyzing the photoassimilatory pigments concentration for sunflower, it can be observed an increasing trend (almost 100% comparing with control when introduce into the growth medium DDW and P. abies polyphenolic extract. DDW and P. abies bark extract have shown an important role in plant growth and development, improving photoassimiliation process.

  9. Timecourse microarray analyses reveal global changes in gene expression of susceptible Glycine max (soybean) roots during infection by Heterodera glycines (soybean cyst nematode). (United States)

    Alkharouf, Nadim W; Klink, Vincent P; Chouikha, Imed B; Beard, Hunter S; MacDonald, Margaret H; Meyer, Susan; Knap, Halina T; Khan, Rana; Matthews, Benjamin F


    Changes in gene expression within roots of Glycine max (soybean), cv. Kent, susceptible to infection by Heterodera glycines (the soybean cyst nematode [SCN]), at 6, 12, and 24 h, and 2, 4, 6, and 8 days post-inoculation were monitored using microarrays containing more than 6,000 cDNA inserts. Replicate, independent biological samples were examined at each time point. Gene expression was analyzed statistically using T-tests, ANOVA, clustering algorithms, and online analytical processing (OLAP). These analyses allow the user to query the data in several ways without importing the data into third-party software. RT-PCR confirmed that WRKY6 transcription factor, trehalose phosphate synthase, EIF4a, Skp1, and CLB1 were differentially induced across most time-points. Other genes induced across most timepoints included lipoxygenase, calmodulin, phospholipase C, metallothionein-like protein, and chalcone reductase. RT-PCR demonstrated enhanced expression during the first 12 h of infection for Kunitz trypsin inhibitor and sucrose synthase. The stress-related gene, SAM-22, phospholipase D and 12-oxophytodienoate reductase were also induced at the early time-points. At 6 and 8 dpi there was an abundance of transcripts expressed that encoded genes involved in transcription and protein synthesis. Some of those genes included ribosomal proteins, and initiation and elongation factors. Several genes involved in carbon metabolism and transport were also more abundant. Those genes included glyceraldehyde 3-phosphate dehydrogenase, fructose-bisphosphate aldolase and sucrose synthase. These results identified specific changes in gene transcript levels triggered by infection of susceptible soybean roots by SCN.

  10. Growth and quality of soybean sprouts (Glycine max L. Merrill) as affected by gamma irradiation (United States)

    Soybean sprouts are considered as natural and healthy food by Asian consumers. However, sprouts are often associated with outbreaks of foodborne illnesses and recalls due to contamination of seeds with human pathogens. Irradiation may be used to inactivate pathogens on seeds and sprouts. In this stu...

  11. Optimization of ultrasonic assisted extraction of antioxidants from black soybean (Glycine max var) sprouts using response surface methodology. (United States)

    Lai, Jixiang; Xin, Can; Zhao, Ya; Feng, Bing; He, Congfen; Dong, Yinmao; Fang, Yun; Wei, Shaomin


    Response surface methodology (RSM) using a central composite design (CCD) was employed to optimize the conditions for extraction of antioxidants from black soybean (Glycine max var) sprouts. Three influencing factors: liquid-solid ratio, period of ultrasonic assisted extraction and extraction temperature were investigated in the ultrasonic aqueous extraction. Then Response Surface Methodology (RSM) was applied to optimize the extraction process focused on DPPH radical-scavenging capacity of the antioxidants with respect to the above influencing factors. The best combination of each significant factor was determined by RSM design and optimum pretreatment conditions for maximum radical-scavenging capacity were established to be liquid-solid ratio of 29.19:1, extraction time of 32.13 min, and extraction temperature of 30 °C. Under these conditions, 67.60% of DPPH radical-scavenging capacity was observed experimentally, similar to the theoretical prediction of 66.36%.

  12. Initial organic products of fixation of [13N]dinitrogen by root nodules of soybean (Glycine max)

    International Nuclear Information System (INIS)

    Meeks, J.C.; Wolk, C.P.; Schilling, N.; Shaffer, P.W.; Avissar, Y.; Chien, W.S.


    When detached soybean Glycine max (L.) Merr. cv. Hark, nodules assimilate ( 13 N)N 2 , the initial organic product of fixation is glutamine; glutamate becomes more highly radioactive than glutamine within 1 minute; 13 N in alanine becomes detectable at 1 minute of fixation and increases rapidly between 1 and 2 minutes. After 15 minutes of fixation, the major 13 N-labeled organic products in both detached and attached nodules are glutamate and alanine, plus, in the case of attached nodules, an unidentified substance, whereas ( 13 N)glutamine comprises only a small fraction of organic 13 N, and very little 13 N is detected in asparagine. The fixation of ( 13 N)N 2 into organic products was inhibited more than 99 percent by C 2 H 2 (10 percent, v/v). The results support the idea that the glutamine synthetase-glutamate synthase pathway is the primary route for assimilation of fixed nitrogen in soybean nodules

  13. Plant regeneration from cotyledons of mature soybean (Glycine max L.) Wilis cultivar using gamma rays

    International Nuclear Information System (INIS)

    Hutabarat, D.; Ratna, R.


    Soybean Wilis cultivar was efficiently regenerated in vitro via somatic embryogenesis. Cotyledonary explants were excised from mature germinating seeds. Seeds were germinated on agar solution and on B5 medium enriched with 5 ppm BA, 0.25 ppm BA, 0.25 ppm IBA and 500 ppm casein hydrolyzate. Cotyledonary nodes from both germinating seeds were excised and cultured on B5 medium enriched with 5 ppm BA, 0.25 ppm IBA and 500 ppm casein hydrolyzate. Age of seedlings had a remarkable influence on shoot regeneration. Cotyledon from seeds germinated on agar solution with light gave better result in shoot regeneration compare with those germinated in darkness. The highest number of regenerants per explants (5 shoots) was produced by cotyledon from seeds germinated on B5 medium enriched with 5 ppm IBA and 500 ppm casein hydrolyzate in darkness. The seeds of soybean were exposed to gamma-rays doses 10 Gy then germinated on B5 medium enriched with 5 ppm BA, 0.25 ppm IBA and 500 ppm casein hydrolyzate did not improve the number of plant regeneration. Only 5-day-old seedlings from seeds were exposed to gamma-rays dose 30 Gy could improve the number of shoot regeneration, one of the cotyledonary node treated produced 21 regeneration shoots

  14. Impact of elevated levels of atmospheric CO2 and herbivory on flavonoids of soybean (Glycine max Linnaeus). (United States)

    O'Neill, Bridget F; Zangerl, Arthur R; Dermody, Orla; Bilgin, Damla D; Casteel, Clare L; Zavala, Jorge A; DeLucia, Evan H; Berenbaum, May R


    Atmospheric levels of carbon dioxide (CO2) have been increasing steadily over the last century. Plants grown under elevated CO2 conditions experience physiological changes, particularly in phytochemical content, that can influence their suitability as food for insects. Flavonoids are important plant defense compounds and antioxidants that can have a large effect on leaf palatability and herbivore longevity. In this study, flavonoid content was examined in foliage of soybean (Glycine max Linnaeus) grown under ambient and elevated levels of CO2 and subjected to damage by herbivores in three feeding guilds: leaf skeletonizer (Popillia japonica Newman), leaf chewer (Vanessa cardui Linnaeus), and phloem feeder (Aphis glycines Matsumura). Flavonoid content also was examined in foliage of soybean grown under ambient and elevated levels of O3 and subjected to damage by the leaf skeletonizer P. japonica. The presence of the isoflavones genistein and daidzein and the flavonols quercetin and kaempferol was confirmed in all plants examined, as were their glycosides. All compounds significantly increased in concentration as the growing season progressed. Concentrations of quercetin glycosides were higher in plants grown under elevated levels of CO2. The majority of compounds in foliage were induced in response to leaf skeletonization damage but remained unchanged in response to non-skeletonizing feeding or phloem-feeding. Most compounds increased in concentration in plants grown under elevated levels of O3. Insects feeding on G. max foliage growing under elevated levels of CO2 may derive additional antioxidant benefits from their host plants as a consequence of the change in ratios of flavonoid classes. This nutritional benefit could lead to increased herbivore longevity and increased damage to soybean (and perhaps other crop plants) in the future.

  15. Emisiones de óxido nitroso en un cultivo de soja [Glycine max (L. Merrill]: efecto de la inoculación y de la fertilización nitrógenada Nitrous oxide emission during a soybean [Glycine max (L. Merril] culture: inoculation and nitrogen fertilization effects

    Directory of Open Access Journals (Sweden)

    Ignacio A Ciampitti


    Full Text Available El óxido nitroso absorbe radiación infrarroja contribuyendo al efecto invernadero; este gas es producido principalmente en el suelo, mediante los procesos de nitrificación y denitrificación. En un estudio a campo, sobre un suelo Argiudol típico, se evaluó el efecto de la fertilización y la inoculación con Bradyrhizobium japonicum en un cultivo de soja [Glycine max (L. Merrill], sobre las emisiones de óxido nitroso. Los gases se extrajeron de cilindros de PVC y la lectura se realizó con cromatografía gaseosa. Las emisiones presentaron valores crecientes desde la siembra hacia madurez fisiológica del cultivo, para todos los tratamientos; este comportamiento fue concomitante con la evolución presentada por la humedad edáfica. La fertilización nitrogenada aumentó significativamente (PNitrous oxide gas absorbs infrared radiation contributing to the greenhouse effect; this gas is produced mainly in soil, by means of the processes of nitrification and denitrification. In a field study at the FAUBA on a typic Argiudol, we evaluated the effect of fertilization and inoculation with Bradyrhizobium japonicum during a soybean culture [Glycine max (L. Merrill], on nitrous oxide emisión. Gases were sampled with PVC cylinders and were read with gaseous chromatography. Emissions presented increasing values from seeding towards physiological maturity for all treatments; this behavior was similar to the evolution presented by nitrate level and soil moisture. Nitrogen fertilization significantly increased (P<0.05 nitrous oxide emissions and inoculation only had a significant effect with the highest level of fertilization (P=0.09. Plots fertilized at highest dose and inoculated gave the greatest nitrous oxide emissions. The variable that better explains the emissions is the nitrate level (r² = 0.1899; P=0.0231.

  16. High-quality permanent draft genome sequence of the Bradyrhizobium elkanii type strain USDA 76T, isolated from Glycine max (L.) Merr (United States)

    Bradyrhizobium elkanii USDA 76T (INSCD = ARAG00000000), the type strain for Bradyrhizobium elkanii, is an aerobic, motile, Gram-negative, non-spore-forming rod that was isolated from an effective nitrogen-fixing root nodule of Glycine max (L. Merr) grown in the USA. Because of its significance as a ...

  17. Genome analysis methods: Glycine max [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available Glycine max Finished 2n=40 1,115 Mb 2010 Sanger (WGS) 7.53 Gb 937.32 Mb 8.04x Arac... from Arabidopsis, rice and grapevine 46,430 SoyBase; Gm1.01 Gm1.01 10.1038/nature08670 20075913 ...

  18. 31P-Nuclear Magnetic Resonance Determination of Phosphate Compartmentation in Leaves of Reproductive Soybeans (Glycine max L.) as Affected by Phosphate Nutrition 1 (United States)

    Lauer, Michael J.; Blevins, Dale G.; Sierzputowska-Gracz, Hanna


    Most leaf phosphorus is remobilized to the seed during reproductive development in soybean. We determined, using 31P-NMR, the effect phosphorus remobilization has on vacuolar inorganic phosphate pool size in soybean (Glycine max [L.] Merr.) leaves with respect to phosphorus nutrition and plant development. Phosphate compartmentation between cytoplasmic and vacuolar pools was observed and followed in intact tissue grown hydroponically, at the R2, R4, and R6 growth stages. As phosphorus in the nutrient solution decreased from 0.45 to 0.05 millimolar, the vacuolar phosphate peak became less prominent relative to cytoplasmic phosphate and hexose monophosphate peaks. At a nutrient phosphate concentration of 0.05 millimolar, the vacuolar phosphate peak was not detectable. At higher levels of nutrient phosphate, as plants progressed from the R2 to the R6 growth stage, the vacuolar phosphate peak was the first to disappear, suggesting that storage phosphate was remobilized to a greater extent than metabolic phosphate. Under suboptimal phosphate nutrition (≤ 0.20 millimolar), the hexose monophosphate and cytoplasmic phosphate peaks declined earlier in reproductive development than when phosphate was present in optimal amounts. Under low phosphate concentrations (0.05 millimolar) cytoplasmic phosphate was greatly reduced. Carbon metabolism was coincidently disrupted under low phosphate nutrition as shown by the appearance of large, prominent starch grains in the leaves. Cytoplasmic phosphate, and leaf carbon metabolism dependent on it, are buffered by vacuolar phosphate until late stages of reproductive growth. Images Figure 4 PMID:16666705

  19. Improvement of Soybean (Glycine max L. Yield with Urea Foliar Application at Growth Stages

    Directory of Open Access Journals (Sweden)

    Mahmood Tohidi


    Full Text Available To investigate the effects of nitrogen foliar application at different growth stages of soybean on the yield and yield components this experiment was performed in Shush, north of Khuzestan, Iran, during growing season of 2014. The experiment was in split plot based on randomized complete block design with three replications. Experimental treatments consisted of four levels of nitrogen fertilizer foliar applications as control (no nitrogen foliar application, 25, 50 and 75 kg/ha pure nitrogen from urea source (46% pure nitrogen assigned to the main plots and spraying times in three levels, at vegetative stage, flowering stage and podding stage to the subplots. Results showed that the effects of nitrogen foliar application on traits measured in this experiment like leaf area index, number of pod per plant, number of seeds per pod, thousand seed weight, seed yield, biologic yield, harvest index, protein percent and protein yield and also interaction of different levels of nitrogen foliar application and different growth stages, were significant. Oil percent and yield were only significant under the effect of nitrogen foliar application treatments at different growth stages while the interaction of different levels of nitrogen foliar application and different growth stages, were not significant. In this experiment nitrogen foliar application increased seed yield. The highest seed yield amounted to 2466 kg/ha when 50kg/ha of foliar nitrogen applied at vegetative growth stage and lowest seed yield amounted to 1295 kg/ha in the control treatment at the stage of podding. In general, results demonstrated that 50 kg/ha treatment could be considered as the best management option of nitrogen foliar application for soybean at vegetative growth stage.

  20. Efektifitas Kemasan dan Suhu Ruang Simpan terhadap Daya Simpan Benih Kedelai (Glycine max (L. Meirril

    Directory of Open Access Journals (Sweden)

    Marlinda Dwi Purwanti


    Full Text Available This study aims to determine the best of packaging types and storage temperature for soybean seeds. The research was conducted in laboratory using a 5x3 factorial design arranged in a completely randomized design (CRD. The first factor was the types of packaging namely PP plastic (Poly Prophylene vaccuum, PP plastic (Poly Prophylene without vaccuum, PE plastic (Poly Ethylene vaccuum, PE plastic (Poly Ethylene without vaccuum, and control (without packaging. The second factor was the temperature of storage room, i.e. room temperature (27-29 0C, air conditioned room (17-19 0C and Cooler room (7 0C. Each treatment was replicated 4 times. The results showed that the best packaging type for storing seed at temperature (27-29 0C PP plastic & PE plastic with and without vaccuum. However, the soybean seed storaged in air-conditioned room (17-19 0C and Cooler room temperature (7 0C using the vaccuum, non vaccuum, and withot packaging could maintain the quality of soybead seed for 4 months.

  1. Fungi isolated from Stewartia pseudocamellia Max. seeds and their pathogenesis

    Directory of Open Access Journals (Sweden)

    Halina Kurzawińska


    Full Text Available The aim of studies was to determine typical composition of fungi occurring on seeds of Stewartia pseudocamellia.The studies conducted on 100 disinfected and 100 nondisinfected seeds of these plants.Isolates of Alternaria alternata, Fusarium oxysporum, Cylindrocarpon radicicola and Rhizoctonia solani were characterized by pathogenicity towards the investigated Stewartia pseudocamellia. In the laboratory experiment, 204 isolations of microorganisms were obtained that belonged to 20 species and form of fungi and bacteria. Among fungi there were both of parasite (Alternaria alternata, Botrytis cinerea, Fusarium spp., Rhizoctonia solani and typical saprophytic (Cladosporium spp., Penicillium spp., Aspergillus spp., Epicoccum spp., Mucor spp.. The dominant fungus on seeds was Alternaria alternata. Among the investigated isolates only one isolate (R4 Rhizoctonia solani, was strongly pathogenic, isolates (A1 Alternaria alternata were weakly pathogenic to seedlings of Stewartia pseudocamellia.

  2. Heat waves imposed during early pod development in soybean (Glycine max) cause significant yield loss despite a rapid recovery from oxidative stress. (United States)

    Siebers, Matthew H; Yendrek, Craig R; Drag, David; Locke, Anna M; Rios Acosta, Lorena; Leakey, Andrew D B; Ainsworth, Elizabeth A; Bernacchi, Carl J; Ort, Donald R


    Heat waves already have a large impact on crops and are predicted to become more intense and more frequent in the future. In this study, heat waves were imposed on soybean using infrared heating technology in a fully open-air field experiment. Five separate heat waves were applied to field-grown soybean (Glycine max) in central Illinois, three in 2010 and two in 2011. Thirty years of historical weather data from Illinois were analyzed to determine the length and intensity of a regionally realistic heat wave resulting in experimental heat wave treatments during which day and night canopy temperatures were elevated 6 °C above ambient for 3 days. Heat waves were applied during early or late reproductive stages to determine whether and when heat waves had an impact on carbon metabolism and seed yield. By the third day of each heat wave, net photosynthesis (A), specific leaf weight (SLW), and leaf total nonstructural carbohydrate concentration (TNC) were decreased, while leaf oxidative stress was increased. However, A, SLW, TNC, and measures of oxidative stress were no different than the control ca. 12 h after the heat waves ended, indicating rapid physiological recovery from the high-temperature stress. That end of season seed yield was reduced (~10%) only when heat waves were applied during early pod developmental stages indicates the yield loss had more to do with direct impacts of the heat waves on reproductive process than on photosynthesis. Soybean was unable to mitigate yield loss after heat waves given during late reproductive stages. This study shows that short high-temperature stress events that reduce photosynthesis and increase oxidative stress resulted in significant losses to soybean production in the Midwest, U.S. The study also suggests that to mitigate heat wave-induced yield loss, soybean needs improved reproductive and photosynthetic tolerance to high but increasingly common temperatures. Published 2015. This article is a U.S. Government work and is

  3. In silico comparison of genomic regions containing genes coding for enzymes and transcription factors for the phenylpropanoid pathway in Phaseolus vulgaris L. and Glycine max L. Merr

    Directory of Open Access Journals (Sweden)

    Yarmilla eReinprecht


    Full Text Available Legumes contain a variety of phytochemicals derived from the phenylpropanoid pathway that have important effects on human health as well as seed coat color, plant disease resistance and nodulation. However, the information about the genes involved in this important pathway is fragmentary in common bean (Phaseolus vulgaris L.. The objectives of this research were to isolate genes that function in and control the phenylpropanoid pathway in common bean, determine their genomic locations in silico in common bean and soybean, and analyze sequences of the 4CL gene family in two common bean genotypes. Sequences of phenylpropanoid pathway genes available for common bean or other plant species were aligned, and the conserved regions were used to design sequence-specific primers. The PCR products were cloned and sequenced and the gene sequences along with common bean gene-based (g markers were BLASTed against the Glycine max v.1.0 genome and the P. vulgaris v.1.0 (Andean early release genome. In addition, gene sequences were BLASTed against the OAC Rex (Mesoamerican genome sequence assembly. In total, fragments of 46 structural and regulatory phenylpropanoid pathway genes were characterized in this way and placed in silico on common bean and soybean sequence maps. The maps contain over 250 common bean g and SSR (simple sequence repeat markers and identify the positions of more than 60 additional phenylpropanoid pathway gene sequences, plus the putative locations of seed coat color genes. The majority of cloned phenylpropanoid pathway gene sequences were mapped to one location in the common bean genome but had two positions in soybean. The comparison of the genomic maps confirmed previous studies, which show that common bean and soybean share genomic regions, including those containing phenylpropanoid pathway gene sequences, with conserved synteny. Indels identified in the comparison of Andean and Mesoamerican common bean sequences might be used to develop

  4. Morphological study on the gamma radiation effect on soybean (Glycine max Merr)

    International Nuclear Information System (INIS)



    Soybean seeds of 1 3 4 5 var. were irradiated with 0, 10, 15, and 20 Krad, of gamma rays. The result of these treatment are as follows: (1) At treatment within 10 Krad of gamma rays, some of the plant growth changed from determinate type to indeterminate type. (2) The treatment within 15 and 20 Krad of gamma rays results in four different kinds of leaf size and shape. (author)

  5. Mutagenic effects of gamma rays on soybean (Glycine max L.) germination and seedlings (United States)

    Kusmiyati, F.; Sutarno; Sas, M. G. A.; Herwibawa, B.


    Narrow genetic diversity is a main problem restricting the progress of soybean breeding. One way to improve genetic diversity of plant is through mutation. The purpose of this study was to investigate effect of different dose of gamma rays as induced mutagen on physiological, morphological, and anatomical markers during seed germination and seedling growth of soybean. Seeds of soybean cultivars Dering-1 were irradiated with 11 doses of gamma rays (0, 5, 10, 20, 40, 80, 160, 320, 640, 1280, and 2560 Gy [Gray]. The research design was arranged in a completely randomized block design in three replicates. Results showed that soybean seed exposed at high doses (640, 1280, and 2560 Gy) did not survive more than 20 days, the doses were then removed from anatomical evaluation. Higher doses of gamma rays siginificantly reduced germination percentage at the first count and final count, coefficient of germination velocity, germination rate index, germination index, seedling height and seedling root length, and significantly increased mean germination time, first day of germination, last day of germination, and time spread of germination. However, the effects of gamma rays were varies for density, width, and length of stomata. The LD50 obtained based on survival percentage was 314.78 Gy. It can be concluded that very low and low doses of gamma rays (5-320 Gy) might be used to study the improvement of soybean diversity.

  6. Bacterial bioeffectors modify bioactive profile and increase isoflavone content in soybean sprouts (Glycine max var Osumi). (United States)

    Algar, Elena; Ramos-Solano, Beatriz; García-Villaraco, Ana; Sierra, M Dolores Saco; Gómez, M Soledad Martín; Gutiérrez-Mañero, F Javier


    The effect of two bacterial strains to enhance bioactive contents (total phenolic compounds, total flavonoid compounds and isoflavones) and antioxidant activity on 3-day-old soybean sprouts were investigated. To identify bacterial determinants responsible for these effects, viable and UV-treated strains were delivered to wounded seeds at different concentration. Multivariate analysis performed with all the evaluated parameters indicated the different effectiveness of Stenotrophomonas maltophilia N5.18 and Pseudomonas fluorescens N21.4 based on different structural and metabolic determinants for each. N21.4 increased total phenolics and isoflavones from the genistein family, while N5.18 triggered biosynthesis of daidzein and genistein families coupled to a decrease in total phenolics, suggesting different molecular targets in the phenilpropanoid pathway. Only extracts from N5.18 treated seeds showed an improved antioxidant activity according to the β-carotene bleaching prevention method. In summary, bioeffectors from both bacterial strains are effective tools to improve soybean sprouts quality; structural elicitors from N5.18 also enhanced antioxidant activity, being the best alternative for further development of a biotechnological procedure.


    Directory of Open Access Journals (Sweden)

    Maman Maman


    Full Text Available The severity of plant disease is closely related to the development of the disease itself, including rusts caused by pathogenic fungi. This research aimed to determine the difference of rusts disease severity and to determine the correlation between rusts disease severity with the productivity of different varieties of soybean. The material used was inoculum of rusts pathogenic fungi, Phakopsora pachyrhizi Syd., and four varieties of soybean, i.e., Slamet, Lokon, Bromo, and Ringgit. This research was a split-plot design experimental with subplot was four different varieties of soybean, and the main plot was the control without the treatment of inoculation (In0. The spores suspension density of inoculum of P. pachyrhizi Syd applied was 104 spores/ml (In1. The main parameters observed in this study were the height of plants, the number of pods per plant, the number of seeds per plant, the wet and dry weight of the plant, and the total weight of 100 grains seed. The supporting parameters were the disease severity, the soil acidity, the humidity, and the air temperature. The results showed the plant with lowest rusts disease severity was Slamet variety (18,38%, and the highest was Ringgit variety (35,92%. The correlation test showed the increment of rusts disease severity reduced the number of pods and dry weight of the plant in Lokon variety.

  8. Characterization of the recombinant copper chaperone (CCS) from the plant Glycine (G.) max. (United States)

    Sagasti, Sara; Yruela, Inmaculada; Bernal, Maria; Lujan, Maria A; Frago, Susana; Medina, Milagros; Picorel, Rafael


    The goal of the present work was to characterize the recombinant copper chaperone (CCS) from soybean. Very little is known about plant copper chaperones, which makes this study of current interest, and allows for a comparison with the better known homologues from yeast and humans. To obtain sizeable amounts of pure protein suitable for spectroscopic characterization, we cloned and overexpressed the G. max CCS chaperone in E. coli in the presence of 0.5 mM CuSO(4) and 0.5 mM ZnSO(4) in the broth. A pure protein preparation was obtained by using two IMAC steps and pH gradient chromatography. Most of the proteins were obtained as apo-form, devoid of copper atoms. The chaperone showed a high content (i.e., over 40%) of loops, turns and random coil as determined both by circular dichroism and homology modelling. The homology 3-D structural model suggests the protein might fold in three structural protein domains. The 3-D model along with the primary structure and spectroscopic data may suggest that copper atoms occupy the two metal binding sites, MKCEGC and CTC, within the N-terminal domain I and C-terminal domain III, respectively. But only one Zn-binding site was obtained spectroscopically.

  9. The lipoxygenase gene family: a genomic fossil of shared polyploidy between Glycine max and Medicago truncatula

    Directory of Open Access Journals (Sweden)

    Choi Beom-Soon


    Full Text Available Abstract Background Soybean lipoxygenases (Lxs play important roles in plant resistance and in conferring the distinct bean flavor. Lxs comprise a multi-gene family that includes GmLx1, GmLx2 and GmLx3, and many of these genes have been characterized. We were interested in investigating the relationship between the soybean lipoxygenase isozymes from an evolutionary perspective, since soybean has undergone two rounds of polyploidy. Here we report the tetrad genome structure of soybean Lx regions produced by ancient and recent polyploidy. Also, comparative genomics with Medicago truncatula was performed to estimate Lxs in the common ancestor of soybean and Medicago. Results Two Lx regions in Medicago truncatula showing synteny with soybean were analyzed. Differential evolutionary rates between soybean and Medicago were observed and the median Ks values of Mt-Mt, Gm-Mt, and Gm-Gm paralogs were determined to be 0.75, 0.62, and 0.46, respectively. Thus the comparison of Gm-Mt paralogs (Ks = 0.62 and Gm-Mt orthologs (Ks = 0.45 supports the ancient duplication of Lx regions in the common ancestor prior to the Medicago-Glycine split. After speciation, no Lx regions generated by another polyploidy were identified in Medicago. Instead tandem duplication of Lx genes was observed. On the other hand, a lineage-specific duplication occurred in soybean resulting in two pairs of Lx regions. Each pair of soybean regions was co-orthologous to one Lx region in Medicago. A total of 34 Lx genes (15 MtLxs and 19 GmLxs were divided into two groups by phylogenetic analysis. Our study shows that the Lx gene family evolved from two distinct Lx genes in the most recent common ancestor. Conclusion This study analyzed two pairs of Lx regions generated by two rounds of polyploidy in soybean. Each pair of soybean homeologous regions is co-orthologous to one region of Medicago, demonstrating the quartet structure of the soybean genome. Differential evolutionary rates between

  10. Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

    Energy Technology Data Exchange (ETDEWEB)

    Murakami, M. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail:; Ae, N. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail:; Ishikawa, S. [Department of Environmental Chemistry, National Institute for Agro-Environmental Sciences, 3-1-3 Kannondai, Tsukuba, Ibaraki 305-0856 (Japan)]. E-mail:


    Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg{sup -1}, during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot.

  11. Phytoextraction of cadmium by rice (Oryza sativa L.), soybean (Glycine max (L.) Merr.), and maize (Zea mays L.)

    International Nuclear Information System (INIS)

    Murakami, M.; Ae, N.; Ishikawa, S.


    Selecting a phytoextraction plant with high Cd-accumulating ability based on the plant's compatibility with mechanized cultivation techniques may yield more immediately practical results than selection based on high tolerance to Cd. Rice (Oryza sativa L., cv. Nipponbare and Milyang 23), soybean (Glycine max [L.] Merr., cv. Enrei and Suzuyutaka), and maize (Zea mays L., cv. Gold Dent) were grown on one Andosol and two Fluvisols with low concentration of Cd contamination ranging from 0.83 to 4.29 mg Cd kg -1 , during 60 days in pots (550 mL) placed in a greenhouse. Shoot Cd uptake was as follows: Gold Dent < Enrei and Nipponbare < Suzuyutaka and Milyang 23. Several soil Cd fractions after Milyang 23 harvesting decreased most. Milyang 23 accumulated 10-15% of the total soil Cd in its shoot. The Milyang 23 rice is thus promising for phytoextraction of Cd from paddy soils with low contamination level. - Milyang 23 rice (Oryza sativa L.) accumulated 10-15% of the total soil Cd in its shoot

  12. MDA and Histologic Profile of Pancreatic Diabetic-Rats Model Administered With Extract of Glycine max (L. Merr.

    Directory of Open Access Journals (Sweden)

    Luh Putu Gina


    Full Text Available Diabetes Mellitus is characterized by leveling up glucose in human blood and affects increasing of free radicals in body as well as leading to cellular oxidative stress. Experimentally, this condition is able to be characterized by increasing malondialdehyde (MDA level in cell and histological changing in pancreas appearance. Consumption of antioxidant substances was reported able to reduce the MDA quantity as free radicals. Black soybean or Glycine max (L Merr. was reported contains important antioxidant agents such as anthocyanin and isoflavone. This paper discloses recent investigation on application of black soybean water extract to reduce the MDA level on diabetes mellitus-rat model induced by STZ (DM and also reports the pancreas histological changing of the DM rats. Investigation revealed that black soybean water extract significantly affect decreasing of MDA level by 4.9%, 27.1% and 45.7% in three different doses theraphy (500, 750, and 1000 mg/kg BW. Histologically, it also clearly indicates repairing of pancreas tissue of the DM rats.

  13. Effects of inoculation with organic-phosphorus-mineralizing bacteria on soybean (Glycine max) growth and indigenous bacterial community diversity. (United States)

    Sun, Wei; Qian, Xun; Gu, Jie; Wang, Xiao-Juan; Li, Yang; Duan, Man-Li


    Three different organic-phosphorus-mineralizing bacteria (OPMB) strains were inoculated to soil planted with soybean (Glycine max), and their effects on soybean growth and indigenous bacterial community diversity were investigated. Inoculation with Pseudomonas fluorescens Z4-1 and Brevibacillus agri L7-1 increased organic phosphorus degradation by 22% and 30%, respectively, compared with the control at the mature stage. Strains P. fluorescens Z4-1 and B. agri L7-1 significantly improved the soil alkaline phosphatase activity, average well color development, and the soybean root activity. Terminal restriction fragment length polymorphism analysis demonstrated that P. fluorescens Z4-1 and B. agri L7-1 could persist in the soil at relative abundances of 2.0%-6.4% throughout soybean growth. Thus, P. fluorescens Z4-1 and B. agri L7-1 could potentially be used in organic-phosphorus-mineralizing biofertilizers. OPMB inoculation altered the genetic structure of the soil bacterial communities but had no apparent influence on the carbon source utilization profiles of the soil bacterial communities. Principal components analysis showed that the changes in the carbon source utilization profiles of bacterial community depended mainly on the plant growth stages rather than inoculation with OPMB. The results help to understand the evolution of the soil bacterial community after OPMB inoculation.

  14. Vermiculite's strong buffer capacity renders it unsuitable for studies of acidity on soybean (Glycine max L.) nodulation and growth. (United States)

    Indrasumunar, Arief; Gresshoff, Peter M


    Vermiculite is the most common soil-free growing substrate used for plants in horticultural and scientific studies due to its high water holding capacity. However, some studies are not suitable to be conducted in it. The described experiments aimed to test the suitability of vermiculite to study the effect of acidity on nodulation and growth of soybean (Glycine max L.). Two different nutrient solutions (Broughton & Dilworth, and modified Herridge nutrient solutions) with or without MES buffer addition were used to irrigate soybean grown on vermiculite growth substrates. The pH of nutrient solutions was adjusted to either pH 4.0 or 7.0 prior its use. The nodulation and vegetative growth of soybean plants were assessed at 3 and 4 weeks after inoculation. The unsuitability of presumably inert vermiculite as a physical plant growth substrate for studying the effects of acidity on soybean nodulation and plant growth was illustrated. Nodulation and growth of soybean grown in vermiculite were not affected by irrigation with pH-adjusted nutrient solution either at pH 4.0 or 7.0. This was reasonably caused by the ability of vermiculite to neutralise (buffer) the pH of the supplied nutrient solution (pH 2.0-7.0). Due to its buffering capacity, vermiculite cannot be used as growth support to study the effect of acidity on nodulation and plant growth.

  15. Elevated Atmospheric CO2 and Drought Affect Soil Microbial Community and Functional Diversity Associated with Glycine max

    Directory of Open Access Journals (Sweden)

    Junfeng Wang


    Full Text Available Abstract Under the background of climate change, the increase of atmospheric CO2 and drought frequency have been considered as significant influencers on the soil microbial communities and the yield and quality of crop. In this study, impacts of increased ambient CO2 and drought on soil microbial structure and functional diversity of a Stagnic Anthrosol were investigated in phytotron growth chambers, by testing two representative CO2 levels, three soil moisture levels, and two soil cover types (with or without Glycine max. The 16S rDNA and 18S rDNA fragments were amplified to analyze the functional diversity of fungi and bacteria. Results showed that rhizosphere microbial biomass and community structure were significantly affected by drought, but effects differed between fungi and bacteria. Drought adaptation of fungi was found to be easier than that of bacteria. The diversity of fungi was less affected by drought than that of bacteria, evidenced by their higher diversity. Severe drought reduced soil microbial functional diversity and restrained the metabolic activity. Elevated CO2 alone, in the absence of crops (bare soil, did not enhance the metabolic activity of soil microorganisms. Generally, due to the co-functioning of plant and soil microorganisms in water and nutrient use, plants have major impacts on the soil microbial community, leading to atmospheric CO2 enrichment, but cannot significantly reduce the impacts of drought on soil microorganisms.

  16. Antioxidant activity of seedling growth in selected soybean genotypes (Glycine max (L.) Merrill) responses of submergence (United States)

    Damanik, R. I.; Marbun, P.; Sihombing, L.


    In order to better understand the physiological and biochemical responses relating to direct seeding establishment in soybeans, the plant growth rate and antioxidative defense responses of seedlings in seven Indonesian soybean genotypes (Anjasmoro, Detam-1, Detam-2, Dieng, Grobogan, Tanggamus, and Willis) at different submergence periods (4, and 8 days) were examined. Twelve-day old seedlings were hydroponically grown in limited oxygen conditions. The results showed that the chlorophyll content in soybean seedlings was reduced beginning as early as 4 d under submerged condition, except for Detam-1, Detam-2, and Grobogan genotypes. The dry weight and protein concentration of seedlings were significantly higher at control condition (0 d) than those in submerged condition. The activities of superoxide dismutase (SOD) increased linearly until 8 d submerged for all genotypes. On the other hand, our results showed that catalase (CAT) and ascorbate peroxidase (APX) activities did not work together, meaning that CAT is activated and APX deactivated, or vice versa, in response to submergence conditions, except for Grobogan and Tanggamus genotypes which had an effect on both CAT and APX activities. Submergence stress led to a significant increase in glutathione reductase (GR) together with APX activity for Detam-2 and Dieng genotypes at 8 d submerged.


    Directory of Open Access Journals (Sweden)

    Nafiatul Umami


    Full Text Available This research was conducted to investigated the effect of rhizobium inoculation and harvesting time on the productivity of edamame and the chemical composition in the straw edamame. This study was planted edamame soy bean seed. This experiment was carried out in green house used regosol soil in polybag, 2x2 factorial experiment with five replication was arranged in completely randomized design, continued by Duncan’s multiple range test (DMRT for the significant result. The first factor was harvesting time (U consisting of harvested at 65 days (U1 and harvested at 75 days (U2; the second factor was inoculant (I consisting of with inoculation (I1 and without inoculant (I0. The result of the study showed, that underground dry weight (DW mass yield and DM and OM straw productions, crude protein (CP, nitrogen free extract (NFE of UP1 were higher (P<0.01 and ash of straw were higher(P<0.05 than UP2. DM and OM pod productions of UP1 was also superior (P<0.05 than UP2. UP2 resulted better fiber crude (FC (P<0.01 than UP1. Inoculation (L1 resulted better DM and OM straw productions and CP of straw (P<0.01, and underground DW mass yield, FC, NFE of straw were affected (P<0.05 by interaction between treatments. Underground DW mass yield, FC, NFE, DM and OM of straw, and pods productions were not affected by interaction. And all the treatments were also not affected ether extract (EE of straw.The results of experiment shown that legin factor not signification of in vitro digestibility. The harvest time (U1 was higher (P<0.05 than harvested at 75 days. Interaction among two factors not significant on in vitro organic matter digestibility.

  18. Biodegradation of glyphosate in rhizospheric soil cultivated with Glycine max, Canavalia ensiformis e Stizolobium aterrimum Biodegradação de glyphosate em solo rizosférico de Glycine max, Canavalia ensiformis e Stizolobium aterrimum

    Directory of Open Access Journals (Sweden)

    J.B. Santos


    Full Text Available Biodegradation of glyphosate was evaluated in rhizospheric soil cultivated with Glycine max (soybean, var. BRS245-RR, Canavalia ensiformis and Stizolobium aterrimum. After these species were cultivated for 60 days, soil samples were collected, placed in flasks and treated with 14C-glyphosate. After 30 days of incubation, the total release rate of C-CO2 was determined along with microbial biomass (MBC, metabolic quotient (qCO2, and degradation percentage of the radio-labeled glyphosate released as 14C-CO2. A higher mass of rhizosphere-associated microorganisms was verified in the soil samples from pots cultivated with soybean, regardless of glyphosate addition. However, in the presence of the herbicide, this characteristic was the most negatively affected. Microorganisms from the C. ensiformis rhizosphere released a lower amount of 14C-CO2, while for those originated from S. aterrimum, the amount released reached 1.3% more than the total carbon derived from the respiratory activity. The rhizospheric soil from S. aterrimum also presented higher glyphosate degradation efficiency per microbial biomass unit. However, considering qCO2, the microbiota of the rhizospheric soil cultivated with soybean was more efficient in herbicide degradation.Avaliou-se neste trabalho a degradação de glyphosate em solo rizosférico proveniente do cultivo de Glycine max (soja var. BRS245-RR, Canavalia ensiformis e Stizolobium aterrimum. Para isso, após o cultivo, em vasos, das citadas espécies por 60 dias, coletaram-se amostras de solo, as quais foram acondicionadas em frascos e tratadas com 14C-glyphosate. Após 32 dias de incubação, foram determinados a taxa de desprendimento total de C-CO2, a biomassa microbiana (MBC, o quociente metabólico (qCO2 e a porcentagem de degradação do glyphosate radiomarcado liberado na forma de 14C-CO2. Verificou-se a maior massa de microrganismos associados à rizosfera em amostras de solo proveniente de vasos cultivados com a

  19. Effects of rotation of cotton (Gossypium hirsutum L.) and soybean [Glycine max (L.) Merr.] crops on soil fertility in Elizabeth, Mississippi, USA


    H.A., Reddy, K. and Pettigrew, W.T.


    The effects of cotton (Gossypium hirsutum L.): soybean [Glycine max (L.) Merr.] rotation on the soil fertility levels are limited. An irrigated soybean: cotton rotation experiment was conducted from 2012 through 2015 near Elizabeth, Mississippi, USA. The crop rotation sequences were included continuous cotton (CCCC), continuous soybean (SSSS), cotton-soybean-cotton-soybean (CSCS), cotton-soybean-soybean-cotton (CSSC), soybean-cotton-cotton-soybean (SCCS), soybean-cotton-soybean-cotton (SCSC)....

  20. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial


    Kim, Ji-Eun; Jeon, Seon-Min; Park, Ki Hun; Lee, Woo Song; Jeong, Tae-Sook; McGregor, Robin A; Choi, Myung-Sook


    Abstract Background Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML) or Garcinia cambogia extract (GCE) to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial...

  1. Evaluation of replacement intercropping of soybean (Glycine max L. with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. under weed infestation

    Directory of Open Access Journals (Sweden)

    M. Bagheri Shirvan


    Full Text Available In order to evaluate intercropping of soybean (Glycine max L. cv. JK with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. with weed interference, an experiment was performed in randomized complete block design with 12 treatments and three replications at a field located 10 km of Shirvan during year of 2011. The treatments were included 75% soybean: 25%sweet basil, 50%soybean: 50% sweet basil, 25% soybean: 75% sweet basil, 75% soybean: 25% borage, 50% soybean: 50% borage and 25% soybean: 75% borage under weed infestation, in addition sole cropping of plants under weed control and weed interference. Intercropped plants had more success in reduction of weed density and biomass compared to monoculture. Soybean50: sweet basil50, reduced the weed density by 47.95% and 52.9%, and reduced the weed biomass by 68.91% and 61.87% more than sweet basil and soybean pure stand, respectively. Investigation of dry matter accumulation showed that increasing of plant proportion in intercropping caused increasing of plant dry matter. The height of soybean and borage was increased in intercropping and weed interference, while the highest height of sweet basil was observed in monoculture at second harvest. Biological and economical yield of soybean in intercropping with sweet basil was higher than intercropping with borage. The highest harvest index was related to 50:50 soybean: sweet basil ratio. In this ratio, the harvest index increased 4.9% compared to soybean monoculture. Yield of sweet basil and borage decreased with increasing of soybean rows in intercropping. Based on area-time equivalent ratio, soybean 75% with sweet basil and borage 25% (based on borage seed yield had 3% and 4% advantage compared to monoculture.

  2. Soybean (Glycine max L.) N-Turnover Effects on Sustainable Agriculture (United States)

    László, Márton, ,, Dr.


    A lysimeter N-experiment was carried out over a period of three years (1986-1988) in Hungary on a slightly calcareous Ramann sandy-loam brown forest soil. In a trial without seed inoculation, the effect of N-fertiliser was studied on yield and N-uptake and the mineral (NO3+ NO2 ) N-content of 0-90 cm soil-layer of soybean. On the given soil with regulated optimal water supply the highest quantity of 200 kg/ha N-dose seemed to give alredy over-fertilization and lowered in its tendency the grain and pod yield. About one third of the dry matter production without roots and foliage at harvest was given by the grain yield, which ranged between 1.8-5.4 t/ha, depending on the treatment applied and on years. The N-content was accumulated chiefly in the grain, its concentration exceeded about 7-10 times the N-content of roots and stalk. The half of the total N-uptake, on an average 102-256 kg/ha, was built in the grain. The highest N-yield = 631 kg/ha was achieved in 1988 by 150 kg/ha N-fertilization per year. In the first years the N-uptake of the plants agreed with the total supply (mineral reserve of soil + given in the form of fertilizer + precipitation N), while in the 3th year a double amount was recorded. The mineral reserve of N in the soil did not decrease at the end of the trial. Presumably, the soil of soybean in monoculture lost gradually its "Rhisobium japonicum sterility", the biological N-fixation increased with the time. In the first years without seed inoculation however, soybean may be in need of N-fertilization. Key Words: soybean, nitrogen, sustainable agriculture Introduction Soya is an important crop and is now grown all over the world (Márton et al. 1998, Márton et al. 1998, Kádár and Márton 1999, Márton and Kádár 1999, Márton and Kádár 1998). This crop originated in the Far East and has been grown in China for more than four thousand years. It has for long been regarded as one of the five sacred grains with rice, wheat, barley and millet


    Directory of Open Access Journals (Sweden)

    Alexander Hernández


    Full Text Available Con el objetivo de evaluar y seleccionar cultivares de soya (Glycine max. (L Merr con fines de forraje, se llevó a cabo un experimento de un diseño en bloques completamente al azar con 6 repeticiones. Los materiales experimentales usados fueron 9 cultivares procedentes del banco de germoplasma de La Fundación DANAC y el cultivar CIGRAS-06 provenientes del Centro de Investigaciones de Granos y Semillas de la UCR. Las variables bajo estudio fueron las relacionadas con la arquitectura de la planta, producción de biomasa total en el estado reproductivo R6, rendimiento de grano y algunas variables bromatológicas. Los análisis estadísticos mostraron diferencias significativas para las variables objeto de estudio. Los cultivares con mayores rendimientos de biomasa fueron CIGRAS-06, FP93-1935, FP93-1924 y FP90-6102 con 17245, 13075, 13066 y 12587 kg.ha-1 de materia seca (MS. Los de mayores contenidos de proteína cruda (PC en las vainas fueron FP90-10205, FP93-1930 y FP92-1904, con 24,2, 23,7 y 21,0%, respectivamente; y a nivel de las hojas los cultivares FP93-1935, FP92-4906 y FP90-7102 con 25,5, 24,9 y 23,0%, respectivamente. Para la producción de grano mostraron alto potencial los cultivares CIGRAS-06, FP93-1924, FP90-6102 y FP90-6103, al superar los 3500 kg.ha-1.

  4. Nonomuraea glycinis sp. nov., a novel actinomycete isolated from the root of black soya bean [Glycine max (L.) Merr]. (United States)

    Li, Zhilei; Song, Wei; Zhao, Junwei; Zhuang, Xiaoxin; Zhao, Yue; Wang, Xiangjing; Xiang, Wensheng


    A novel actinomycete, designated strain NEAU-BB2C19 T , was isolated from the root of black soya bean [Glycine max (L.) Merr] collected from Harbin, Heilongjiang Province, China, and characterized using a polyphasic approach. The strain was an aerobic, Gram-stain-positive actinomycete that formed extensively branched substrate mycelium and aerial hyphae. The predominant menaquinones were MK-9(H2) and MK-9(H0). The major cellular fatty acid profile consisted of iso-C16 : 0, 10-methyl C17 : 0 and 10-methyl C18 : 0. The polar lipid profile consisted of diphosphatidylglycerol, phosphatidylethanolamine, hydroxy-phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannoside, phosphatidylglycerol and glycolipid. The DNA G+C content was 68.2±0.4 mol%. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain NEAU-BB2C19 T should be assigned to the genus Nonomuraea and formed a distinct branch with its closest neighbour Nonomuraea guangzhouensis NEAU-ZJ3 T (98.75 % 16S rRNA gene sequence similarity). The morphological and chemotaxonomic properties of the strain were also consistent with those of members of the genus Nonomuraea. A combination of DNA-DNA hybridization results and some phenotypic characteristics indicated that strain NEAU-BB2C19 T could be clearly differentiated from its closest phylogenetic relative. Thus, the strain is concluded to represent a novel species of the genus Nonomuraea, for which the name Nonomuraea glycinis sp. nov. is proposed. The type strain is NEAU-BB2C19 T (=CGMCC 4.7430 T =DSM 104838 T ).

  5. Molecular cloning, heterologous expression and functional characterization of gamma tocopherol methyl transferase (γ-TMT) from Glycine max. (United States)

    Tewari, Kalpana; Dahuja, Anil; Sachdev, Archana; Kumar, Vaibhav; Ali, Kishwar; Kumar, Amresh; Kumari, Sweta


    γ-Tocopherol methyltransferase (γ-TMT) (EC is the last enzyme in the tocopherol biosynthetic pathway and it catalyzes the conversion of γ-tocopherol into α-tocopherol, the nutritionally significant and most bioactive form of vitamin E. Although the γ-TMT gene has been successfully overexpressed in many crops to enhance their α-tocopherol content but still only few attempts have been made to uncover its structural, functional and regulation aspects at protein level. In this study, we have cloned the complete 909bp coding sequence of Glycine max γ-TMT (Gm γ-TMT) gene that encodes the corresponding protein comprising of 302 amino acid residues. The deduced Gm γ-TMT protein showed 74-87% sequence identity with other characterized plant γ-TMTs. Gm γ-TMT belongs to Class I Methyl Transferases that have a Rossmann-like fold which consists of a seven-stranded β sheet joined by α helices. Heterologous expression of Gm γ-TMT in pET29a expression vector under the control of bacteriophage T7 promoter produced a 37.9 kDa recombinant Gm γ-TMT protein with histidine hexamer tag at its C-terminus. The expression of recombinant Gm γ-TMT protein was confirmed by western blotting using anti-His antibody. The recombinant protein was purified by Ni 2+ -NTA column chromatography. The purified protein showed SAM dependent methyltransferase activity. The α-tocopherol produced in the in-vitro reaction catalyzed by the purified enzyme was detected using reverse phase HPLC. This study has laid the foundation to unveil the biochemical understanding of Gm γ-TMT enzyme which can be further explored by studying its kinetic behaviour, substrate specificity and its interaction with other biomolecules. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Changes in the physiological activity of soybean (Glycine max L. Merr. under the influence of exogenous growth regulators

    Directory of Open Access Journals (Sweden)

    Anna Nowak


    Full Text Available In a two-year pot experiment (2008–2009 conducted at the Vegetation Hall, West Pomeranian University of Technology in Szczecin, we investigated the influence of exogenous growth regulators, i.e. indole-3-butyric acid (IBA and 6-benzylaminopurine (BAP and their mixture, on the activity of gas exchange and selected physiological features of soybeans (Glycine max L. Merr.. The experimental factors included the following Polish soybean cultivars: ‘Aldana’, ‘Progres’ and ‘Jutro’. During plant growth, CO2 assimilation (A, transpiration rate (E, stomatal conductance (gs, and substomatal CO2 concentration (ci were determined. Two soybean cultivars, i.e. ‘Jutro’ and ‘Progres’, showed a significant increase in the intensity of assimilation and transpiration after using all kinds of growth regulators as compared with the control plants. It was found that the ‘Jutro’ cultivar, after using a mixture of growth regulators (IBA + BAP, was characterized by the significantly highest CO2 assimilation (A and transpiration (E as well as the highest stomatal conductance (gs. The ‘Aldana’ cultivar, on the other hand, responded by a significant reduction in the transpiration rate, stomatal conductance and subsomatal CO2 concentration. The spraying of the plants with exogenous growth regulators had a significant influence on the increase in the number of stomata and stomatal pore length, mostly on the lower epidermis of the lamina. It was also found that plants from the ‘Jutro’ and ‘Aldana’ cultivars sprayed with IBA and IBA + BAP were characterized by the highest yield, as compared with the control plants. In the case of the ‘Jutro’ cultivar, after using the growth regulators, a positive correlation was observed between the assimilation and transpiration rates and the length of stomata, which in consequence produced increased yields.

  7. Effect of gamma irradiation on microbial load, physicochemical and sensory characteristics of soybeans (Glycine max L. Merrill)

    International Nuclear Information System (INIS)

    Yun Juan; Li Xihong; Fan Xuetong; Tang Yao; Xiao Yao; Wan Sen


    Gamma irradiation is highly effective in inactivating microorganisms in various foods and offers a safe alternative method of food decontamination. In the present study, soybeans (Glycine max L. Merrill) were treated with 0, 1.0, 3.0, 5.0 and 10.0 KGy of gamma irradiation. Microbial populations on soybeans, isoflavone, tocopherol contents, raffinose family oligosaccharides, color and sensory properties were evaluated as a function of irradiation dose. The results indicated that gamma irradiation reduced aerobic bacterial and fungal load. Irradiation at the doses applied did not cause any significant change (p>0.05) in the contents of isoflavone of soybeans, but decreased tocopherol contents. The content of key flatulence-producing raffinose family oligosaccharides in irradiated soybeans (10.0 kGy) decreased by 82.1% compared to the control. Sensory analysis showed that the odor of the soybeans was organoleptically acceptable at doses up to 5.0 kGy and no significant differences were observed between irradiated and nonirradiated samples in flavor, texture and color after irradiation. - Highlights: ► The objective of this study concerns the elimination of microbial load factors at different radiation dose (0.0, 1.0, 3.0, 5.0 and 10.0 kGy). ► Investigated the degradation of the gamma irradiation on the reduction of flatulence-causing. ► Indicated the effect of irradiation on the isoflavone and tocopherol contents of the soybeans. ► Evaluated the effect of the gamma irradiation on the sensory properties of soybeans.


    Directory of Open Access Journals (Sweden)

    Mónica Beatriz Barrios


    Full Text Available La soja es el principal cultivo en Argentina debido a su adaptación a los suelos, la incorporación de tecnología con el empleo de la siembra directa y el precio del mercado internacional. Las propiedades físicas, químicas y biológicas de cada suelo se ven modificadas por el tipo de sistema de laboreo empleado. El entorno generado por la labranza altera el crecimiento y el equilibrio funcional de los cultivos herbáceos. En el año 2006, se instaló un ensayo en el Partido de Ezeiza (Pampa Ondulada, con el objetivo de evaluar los efectos del sistema de laboreo en el equilibrio funcional entre biomasa de raíces/biomasa total en soja (Glycine max durante la campaña 2012/2013. Se utilizó un diseño de bloques completos al azar con dos tratamientos que consistieron en: labranza convencional (LC y siembra directa (SD, con cuatro repeticiones. Se midió: peso de biomasa aérea, área foliar, rendimiento en grano, peso de raíces de 0-10 y 10-20 cm de profundidad, y se calculó biomasa total y la relación biomasa de raíces/biomasa total. El peso de raíces se determinó con el método del cilindro, el área foliar con el paquete estadístico Iproplus y el rendimiento con el cuadrado de corte. Los datos obtenidos fueron sometidos a análisis de varianza y las medias de los tratamientos fueron comparadas según Tukey (P < 0.05. El efecto del sistema de labranza generó diferentes respuestas en función de la variable evaluada y la fecha de muestreo. LC resultó significativamente superior (P < 0.05 respecto a SD en biomasa total y biomasa aérea en las etapas fenológicas R3 y R5; biomasa de raíces en R1 y R3; IAF en R2, R3 y R5. El rendimiento en grano fue mayor en LC respecto de SD, sin embargo el sistema de labranza no afectó la relación biomasa de raíz/biomasa total.

  9. Jasmonic acid Modulates the Physio-Biochemical Attributes, Antioxidant Enzyme Activity and Gene Expression in Glycine max under Nickel Toxicity

    Directory of Open Access Journals (Sweden)

    Geetika eSirhindi


    Full Text Available In present study, we evaluated the effects of Jasmonic acid (JA on physio-biochemical attributes, antioxidant enzyme activity and gene expression in soybean (Glycine max L. plants subjected to nickel (Ni stress. Ni stress decreases the shoot and root length and chlorophyll content by 37.23%, 38.31% and 39.21% respectively over the control. However, application of JA was found to improve the chlorophyll content and growth of Ni-stressed seedlings in terms of root and shoot length. Plants supplemented with Jasmonate restores the chlorophyll fluorescence, which was disturbed by Ni stress. The present study demonstrated increase in proline, glycinebetaine, total protein and total soluble sugar (TSS by 33.09%, 51.26%, 22.58% and 49.15% respectively under Ni toxicity as compared to control. Supplementation of JA to Ni stressed plants further enhanced the above parameters. Ni stress increases hydrogen peroxide (H2O2 by 68.49%, lipid peroxidation (MDA by 50.57% and NADPH oxidase by 50.92% over the control. Supplementation of JA minimizes the accumulation of H2O2, MDA and NADPH oxidase, which helps in stabilization of biomolecules. The activities of superoxide dismutase (SOD, peroxidase (POD, catalase (CAT and ascorbate peroxidase (APX increases by 40.04%, 28.22%, 48.53% and 56.79% respectively over the control in Ni treated seedlings and further enhancement in the antioxidant activity was observed by the application of JA. Ni treated soybean seedlings showed increase in expression of Fe-SOD by 77.62%, CAT by 15.25%, POD by 58.33% and APX by 80.58% over the control. Nevertheless, application of JA further enhanced the expression of the above genes in the present study. Our results signified that Ni stress caused negative impacts on soybean seedlings, but, co-application of JA facilitate the seedlings to combat the detrimental effects of Ni through enhanced osmolytes and osmoprotectants, antioxidant enzyme activity and gene expression.

  10. Molecular cloning, characterization and expression analysis of two members of the Pht1 family of phosphate transporters in Glycine max.

    Directory of Open Access Journals (Sweden)

    Zhaoyun Wu

    Full Text Available BACKGROUND: Phosphorus is one of the macronutrients essential for plant growth and development. The acquisition and translocation of phosphate are pivotal processes of plant growth. In a large number of plants, phosphate uptake by roots and translocation within the plant are presumed to occur via a phosphate/proton cotransport mechanism. PRINCIPAL FINDINGS: We cloned two cDNAs from soybean (Glycine max, GmPT1 and GmPT2, which show homology to the phosphate/proton cotransporter PHO84 from the budding yeast Saccharomyces cerevisiae. The amino acid sequence of the products predicted from GmPT1 and GmPT2 share 61% and 63% identity, respectively, with the PHO84 in amino acid sequence. The deduced structure of the encoded proteins revealed 12 membrane-spanning domains with a central hydrophilic region. The molecular mass values are ∼58.7 kDa for GmPT1 and ∼58.6 kDa for GmPT2. Transiently expressed GFP-protein fusions provide direct evidence that the two Pi transporters are located in the plasma membrane. Uptake of radioactive orthophosphate by the yeast mutant MB192 showed that GmPT1 and GmPT2 are dependent on pH and uptake is reduced by the addition of uncouplers of oxidative phosphorylation. The K(m for phosphate uptake by GmPT1 and GmPT2 is 6.65 mM and 6.63 mM, respectively. A quantitative real time RT-PCR assay indicated that these two genes are expressed in the roots and shoots of seedlings whether they are phosphate-deficient or not. Deficiency of phosphorus caused a slight change of the expression levels of GmPT1 and GmPT2. CONCLUSIONS: The results of our experiments show that the two phosphate transporters have low affinity and the corresponding genes are constitutively expressed. Thereby, the two phosphate transporters can perform translocation of phosphate within the plant.

  11. Efecto de la morfología de los embriones somáticos en la regeneración de plantas de soya (Glycine max L. Merrill)


    Pérez-Pérez, Jorge L.; García-Rodríguez, Lourdes; Veitía-Rodríguez, Novisel; Bermúdes-Caraballoso, Idalmis; Collado-López, Raúl; Torres-Rodríguez, Damaris


    Los protocolos establecidos para la regeneración de plantas vía embriogénesis somática en soya (Glycine max L. Merrill), son específicos para un número reducido de cultivares, lo que requiere de nuevos estudios que permitan disponer de protocolos más eficientes y reproducibles en un mayor número de genotipos. Este trabajo tuvo como objetivo determinar el efecto del tipo de morfología de los embriones somáticos en la germinación y conversión a planta en soya cultivar ʻIncasoy-27ʼ. Se emplearon...

  12. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress


    Bilal, Saqib; Khan, Abdul L.; Shahzad, Raheem; Asaf, Sajjad; Kang, Sang-Mo; Lee, In-Jung


    This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum, Paecilomyces formosus, Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean) in response to dose-dependent increases in soil Ni (0.5, 1.0, and ...

  13. Identification of Alternaria alternata Mycotoxins by LC-SPE-NMR and Their Cytotoxic Effects to Soybean (Glycine max Cell Suspension Culture

    Directory of Open Access Journals (Sweden)

    Edson Rodrigues-Filho


    Full Text Available This present work describes the application of liquid chromatograpy-solid phase extraction-nuclear magnetic resonance spectroscopy to analyse Alternaria alternata crude extracts. Altenusin (1, alternariol (2, 3'-hydroxyalternariol monomethyl ether (3, and alternariol monomethyl ether (4, were separated and identified. High-resolution mass spectrometry confirmed the proposed structures. The cytotoxic effects of these compounds towards plants were determined using soybean (Glycine max cell cultures as a model. EC50 values which range from 0.11 (±0.02 to 4.69 (±0.47 μM showed the high cytotoxicity of these compounds.

  14. Desenvolvimento, partição de assimilados e produção de matéria seca de plantas de soja (Glycine max (L. merrill submetidas a quatro doses de metribuzin Development,assimilate partition and dry matter production in soybean (Glycine max (L. merrill plants treated with four doses of metribuzin

    Directory of Open Access Journals (Sweden)

    P. J. Silva Neto


    Full Text Available O desenvolvimento, a partição e a produção de matéria seca, foram estudados em soja (Glycine Max (L. Merri ll, cv. 'Uberaba', cultivadas em condições de campo, sob quatro doses de metribuzin - (0,0; 0,35; 0,70 e 1,05 kg i.a. ha-1. O metri buzin não reduziu a população e nem alterou significativamente a razão parte aérea/sistema radicular. A altura média das plantas aumentou significativamente com o incremento das doses de metribuzin, sendo que as alturas máximas das plantas foram 761, 784, 815 e 812 mm, em ordem crescente de dose de metribuzin. As variações das taxas de acúmulo de matéria seca foram nitida mente seqüenciais em todos os tratamentos, ocorrendo mudanças do dreno metabólico preferencial de um órgão para outro, de acordo com as transformações morfológicas das plantas, ressaltando-se que o metribuzin não alterou esse comportamento. Os tratamentos não influencia ramo acumulo de matéria seca das vagens (Wv, no entanto, a partir do inicio da maturação, as plantas-controle apres entaram maiores Wv, provavelmente, devido a maior taxa assi milatória líquida verificada a partir da floração plena. A matéria seca acumulada nos pericarpos (Wp diminuiu, a partir das sementes completamente desenvolvid os, para todos os tratamentos com exceção de Wp das plantas tratadas com 0,7 kg i.a. ha-1 de metribuzin que, manteve-se estável. Por outro lado, a matéria seca nas sementes (Ws aumentou de forma acentuada, desde o seu aparecimento até a colheita final , em todas as doses do herbicida.Development, assimlate partition and dry matter production in soybean (Glycine Max (L. Merri ll, cv. Uberaba plants treat ed with four metri buzin doses (0,0; 0,35; 0,70 and 1,05 kg i.a.ha-1 were studied in a field experiment. Metribuzin did not reduce the stand or alter ed significantly shoot /root ratio. Plants height average incre ased as the doses of metribuzin increased; maximum heights were 761, 784, 815 and 812 mm, for

  15. Efeito do metribuzin no controle das plantas daninhas e na produção de grãos em Glycine max (L merrill Effect of metribuzin in weed control and yield of Glycine max (L. merrill

    Directory of Open Access Journals (Sweden)

    J. P. Silva Neto


    Full Text Available No ano agrícola 1985/ 86, em Viçosa-MG, foi instalado um ensaio de campo em solo Pdzólico Vermelho-Amarelo argiloso e com 2,9% de matéria orgânica, objetivando estudar o efeito das doses de metribuzin (0,0; 0,35; 0,70 e 1,05 kg i.a.ha-1 no controle de plantas daninhas e na produtividade da soja (Geycine max (L. Merri ll, cv. 'Uber aba'. A maioria das monocotiledôneas que ocorreram na area experimental foi represent ada por Cyperus rotundus L., Brachiaria plantaginea (Link Hitch. e Cynodon dactylon (L. Pers., tendo-se verificado somente redução em Brachiaria planta taginea em virtude do aumento das doses de metribuzin, ocorrendo o mesmo com relação às dicotiledôneas que se fizerem presentes no experimento, com exceção de Oxalis Oxyptera Prop., que não foi controlada nas doses utilizadas. A densidade total médias das invasoras, menos Cyperus rotundus , Oxalis oxyptera e Cynodon dactylon, foi de 141; 124; 62 e 59 plantas . m-2, respectivamente, para as doses de 0,0; 0,35 ; 0,70 e 1,05 kg i.a.ha-1 de metribuzin. A dose de 0,35 kg i.a. de metribuzin.ha-1 foi suficiente para promover a redução da matéria seca da parte aérea das plantas daninhas com a mesma eficiência de controle da dose de 1,05 kg i.a .ha-1 Entretanto, a densidade total médil das invasoras foi reduzida sig nificativamente nas doses de 0,70 e 1,05 kg i.a. de metribuzin.ha-l. O efeito do metribuzin na soja foi evidenciado somente na dose de 1,05 kg i.a.ha-1, com injúria foliar (clorose leve ocorrida até 25 dias, aproximadamente, apôs a emergência das plântulas. Após esse período, houve total recuperação de todas as plantas de soja submetidas a essa dose. A produção de grão se o índice de colheita não foram influencia dos significativamente pelas doses de metribuzin.In order to test doses of metribu zin (0,0; 0,35; 0,70 and 1,05 kg a.i.ha ¹ in weed control and yield of soybe an (Glycine max (L. Merri ll, Uberaba, an experiment was conducted under

  16. Seleccion de cepas de rizobios en suelos promisorios para el cultivo de la soya (Glycine max (L Merril en Colombia

    Directory of Open Access Journals (Sweden)

    Sylvester Bradley Rosemary


    Full Text Available En el invernadero se evaluó la efectividad de las cepas preseleccionadas de B. japonicum (CIAT 199,209,3778,3874 y 3876 de la recomendada (CIAT51 y una de Rhizobium spp (CIAT 3779. En el suelo Fluventic Haplustoll, de reacción casi neutra, se presentó respuesta altamente significativa a la inoculación. El tratamiento fertilizado con 150 kg de N/ha produjo el mayor rendimiento de N. Las cepas más efectivas fueron CIAT 3778 y 51, que también presentaron el mayor indice de efectividad a la inoculación (IEI. En el suelo Typic Pellustert,de reacción alcalina, se presentó respuesta significativa a la inoculación. El mayor rendimiento de N se obtuvo con las cepas CIAT 3778 y 51, que fueron además estadísticamente iguales a las cepas CIAT 199 y 3876 en cuanto al IEI. En el suelo Arenic Haplustalf, de reacción ligeramente ácida, hubo respuesta altamente significativa a la inoculación y la cepa más efectiva fue la CJAT 199. En el suelo Fluventic Ustropept, de reacci6n ligeramente ácida, se presentaron diferencias significativas entre los tratamientos inoculados. El mayor rendimiento de N se presentó en el tratamiento fertilizado con N. Las mejores cepas fueron CIAT 3778,3779 y 209. En el suelo Vertic Ustropept, de reacción alcalina, se presentó respuesta altamente significativa a la inoculación. En cuanto al rendimiento de N no se encontraron diferencias entre el tratamiento fertilizado con N y las cepas CIAT 51, 209 y CIAT 3778, siendo también las más efectivas en cuanto al IEI, junto oon la cepa CIAT 199. En los suelos Tropentic Haplorthox y Typic Tropudult no se enoontró respuesta a la inoculación.Screening of Rhizobium strains in soils apt for soybean (Glycine max (L Merril cultivation in Colombia. Under greenhouse conditions were evaluated the effectivity of the preselected strains of the preselected strains of B. japonicum (CIAT 199, 209, 3778, 3874 and 3876, in addition to the recommended strain (CIAT 51 and one of

  17. Manganese (Mn) stress toward hyperaccumulators plants combination (HPC) using Jatropha curcas and lamtoro gung (L. leucocephala) in mychorrizal addition on soybean (Glycine max) seedling stage (United States)

    Darmawan, Tania Sylviana; Zahroh, Tata Taqiyyatuz; Merindasya, Mirza; Masfaridah, Ririn; Hartanti, Dyah Ayu Sri; Arum, Sekar; Nurhatika, Sri; Muhibuddin, Anton; Surtiningsih, Tini; Arifiyanto, Achmad


    Heavy metals were a metal bracket which had a specific gravity greater than 5 g / cm3. Manganese was one of them because it has a specific gravity of 7.4 g / cm3. Together with widespread cases of soil contamination caused by heavy metals as well as increased development of the science of breeding ground rapidly, then the alternative rehabilitation techniques were relatively cheap and effective it needs to be developed and even some cases of contaminated management soil using a combination of plants with microorganisms to be more effective. Thus it was necessary to develop research on plants that were able to accumulate heavy metals and other toxic materials, such as Mn so that the land becomes safe for health and the environment. Based on above reason this research aimed to see the influence of hyperaccumulators combination of plants using Jatropha curcas and lamtoro gung (L. leucocephala) in mychorrizal addition to stressed by manganese (Mn) on soybean (Glycine max). Observations of growth, chlorophyll content and heavy metals analysis performed on nine treatments (P1-P9) and one control (P0). The results showed a combination of hyperaccumulators under mychorrizal helped overcome the stress of manganese (Mn) in the leaves of soybean (G. max). It gave an influence on the number of leaves and chlorophyll content of soybean (G. max), but no effect performed on the height and the roots of soybean (G. max). The use of plants in small amounts hyperaccumulators (P1;1 jatropha and 1 lamtoro) was sufficient to cope with stress of Mn in the leaves of soybean (G. max).

  18. Protective effect of Mn(III)-desferrioxamine B upon oxidative stress caused by ozone and acid rain in the Brazilian soybean cultivar Glycine max "Sambaiba". (United States)

    Esposito, Jéssica Bordotti Nobre; Esposito, Breno Pannia; Azevedo, Ricardo Antunes; Cruz, Luciano Soares; da Silva, Luzimar Campos; de Souza, Silvia Ribeiro


    This study aimed to investigate the effects of the Mn complex (Mn(III)-desferrioxamine B (MnDFB)) on oxidative stress in the Brazilian soybean cultivar Glycine max "Sambaiba" following exposure to ozone and acid rain. We determined the suitable dose of MnDFB to apply to G. max seedlings using a dose-response curve. The highest superoxide dismutase (SOD) activity and Mn content in leaves were found upon the application of 8 μM MnDFB. Thus, G. max seedlings pretreated with 8 μM MnDFB were individually exposed to ozone and acid rain simulated. Pretreatment with MnDFB reduced lipid peroxidation upon ozone exposure and increased SOD activity in leaves; it did not alter the metal content in any part of the plant. Conversely, following acid rain exposure, neither the metal content in leaves nor SOD enzyme activity were directly affected by MnDFB, unlike pH. Our findings demonstrated that exogenous MnDFB application before ozone exposure may modulate the MnSOD, Cu/ZnSOD, and FeSOD activities to combat the ROS excess in the cell. Here, we demonstrated that the applied dose of MnDFB enhances antioxidative defenses in soybean following exposure to acid rain and especially to ozone.

  19. Effects of enhanced UVB on growth and yield of alfalfa (Medic ago Sativa L.) and soybean (Glycine max L.) under field conditions

    International Nuclear Information System (INIS)

    Al-Oudat, M.; Baydoun, S.A.; Mohamad, A.


    The effects of 20% increase of UVB on growth and yield of alfalfa (Medicago Sativa L.) and two cultivars of soybean (Glycine Max (L.) Mer) under field conditions have been investigated. The increase of UVB dose ranged between 1.746 and 7.112 J/cm 2 during experiment. The results showed that soybean yield decrease by 16% and 31% in A. 3803 and A. 2522 cultivars respectively, under UVB exposure. The dry weight and leaf area were sensitive in the A. 3803 cultivar, while they were tolerant in the A. 2522 cultivar. Alfalfa response to UVB varied during the different stages of growth, whereas the yield was 12% less in the exposed plants. (author). 21 refs., 17 tabs

  20. Analysis and modeling of dry matter production rate by soybean [Glycine max] community: Curvilinear response to radiation intensity

    International Nuclear Information System (INIS)

    Sameshima, R.


    The linear relationship between the amount of absorbed radiation and dry matter production by crop communities has long been known, and the proportionality constant between them is known as the radiation use efficiency (RUE). To analyze and predict crop production using RUE, the assumption is often made that RUE is not sensitive to radiation intensity and that dry matter production rate (DMPR) is a linear function of radiation intensity.However, there is evidence in opposition to this assumption, including reports of increasing RUE in shade tests, and hyperbolic response of photosynthetic rate to radiation intensity. The following model was developed and used to analyze the response of DMPR and RUE to daily radiation R S : DMPR = DMPR max (R S ) * g(α) where DMPR max (R S ) is the DMPR of a hypothetical soybean community absorbing all radiation, and g(α) represents the effect of radiation absorptivity (α). A hyperbolic curve and a straight line were employed for DMPR max (R S ) and g(α), respectively. Field experimental data including shade tests were used to determine the parameters for the model. Two sets of parameters were required to cover the entire experimental period. DMPR max (R S ) had an apparent curvilinear relationship with R S . The model successfully described dry matter production under successive low radiation conditions, which could not be estimated by a model with RUE insensitive to radiation. (author)

  1. Genome-wide comparative in silico analysis of the RNA helicase gene family in Zea mays and Glycine max: a comparison with Arabidopsis and Oryza sativa. (United States)

    Xu, Ruirui; Zhang, Shizhong; Huang, Jinguang; Zheng, Chengchao


    RNA helicases are enzymes that are thought to unwind double-stranded RNA molecules in an energy-dependent fashion through the hydrolysis of NTP. RNA helicases are associated with all processes involving RNA molecules, including nuclear transcription, editing, splicing, ribosome biogenesis, RNA export, and organelle gene expression. The involvement of RNA helicase in response to stress and in plant growth and development has been reported previously. While their importance in Arabidopsis and Oryza sativa has been partially studied, the function of RNA helicase proteins is poorly understood in Zea mays and Glycine max. In this study, we identified a total of RNA helicase genes in Arabidopsis and other crop species genome by genome-wide comparative in silico analysis. We classified the RNA helicase genes into three subfamilies according to the structural features of the motif II region, such as DEAD-box, DEAH-box and DExD/H-box, and different species showed different patterns of alternative splicing. Secondly, chromosome location analysis showed that the RNA helicase protein genes were distributed across all chromosomes with different densities in the four species. Thirdly, phylogenetic tree analyses identified the relevant homologs of DEAD-box, DEAH-box and DExD/H-box RNA helicase proteins in each of the four species. Fourthly, microarray expression data showed that many of these predicted RNA helicase genes were expressed in different developmental stages and different tissues under normal growth conditions. Finally, real-time quantitative PCR analysis showed that the expression levels of 10 genes in Arabidopsis and 13 genes in Zea mays were in close agreement with the microarray expression data. To our knowledge, this is the first report of a comparative genome-wide analysis of the RNA helicase gene family in Arabidopsis, Oryza sativa, Zea mays and Glycine max. This study provides valuable information for understanding the classification and putative functions of


    Directory of Open Access Journals (Sweden)

    S.M. Sitompul


    Full Text Available Field studies were conducted in two years using 638 F2 and 1185 F3 lines of selected 16 F1 and 15 F2 parent lines (³80 pods plant-1 to evaluate pod number and CO2 exchange rate (CER as selection criteria. Pod and seed number, and seed weight of individual lines were observed during harvesting time, and CER of randomly selected 32 F2 and 30 F3 lines was measured at initial seed filling stage. The selection of F2 lines based on pod number to generate F3 lines increased the average of seed yield by 39%, and pod number by 77% in F3 lines compared with F2 lines. A close relationships was found between seed weight and pod or seed number per plant. Net CER responded sensitively to a reduction of light in a short-term and showed 78% of F2 lines and all F3 lines with maximum CER (Pmax³20 mmolCO2.m-2.s-1. The ratio of pod number per plant and Pmax varied between lines and were used to group lines resulting in close relationships between Pmax and pod number. It is concluded that the use of pod number and CER (Pmax as selection criteria offers an alternative approach in soybean breeding for high yield.

  3. Analysis of Gene expression in soybean (Glycine max roots in response to the root knot nematode Meloidogyne incognita using microarrays and KEGG pathways

    Directory of Open Access Journals (Sweden)

    Gamal El-Din Abd El Kader Y


    Full Text Available Abstract Background Root-knot nematodes are sedentary endoparasites that can infect more than 3000 plant species. Root-knot nematodes cause an estimated $100 billion annual loss worldwide. For successful establishment of the root-knot nematode in its host plant, it causes dramatic morphological and physiological changes in plant cells. The expression of some plant genes is altered by the nematode as it establishes its feeding site. Results We examined the expression of soybean (Glycine max genes in galls formed in roots by the root-knot nematode, Meloidogyne incognita, 12 days and 10 weeks after infection to understand the effects of infection of roots by M. incognita. Gene expression was monitored using the Affymetrix Soybean GeneChip containing 37,500 G. max probe sets. Gene expression patterns were integrated with biochemical pathways from the Kyoto Encyclopedia of Genes and Genomes using PAICE software. Genes encoding enzymes involved in carbohydrate and cell wall metabolism, cell cycle control and plant defense were altered. Conclusions A number of different soybean genes were identified that were differentially expressed which provided insights into the interaction between M. incognita and soybean and into the formation and maintenance of giant cells. Some of these genes may be candidates for broadening plants resistance to root-knot nematode through over-expression or silencing and require further examination.

  4. Effect of sheep manure and phosphorus application on growth, yield, and N2 - fixation of inoculated soybean (Glycine max (L.) Merr) grown on Syrian arid soils using the 15N isotopic dilution technique

    International Nuclear Information System (INIS)

    Khalifa, Kh.; Al-Ain, F.; Al-Shamma'a, M.


    A field experiment was carried out in Syrian arid soils at Deir Al-Hajar research station to study the effect of different rates of sheep manure (0, 20, and 40 ton/ha) and levels of P- fertilizer (0, 40 and 80 kg P 2 O 5 /ha) on dry matter production and N 2 fixation by Soybean [(Glycine max) (SB171 variety)], of which seeds were inoculated by Bradyrhizobium japonicum-FA3 bacterial. Sorghum bicolor L. was employed as a reference crop ti evaluate N 2 -fixation using the 15 N-isotope dilution technique. In general, results indicated that, a positive effects were found to adding Sheep Manure or P-fertilizer on D.M production in different plants parts of soybean (shoots, roots, pods). This effect was more pronounced when adding sheep manure and phosphorus together especially under the optimum M40P80 treatment. Quantity of N-fixed by Soybean responds positively to sole application of Sheep Manure or P-fertilizer. Moreover, the optimum combined treatment showed significant increases in the quantity of nitrogen derived from the atmosphere (Qndfa), which were (3.29, 25.54, 53.49 kg N/ha) in roots, shoots, and pods respectively. P-fertilization resulted in a significant increase in the percentage of nitrogen use efficiency (NUE) with increasing phosphorus levels added to Sorghum plants; However, an adverse effect was noticed for the NUE when using sheep manure solely or in combination with P-fertilizer. (author)

  5. Evaluation of constitutive iron reductase (AtFRO2 expression on mineral accumulation and distribution in soybean (Glycine max. L

    Directory of Open Access Journals (Sweden)

    Marta Wilton Vasconcelos


    Full Text Available Iron is an important micronutrient in human and plant nutrition. Adequate iron nutrition during crop production is central for assuring appropriate iron concentrations in the harvestable organs, for human food or animal feed. The whole-plant movement of iron involves several processes, including the reduction of ferric to ferrous iron at several locations throughout the plant, prior to transmembrane trafficking of ferrous iron. In this study, soybean plants that constitutively expressed the AtFRO2 iron reductase gene were analyzed for leaf iron reductase activity, as well as the effect of this transgene's expression on root, leaf, pod wall, and seed mineral concentrations. High Fe supply, in combination with the constitutive expression of AtFRO2, resulted in significantly higher concentrations of different minerals in roots (K, P, Zn, Ca, Ni, Mg and Mo, pod walls (Fe, K, P, Cu and Ni, leaves (Fe, P, Cu, Ca, Ni and Mg and seeds (Fe, Zn, Cu and Ni. Leaf and pod wall iron concentrations increased as much as 500% in transgenic plants, while seed iron concentrations only increased by 10%, suggesting that factors other than leaf and pod wall reductase activity were limiting the translocation of iron to seeds. Protoplasts isolated from transgenic leaves had three-fold higher reductase activity than controls. Expression levels of the iron storage protein, ferritin, were higher in the transgenic leaves than in wild-type, suggesting that the excess iron may be stored as ferritin in the leaves and therefore unavailable for phloem loading and delivery to the seeds. Also, citrate and malate levels in the roots and leaves of transgenic plants were significantly higher than in wild-type, suggesting that organic acid production could be related to the increased accumulation of minerals in roots, leaves and pod walls, but not in the seeds. All together, these results suggest a more ubiquitous role for the iron reductase in whole-plant mineral accumulation and

  6. Characterization and molecular modeling of Inositol 1,3,4 tris phosphate 5/6 kinase-2 from Glycine max (L) Merr.: comprehending its evolutionary conservancy at functional level. (United States)

    Marathe, Ashish; Krishnan, Veda; Mahajan, Mahesh M; Thimmegowda, Vinutha; Dahuja, Anil; Jolly, Monica; Praveen, Shelly; Sachdev, Archana


    Soybean genome encodes a family of four inositol 1,3,4 trisphosphate 5/6 kinases which belong to the ATP-GRASP group of proteins. Inositol 1,3,4 trisphosphate kinase-2 ( GmItpk2 ), catalyzing the ATP-dependent phosphorylation of Inositol 1,3,4 trisphosphate (IP3) to Inositol 1,3,4,5 tetra phosphate or Inositol 1,3,4,6 tetra phosphate, is a key enzyme diverting the flux of inositol phosphate pool towards phytate biosynthesis. Although considerable research on characterizing genes involved in phytate biosynthesis is accomplished at genomic and transcript level, characterization of the proteins is yet to be explored. In the present study, we report the isolation and expression of single copy Itpk 2 (948 bp) from Glycine max cv Pusa-16 predicted to encode 315 amino acid protein with an isoelectric point of 5.9. Sequence analysis revealed that Gm ITPK2 shared highest similarity (80%) with Phaseolus vulgaris. The predicted 3D model confirmed 12 α helices and 14 β barrel sheets with ATP-binding site close to β sheet present towards the C-terminus of the protein molecule. Spatio-temporal transcript profiling signified GmItpk2 to be seed specific, with higher transcript levels in the early stage of seed development. The present study using various molecular and bio-computational tools could, therefore, help in improving our understanding of this key enzyme and prove to be a potential target towards generating low phytate trait in nutritionally rich crop like soybean.

  7. Metabolism of 7-14C-2,3,5 triodobenzoic acid (TIBA) in soybeans plant (Glycine max)

    International Nuclear Information System (INIS)

    Sant'Anna, R.; Ohlrogge, A.J.; Christian, J.E.


    A metabolic study was done in mature seeds of field grown soybeans sprayed with 7- 14 C-2,3,5 triiodobenzoic acid (TIBA) at the onset of flowering. Seed extraction with 95% alcohol yielded only 65% of the total radioactivity present. No further studies were performed on the ethanol insoluble fraction. Upon acid base purification of the 14 C seed extracts, the ether phase (pH 9,0) contained about 70% of the activity suggesting the existence of a low polarity compound(s). Acid hydrolysis of the alcoholic extracts increased the radioactivity in the ether soluble fraction, while the basic treatment decreased it about the same level as for free TIBA. The latter behaviour seemed to indicate hydrolysis of a conjugation product(s). Alumina column chromatography was unsuccessful for separating the oil-activity combination; however, three radioactive peaks were obtained. The first two peaks degrated to form the last one, which coincided with the TIBA peak. When the alcoholic extracts were run in a Sephadex LH-20 column, oils, proteins and pigments separated from the radioactivity. Two main peaks appeared for the 14 C seeds extracts. Peak I was essentially unaltered when it was co-cromatographed with the standard 14 C-TIBA, peak II was indistinguishable from the TIBA peak. Although the work did not reach the final stage of caracterization, postulation was made for a conjugate nature of the ester type for peak I and the correspondence of peak II with free TIBA or TIBA in mixture with related compounds, such as 2,5 DIBA and 3,5 DIBA, products of its deiodination [pt

  8. Population-specific gene expression in the plant pathogenic nematode Heterodera glycines exists prior to infection and during the onset of a resistant or susceptible reaction in the roots of the Glycine max genotype Peking

    Directory of Open Access Journals (Sweden)

    Alkharouf Nadim W


    Full Text Available Abstract Background A single Glycine max (soybean genotype (Peking reacts differently to two different populations of Heterodera glycines (soybean cyst nematode within the first twelve hours of infection during resistant (R and susceptible (S reactions. This suggested that H. glycines has population-specific gene expression signatures. A microarray analysis of 7539 probe sets representing 7431 transcripts on the Affymetrix® soybean GeneChip® were used to identify population-specific gene expression signatures in pre-infective second stage larva (pi-L2 prior to their infection of Peking. Other analyses focused on the infective L2 at 12hours post infection (i-L212h, and the infective sedentary stages at 3days post infection (i-L23d and 8days post infection (i-L2/L38d. Results Differential expression and false discovery rate (FDR analyses comparing populations of pi-L2 (i.e., incompatible population, NL1-RHg to compatible population, TN8 identified 71 genes that were induced in NL1-RHg as compared to TN8. These genes included putative gland protein G23G12, putative esophageal gland protein Hgg-20 and arginine kinase. The comparative analysis of pi-L2 identified 44 genes that were suppressed in NL1-RHg as compared to TN8. These genes included a different Hgg-20 gene, an EXPB1 protein and a cuticular collagen. By 12 h, there were 7 induced genes and 0 suppressed genes in NL1-RHg. By 3d, there were 9 induced and 10 suppressed genes in NL1-RHg. Substantial changes in gene expression became evident subsequently. At 8d there were 13 induced genes in NL1-RHg. This included putative gland protein G20E03, ubiquitin extension protein, putative gland protein G30C02 and β-1,4 endoglucanase. However, 1668 genes were found to be suppressed in NL1-RHg. These genes included steroid alpha reductase, serine proteinase and a collagen protein. Conclusion These analyses identify a genetic expression signature for these two populations both prior to and subsequently

  9. In silico characterization of 1,2-diacylglycerol cholinephosphotransferase and lysophospha-tidylcholine acyltransferase genes in Glycine max L. Merrill. (United States)

    Sousa, C S; Barros, B A; Barh, D; Ghosh, P; Azevedo, V; Barros, E G; Moreira, M A


    The enzymes 1,2-diacylglycerol cholinephosphotrans-ferase (CPT) and lysophosphatidylcholine acyltransferase (LPCAT) are important in lipid metabolism in soybean seeds. Thus, understand-ing the genes that encode these enzymes may enable their modification and aid the improvement of soybean oil quality. In soybean, the genes encoding these enzymes have not been completely described; there-fore, this study aimed to identify, characterize, and analyze the in silico expression of these genes in soybean. We identified two gene models encoding CPT and two gene models encoding LPCAT, one of which presented an alternative transcript. The sequences were positioned on the physical map of soybean and the promoter regions were analyzed. Cis-elements responsible for seed-specific expression and responses to biotic and abiotic stresses were identified. Virtual expression analysis of the gene models for CPT and LPCAT indicated that these genes are expressed under different stress conditions, in somatic embryos during differentiation, in immature seeds, root tissues, and calli. Putative ami-no acid sequences revealed the presence of transmembrane domains, and analysis of the cellular localization of these enzymes revealed they are located in the endoplasmic reticulum.

  10. Overexpression of Nictaba-Like Lectin Genes from Glycine max Confers Tolerance towards Pseudomonas syringae Infection, Aphid Infestation and Salt Stress in Transgenic Arabidopsis Plants

    Directory of Open Access Journals (Sweden)

    Sofie Van Holle


    Full Text Available Plants have evolved a sophisticated immune system that allows them to recognize invading pathogens by specialized receptors. Carbohydrate-binding proteins or lectins are part of this immune system and especially the lectins that reside in the nucleocytoplasmic compartment are known to be implicated in biotic and abiotic stress responses. The class of Nictaba-like lectins (NLL groups all proteins with homology to the tobacco (Nicotiana tabacum lectin, known as a stress-inducible lectin. Here we focus on two Nictaba homologs from soybean (Glycine max, referred to as GmNLL1 and GmNLL2. Confocal laser scanning microscopy of fusion constructs with the green fluorescent protein either transiently expressed in Nicotiana benthamiana leaves or stably transformed in tobacco BY-2 suspension cells revealed a nucleocytoplasmic localization for the GmNLLs under study. RT-qPCR analysis of the transcript levels for the Nictaba-like lectins in soybean demonstrated that the genes are expressed in several tissues throughout the development of the plant. Furthermore, it was shown that salt treatment, Phytophthora sojae infection and Aphis glycines infestation trigger the expression of particular NLL genes. Stress experiments with Arabidopsis lines overexpressing the NLLs from soybean yielded an enhanced tolerance of the plant towards bacterial infection (Pseudomonas syringae, insect infestation (Myzus persicae and salinity. Our data showed a better performance of the transgenic lines compared to wild type plants, indicating that the NLLs from soybean are implicated in the stress response. These data can help to further elucidate the physiological importance of the Nictaba-like lectins from soybean, which can ultimately lead to the design of crop plants with a better tolerance to changing environmental conditions.

  11. Microbial assisted phyto extraction of metals and growth of soybean (glycine max l. merrill) on industrial waste water contaminated soil

    International Nuclear Information System (INIS)

    Ali, I.; Bano, A.


    Pots experiments were made to investigate the role of effective microorganisms (EM) in improving phyto extraction of metals (Cd/sup +2/ and Mn/sup +2/) and growth of soybean plant in industrial waste water polluted soil. Waste water applications to soil were made in four different dilutions (i.e. 25%, 50%, 75% and 100%). Effective microorganisms were added into waste water prior to application. Effect of treatments on growth parameters was studied. The Cd/sup +2/ and Mn/sup +2/ concentrations in different parts of plant were measured by Atomic Absorption Spectrophotometer. Plant height significantly increased at all treatments except at 25% waste water treatment. Plant dry biomass and oil contents in seed significantly increased with all treatments compared to control but were higher at low concentration of waste water. Waste water treatments significantly increased the Cd and Mn accumulation in plant while inoculation of EM further enhanced the metals accumulation. The maximum accumulation of Cd and Mn found in plant treated with 100% waste water in combination with effective microorganisms. At harvest, the Cd/sup +2/ concentration decreased in leaves but increased in roots followed by stem > seeds, while, Mn/sup +2/ accumulation increased in leaves followed by roots > stem > seeds. Conclusively, EM enhanced the phyto extraction of Cd and Mn and also increased the oil contents in soybean on polluted soil. These findings suggest further investigation to find out a suitable concentration of industrial waste water in combination with EM for better growth of soybean and improving phyto extraction of metals. (author)

  12. Induced mutations for disease resistance and other agronomic characteristics in bean (Phaseolus vulgaris L.) and soybean (Glycine max (L.) Merrill)

    International Nuclear Information System (INIS)

    Tulmann Neto, A.; Menten, J.O.M.; Ando, A.; Alberini, J.; Peixoto, T.C.


    The present research project aims to induce mutations with resistance to Xanthomonas phaseoli (common blight) and golden mosaic virus (GMV) in bean and resistance to Phakopsora pachyrhizi (rust) and Brazilian bud blight in soybean. At the same time, other mutant types of interest were selected. Gamma rays and ethyl methane-sulphonate (EMS) were generally utilized as mutagenic agents and seeds of several cultivars from both crops were treated. The selection was made at the M 2 or M 3 generation, utilizing progeny or mixtures of seeds from bulk. Screening was carried out in the field, greenhouse or insectary (according to the disease). Priority was given to GMV in bean and about 235,850 plants were observed in the field and 67,500 in the insectary. Only one plant showing mild GMV symptoms was obtained. However, owing to negative pleiotropic effects, this mutant could not be used. Concerning the other diseases, there are some selected plants that still require better observation before reporting that progress has been made. With regard to other mutant types, earliness was obtained in soybean and a bush variety and an earlier mutant was selected in bean. This mutant has already been utilized by breeders in cross-breeding and is being multiplied to be experimentally utilized by farmers under special conditions of cultivation. In soybean, preliminary yield trials are under way, and include some of the early mutants obtained. (author). 26 refs, 20 tabs

  13. Comparison of fluoride effects on germination and growth of Zea mays, Glycine max and Sorghum vulgare. (United States)

    Fina, Brenda L; Lupo, Maela; Dri, Nicolas; Lombarte, Mercedes; Rigalli, Alfredo


    Fluorosis is a disease caused by over-exposure to fluoride (F). Argentina's rural lands have higher fluorine content than urban lands. Evidence confirms that plants grown in fluoridated areas could have higher F content. We compared F uptake and growth of crops grown in different F concentrations. The effect of 0-8 ppm F concentrations on maize, soybeans and sorghum germination and growth was compared. After 6 days seeding, the germination was determined, the roots and aerial parts lengths were measured, and vigor index was calculated. F content was measured in each part of the plants. Controls with equal concentrations of NaCl were carried out. Significant decrease in roots and aerial parts lengths, and in vigor index of maize and soybeans plants was observed with F concentrations greater than 2 ppm. This was not observed in sorghum seedlings. Also, the amount of F in all crops augmented as F increases, being higher in roots and ungerminated seeds. Sorghum was the crop with the highest F content. Fluoride decreased the germination and growth of maize and soybeans and therefore could influence on their production. Conversely, sorghum seems to be resistant to the action of F. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  14. Induced of plastid mutations in soybean plant (Glycine max L. Merrill) with gamma radiation and determination with RAPD

    International Nuclear Information System (INIS)

    Atak, Cimen; Alikamanoglu, Sema; Acik, Leyla; Canbolat, Yasemin


    The aim of our study was to induce with radiation of atrazine resistant and tolerated mutants in Coles, Amsoy-71 and 1937 soybean varieties. Atrazine that is photosynthetic inhibitor is the most important herbicide of S-triazin group, and shows toxic effect on soybean plant. For the improvement of the atrazine resistant plants with mutation breeding, the seeds belonging to the three varieties were irradiated with 200 Gy of gamma radiation dose. The irradiated seeds were sown in the field and at the end of harvesting season, every pod at node situated on the main stem was picked up separately and M 2 generations were obtained. At the plants, which were obtained from M 2 generation, chlorophyll mutants were determined and atrazine selection was made. The percentage of chlorophyll mutants for Amsoy-71, Coles and 1937 soybean varieties were found as 1.07, 1.48 and 1.32, respectively. At the end of atrazine selection, the percentages of atrazine resistant plants for Amsoy-71, Coles and 1937 soybean varieties were 0.80, 0.60 and 0.53, respectively. The percentages of atrazine tolerated plants were 1.07, 1.18 and 1.05, respectively as well. In our research; the differences among the mutants replying to atrazine in various concentrations were examined by using RAPD procedure as the molecular marker techniques in comparison with polymorphism. In the study done by using 14 primers; according to the amplification results, the differences between atrazine resistant plants were shown

  15. Effect of foliar application of chitosan and salicylic acid on the growth of soybean (Glycine max (L.) Merr.) varieties (United States)

    Hasanah, Y.; Sembiring, M.


    Elicitors such as chitosan and salicylic acid could be used not only to increase isoflavone concentration of soybean seeds, but also to increase the growth and seed yield. The objective of the present study was to determine the effects of foliar application of elicitor compounds (i.e. chitosan, and salicylic acid)on the growth of two soybean varieties under dry land conditions. Experimental design was a randomized block design with 2 factors and 3 replications. The first factor was soybean varieties (Wilis and Devon). The second factor was foliar application of elicitors consisted of without elicitor; chitosan at V4 (four trifoliate leaves are fully developed); chitosan at R3 (early podding); chitosan at V4 and R3; salicylic acid at V4; salicylic acid at R3 and salicylic acid at V4 and R3. Parameters observed was plant height at 2-7 week after planting (WAP), shoot dry weight and root dry weight. The results suggest that the Wilis variety had higher plant height 7 WAP than Devon. The foliar application of chitosan increased the plant height at 7 WAP, shoot dry weight and root dry weight. The foliar application of chitosan at V4 and R3 on Devon variety increased shoot dry weight.

  16. Estudo de competição inter e intraespecífica envolvendo Glycine max (L. Merril e Cyperus rotundus (L., em condições de casa de vegetação Inter and intraspecific competitions studies in Glycine max (L. merril and Cyperus rotundus L., in greenhouse conditions

    Directory of Open Access Journals (Sweden)

    R.A. Pitelli


    Full Text Available O presente experimento teve por objetivo estudar os efeitos da competição inter e intraespecífica envolvendo Glycine max (L. Merril e Cyperus rotundus L. sobre as características das plantas e acúmulos de N, P, K, Ca e Mg pelas espécies envolvidas. Para tanto, estipulou-se um tratamento em que se desenvolveram três plantas de Glycine max e outro em que se desenvolveram 3 tubérculos de Cyperus rotundus por vaso. Para estudar os efeitos da competição intraespecífica, em dois outros tratamentos dobraram-se as populações por vaso. No estudo da competição interespecífica permitiu-se o desenvolvimento de três plantas de Glycine max e de três tubérculos de Cyperus rotundus num mesmo vaso. De uma maneira geral, pôde-se observar que principalmente devido às diferenças no hábito de crescimento das duas espécies, a expressão da competição inter e intraespecífica, em cada uma delas, assume aspectos distintos. No caso de Cyperus rotundus, o efeito do dobro da densidade pôde ser compensado, em parte, pela maior produção de manifestações epígeas e de tubérculos, aliados ao maior desenvolvimento dos tubérculos na menor densidade de plantio. No caso da competição interespecífica, os resultados sugerem um efeito decisivo do sombreamento de Leguminosae sobre o comportamento da Cyperaceae. Os padrões de efeitos da competição pelos nutrientes foi determinado também pelas diferenças no recrutamento dos elementos do solo pelas espécies envolvidas.Inter and intraspecific competition studies envolving Glycine max (L. Merril and Cyperus rotundus L. were performed by measuring the effects on the growth and accumulation of N, P, K, Ca and Mg in the plants. The standard number of the plants per pot was three. In the interspecific competition plots three shoots of purple nutsedge and three plants of soybeans were cultivated per pot. In the intraspecific competition studies six shoots or plants per pot of C. rotundus or G. max were

  17. Glyphosate-tolerant soybeans remain compositionally equivalent to conventional soybeans (Glycine max L.) during three years of field testing. (United States)

    McCann, Melinda C; Liu, Keshun; Trujillo, William A; Dobert, Raymond C


    Previous studies have shown that the composition of glyphosate-tolerant soybeans (GTS) and selected processed fractions was substantially equivalent to that of conventional soybeans over a wide range of analytes. This study was designed to determine if the composition of GTS remains substantially equivalent to conventional soybeans over the course of several years and when introduced into multiple genetic backgrounds. Soybean seed samples of both GTS and conventional varieties were harvested during 2000, 2001, and 2002 and analyzed for the levels of proximates, lectin, trypsin inhibitor, and isoflavones. The measured analytes are representative of the basic nutritional and biologically active components in soybeans. Results show a similar range of natural variability for the GTS soybeans as well as conventional soybeans. It was concluded that the composition of commercial GTS over the three years of breeding into multiple varieties remains equivalent to that of conventional soybeans.

  18. Novel process of fermenting black soybean [Glycine max (L.) Merrill] yogurt with dramatically reduced flatulence-causing oligosaccharides but enriched soy phytoalexins. (United States)

    Feng, Shengbao; Saw, Chin Lee; Lee, Yuan Kun; Huang, Dejian


    Black soybeans [Glycine max (L.) Merrill] were germinated under fungal stress with food grade R. oligosporus for 3 days and were homogenized and fermented with lactic acid bacteria (LAB) to produce soy yogurt. Fungal stress led to the generation of oxylipins [oxooctadecadienoic acids (KODES) isomers and their respective glyceryl esters] and glyceollins--a type of phytoalexins unique to soybeans. In soy yogurt, the concentrations of total KODES and total glyceollins were 0.678 mg/g (dry matter) and 0.953 mg/g, respectively. The concentrations of other isoflavones (mainly genistein and daidzein and their derivatives) in soy yogurt remained largely unchanged after the processes compared with the control soy yogurt. Germination of black soybean under fungal stress for 3 days was sufficient to reduce stachyose and raffinose (which cause flatulence) by 92 and 80%, respectively. With a pH value of 4.42, a lactic acid content of 0.262%, and a maximum viable cell count of 2.1 x 10 (8) CFU/mL in the final soy yogurt, soy milk from germinated soybeans under fungal stress was concluded to be a suitable medium for yogurt-making. The resulting soy yogurt had significantly altered micronutrient profiles with significantly reduced oligosaccharides and enriched glyceollins.

  19. Antioxidative Defense Responses to lead-induced Oxidative Stress in Glycine max L. CV. Merrill grown in Different pH Gradient

    Directory of Open Access Journals (Sweden)

    Mishra, Pankaj Kishor


    Full Text Available Physiological and biochemical changes as well as the activities of anti-oxidative enzymes under lead (Pb2+ phytotoxicity were investigated in 20 days old soybean (Glycine max L. seedlings grown hydroponically in the laboratory under different pH conditions. The rapid uptake of Pb 2+ was observed immediately after the start of treatment. The quantity of accumulation of Pb2+ was much higher in roots than in shoots, its level rising with increasing pH from 3.0 to 8.0 . Not only that, an oxidative stress conditions were observed due to increased level of superoxide anion radical and hydrogen peroxide in shoots and root cells of 20 days old seedlings when treated with Pb(NO32 at a concentration of 0, 500, 1000 and 2000 μM. Spectrometric assays of seedlings showed increased level of activities of antioxidant enzymes like catalase, peroxidase and glutathione reductase. The presence of thiobarbituric acid reacting substances (TBARS indicates the enhanced lipid peroxidation compared to controls. The alteration in the activities of the antioxidant enzymes and the induction of lipid peroxidation reflects the presence of Pb2+, which may cause oxidative stress.

  20. A Novel Sucrose-Regulatory MADS-Box Transcription Factor GmNMHC5 Promotes Root Development and Nodulation in Soybean (Glycine max [L.] Merr.

    Directory of Open Access Journals (Sweden)

    Wei Liu


    Full Text Available The MADS-box protein family includes many transcription factors that have a conserved DNA-binding MADS-box domain. The proteins in this family were originally recognized to play prominent roles in floral development. Recent findings, especially with regard to the regulatory roles of the AGL17 subfamily in root development, have greatly broadened their known functions. In this study, a gene from soybean (Glycine max [L.] Merr., GmNMHC5, was cloned from the Zigongdongdou cultivar and identified as a member of the AGL17 subfamily. Real-time fluorescence quantitative PCR analysis showed that GmNMHC5 was expressed at much higher levels in roots and nodules than in other organs. The activation of expression was first examined in leaves and roots, followed by shoot apexes. GmNMHC5 expression levels rose sharply when the plants were treated under short-day conditions (SD and started to pod, whereas low levels were maintained in non-podding plants under long-day conditions (LD. Furthermore, overexpression of GmNMHC5 in transgenic soybean significantly promoted lateral root development and nodule building. Moreover, GmNMHC5 is upregulated by exogenous sucrose. These results indicate that GmNMHC5 can sense the sucrose signal and plays significant roles in lateral root development and nodule building.

  1. Response of Glycine max to drought stress in relation to growth parameters and some key enzymes of carbon and nitrogen metabolism

    Directory of Open Access Journals (Sweden)

    Maryam Nasr Esfahani


    Full Text Available Drought stress is one of the major constraints for production and yield of soybean (Glycine max. For this reason, identifying mechanisms associated with drought tolerance in soybean is very impotent for improving and increasing drought resistance by genetic engineering methods. In this study, the effect of drought on growth traits (plant height, fresh and dry weight of shoot and also fresh and dry weight of root and enzyme activities of isocitrate dehydrogenase (ICDH, phosphoenolpyruvate carboxylase (PEPC, malate dehydrogenase (MDH, glutamine synthetase (GS and nitrate reductase (NR were assessed in drought sensitive and tolerant cultivars of soybean. The results showed that growth indicators are higher in drought tolerant cultivar under water availability (control and water deficient when compared with those of drought sensitive cultivar. An increase in the activity of ICDH was observed in both the cultivars under drought stress as compared with their respective control plants but this activity was higher in tolerant cultivar. The activities of PEPC, MDH, GS and NR were significantly decreased in drought sensitive cultivar whereas the activities of these enzymes were higher in another cultivar. In general, the results of this study showed different behavior in the activities of assayed enzymes in two sets of soybean cultivars differing in drought tolerance and also decline of the activities of these enzymes in drought sensitive cultivar due to water deficit stress may be one of the possible reasons for decreased growth of the soybean plants under drought.

  2. Drought resistant of bacteria producing exopolysaccharide and IAA in rhizosphere of soybean plant (Glycine max) in Wonogiri Regency Central Java Indonesia (United States)

    Susilowati, A.; Puspita, A. A.; Yunus, A.


    Drought is one of the main problem which limitating the agriculture productivity in most arid region such as in district Eromoko, Wuryantro and SelogiriWonogiri Central Java Indonesia. Bacteria are able to survive under stress condition by producte exopolysaccharide. This study aims to determine the presence of exopolysaccharide-producing drought-resistant bacteria on rhizosphere of soybean (Glycine max) and to determine the species of bacteria based on 16S rRNA gene. Isolation of bacteria carried out by the spread plate method. The decreased of osmotic potential for screening drought tolerant bacteria according to the previous equation [12]. Selection of exopolysaccharide-producing bacteria on solid media ATCC 14 followed by staining the capsule. 16S rRNA gene amplification performed by PCR using primers of 63f and 1387r. The identificationof the bacteria is determined by comparing the results of DNA sequence similarity with bacteria databank in NCBI database. The results showed 11 isolates were exopolysaccharide-producing drought tolerant bacteria. The identity of the bacteria which found are Bacillus sp, Bacillus licheniformis, Bacillus megaterium and Bacillus pumilus.

  3. Selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in greenhouse

    Directory of Open Access Journals (Sweden)



    Full Text Available An experiment on the selection of Rhizobium strain from Wonogiri, Central Java on the growth of soybean (Glycine max L. on the sand sterile medium in green house. The aim of the experiment the selection and potency of the Rhizobium strain to increase the growth of soybean. The experiment was carried out in green house condition in Microbiology Division, Research Center for Biology-LIPI with sterile sand medium. The research design was Completely Randomized Design with three replications for each treatment. The Rhizobium strains used were 1 W (isolated from bean, Vigna radiata, 2 W (isolated from soybean, 3 W (isolated from bean, 4 W (isolated from soybean, 5 W (isolated from soybean, 6 W (isolated from peanut, Arachis hypogaea, 7 W (isolated from peanut, 8 W (isolated from peanut, the controls were uninoculated with Rhizobium strain and without urea fertilizer (K1, uninoculated and with urea fertilizer equal 100 kg/ha (K2. The plants were harvested after 50 days, the variable of investigation were the dry weight of canopy, roots, nodules root, total plants, number of nodules and ‘symbiotic capacity”. The results showed that all of experiment plant which be inoculated with Rhizobium able to form nodule. Strain of 2 W (isolated from soybean has given the best effects on the growth of soybean.

  4. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial. (United States)

    Kim, Ji-Eun; Jeon, Seon-Min; Park, Ki Hun; Lee, Woo Song; Jeong, Tae-Sook; McGregor, Robin A; Choi, Myung-Sook


    Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML) or Garcinia cambogia extract (GCE) to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial effect on lipid, adipocytokine or antioxidant profiles. Eighty-six overweight subjects (Male:Female = 46:40, age: 20~50 yr, BMI > 23 GCE (2 g/day) or placebo (starch, 2 g/day) for 10 weeks. At baseline and after 10 weeks, body composition, plasma cholesterol and diet were assessed. Blood analysis was also conducted to examine plasma lipoproteins, triglycerides, adipocytokines and antioxidants. EGML and GCE supplementation failed to promote weight-loss or any clinically significant change in %body fat. The EGML group had lower total cholesterol after 10 weeks compared to the placebo group (p GCE had no effect on triglycerides, non-HDL-C, adipocytokines or antioxidants when compared to placebo supplementation. However, HDL-C was higher in the EGML group (p GCE supplementation did not promote weight-loss or lower total cholesterol in overweight individuals consuming their habitual diet. Although, EGML did increase plasma HDL-C levels which is associated with a lower risk of atherosclerosis.

  5. Does Glycine max leaves or Garcinia Cambogia promote weight-loss or lower plasma cholesterol in overweight individuals: a randomized control trial

    Directory of Open Access Journals (Sweden)

    Jeong Tae-Sook


    Full Text Available Abstract Background Natural food supplements with high flavonoid content are often claimed to promote weight-loss and lower plasma cholesterol in animal studies, but human studies have been more equivocal. The aim of this study was firstly to determine the effectiveness of natural food supplements containing Glycine max leaves extract (EGML or Garcinia cambogia extract (GCE to promote weight-loss and lower plasma cholesterol. Secondly to examine whether these supplements have any beneficial effect on lipid, adipocytokine or antioxidant profiles. Methods Eighty-six overweight subjects (Male:Female = 46:40, age: 20~50 yr, BMI > 23 Results EGML and GCE supplementation failed to promote weight-loss or any clinically significant change in %body fat. The EGML group had lower total cholesterol after 10 weeks compared to the placebo group (p Conclusions Ten weeks of EGML or GCE supplementation did not promote weight-loss or lower total cholesterol in overweight individuals consuming their habitual diet. Although, EGML did increase plasma HDL-C levels which is associated with a lower risk of atherosclerosis.

  6. Residual Effect Of Organic Fertilizer And Addition Inorganik Fertilizer To Nutrient Uptake Growth And Productions Of Black Soy Bean Glycine Max L. Merr At Rainfed Areas.

    Directory of Open Access Journals (Sweden)

    Elli Afrida


    Full Text Available Abstract Research that have theme Residual Effect of Organic Fertilizer and Addition Anorganik Fertilizer to Nutrient Uptake Growth and pruductions of Black Soy Bean Glycine max L. Merr at Rainfed Wetland. Research was conducted at Suka Makmur village sub-distric Binjai Distric Langkat. Research was arranged in split plot design main plot is applications of phonska fertilizerwith 4 level i.e 0 t ha-1 A0 0.20 t ha-1 A1 0.25 t ha-1 A2 dan 0.30 t ha-1 A3 and sub plot is residual effect from first research with 16 combinations. Research was replicated 3 times. Result of research was showed application organic fertilizer that was combinated with anorganic fertilizer can increased N and K uptake. Application organic and anorganic fertilizer as single factor showed significantly effect of number of pods and soy bean productions but at interaction treatment not significantly effect however generally occurs increased production at O33A3 tratment until 80 comparison with control.

  7. Assessing the effects of cultivating genetically modified glyphosate-tolerant varieties of soybeans (Glycine max (L.) Merr.) on populations of field arthropods. (United States)

    Imura, Osamu; Shi, Kun; Iimura, Keiji; Takamizo, Tadashi


    We assessed the effects of cultivating two genetically modified (GM) glyphosate-tolerant soybean varieties (Glycine max (L.) Merr.) derived from Event 40-3-2 and a Japanese conventional variety on arthropods under field conditions, with weed control using glyphosate and conventional weed control for two years. Plant height and dry weight of the conventional variety were significantly larger than those of the GM varieties, but the GM varieties bore more pods than the conventional variety. We found arthropods of nine taxonomic orders (Araneae, Acari, Thysanoptera, Homoptera, Heteroptera, Coleoptera, Diptera, Lepidoptera, and Hymenoptera) on the plants. The arthropod incidence (number per plant unit weight pooled for each taxonomic order) on the soybean stems and leaves generally did not differ significantly between the GM and conventional varieties. However, the incidence of Thysanoptera and total incidence (all orders combined) were greater on the GM variety in the second year. The weed control regimes had no significant influence on the arthropod incidence on the soybean stems and leaves. The number of flower-inhabiting Thysanoptera (the dominant arthropod in the flowers) was not significantly different between the GM and conventional varieties. Asphondylia yushimai (Diptera, Cecidomyiidae) was more numerous on the pods of the GM variety in both years. Neither the soybean variety nor the weed control regime significantly affected the density of soil macro-organisms. However, the glyphosate weed control affected arthropods between the rows of plants by decreasing the abundances of Homoptera, Heteroptera, Coleoptera and Lepidoptera, and diversity of arthropods. © ISBR, EDP Sciences, 2011.

  8. Yield response of soy bean cultivars (Glycine max [L.] Merrill to the application of different doses of biofertilizer FitoMás–E

    Directory of Open Access Journals (Sweden)

    Yanitza Meriño Hernández


    Full Text Available This research was done under field conditions, from December 2012 through February 2013. The objective was to evaluate the yield response of soy bean (Glycine max [L.] Merrill, variety “INCASOY-24”, to the application of different doses of FitoMás-E, in a randomized block experimental design with 4 treatments: T1 (control, T2 (1 L.ha-1, T3 (1.5 L.ha-1 and T4 (2 L.ha-1, and 4 replications. The bioestimulant was applied to foliage early in the morning from the 10th day after germination. The data were analyzed statistically with Statistica, ver. 8.0 software. When the indicators used showed significant differences, the Duncan’s Multiple Range Test was applied to p < 0.05. The results of each evaluated variable showed a significant effect of FitoMás-E on the cultivar. The best results were achieved where the application dose was 1 L.ha-1 (T2.

  9. Changes in Amino Acid Profile in Roots of Glyphosate Resistant and Susceptible Soybean (Glycine max) Induced by Foliar Glyphosate Application. (United States)

    Moldes, Carlos Alberto; Cantarelli, Miguel Angel; Camiña, José Manuel; Tsai, Siu Mui; Azevedo, Ricardo Antunes


    Amino acid profiles are useful to analyze the responses to glyphosate in susceptible and resistant soybean lines. Comparisons of profiles for 10 amino acids (Asp, Asn, Glu, Gln, Ser, His, Gly, Thr, Tyr, Leu) by HPLC in soybean roots were performed in two near isogenic pairs (four varieties). Foliar application of glyphosate was made to soybean plants after 5 weeks of seeding. Roots of four varieties were collected at 0 and 72 h after glyphosate application (AGA) for amino acid analysis by HPLC. Univariate analysis showed a significant increase of several amino acids in susceptible as well as resistant soybean lines; however, amino acids from the major pathways of carbon (C) and nitrogen (N) metabolism, such as Asp, Asn, Glu and Gln, and Ser, increased significantly in susceptible varieties at 72 h AGA. Multivariate analysis using principal component analysis (2D PCA and 3D PCA) allowed different groups to be identified and discriminated based on the soybean genetic origin, showing the amino acid responses on susceptible and resistant varieties. Based on the results, it is possible to infer that the increase of Asn, Asp, Glu, Gln, and Ser in susceptible varieties would be related to the deregulation of C and N metabolism, as well as changes in the growth mechanisms regulated by Ser.

  10. Residue and bio-efficacy evaluation of controlled release formulations of imidacloprid against pests in soybean (Glycine max). (United States)

    Adak, Totan; Kumar, Jitendra; Dey, Debjani; Shakil, N A; Walia, S


    Controlled release (CR) formulations of imidacloprid (1-(6 chloro-3-pyridinyl methyl)-N- nitro imidazolidin-2- ylideneamine) were prepared using novel amphiphilic polymers synthesized from polyethylene glycol and aliphatic diacids employing encapsulation technique. The bioefficacy of the prepared CR formulations was evaluated against major pests of soybean, namely stem fly, Melanagromyza sojae Zehntmer and white fly, Bemisia tabaci Gennadius along with a commercial formulation at the experimental farm of Indian Agricultural Research Institute (IARI), New Delhi during kharif 2009 and 2010. Most of the CR formulations of imidacloprid gave significantly better control of the pests compare to its commercial formulations, however the CR formulations, Poly [poly (oxyethylene-1000)-oxy suberoyl] amphiphilic polymer based formulation performed better over others for controlling of both stem fly incidence and Yellow Mosaic Virus (YMV) infestation transmitted by white fly. Some of the developed CR formulations recorded higher yield over commercial formulation and control. Nodulation pattern of soybean was not affected due to treatment of CR and commercial formulations of imidacloprid. Also the residues of imidacloprid in seed and soil at harvest were not detectable for both CR and commercial formulations.

  11. Effectiveness of fast neutrons irradiation for the stimulation and induction of genetic changes in soybean (Glycine max L. Merrill) genome

    International Nuclear Information System (INIS)

    Sodkiewicz, T.; Sodkiewicz, W.


    Air-dry seeds of soybean cv. Warszawska were irradiated with fast neutrons (Nf) using the U-120 cyclotron (at the Institute of Nuclear Physics in Cracow) at the doses of 500, 1000, 1500 R. Additionally, each of the irradiation doses was combined with the selected effective chemical mutagen N-nitroso-N-methylurea - in three concentrations: 0.5, 1.5 and 2.5 mM, to evaluate synergistic effect of these two different mutagenic agents. The results showed some of protection effect of radiation on the level of somatic damage of soybean plants. In addition, the phenomenon of the 'delaying effect' was noted, because the protection effect of fast neutron radiation in the combined treatments with chemomutagen was observed in the emergence and plant survival in the M 2 generation as well. From the point of view of genetic changes induced in the soybean genome, the most effective dose of fast neutron irradiation was 500 R. The number of soybean mutants with earlier ripening obtained (in comparison with original 'mother' variety) at this irradiation dose was higher, than with the highest effective concentration of chemical mutagen (1.0 -1.5 mM MNUA). (author)

  12. Predicting Emergence of the Most Important Weed Species in Soybean (Glycine max L. under Different Management Operation

    Directory of Open Access Journals (Sweden)

    R. Khakzad


    Full Text Available Introduction: Summer annual weeds typically germinate in spring and early summer, grow throughout the summer, and set seeds by fall. Summer annual weeds are a persistent problem in summer annual row crops, competing directly for water, light, and nutrients, causing yield losses in quantity and quality. Although agriculture is increasingly relying on modern technology, knowledge of the biological systems in which these technologies are used is still critical for implementation of management strategies. Biological information about weeds is valuable and necessary for developing management strategies to minimize their impact. Scouting fields for pest problems are essential in any cropping system and knowledge of the timing and sequence of weed species emergence could increase the effectiveness of weed scouting trips and subsequent management practices. The success of any annual plant is directly correlated to its time of seedling emergence because it determines the ability of a plant to compete with its neighbors, survive biotic and abiotic stresses, and reproduce. The period and pattern of emergence of the weed community depend on the species present in the seed bank and their interaction with the environment. Therefore, knowledge of the weed species present in the soil seed bank and when these species are most likely to emerge is important in planning effective weed control programs. Temperature has been reported to be the main environmental factor regulating germination and emergence of weed species. Scientists have developed TT models to predict the emergence of weed species based on a daily accumulation of heat units or growing degree days (GDD above a minimum base threshold value (Tbase. The predictive models for weed emergence based on the accumulation of TT appear to be accurate enough for projections of weed emergence time (Grundy 2003. Moreover, soil temperature data are easily accessible, making this type of model practical and useful to

  13. The effect of gamma irradiation and ethyl methan sulfonate on somatic embryo formation of soybean (Glycine max L.)

    International Nuclear Information System (INIS)

    Ragapadmi Purnamaningsih; Ika Mariska; Lestari, E.G.; Sri Hutami; Rossa Yunita


    Soybean is a source of protein and vegetable oil. Global climate change affect the productivity of soybean, so that new cultivars that have superior characteristic can be produced. In vitro techniques through somaclonal variation and mutation is one alternative for obtaining new varieties when genetic material as the material selection is not available. Mutation induction can be performed on embryogenic cell populations using gamma irradiation or chemical compounds, such as Ethyl Methane Sulfonate (EMS). Both of these methods have been widely used to increase the genetic diversity of plants and have produced new clones with superior characteristic. The main component that must be controlled in the implementation of these technologies is somatic cells regeneration after mutation treatment in order to get in vitro shoots. Regeneration methods which are successfully applied to certain varieties, often is not successfully for other varieties of the same species. Some factors that influence it, are such as explants source, genotype, medium composition, genotype, medium composition, etc. Somaclonal variation and mutation treatment can cause cell damage that is sometimes necessary need modifications of the regeneration method that has been produced before. The aim of the experiment was to get cell population and planlet mutation with gamma irradiation and Ethyl Methan Sulfonate (EMS). Young embryozygotic was used as explant came from young pod that was harvested at 12-20 days after fertilization of Willis, Burangrang and Baluran varieties and accession No B 3592. Embryogenic callus induction was done by using MS media with vitamin B5 added with 20 mg/l of 2,4-D and 3% sucrose. The callus were irradiated by gamma rays 400 rad or dilute in EMS solution with 0.1%, 0.3% and 0.5% concentration for 1, 2, and 3 hours. After mutation treatment, the callus were sub culture for seed somatic induction. The results showed that callus formation was influenced by plant genotype. All

  14. The essence of NAC gene family to the cultivation of drought-resistant soybean (Glycine max L. Merr.) cultivars. (United States)

    Hussain, Reem M; Ali, Mohammed; Feng, Xing; Li, Xia


    The NAC gene family is notable due to its large size, as well as its relevance in crop cultivation - particularly in terms of enhancing stress tolerance of plants. These plant-specific proteins contain NAC domain(s) that are named after Petunia NAM and Arabidopsis ATAF1/2 and CUC2 transcription factors based on the consensus sequence they have. Despite the knowledge available regarding NAC protein function, an extensive study on the possible use of GmNACs in developing soybean cultivars with superior drought tolerance is yet to be done. In response to this, our study was carried out, mainly through means of phylogenetic analysis (rice and Arabidopsis NAC genes served as seeding sequences). Through this, 139 GmNAC genes were identified and later grouped into 17 clusters. Furthermore, real-time quantitative PCR was carried out on drought-stressed and unstressed leaf tissues of both sensitive (B217 and H228) and tolerant (Jindou 74 and 78) cultivars. This was done to analyze the gene expression of 28 dehydration-responsive GmNAC genes. Upon completing the analysis, it was found that GmNAC gene expression is actually dependent on genotype. Eight of the 28 selected genes (GmNAC004, GmNAC021, GmNAC065, GmNAC066, GmNAC073, GmNAC082, GmNAC083 and GmNAC087) were discovered to have high expression levels in the drought-resistant soybean varieties tested. This holds true for both extreme and standard drought conditions. Alternatively, the drought-sensitive cultivars exhibited lower GmNAC expression levels in comparison to their tolerant counterparts. The study allowed for the identification of eight GmNAC genes that could be focused upon in future attempts to develop superior soybean varieties, particularly in terms of drought resistance. This study revealed that there were more dehydration-responsive GmNAC genes as (GmNAC004, GmNAC005, GmNAC020 and GmNAC021) in addition to what were reported in earlier inquiries. It is important to note though, that discovering such

  15. Soybean (Glycine max L. Merr. Yield Gap Analysis using Boundary Line Method in Gorgan and Aliabad Katul

    Directory of Open Access Journals (Sweden)

    Alireza Nehbandani


    management, this productivity can increase to as high as 5355 Kg.ha-1. Most evaluated soybean yield responses in terms of the value of the nitrogen fertilizer showed that the data points follow a two-segmented function in a way that by increasing the amount of nitrogen fertilizer to 48 Kg.ha-1, the yield increased and then, the addition of the amount of nitrogen fertilizer had no effect on grain yield. Most evaluated soybean yield responses in terms of the amount of phosphorous fertilizer showed that the data points follow a two-segmented function in a way that by increasing the amount of phosphorous fertilizer to 43 kg per hectare, the yield increased and then, the addition of the amount of fertilizer had no effect on grain yield. Most evaluated soybean yield responses in terms of the irrigation frequency showed that the data points follow a two-segmented function in a way that by increasing irrigation frequencies up to four times, the yield increased and then, by increasing the number of irrigations no effect on grain yield has been observed. Data distribution of grain yield against the amount of seed used showed that the boundary line follows dent-like function. Accordingly, to reach a yield potential of 5780 Kg.ha-1, 53 to 67 kg of seeds per hectare is needed. The distribution of yield data against the distance between the rows showed that the boundary line follows a quadratic function. Hence, to reach a yield potential of 4048 Kg.ha-1, a 40 cm rows distance must be considered . Data distribution of grain yield against the inter-crop distance showed that the boundary line follows a dent-like function and inter-crop distance must be kept at a range of 5-7cm to reach a 5102 Kg.ha-1 grain yield. Conclusion In this study by examining several important management factors in growing soybean, optimal requirements of each factor to achieve the highest yield was determined by boundary analysis. In addition, the percentage of farms that had poor management as well as soybean yield

  16. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress. (United States)

    Bilal, Saqib; Khan, Abdul L; Shahzad, Raheem; Asaf, Sajjad; Kang, Sang-Mo; Lee, In-Jung


    This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum , Paecilomyces formosus , Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean) in response to dose-dependent increases in soil Ni (0.5, 1.0, and 5.0 mM). Inoculation with P. formosus LHL10 significantly increased plant biomass and growth attributes as compared to non-inoculated control plants with or without Ni contamination. LHL10 enhanced the translocation of Ni from the root to the shoot as compared to the control. In addition, P. formosus LHL10 modulated the physio-chemical apparatus of soybean plants during Ni-contamination by reducing lipid peroxidation and the accumulation of linolenic acid, glutathione, peroxidase, polyphenol oxidase, catalase, and superoxide dismutase. Stress-responsive phytohormones such as abscisic acid and jasmonic acid were significantly down-regulated in fungal-inoculated soybean plants under Ni stress. LHL10 Ni-remediation potential can be attributed to its phytohormonal synthesis related genetic makeup. RT-PCR analysis showed the expression of indole-3-acetamide hydrolase , aldehyde dehydrogenase for indole-acetic acid and geranylgeranyl-diphosphate synthase , ent-kaurene oxidase ( P450-4 ), C13-oxidase ( P450-3 ) for gibberellins synthesis. In conclusion, the inoculation of P. formosus can significantly improve plant growth in Ni-polluted soils, and assist in improving the phytoremediation abilities of economically important crops.

  17. Endophytic Paecilomyces formosus LHL10 Augments Glycine max L. Adaptation to Ni-Contamination through Affecting Endogenous Phytohormones and Oxidative Stress

    Directory of Open Access Journals (Sweden)

    Saqib Bilal


    Full Text Available This study investigated the Ni-removal efficiency of phytohormone-producing endophytic fungi Penicillium janthinellum, Paecilomyces formosus, Exophiala sp., and Preussia sp. Among four different endophytes, P. formosus LHL10 was able to tolerate up to 1 mM Ni in contaminated media as compared to copper and cadmium. P. formosus LHL10 was further assessed for its potential to enhance the phytoremediation of Glycine max (soybean in response to dose-dependent increases in soil Ni (0.5, 1.0, and 5.0 mM. Inoculation with P. formosus LHL10 significantly increased plant biomass and growth attributes as compared to non-inoculated control plants with or without Ni contamination. LHL10 enhanced the translocation of Ni from the root to the shoot as compared to the control. In addition, P. formosus LHL10 modulated the physio-chemical apparatus of soybean plants during Ni-contamination by reducing lipid peroxidation and the accumulation of linolenic acid, glutathione, peroxidase, polyphenol oxidase, catalase, and superoxide dismutase. Stress-responsive phytohormones such as abscisic acid and jasmonic acid were significantly down-regulated in fungal-inoculated soybean plants under Ni stress. LHL10 Ni-remediation potential can be attributed to its phytohormonal synthesis related genetic makeup. RT-PCR analysis showed the expression of indole-3-acetamide hydrolase, aldehyde dehydrogenase for indole-acetic acid and geranylgeranyl-diphosphate synthase, ent-kaurene oxidase (P450-4, C13-oxidase (P450-3 for gibberellins synthesis. In conclusion, the inoculation of P. formosus can significantly improve plant growth in Ni-polluted soils, and assist in improving the phytoremediation abilities of economically important crops.

  18. Yield and Yield Attributes Responses of Soybean (Glycine max L. Merrill to Elevated CO2 and Arbuscular Mycorrhizal Fungi Inoculation in the Humid Transitory Rainforest

    Directory of Open Access Journals (Sweden)

    Nurudeen ADEYEMI


    Full Text Available Variations in yield components and grain yield of arbuscular mycorrhizal fungi (AMF inoculated soybean varieties (Glycine max L. Merrill grown in CO2 enriched environment in the humid rainforest were tested.  A screen house trial was established with soybean varieties (‘TGx 1448-2E’, ‘TGx 1440-1E’ and ‘TGx 1740-2F’, AMF inoculation (with and without and CO2 enrichment (350±50 ppm and 550±50 ppm in open top chamber, arranged in completely randomised design, replicated three times. A field trial was also conducted; the treatments were arranged in a split-split plot configuration fitted into randomised complete block design. In the main plot the variant was CO2 enrichment, the sub-plot consisted of AMF inoculation (with and without, while the sub-sub plot consisted of soybean varieties, replicated three times. Both trials had significantly higher grain yield at elevated CO2 than ambient. This could be attributed to improved yield attributes, more spore count and root colonisation. In both trials, inoculated soybean had significantly higher dry pod weight than un-inoculated, which could suggest the increased grain yield observed on the field. AMF inoculated soybean varieties outperformed un-inoculated in both CO2 enriched and ambient concentrations. AMF inoculated soybean variety ‘TGx 1740-2F’ is most preferable in CO2 enriched environment, while variety ‘TGx 1448-2E’ had the most stable grain yield in all growth environments.

  19. Growth enhancement of soybean (Glycine max) upon exclusion of UV-B and UV-B/A components of solar radiation: characterization of photosynthetic parameters in leaves. (United States)

    Guruprasad, Kadur; Kadur, Guruprasad; Bhattacharjee, Swapan; Swapan, Bhattacharjee; Kataria, Sunita; Sunita, Kataria; Yadav, Sanjeev; Sanjeev, Yadav; Tiwari, Arjun; Arjun, Tiwari; Baroniya, Sanjay; Sanjay, Baroniya; Rajiv, Abhinav; Abhinav, Rajiv; Mohanty, Prasanna


    Exclusion of UV (280-380 nm) radiation from the solar spectrum can be an important tool to assess the impact of ambient UV radiation on plant growth and performance of crop plants. The effect of exclusion of UV-B and UV-A from solar radiation on the growth and photosynthetic components in soybean (Glycine max) leaves were investigated. Exclusion of solar UV-B and UV-B/A radiation, enhanced the fresh weight, dry weight, leaf area as well as induced a dramatic increase in plant height, which reflected a net increase in biomass. Dry weight increase per unit leaf area was quite significant upon both UV-B and UV-B/A exclusion from the solar spectrum. However, no changes in chlorophyll a and b contents were observed by exclusion of solar UV radiation but the content of carotenoids was significantly (34-46%) lowered. Analysis of chlorophyll (Chl) fluorescence transient parameters of leaf segments suggested no change in the F v/F m value due to UV-B or UV-B/A exclusion. Only a small reduction in photo-oxidized signal I (P700+)/unit Chl was noted. Interestingly the total soluble protein content per unit leaf area increased by 18% in UV-B/A and 40% in UV-B excluded samples, suggesting a unique upregulation of biosynthesis and accumulation of biomass. Solar UV radiation thus seems to primarily affect the photomorphogenic regulatory system that leads to an enhanced growth of leaves and an enhanced rate of net photosynthesis in soybean, a crop plant of economic importance. The presence of ultra-violet components in sunlight seems to arrest carbon sequestration in plants.

  20. Effect of cadmium salts on some growth and metabolic activities of selected fungi from the rhizosphere of Glycine max and Zea mays

    Energy Technology Data Exchange (ETDEWEB)

    Naguib, M.I.; Ali, M.I.; Haikal, N.Z.; Sharaf, E.F. (Cairo Univ. (Egypt))


    Six fungi, isolated from the rhizosphere of Glycine max and Zea Mays, were selected for their variable resistance to soil application of cadmium nitrate and cadmium sulfate, at the range of 100-1000 ppm concentration. These were (a) Aspergillus terreus and Rhizopus oryzae; (b) Paecilomyces divaricata, Curvularia tetramera; (c) Fusarium oxysporum and (d) Cladosporium herbarum. Fifty ppm cadmium salts exerted no effect on spore germination of R. oryzae, F. oxysporum or C. tetramera, stimulated A. terreus and P. divaricata and suppressed C. herbarum. 100 ppm dose exerted variable effects dependent on the organism and/or accompanying anion. 1000 ppm cadmium arrested spore germination of all the tested fungi except F. oxysporum where marked suppression were observed. Cadmium arrested growth of C. herbarum and P. divaricata at 50 ppm, initiated that of A. terreus, C. tetramera and F. oxysporum but seemed without effect on R. oryzae. Larger doses seemed to be inhibitory to all organisms, R. oryzae being least affected. Results show that nitrogen secretion was not a function of tolerance of the fungi to cadmium applied to the soil but was largely controlled by the effect of cadmium on the permeability of the cells of each individual fungus. Cadmium seemed to stimulate nitrogen metabolism of Aspergillus and Fusarium, had little or no effect on that of Rhizopus but suppressed that of Curvularia. Most accumulated nitrogen was in the form of amino and other soluble nitrogen. Cadmium inhibited the incorporation of absorbed phosphorus into energy-rich compounds. This was concomitant with the failure of amino acid incorporation into proteins.

  1. The effect of soil tillage system and weeding time on the growth of weed and yield of soybean (Glycine max (L. Merril

    Directory of Open Access Journals (Sweden)

    Husni Thamrin Sebayang


    Full Text Available The growth and yield of soybeans can decrease due to competition from weeds. Various efforts have been made to control the growth of weeds such as land preparation and weeding periods. An experiment to study the effect of soil tillage systems and weeding time on the growth of weeds and soybean crop yield (Glycine max (L. Merril has been done in Wringinsongo Village, Tumpang Sub-District, Malang Regency from February to May 2017. The split-plot design with three replicates was used with the soil tillage system as the main plot consisting of three levels, T0: no tillage, T1: minimum tillage, and T2: conventional tillage, and weeding time as the sub plot consisting of 4 levels, P0: no weeding, P1: weeding 1 time, P2: weeding two times and P3: weeding three times. The results showed that the dominant weed species before treatment were Amaranthus spinosus (Spiny amaranth, Cynodon dactylon (Bermuda grass, Cyperus rotundus (Purple nutsedge, Ageratum conyzoides (Billygoat weed, and Portulaca oleracea (Common purslane. After treatment, the dominant weed species were Cyperus rotundus (Purple nutsedge, Amaranthus spinosus (Spiny amaranth, Ageratum conyzoides (Billygoat weed, Physalis peruviana (Cape gooseberry, and Eclipta alba (False daisy. There was no significant difference of the dry weight of weeds in conventional tillage followed by weeding 3 times at 15, 30 and 45 days after planting, and minimum tillage and no tillage. For the yield of soybeans, conventional tillage followed by weeding 3 times at 15, 30 and 45 days after planting were not significant with that of minimum tillage. The yield of soybeans was lower than that of with no tillage and no weeding.

  2. Molecular cloning and characterization of a novel salt-inducible gene encoding an acidic isoform of PR-5 protein in soybean (Glycine max [L.] Merr.). (United States)

    Onishi, M; Tachi, H; Kojima, T; Shiraiwa, M; Takahara, H


    We identified a novel salt-inducible soybean gene encoding an acidic-isoform of pathogenesis-related protein group 5 (PR-5 protein). The soybean PR-5-homologous gene, designated as Glycine max osmotin-like protein, acidic isoform (GmOLPa)), encodes a putative polypeptide having an N-terminal signal peptide. The mature GmOLPa protein without the signal peptide has a calculated molecular mass of 21.5 kDa and a pI value of 4.4, and was distinguishable from a known PR-5-homologous gene of soybean (namely P21 protein) through examination of the structural features. A comparison with two intracellular salt-inducible PR-5 proteins, tobacco osmotin and tomato NP24, revealed that GmOLPa did not have a C-terminal extension sequence functioning as a vacuole-targeting motif. The GmOLPa gene was transcribed constitutively in the soybean root and was induced almost exclusively in the root during 24 h of high-salt stress (300 mM NaCl). Interestingly, GmOLPa gene expression in the stem and leaf, not observed until 24 h, was markedly induced at 48 and 72 h after commencement of the high-salt stress. Abscisic acid (ABA) and dehydration also induced expression of the GmOLPa gene in the root; additionally, dehydration slightly induced expression in the stem and leaf. In fact, the 5'-upstream sequence of the GmOLPa gene contained several putative cis-elements known to be involved in responsiveness to ABA and dehydration, e.g. ABA-responsive element (ABRE), MYB/MYC, and low temperature-responsive element (LTRE). These results suggested that GmOLPa may function as a protective PR-5 protein in the extracellular space of the soybean root in response to high-salt stress and dehydration.

  3. 78 FR 9317 - Glycine max (United States)


    ... overall sequence similarity or identity at the level of eight contiguous amino acid residues, the level of... inhibitors of amino acid biosynthesis and herbicide-tolerant crops. Amino Acids 30: 195-204. 13. Locke, M...

  4. Efeito de doses de metribuzin no crescimento e na conversão da energia solar em plantas de soja (Glycine max (L . merrill Effect of metribuzin doses on the growth and solar energy conversion in soybean (Glycine max (L. merrill plants

    Directory of Open Access Journals (Sweden)

    P. J. Silva Neto


    Full Text Available O crescimento e a eficiência na conversão da energia solar foram estudados em soja (Glycine max (L. Merri ll, cv. 'Uberaba', cultivada em condições de campo, sob quatro doses de metribuzin (0, 0,35; 0,70 e 1,05 kg i.a.ha-1. O valor máximo da conversão da energia solar foi de 0,75%, para as plantas cultiva das na maior dose do herbicida. Os valores da conversão da energia solar média durante o ciclo da cultura foram 0,32 ; 0,31 ; 0,32 e 0,33%. em ordem crescente de dose do metribuzin. De modo geral, na fase vegetativa as plantas controle apresentaram valores inferiores em todos os valores de crescimento determinados, superando as tratadas com metribuzin somente na fase reprodutiva, mostrando que no período crítico de competição o dano causado pelas plantas daninhas é maior que a possível fitotoxicida de causada pelo metribuzin.Growth analysis and evaluation of solar energy conversion in soybean (Glycine max (L. Merrill, Uberaba unver field conditions and four doses of metribuzin (0,0;0,35; 0,70 and 1,05 kg i.a.ha-1 were performed in this study. Maximum solar energy conversion was 0,75% for pla nts tre ate d wit h 1,05 kg i.a.ha -1 metribuzin. The aver age of solar energy conversion throughout the entire crop cycle were 0,32, 0,31 , 0,32 and 0,33% for the increasing metribuzin doses. In general, the control showed lower figures for all growth values studied than the treated during the vegetative phase. During the reproductive phase, however, they surpassed those tre ated with metribuzin, showing that in the critical period of competition weeds were more harmful than the phytotoxicity produced by metribuzin.

  5. Redox markers for drought-induced nodule senescence, a process occurring after drought-induced senescence of the lowest leaves in soybean (Glycine max). (United States)

    Marquez-Garcia, Belén; Shaw, Daniel; Cooper, James William; Karpinska, Barbara; Quain, Marian Dorcas; Makgopa, Eugene Matome; Kunert, Karl; Foyer, Christine Helen


    Water is an increasingly scarce resource that limits crop productivity in many parts of the world, and the frequency and severity of drought are predicted to increase as a result of climate change. Improving tolerance to drought stress is therefore important for maximizing future crop yields. The aim of this study was to compare the effects of drought on soybean (Glycine max) leaves and nodules in order to define phenotypic markers and changes in cellular redox state that characterize the stress response in different organs, and to characterize the relationships between leaf and nodule senescence during drought. Leaf and crown nodule metabolite pools were measured together with leaf and soil water contents, and leaf chlorophyll, total protein contents and chlorophyll a fluorescence quenching parameters in nodulated soybeans that were grown under either well-watered conditions or deprived of water for up to 21 d. Ureides, ascorbate, protein, chlorophyll and the ratios of variable chlorophyll a fluorescence (Fv') to maximal chlorophyll a fluorescence (Fm') fell to levels below detection in the oldest leaves after 21 d of drought. While these drought-induced responses were not observed in the youngest leaf ranks, the Fv'/Fm' ratios, pyridine nucleotide levels and the reduction state of the ascorbate pool were lower in all leaf ranks after 21 d of drought. In contrast to leaves, total nodule protein, pyridine nucleotides, ureides, ascorbate and glutathione contents increased as a result of the drought treatment. However, the nodule ascorbate pool was significantly less reduced as a result of drought. Higher levels of transcripts encoding two peroxiredoxins were detected in nodules exposed to drought stress but senescence-associated transcripts and other mRNAs encoding redox-related proteins were similar under both conditions. While the physiological impact of the drought was perceived throughout the shoot, stress-induced senescence occurred only in the oldest

  6. System-level insights into the cellular interactome of a non-model organism: inferring, modelling and analysing functional gene network of soybean (Glycine max.

    Directory of Open Access Journals (Sweden)

    Yungang Xu

    Full Text Available Cellular interactome, in which genes and/or their products interact on several levels, forming transcriptional regulatory-, protein interaction-, metabolic-, signal transduction networks, etc., has attracted decades of research focuses. However, such a specific type of network alone can hardly explain the various interactive activities among genes. These networks characterize different interaction relationships, implying their unique intrinsic properties and defects, and covering different slices of biological information. Functional gene network (FGN, a consolidated interaction network that models fuzzy and more generalized notion of gene-gene relations, have been proposed to combine heterogeneous networks with the goal of identifying functional modules supported by multiple interaction types. There are yet no successful precedents of FGNs on sparsely studied non-model organisms, such as soybean (Glycine max, due to the absence of sufficient heterogeneous interaction data. We present an alternative solution for inferring the FGNs of soybean (SoyFGNs, in a pioneering study on the soybean interactome, which is also applicable to other organisms. SoyFGNs exhibit the typical characteristics of biological networks: scale-free, small-world architecture and modularization. Verified by co-expression and KEGG pathways, SoyFGNs are more extensive and accurate than an orthology network derived from Arabidopsis. As a case study, network-guided disease-resistance gene discovery indicates that SoyFGNs can provide system-level studies on gene functions and interactions. This work suggests that inferring and modelling the interactome of a non-model plant are feasible. It will speed up the discovery and definition of the functions and interactions of other genes that control important functions, such as nitrogen fixation and protein or lipid synthesis. The efforts of the study are the basis of our further comprehensive studies on the soybean functional

  7. Re-annotation of the physical map of Glycine max for polyploid-like regions by BAC end sequence driven whole genome shotgun read assembly

    Directory of Open Access Journals (Sweden)

    Shultz Jeffry


    Full Text Available Abstract Background Many of the world's most important food crops have either polyploid genomes or homeologous regions derived from segmental shuffling following polyploid formation. The soybean (Glycine max genome has been shown to be composed of approximately four thousand short interspersed homeologous regions with 1, 2 or 4 copies per haploid genome by RFLP analysis, microsatellite anchors to BACs and by contigs formed from BAC fingerprints. Despite these similar regions,, the genome has been sequenced by whole genome shotgun sequence (WGS. Here the aim was to use BAC end sequences (BES derived from three minimum tile paths (MTP to examine the extent and homogeneity of polyploid-like regions within contigs and the extent of correlation between the polyploid-like regions inferred from fingerprinting and the polyploid-like sequences inferred from WGS matches. Results Results show that when sequence divergence was 1–10%, the copy number of homeologous regions could be identified from sequence variation in WGS reads overlapping BES. Homeolog sequence variants (HSVs were single nucleotide polymorphisms (SNPs; 89% and single nucleotide indels (SNIs 10%. Larger indels were rare but present (1%. Simulations that had predicted fingerprints of homeologous regions could be separated when divergence exceeded 2% were shown to be false. We show that a 5–10% sequence divergence is necessary to separate homeologs by fingerprinting. BES compared to WGS traces showed polyploid-like regions with less than 1% sequence divergence exist at 2.3% of the locations assayed. Conclusion The use of HSVs like SNPs and SNIs to characterize BACs wil improve contig building methods. The implications for bioinformatic and functional annotation of polyploid and paleopolyploid genomes show that a combined approach of BAC fingerprint based physical maps, WGS sequence and HSV-based partitioning of BAC clones from homeologous regions to separate contigs will allow reliable de

  8. Diaspora, a large family of Ty3-gypsy retrotransposons in Glycine max, is an envelope-less member of an endogenous plant retrovirus lineage. (United States)

    Yano, Sho T; Panbehi, Bahman; Das, Arpita; Laten, Howard M


    The chromosomes of higher plants are littered with retrotransposons that, in many cases, constitute as much as 80% of plant genomes. Long terminal repeat retrotransposons have been especially successful colonizers of the chromosomes of higher plants and examinations of their function, evolution, and dispersal are essential to understanding the evolution of eukaryotic genomes. In soybean, several families of retrotransposons have been identified, including at least two that, by virtue of the presence of an envelope-like gene, may constitute endogenous retroviruses. However, most elements are highly degenerate and are often sequestered in regions of the genome that sequencing projects initially shun. In addition, finding potentially functional copies from genomic DNA is rare. This study provides a mechanism to surmount these issues to generate a consensus sequence that can then be functionally and phylogenetically evaluated. Diaspora is a multicopy member of the Ty3-gypsy-like family of LTR retrotransposons and comprises at least 0.5% of the soybean genome. Although the Diaspora family is highly degenerate, and with the exception of this report, is not represented in the Genbank nr database, a full-length consensus sequence was generated from short overlapping sequences using a combination of experimental and in silico methods. Diaspora is 11,737 bp in length and contains a single 1892-codon ORF that encodes a gag-pol polyprotein. Phylogenetic analysis indicates that it is closely related to Athila and Calypso retroelements from Arabidopsis and soybean, respectively. These in turn form the framework of an endogenous retrovirus lineage whose members possess an envelope-like gene. Diaspora appears to lack any trace of this coding region. A combination of empirical sequencing and retrieval of unannotated Genome Survey Sequence database entries was successfully used to construct a full-length representative of the Diaspora family in Glycine max. Diaspora is presently the

  9. Comparative study of the anti-oxidant activity of the total polyphenols extracted from Hibiscus Sabdariffa L., Glycine max L. Merr., yellow tea and red wine through reaction with DPPH free radicals

    Directory of Open Access Journals (Sweden)

    T. Andzi Barhé


    Full Text Available The present study is part of the evaluation of extracts of Glycine max L. Merr and Hibiscus L. Sabdariffa as antioxidants. A comparative study was performed with extracts of yellow tea and commercial red wine, two foods known for their antioxidant activity. The method applied is free radical scavenging using the 1,1-diphenyl-2-picrylhydrazyl (DPPH°. The antioxidant properties were identified and measured by the determining the anti-radical activity reducing index, expressed in percentage % RSA (Radical Scavenger Activity, and by the determination of the colouring intensity (IC50. All results are compared to those of ascorbic acid as reference antioxidant. The results indicate the following order for the antioxidant power of the extracts tested. % RSA (tea > % RSA (Glycine max % > RSA (red wine % > RSA (Sabdariffa Hibiscus, and colouring intensities (IC50 ranging from 4.62 μM (ascorbic acid to 1.10 μM (Hibiscus sabdariffa correlated with their chemical structure and the content of phenolic compounds.

  10. 不同大豆品种生理特性及产量的比较研究%Comparative Study of Different Soybean ( Glycine max) Varieties' Physiological Characteristics and Yield

    Institute of Scientific and Technical Information of China (English)

    章彦俊; 常宝; 董建新


    [目的]比较研究不同大豆(Glycine max)品种各生育期生理特性及产量,筛选出适合于河北张家口地区种植的高产品种,采用各种调控措施,实现大豆高产优质生产.[方法]14个供试大豆品种分别为东北地区引种的长农18、绥农14、长农16、吉农24、黑农38、吉农15、吉育47、吉农6、吉林30、吉农23、吉农1号、吉农12、吉农14和206.测定苗期、结英期、鼓粒期和成熟期株高、叶面积指数、叶绿素含量,并统计产量,并分析4个时期株高、叶面积指数、叶绿素含量与产量的相关性.[结果]吉林30的产量最高,达到16.839 kg/小区,206次之,为小区.不同大豆品种叶面积指数在结英期和鼓粒期与产量的相关系数较大,在鼓粒期达到显著或极显著正相关;结英期和鼓粒期的叶绿素含量与产量呈显著或极显著正相关;鼓粒期的株高与产量呈显著正相关.[结论]该研究筛选出了适合于张家口地区种植的高产品种吉林30和206,同时阐明了不同生理生化指标和产量的关系,为栽培技术的合理利用及生态育种指标的有效选择提供了理论依据.%[Objective] The purpose was to comparatively study different soybean varieties' physiological characteristics and yield during ever-y growth period, screen high yield soybean varieties suit for planting in Zhangjiakou Region of Hebei, and realize its high yield and good quality production by all kings of controlling measures. [Method] Fourteen soybeans introduced from Northeast Region were Changnong18, Sui nong14 , Changnong16, Jinong 24, heinong38, Jinong 15, JiYu 47, Jinong6, Jilin 30, Jinong 23, Jinong 1, Jinong 12, Jinong 14 and 206 respectively. Plant height, leaf area index, chlorophyll content at seedling stage, pod setting stage, seed filling stage and mature stage were determined and yield was counted, then their corelation were analyzed. [Method] In fourteen soybeans, Jilin 30' s yield was the

  11. Modelling of seed yield and its components in tall fescue (Festuca ...

    African Journals Online (AJOL)



    Oct 3, 2011 ... number spikelet -1 (Y4), seed weight (Y5), and the seed yield (Z) of tall fescue were determined in field experiments from 2003 to .... the time of fertilisation (X1), the quantity of irrigation (X2), the amount of N applied (X3), the ...... certain agronomical traits in soybean [Glycine max (L.) Merr.]. Afr. J. Biotechnol.

  12. An overview of the metabolic differences between Bradyrhizobium japonicum 110 bacteria and differentiated bacteroids from soybean (Glycine max) root nodules: an in vitro 13C- and 31P-nuclear magnetic resonance spectroscopy study

    International Nuclear Information System (INIS)

    Vauclare, Pierre; Bligny, Richard; Gout, Elisabeth; Widmer, Francois


    Bradyrhizobium japonicum is a symbiotic nitrogen-fixing soil bacteria that induce root nodules formation in legume soybean (Glycine max.). Using 13 C- and 31 P-nuclear magnetic resonance (NMR) spectroscopy, we have analysed the metabolite profiles of cultivated B. japonicum cells and bacteroids isolated from soybean nodules. Our results revealed some quantitative and qualitative differences between the metabolite profiles of bacteroids and their vegetative state. This includes in bacteroids a huge accumulation of soluble carbohydrates such as trehalose, glutamate, myo-inositol and homo-spermidine as well as Pi, nucleotide pools and intermediates of the primary carbon metabolism. Using this novel approach, these data show that most of the compounds detected in bacteroids reflect the metabolic adaptation of rhizobia to the surrounding microenvironment with its host plant cells. (authors)

  13. Qualidade da aplicação aérea líquida com uma aeronave agrícola experimental na cultura da soja (Glycine Max L. Liquid aerial pesticide application quality with an experimental agricultural aircraft in soybean crop (Glycine Max L.

    Directory of Open Access Journals (Sweden)

    Elton F. dos Reis


    Full Text Available Os avanços da tecnologia de aplicação aérea de agroquímicos têm-se dado na direção de redução do volume de calda, o que pode ocasionar má distribuição e consequente deposição irregular. O presente trabalho teve como objetivo avaliar a qualidade da aplicação de calda de pulverização em aplicação aérea, na cultura da soja (Glycine Max L.. Para a aplicação, foi utilizada uma aeronave agrícola experimental, aplicando um volume de calda de 20 L ha-1 . Para a determinação dos volumes depositados nas folhas do terço superior, médio e inferior das plantas de soja, foi utilizado corante alimentício azul brilhante adicionado à calda de pulverização. Estas folhas foram lavadas, e o volume determinado por espectrofotometria. Para a obtenção do espectro de gotas, foram utilizados alvos artificiais constituídos por papel hidrossensível, distribuídos no terço superior e médio das plantas. Os dados foram submetidos à análise de variância de fator único, considerando as diferentes posições na planta, e cartas de controle foram feitas a partir dos limites inferior e superior de controle. A aplicação aérea de calda de pulverização na cultura da soja apresentou menores valores de diâmetro da mediana volumétrica, amplitude relativa e cobertura no terço médio em relação ao terço superior da cultura da soja. Houve menor deposição da calda de pulverização no terço inferior. Os indicadores de cobertura da calda de pulverização demonstraram que a aplicação aérea com a aeronave agrícola experimental avaliada não se encontra sob controle estatístico de processo, ou seja, fora do padrão de qualidade.Advances in aerial pesticide application technology of chemicals have been given in the direction of reducing the syrup volume, which can cause poor distribution and consequent irregular deposition. This study aimed to evaluate the quality of the syrup spray on aerial application in soybean crop (Glycine Max

  14. Study of the Quantitative and Qualitative Traits of Four Soybean (Glycine max L. Cultivars under Different Sowing Dates in Shahrekord Region

    Directory of Open Access Journals (Sweden)

    H. Gharakhani Beni


    Full Text Available To study the effect of sowing date on quantitave and qualitative traits of soybean in Shahrekord region, an experiment was performed as split plot based on randomized complete blocks design with four replications at Agricultural and Natural Resources Research Centre of Chaharmahal-va-Bakhtiari, Shahrekord, in 2008. Four sowing dates (May 5, May 20, June 4 and June 19 and four varieties (M9, M7, L17 and Williams were selected as main and sub plots, respectively. Results showed that maximum number of pods per plant, seeds per plant and biological yield were observed for M9 cultivar at 20 May sowing date. This sowing date had also the highest seed weight, oil percent and biological yield comared to other dates. The maximum protein percent was observed in June 4 (37.6% and June 19 (38.4% sowing dates. There was no significant difference between cultivars for oil and protein percent. There was no significant difference between three planting dates of May 5, May 20 and June 4 for seed yield. But minimum seed yield belonged to June 19 sowing date. In general, the M9 cultivar, with 2896.1 kg/ha seed yield, and then M7 cultivar with 2597.7 kg/ha seed yield, are recommendable as suitable soybean cultivars for cultivation in Shahrekord region.

  15. Genetic Analysis of Embryo, Cytoplasm and Maternal Effects and Their Environment Interactions for Isoflavone Content in Soybean [Glycine max(L.) Merr.

    Institute of Scientific and Technical Information of China (English)


    Soybean seed products contain isoflavones (genistein, daidzein, and glycitein) that display biological effects when ingested by humans and animals. These effects are species, dose and age dependent. Therefore, the content and quality of isoflavones in soybeans is a key factor to the biological effect. Our objective was to identify the genetic effects that underlie the isoflavone content in soybean seeds. A genetic model for quantitative traits of seeds in diploid plants was applied to estimate the genetic main effects and genotype × environment (GE) interaction effects for the isoflavone content (IC) of soybean seeds by using two years experimental data with an incomplete diallel mating design of six parents. Results showed that the IC of soybean seeds was simultaneously controlled by the genetic effects of maternal,embryo, and cytoplasm, of which maternal genetic effects were most important, followed by embryo and cytoplasmic genetic effects. The main effects of different genetic systems on IC trait were more important than environment interaction effects. The strong dominance effects on isoflavone from residual was made easily by environment conditions. Therefore,the improvement of the IC of soybean seeds would be more efficient when selection is based on maternal plants than that on the single seed. Maternal heritability (65.73%) was most important for IC, followed by embryo heritability (25.87%) and cytoplasmic heritability (8.39%). Based on predicated genetic effects, Yudou 29 and Zheng 90007 were better than other parents for increasing IC in the progeny and improving the quality of soybean. The significant effects of maternal and embryo dominance effects in variance show that the embryo heterosis and maternal heterosis are existent and uninfluenced by environment interaction effects.

  16. Influência de abelhas africanizadas na concentração de açúcares no néctar de soja (Glycine max L. Merrill var. Coodetec 207 = Influence of africanized honeybees on sugar concentration in the nectar of soybean (Glycine max L. Merrill var. Coodetec 207

    Directory of Open Access Journals (Sweden)

    Eloi Machado Alves


    Full Text Available O objetivo foi avaliar a concentração de açúcares no néctar de soja (Glycine max L. Merrill em áreas com ou sem a presença de abelhas Apis mellifera L. Foi utilizada a variedade Coodetec 207 em quatro tratamentos: área de 24 m2 coberta com colônia de abelhas africanizadas em seu interior; área semicoberta com livre acesso para insetos visitantes; área livre e área coberta sem abelhas. As flores foram coletadas durante três dias, a cada 2h. e a concentração dos açúcares totais por flor foi determinada por espectrofotometria. A área coberta com abelha apresentou maior concentração de açúcares totais em relação à área coberta sem abelhas e livre, contudo, aconcentração de açúcares totais na área livre não diferiu da concentração observada na área coberta sem abelhas. Houve redução na concentração média de sacarose na área livre, diferindo das concentrações nas demais áreas. A concentração média de glicose não diferiu entre os tratamentos, enquanto que a de frutose não apresentou diferença entre as áreas cobertas com abelhas, semicoberta e livre. A variedade Coodetec 207 da soja apresentou maior concentração total de açúcares e de frutose nas áreas cobertas com abelhas. Contudo, a presença de Apis mellifera não interferiu nesta concentração de açúcares no néctar das flores de soja desta variedade.This research was carried out to evaluate the sugar concentration in soybean nectar in areas with Africanized honeybee colonies. The var. Coodetec 207 was used in four treatments: 24 m2 covered area with Africanized honeybee colony inside, semi-covered area for free insect visitation, uncovered area, and covered area without insect visitation. Flowers were harvested for three days at two-hour intervals, and the total sugar concentration per flower was determined by spectrophotometry. The covered area with Africanized honeybee colony presented higher sugar concentration than the covered area

  17. Effect of montmorillonite clay addition on the morphological and physical properties of Jatropha curcas L. and Glycine max L. protein concentrate films (United States)

    Protein concentrates from jatropha (JPC) and soy seeds (SPC) were obtained by solubilization and acid precipitation of proteins. Films from JPC and SPC were prepared by the casting method, using two different montmorillonite (MMT) clay concentrations and plasticized with glycerol. Film properties we...

  18. Nitrogen, phosphor, and potassium nutrients uptake of soybean (Glycine max (L.) Merril) on three levels of radiation intensities and soil moisture content of latosol

    International Nuclear Information System (INIS)

    Syahbuddin, H.; Apriyana, Y.; Heryani, N.; Darmijati, S.; Las, I.


    An experiment was implemented from July to August 1994 in greenhouse of the Ecophysiology Division, Bogor Research Institute for Food Crops using a split-split plot design with three replications. Radiation intensity levels as main plot were: without shelter, 25 percent shelter, and 67 percent shelter. Levels of available water in soil as sub-plot were: less than 25 percent soil water availability, content of soil water availability, and 125 percent soil water availability. Soybean varieties as sub-sub plots were: Wilis, Malabar, and Lokon. The experiment showed that nitrogen and phosphor uptake of Wilis was the highest, 41.228 mg and 1.225 mg per hill, especially under 100 percent light intensity and soil water availability more than 25 percent. Under 25 percent shade the potassium uptake of Wilis was 45.997 mg, this was higher than Malabar. The highest increased in seed dry weight, up to 0.733 g, occurred if soil water content changed from available water to 125 percent water content. One calory decreased in radiation caused 0.006 g decreased in seed dry weight per hill, Malabar variety produced an average of 0.892 g seed dry weight, where each millimeter of water will increased 2.0 mg of dry seed weight. Malabar variety had water use efficiency of 0.043 percent g/ml and radiation use efficiency 0.011 percent g/cal. Malabar variety produced the heaviest 100 good seed (7.293 g), followed by Wilis variety (5.520 g) and Lokon variety (4.597 g) [in

  19. Unraveling the effect of structurally different classes of insecticide on germination and early plant growth of soybean [Glycine max (L.) Merr]. (United States)

    Dhungana, Sanjeev Kumar; Kim, Il-Doo; Kwak, Hwa-Sook; Shin, Dong-Hyun


    Although a considerable number of studies about the effect of different insecticides on plant physiology and metabolism have been carried out, research work about the comparative action of structurally different classes of insecticide on physiological and biochemical properties of soybean seed germination and early growth has not been found. The objective of this study was to investigate the effect of different classes of insecticides on soybean seed germination and early plant growth. Soybean seeds of Bosuk cultivar were soaked for 24h in distilled water or recommended dose (2mLL(-1), 1mLL(-1), 0.5gL(-1), and 0.5gL(-1) water for insecticides Mepthion, Myungtaja, Actara, and Stonate, respectively) of pesticide solutions of four structurally different classes of insecticides - Mepthion (fenitrothion; organophosphate), Myungtaja (etofenprox; pyrethroid), Actara (thiamethoxam; neonicotinoid), and Stonate (lambda-cyhalothrin cum thiamethoxam; pyrethroid cum neonicotinoid) - which are used for controlling stink bugs in soybean crop. Insecticides containing thiamethoxam and lamda-cyhalothrin cum thiamethoxam showed positive effects on seedling biomass and content of polyphenol and flavonoid, however fenitrothion insecticide reduced the seed germination, seed and seedling vigor, and polyphenol and flavonoid contents in soybean. Results of this study reveal that different classes of insecticide have differential influence on physiologic and metabolic actions like germination, early growth, and antioxidant activities of soybean and this implies that yield and nutrient content also might be affected with the application of different types of insecticide. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Biochemical acclimation, stomatal limitation and precipitation patterns underlie decreases in photosynthetic stimulation of soybean (Glycine max) at elevated [CO₂] and temperatures under fully open air field conditions. (United States)

    Rosenthal, David M; Ruiz-Vera, Ursula M; Siebers, Matthew H; Gray, Sharon B; Bernacchi, Carl J; Ort, Donald R


    The net effect of elevated [CO2] and temperature on photosynthetic acclimation and plant productivity is poorly resolved. We assessed the effects of canopy warming and fully open air [CO2] enrichment on (1) the acclimation of two biochemical parameters that frequently limit photosynthesis (A), the maximum carboxylation capacity of Rubisco (Vc,max) and the maximum potential linear electron flux through photosystem II (Jmax), (2) the associated responses of leaf structural and chemical properties related to A, as well as (3) the stomatal limitation (l) imposed on A, for soybean over two growing seasons in a conventionally managed agricultural field in Illinois, USA. Acclimation to elevated [CO2] was consistent over two growing seasons with respect to Vc,max and Jmax. However, elevated temperature significantly decreased Jmax contributing to lower photosynthetic stimulation by elevated CO2. Large seasonal differences in precipitation altered soil moisture availability modulating the complex effects of elevated temperature and CO2 on biochemical and structural properties related to A. Elevated temperature also reduced the benefit of elevated [CO2] by eliminating decreases in stomatal limitation at elevated [CO2]. These results highlight the critical importance of considering multiple environmental factors (i.e. temperature, moisture, [CO2]) when trying to predict plant productivity in the context of climate change. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.


    Directory of Open Access Journals (Sweden)

    D.C.F.S DIAS


    Full Text Available O presente trabalho teve como objetivo investigar a possibilidade de redução do período de condicionamento das sementes nos testes de condutividade elétrica, nos sistemas de massa e individual, e consequentemente, obter indicações mais rápidas sobre a qualidade fisiológica dos lotes. Para tanto, foram utilizados quatro lotes de sementes de soja das variedades IAC-8 e IAC-15 que foram submetidos a estudos específicos de condutividade elétrica de massa e individual (ASA-610, empregando-se períodos de condicionamento de 4, 8, 12, 16, 20 e 24 horas. No sistema de massa foram utilizadas amostras de sementes não danificadas e de sementes fisicamente puras. Nos estudos com o ASA-610 foram testadas as intensidades de corrente elétrica de 95 a 45 mA/semente, em intervalos de 5mA. Além destes foram conduzidos os seguintes testes: germinação, primeira contagem de germinação, envelhecimento artificial e determinação do grau de umidade das sementes. Os resultados indicaram que há possibilidade de redução no período de condicionamento das sementes no teste de condutividade de massa, sendo que os períodos de embebição mais curtos (4 e 8 horas permitiram a identificação de diferenças mais acentuadas entre os lotes, enquanto que leituras realizadas a partir de 16 horas mostraram-se mais sensíveis às variações de vigor das sementes. O referido teste mostrou-se adequado para a identificação de lotes com diferentes níveis de vigor. Já a condutividade individual (ASA-610 revelou eficiência variável de acordo com a variedade avaliada.To investigate the reduction of the seed soaking time, in bulk and individualy, conductivity tests were performed on four seed lots of two soybean varieties (IAC-8 and IAC-15. The following tests were conducted: standard germination, first count of standard germination, accelerated aging and seed moisture. Studies of bulk and individual (ASA-610 seed conductivity were conducted with 4, 8, 12, 16

  2. Rate and time of nitrogen fertilizer application on the growth, nitrogen remobilization and yield of soyabean (Glycine max(L) Merrill)

    International Nuclear Information System (INIS)

    Bebeley, J. F.; Sarkodie-Addo; Duku, S.


    Two field experiments were conducted in 2012 at the plantation Crop section of the Department of Crop and Soil Sciences, Kwame Nkrumah University of Science and Technology, to investigate the effect N availability on nodulation, nitrogen fixation, N remobilization and grain yield of soybean. The design used in both studies was a 3 x 4 factorial arranged in randomized complete block design. Each treatment was replicated three times. The factors studied were rate and time of N fertilizer application. The N rate were 0, 20, 40 and 60kg N/ha and the time of application were early vegetative and early flowering phases. Anidaso, an improved soybean variety of 110 days maturity was used. Following land preparation, seeds were planted at the beginning of the rains at a spacing of 50 x 5cm. All required cultural practices were observed. Data collected were nodule number per plant and nodule dry weight, number of pods per plant, number of seeds per pod, 100 seeds weight, total nitrogen fixed, harvest index, grain yield and remobilized N. The total nitrogen difference method was used in determining the amount of N 2 fixed by the soybean and the micro kjeldahl method was used in determining the total plant N. The results indicated that nodulation was not significantly (p>0.05) affected by N rate and time of N application. However Nitrogen fixation was significantly (p<0.05 in affected time of N application in the minor season. Harvest index was significantly affected time of N application in the major season. Grain yield was also significantly affected by time of N application in both seasons. The results indicate that if farmers would apply N fertilizer to soybean at the vegetative growth phase, there would be increase in yield. The study also demonstrate that N remobilization occurs in soybean during grain filling although rate and time of application used did not significantly (p>0.05) affect N remobilization. (au)

  3. Efecto del boro, zinc y el azufre sobre la doble finalidad (forraje y grano del cultivo de soya Glycine max (L Merr

    Directory of Open Access Journals (Sweden)

    Restrepo S. L. Diego


    Full Text Available El diseño experimental empleado fue el de bloques completamente al azar, con cinco repeticiones y nueve tratamientos constituidos por: un testigo absoluto (no podado, ni fertilizado, un testigo normal (podado, no fertilizado, el resto de tratamientos fueron podados y fertilizados de la siguiente manera: boro, zinc, azufre, boro + zinc, boro + azufre, zinc + azufre, boro + zinc + azufre, esta fertilización se hizo al suelo al momento de la siembra. La variedad empleada fue Andree-23 con una densidad de población de 600.000 plantas /ha, con surcos separados a 40 cm, el corte se realizó a los 38 días de emergencia o sea al inicio de floración a un 40% de altura. La poda total ejerce efecto negativo sobre la producción de grano al reducirlo en un 53%, pero aumenta el número de ramas. La fertilización solo fue favorable en la altura de planta y en la reducción de vainas sin semilla; en las demás variables (número pe vainas/planta, número de semillas/ vaina, peso promedio de cien semillas, etc. no se presentó ninguna incidencia.The experiment pretended to watch the soybean's behavior submited to pruness by realizing fertilization with boron, cinc and sulphur and their influence over seed and f or age yield. Experimental design used was blocks by random completely, with five repetitions and nine treatments set up by: an absolute control (no pruned, no fertilized, a normal control (pruned, no fertilized, other treatments were pruned and fertilized by this way: boron, cinc, sulphur, boron + cinc, boron + sulphur, cinc + sulphur, boron + cinc + sulphur, this fertilization was made to soil in sowing moment. The variety was Andree-23 (600.000 plants /ha., with forrows separated by 40 cm, cutting was made 38 days after emergetion. The whole pruness makes a negative effect over seed yield by decreasing it about 53 percent, but arise branche number. Fertilization only was good for height plant and empty pods reduction; over other variables (pod

  4. Correlation and Principal Component Analysis for Traits of Soybean ( Glycine max) in the West Semiarid Region of Heilongjiang Province%黑龙江省西部半干旱地区大豆性状的相关性和主成分分析

    Institute of Scientific and Technical Information of China (English)

    韩毅强; 杜吉到; 郑殿峰; 张玉先; 张文慧


    [Objective] The aim was to understand the correlative variance and adaptability of the main traits of soybean in the west semiarid region of Heilongjiang Province. [Method] Seventeen agronomic traits of ninety-three soybean varieties were analyzed with the method of correlation and cluster analysis. [ Result] The results showed that there was a significant correlation between yield and pods per plant, three-seed pods, four-seed pods, seeds per plant, 100-seed weight, oil content etc. Principal component analysis showed that the variance of the first six principal component contrihuted to above 80% , which explained the most biology traits, and principal 1,2,4 reflected the main yield relative traits, and principal 3,5,6 reflected the main quality relative traits. [ Conclusion ] The study provides a theoretical basis for choosing soybean hybridization parents and reasonably utilizing its resources.%[目的]为了掌握不同大豆(Glycine max)品种(系)主要农艺性状在黑龙江省西部半干旱地区环境下的相关变异及适应性.[方法]以93份大豆为材料,对大豆17个农艺性状进行了相关性和主成分分析.[结果]产量与单株有效英数、单株3粒英数、单株4粒英数、单株粒数、百粒重和脂肪含量等性状呈显著相关.主成分分析表明,前6个主成分的方差累计贡献率大于80%,可解释生物学性状的绝大部分信息,其中主成分1、2、4主要反映产量相关性状,主成分3、5、6主要反映品质相关性状.[结论]该研究可为大豆杂交亲本的选择和资源的利用提供理论依据.

  5. Influence of planting date on seed protein oil sugars minerals and nitrogen metabolism in soybean under irrigated and non-irrigated enviroments (United States)

    Information on the effect of planting date and irrigation on soybean [Glycine max (L.) Merr.] seed composition in the Early Soybean Production System is deficient, and what is available is inconclusive. The objective of this research was to investigate the effects of planting date on seed protein, o...

  6. Effects of heavy metal concentrations (Cd, Zn and Pb) in agricultural soils near different emission sources on quality, accumulation and food safety in soybean [Glycine max (L.) Merrill]. (United States)

    Salazar, María Julieta; Rodriguez, Judith Hebelen; Leonardo Nieto, Gastón; Pignata, María Luisa


    Argentina is one of the major producers of soybean in the world, this generates a high global demand for this crop leading to find it everywhere, even close to human activities involving pollutant emissions. This study evaluated heavy metal content, the transfer of metals and its relation to crop quality, and the toxicological risk of seed consumption, through soil and soybean sampling. The results show that concentrations of Pb and Cd in soils and soybeans at several sites were above the maximum permissible levels. The heavy metal bioaccumulation depending on the rhizosphere soil compartment showed significant and high regression coefficients. In addition, the similar behavior of Cd and Zn accumulation by plants reinforces the theory of other studies indicating that these metals are incorporated into the plant for a common system of transport. On the other hand, the seed quality parameters did not show a clear pattern of response to metal bioacumulation. Taken together, our results show that soybeans grown nearby to anthropic emission sources might represent a toxicological hazard for human consumption in a potential Chinese consumer. Hence, further studies should be carried out taking into account the potential negative health effects from the consumption of soybeans (direct or indirect through consumption of meat from cattle) in these conditions. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Effects of heavy metal concentrations (Cd, Zn and Pb) in agricultural soils near different emission sources on quality, accumulation and food safety in soybean [Glycine max (L.) Merrill

    International Nuclear Information System (INIS)

    Salazar, María Julieta; Rodriguez, Judith Hebelen; Nieto, Gastón Leonardo; Pignata, María Luisa


    Highlights: ► Soybean grown near metal sources presents a toxicological hazard from heavy metals for Chinese consumers. ► Rhizosphere soil is the most suitable compartment for toxicological studies. ► Soil guidelines should be modified considering the exchangeable metals. - Abstract: Argentina is one of the major producers of soybean in the world, this generates a high global demand for this crop leading to find it everywhere, even close to human activities involving pollutant emissions. This study evaluated heavy metal content, the transfer of metals and its relation to crop quality, and the toxicological risk of seed consumption, through soil and soybean sampling. The results show that concentrations of Pb and Cd in soils and soybeans at several sites were above the maximum permissible levels. The heavy metal bioaccumulation depending on the rhizosphere soil compartment showed significant and high regression coefficients. In addition, the similar behavior of Cd and Zn accumulation by plants reinforces the theory of other studies indicating that these metals are incorporated into the plant for a common system of transport. On the other hand, the seed quality parameters did not show a clear pattern of response to metal bioacumulation. Taken together, our results show that soybeans grown nearby to anthropic emission sources might represent a toxicological hazard for human consumption in a potential Chinese consumer. Hence, further studies should be carried out taking into account the potential negative health effects from the consumption of soybeans (direct or indirect through consumption of meat from cattle) in these conditions.

  8. Genetic mapping and validation of the loci controlling 7S α' and 11S A-type storage protein subunits in soybean [Glycine max (L.) Merr.]. (United States)

    Boehm, Jeffrey D; Nguyen, Vi; Tashiro, Rebecca M; Anderson, Dale; Shi, Chun; Wu, Xiaoguang; Woodrow, Lorna; Yu, Kangfu; Cui, Yuhai; Li, Zenglu


    Four soybean storage protein subunit QTLs were mapped using bulked segregant analysis and an F 2 population, which were validated with an F 5 RIL population. The storage protein globulins β-conglycinin (7S subunit) and glycinin (11S subunits) can affect the quantity and quality of proteins found in soybean seeds and account for more than 70% of the total soybean protein. Manipulating the storage protein subunits to enhance soymeal nutrition and for desirable tofu manufacturing characteristics are two end-use quality goals in soybean breeding programs. To aid in developing soybean cultivars with desired seed composition, an F 2 mapping population (n = 448) and an F 5 RIL population (n = 180) were developed by crossing high protein cultivar 'Harovinton' with the breeding line SQ97-0263_3-1a, which lacks the 7S α', 11S A 1 , 11S A 2 , 11S A 3 and 11S A 4 subunits. The storage protein composition of each individual in the F 2 and F 5 populations were profiled using SDS-PAGE. Based on the presence/absence of the subunits, genomic DNA bulks were formed among the F 2 plants to identify genomic regions controlling the 7S α' and 11S protein subunits. By utilizing polymorphic SNPs between the bulks characterized with Illumina SoySNP50K iSelect BeadChips at targeted genomic regions, KASP assays were designed and used to map QTLs causing the loss of the subunits. Soybean storage protein QTLs were identified on Chromosome 3 (11S A 1 ), Chromosome 10 (7S α' and 11S A 4 ), and Chromosome 13 (11S A 3 ), which were also validated in the F 5 RIL population. The results of this research could allow for the deployment of marker-assisted selection for desired storage protein subunits by screening breeding populations using the SNPs linked with the subunits of interest.


    Directory of Open Access Journals (Sweden)

    A. V. Amelin


    Full Text Available The thematic core facilities plan, CCU of Orel state agrarian university "Genetic resources of plants and their use" for a joint program with Shatilovskay of Institute of leguminous and cereal crops, of field and vegetation experiments on the study of specific features of manifestation of the activity of transpiration leaves of soybean are achieved. The object of the study were 10 varieties of soybeans that were grown on plots of 15 m2 in four replications. Seeding was carried out breeding seeder calculated 600 thousand of viable seeds per hectare. the way the plots were allocated systematically with offset. The care of crops was carried out in accordance with the recommended regional events. It was demonstrated that leaf transpiration activity of the culture increases sharply in the transition of plants to the generative period of development, reaching a maximum in the phase of mass fruit formation, when the most active growth and, consequently, the demand for assimilate. The intensity of transpiration of leaves during this period of plant development was by 8.22 mmol H2O/m2c. The highest transpiration activity was typical for the upper leaves located in the generative sphere of plants, the lowest - activity was fount for the lowerst leaves. On the 5th node from the bottom, its value was 2.2 times lower compared to the assimilating leaves at the top of the plants (3-4 knots top. Thus, the most intensive evaporation of the water by leaves are held from 9:00 to 13:00 hours Moscow time. The intensity of transpiration in this period amounted to an average of 5.42 mmol H2O/m2c, which was 19.9% higher than in the morning (from 7:00 to 8:00 and 42.3% in the afternoon (from 15:00 to 17:00.

  10. The effect of nano-silica fertilizer concentration and rice hull ash doses on soybean (Glycine max (L.) Merrill) growth and yield (United States)

    Suciaty, T.; Purnomo, D.; Sakya, A. T.; Supriyadi


    Agriculture is facing a number of challenges included limited water supply, low nutrient use efficiency, etc affected by climate change. Nano-silica is a product of nanotechnology, the frontier technologies to enhance crop productivity under climate change threats. The purpose of the research was to investigate the effects of nano silica concentration and rice hull ash on growth and yield of soybean. The experiment was conducted at Gagasari village, Cirebon, West Java from March until June 2017. The treatments were arranged by using factorial completely randomized block design with two factors. The first factor was a concentration of nano silica fertilizer consisted of four levels i.e., 0, 1.75, 2.5, and 3.75 ml.l‑1. The second factor was doses of rice hull ash consisted of four levels i.e., 0, 1, 2, and 3 ton.ha‑1. Each treatment combinations was repeated three times. The result showed that concentration of nano silica individually affected the number of leaves and number of branches, NAR and RGR, productive branches at 21, 30-45, and 35 daps, respectively. It also affected the seed dry weight plant‑1 and plot‑1. Meanwhile, doses of rice hull ash affected LAI, NAR, and RGR, 15-30, and 30-45 dap, respectively. Dry seed weight plot‑1 was also affected by doses of rice hull ash. There was an interaction effect between nano-silica concentration and doses of rice hull ash on number pods.plant‑1. Combinations of 2.5 ml.l‑1 nano-silica and 3 ton.ha‑1 of rice hull ash gave the highest number pods.plant‑1.

  11. Effects of heavy metal concentrations (Cd, Zn and Pb) in agricultural soils near different emission sources on quality, accumulation and food safety in soybean [Glycine max (L.) Merrill

    Energy Technology Data Exchange (ETDEWEB)

    Salazar, Maria Julieta [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina); Rodriguez, Judith Hebelen, E-mail: [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina); Nieto, Gaston Leonardo; Pignata, Maria Luisa [Multidisciplinary Institute of Plant Biology, Pollution and Bioindicator Section, Faculty of Physical and Natural Sciences, National University of Cordoba, Av. Velez Sarsfield 1611, X5016CGA Cordoba (Argentina)


    Highlights: Black-Right-Pointing-Pointer Soybean grown near metal sources presents a toxicological hazard from heavy metals for Chinese consumers. Black-Right-Pointing-Pointer Rhizosphere soil is the most suitable compartment for toxicological studies. Black-Right-Pointing-Pointer Soil guidelines should be modified considering the exchangeable metals. - Abstract: Argentina is one of the major producers of soybean in the world, this generates a high global demand for this crop leading to find it everywhere, even close to human activities involving pollutant emissions. This study evaluated heavy metal content, the transfer of metals and its relation to crop quality, and the toxicological risk of seed consumption, through soil and soybean sampling. The results show that concentrations of Pb and Cd in soils and soybeans at several sites were above the maximum permissible levels. The heavy metal bioaccumulation depending on the rhizosphere soil compartment showed significant and high regression coefficients. In addition, the similar behavior of Cd and Zn accumulation by plants reinforces the theory of other studies indicating that these metals are incorporated into the plant for a common system of transport. On the other hand, the seed quality parameters did not show a clear pattern of response to metal bioacumulation. Taken together, our results show that soybeans grown nearby to anthropic emission sources might represent a toxicological hazard for human consumption in a potential Chinese consumer. Hence, further studies should be carried out taking into account the potential negative health effects from the consumption of soybeans (direct or indirect through consumption of meat from cattle) in these conditions.

  12. Increasing seed size and quality by manipulating BIG SEEDS1 in legume species. (United States)

    Ge, Liangfa; Yu, Jianbin; Wang, Hongliang; Luth, Diane; Bai, Guihua; Wang, Kan; Chen, Rujin


    Plant organs, such as seeds, are primary sources of food for both humans and animals. Seed size is one of the major agronomic traits that have been selected in crop plants during their domestication. Legume seeds are a major source of dietary proteins and oils. Here, we report a conserved role for the BIG SEEDS1 (BS1) gene in the control of seed size and weight in the model legume Medicago truncatula and the grain legume soybean (Glycine max). BS1 encodes a plant-specific transcription regulator and plays a key role in the control of the size of plant organs, including seeds, seed pods, and leaves, through a regulatory module that targets primary cell proliferation. Importantly, down-regulation of BS1 orthologs in soybean by an artificial microRNA significantly increased soybean seed size, weight, and amino acid content. Our results provide a strategy for the increase in yield and seed quality in legumes.

  13. Magnetic molecularly imprinted polymers based on silica modified by deep eutectic solvents for the rapid simultaneous magnetic-based solid-phase extraction of Salvia miltiorrhiza bunge, Glycine max (Linn.) Merr and green tea. (United States)

    Li, Guizhen; Wang, Xiaoqin; Row, Kyung Ho


    Novel magnetic molecularly imprinted polymers (MMIPs) with multiple-template based on silica were modified by four types of deep eutectic solvents (DESs) for the rapid simultaneous magnetic solid-phase extraction (MSPE) of tanshinone Ⅰ, tanshinone ⅡA, and cryptotanshinone from Salvia miltiorrhiza bunge; glycitein, genistein, and daidzein from Glycine max (Linn.) Merr; and epicatechin, epigallocatechin gallate, and epicatechin gallate from green tea, respectively. The synthesized materials were characterized by Fourier transform infrared spectroscopy and field emission scanning electron microscopy. Single factor experiments were to explore the relationship between the extraction efficiency and four factors (the sample solution pH, amount of DESs for modification, amount of adsorbent, and extraction time). It was showed that the DES4-MMIPs have better extraction ability than the MMIPs without DESs and the other three DESs-modified MMIPs. The best extraction recoveries with DES4-MMIP were tanshinone Ⅰ (85.57%), tanshinone ⅡA (80.58%), cryptotanshinone (92.12%), glycitein (81.65%), genistein (87.72%), daidzein (92.24%), epicatechin (86.43%), epigallocatechin gallate (80.92%), and epicatechin gallate (93.64%), respectively. The novel multiple-template MMIPs materials modified by DES for the rapid simultaneous MSPE of active compounds were proved to reduce the experimental steps than single-template technique, and increase the extraction efficiency. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Study of Agronomical and Ecological Parameters of Additive and Replacement Intercropping Systems of Corn (Zea maize L. and Soybean (Glycine max L. Merr.

    Directory of Open Access Journals (Sweden)

    Issa Piri


    Full Text Available Introduction Intercropping is a multiple cropping agricultural practice involves growing two or more crops in close proximity. Intercropping of compatible plants also encourages biodiversity, by providing a habitat for a variety of insects and soil organisms that would not be present in a monocrop environment. This in turn can help limit outbreaks of crop pests by increasing predator biodiversity. Additionally, reducing the homogeneity of crops increases the barriers against biological dispersal of pests through the crops. Cereal–legume intercropping plays an important role in subsistence food production in developing countries, especially in the situations of limited resources. Nitrogen fixing legumes can be included to a greater extent in arable cropping systems via intercrops. Legumes contribute to maintaining the soil fertility via nitrogen fixation, which is increased in intercrops due to the more competitive character of the cereal for soil inorganic N. Ariel et al., (2013 showed that,Legume-Cereal Intercropping of corn and soybean may be advantageous compared to monocultures. Corn and soybean intercropping produce high yields of green matter and seed concentrates especially when the corn-soybean ratio is 1:2. Due to the importance of cereal–legume intercropping in the sustainability of agricultural systems, the objective of this study was to determine the effects of cereal-legume intercropping on the total biomass and grain yield and to find the best pattern of additive and replacement intercropping systems in Iranshahr Region. Material and Methods In order to study the agronomical and ecological parameters of additive and replacement intercropping systems of corn and soybean, a field experiment was conducted in 2012-13 in the south of Iranshahr city on a randomized complete block design with three replications. Treatments consisted of 8 different intercropping ratios: corn monoculture (C100S0 and soybean monoculture (C0S100 as sole

  15. Influence of Agricultural Practices on Biotic Production Potential and Climate Regulation Potential. A Case Study for Life Cycle Assessment of Soybean (Glycine max in Argentina

    Directory of Open Access Journals (Sweden)

    Roxana Piastrellini


    Full Text Available The aim of this study is to determine the impact potential of land use on biotic production and climate regulation in the agricultural phase of a product, taking into account the varied soil and crop management. Land occupation and transformation impacts of soybean production in Argentina for different agricultural systems are evaluated. The results indicate that the magnitude of occupation and transformation impacts is considerably reduced by implementing no-tillage instead of conventional tillage. Nevertheless, the methodologies adopted are unable to show any of the expected differences between rainfed or irrigation systems, crop sequences and delays in seed-planting, due to failures in the specific characterization factors. On the other hand, an uncertainty is demonstrated by the results associated with the choice of regeneration time corresponding to the different ecoregions over which soybean cultivation extends across the country. One of the recommendations that comes to the fore is to consider in the characterization factors increments in the soil organic carbon stock and in the mineralization rates, associated with the presence of the preceding crop and the greater availability of water in the soil of irrigated systems.

  16. Effect of organic fertiliser residues from rice production on nitrogen fixation of soya (Glycine max L. Merrill, Chiang Mai 60 variety

    Directory of Open Access Journals (Sweden)

    Nattida Luangmaka


    Full Text Available A field study was undertaken on the residual effect of organic fertilisers applied to the preceding rice cropping on nitrogen fixation of soya in a rice-soya cropping system. The experiment was conducted on a farmer’s lowland paddy in Mae Rim district, Chiang Mai province, Thailand. Organic fertiliser treatments assigned were: 1 control (no fertiliser, 2 animal manure of cattle (AM, 3 compost (CP, 4 azolla (AZ, 5 AM + CP, 6 AM + AZ, 7 CP + AZ and 8 AM + CP + AZ. Soya seeds were planted without rhizobial inoculation in December 2011, four months after the application of organic fertilisers. Nodule weight, total shoot nitrogen accumulation and relative ureide index at various growth stages were recorded as the indices of nitrogen fixation. Results of the study demonstrate that the residues from the application the organic fertilisers of narrow C/N ratios during the land preparation for rice cropping four months before soya cultivation promoted nitrogen fixation by native rhizobia.

  17. Comparative Transcriptome Analysis between the Cytoplasmic Male Sterile Line NJCMS1A and Its Maintainer NJCMS1B in Soybean (Glycine max (L. Merr..

    Directory of Open Access Journals (Sweden)

    Jiajia Li

    Full Text Available The utilization of soybean heterosis is probably one of the potential approaches in future yield breakthrough as was the situation in rice breeding in China. Cytoplasmic male sterility (CMS plays an important role in the production of hybrid seeds. However, the molecular mechanism of CMS in soybean remains unclear.The comparative transcriptome analysis between cytoplasmic male sterile line NJCMS1A and its near-isogenic maintainer NJCMS1B in soybean was conducted using Illumina sequencing technology. A total of 88,643 transcripts were produced in Illumina sequencing. Then 56,044 genes were obtained matching soybean reference genome. Three hundred and sixty five differentially expressed genes (DEGs between NJCMS1A and NJCMS1B were screened by threshold, among which, 339 down-regulated and 26 up-regulated in NJCMS1A compared to in NJCMS1B. Gene Ontology (GO annotation showed that 242 DEGs were annotated to 19 functional categories. Clusters of Orthologous Groups of proteins (COG annotation showed that 265 DEGs were classified into 19 categories. Kyoto Encyclopedia of Genes and Genomes (KEGG analysis showed that 46 DEGs were assigned to 33 metabolic pathways. According to functional and metabolic pathway analysis combined with reported literatures, the relations between some key DEGs and the male sterility of NJCMS1A were discussed. qRT-PCR analysis validated that the gene expression pattern in RNA-Seq was reliable. Finally, enzyme activity assay showed that energy supply was decreased in NJCMS1A compared to in NJCMS1B.We concluded that the male sterility of NJCMS1A might be related to the disturbed functions and metabolism pathways of some key DEGs, such as DEGs involved in carbohydrate and energy metabolism, transcription factors, regulation of pollen development, elimination of reactive oxygen species (ROS, cellular signal transduction, and programmed cell death (PCD etc. Future research will focus on cloning and transgenic function validation of

  18. Physicochemical, thermal and functional characterisation of protein isolates from Kabuli and Desi chickpea (Cicer arietinum L.): a comparative study with soy (Glycine max) and pea (Pisum sativum L.). (United States)

    Withana-Gamage, Thushan S; Wanasundara, Janitha P D; Pietrasik, Zeb; Shand, Phyllis J


    Chickpea (Cicer arietinum L.) seeds are a good source of protein that has potential applications in new product formulation and fortification. The main objectives of this study were to analyse the physicochemical, thermal and functional properties of chickpea protein isolates (CPIs) and compare them with those of soy (SPI) and pea (PPI) protein isolates. Extracted CPIs had mean protein contents of 728-853 g kg(-1) (dry weight basis). Analysis of their deconvoluted Fourier transform infrared spectra gave secondary structure estimates of 25.6-32.7% α-helices, 32.5-40.4% β-sheets, 13.8-18.9% turns and 16.3-19.2% disordered structures. CPIs from CDC Xena, among Kabuli varieties, and Myles, among Desi varieties, as well as SPI had the highest water-holding and oil absorption capacities. The emulsifying properties of Kabuli CPIs were superior to those of PPI and Desi CPIs and as good as those of SPI. The heat-induced gelation properties of CPIs showed a minimum protein concentration required to form a gel structure ranging from 100 to 140 g L(-1) . Denaturation temperatures and enthalpies of CPIs ranged from 89.0 to 92.0 °C and from 2.4 to 4.0 J g(-1) respectively. The results suggest that most physicochemical, thermal and functional properties of CPIs compare favourably with those of SPI and are better than those of PPI. Hence CPI may be suitable as a high-quality substitute for SPI in food applications. Copyright © 2011 Society of Chemical Industry.

  19. Efecto de algunos fungicidas sobre la interacción Rhizoctonia solani Kuhn-Micorriza vesículo arbuscular en soya, Glycine max Merril

    Directory of Open Access Journals (Sweden)

    Sánchez de Prager Marina


    Full Text Available En el campo se dispuso de dos preparaciones de suelo: natural y desinfectado químicamente (Ditrapex-CE y en el invernadero de suelo esterilizado con vapor. Se utilizaron los fungicidas Propamocarb, SN-84364, PCNB y Vitavax-300. Se contó con la flora micorrizógena natural y una cepa introducida, Glomus manihotis. R. solani disminuyó en un 50 % la emergencia de la soya, comportándose más agresivo en suelo desinfectado. En los primeros 15 días su ataque se incrementó y redujo el desarrollo de MVA en suelo natural. Al avanzar la edad de la planta decreció su infección. Con relación a la MVA la tendencia es contraria. La presencia de la MVA, incluyendo G. manihotis no incrementó significativamente la materia seca y el rendimiento de la soya. Al desinfectar el suelo los fungicidas afectaron negativamente la infección micorrizógena, mientras que en suelo natural no sucedió este fenómeno, al contrario SN-84364 incrementó su presencia. Este producto es el que menos afecta la simbiosis en el suelo desinfectado. Los fungicidas SN-84364 y PCNB mostraron gran especificidad contra R. solani y Vitavax-300 mayor espectro de acción.With the object to evaluate in the soybeans crop behavior in the interaction of Rhizoctonia solani, vesicular-arbuscular mycorrhizae (VAM and fungicides used to treatment of seed, two different soil preparations were used in the field trials: natural and chemically disinfected (Ditrapex-CE and under greenhouse: using vapor- sterilized. Was utilized the fungicides Propamocarb, SN-84364, PCNB y Vitavax- 300. Be had into account the natural mycorrhizal flora and a source of Glomus manihotis introduced. R. solani reduced the emergence of soybean by 50%, the above-metioned pathogen was more agressive in disinfected soil. In the 15 days first the attack increased and reduced the VAM development in the natural soil. With the age of the plant the pathogen infection decreased. With relation by VAM is contrary the tendency

  20. Effect of Cover Crops on Vertical Distribution of Leaf Area and Dry Matter of Soybean (Glycine max L. in Competition with Weeds

    Directory of Open Access Journals (Sweden)

    seyyedeh samaneh hashemi


    Full Text Available Introduction Amount and vertical distribution of leaf area are essential for estimating interception and utilization of solar radiation of crop canopies and, consequently dry matter accumulation (Valentinuz & Tollenaar, 2006. Vertical distribution of leaf area is leaf areas per horizontal layers, based on height (Boedhram et al., 2001. Above-ground biomass is one of the central traits in functional plant ecology and growth analysis. It is a key parameter in many allometric relationships (Niklas & Enquist, 2002. The vertical biomass distribution is considered to be the main determinant of competitive strength in plant species. The presence of weeds intensifies competition for light, with the effect being determined by plant height, position of the branches, and location of the maximum leaf area. So, this experiment was conducted to study the vertical distribution of leaf area and dry matter of soybean canopy in competition with weeds and cover crops. Materials and methods This experiment was performed based on complete randomized block design with 3 replications in center of Agriculture of Joybar in 2013. Soybean was considered as main crop and soybean and Persian clover (Trifolium resupinatum L., fenugreek (Trigonella foenum–graecum L., chickling pea (Lathyrus sativus L. and winter vetch (Vicia sativa L. were the cover crops. Treatments were included cover crops (Persian clover, fenugreek, chickling pea and winter vetch and cover crop planting times (simultaneous planting of soybean with cover crops and planting cover crops three weeks after planting of soybeans and also monoculture of soybeans both in weedy and weed free conditions were considered as controls. Soybean planted in 50 cm row spacing with 5 cm between plants in the same row. Each plot was included 5 rows soybeans. Cover crop inter-seeded simultaneously in the main crop. Crops were planted on 19 May 2013 for simultaneous planting of soybean. The dominant weed species were green

  1. Gamma radiation effects on crude oil yield of some soybean seeds ...

    African Journals Online (AJOL)

    Abstract. Purpose: To investigate the crude oil yield of eight different varieties of soybean (Glycine max L.) seeds ... the health advantages of soybeans in both in vivo and in vitro experiments [2]. Therefore, plant breeding has gained importance especially soybean plants. ..... Ionizing radiation might affect the quality of oils.

  2. Enviromental Effects on Oleic Acid in Soybean Seed Oil of Plant Introductions with Elevated Oleic Concentration (United States)

    Soybean [Glycine max (L.) Merr.] oil with oleic acid content >500 g per kg is desirable for a broader role in food and industrial uses. Seed oil in commercially grown soybean genotypes averages about 230 g per kg oleic acid (18:1). Some maturity group (MG) II to V plant introductions (PIs) have el...

  3. Differential gene expression and mitotic cell analysis of the drought tolerant soybean (Glycine max L. Merrill Fabales, Fabaceae cultivar MG/BR46 (Conquista under two water deficit induction systems

    Directory of Open Access Journals (Sweden)

    Polyana K. Martins


    Full Text Available Drought cause serious yield losses in soybean (Glycine max, roots being the first plant organ to detect the water-stress signals triggering defense mechanisms. We used two drought induction systems to identify genes differentially expressed in the roots of the drought-tolerant soybean cultivar MG/BR46 (Conquista and characterize their expression levels during water deficit. Soybean plants grown in nutrient solution hydroponically and in sand-pots were submitted to water stress and gene expression analysis was conducted using the differential display (DD and real time polymerase chain reaction (PCR techniques. Three differentially expressed mRNA transcripts showed homology to the Antirrhinum majus basic helix-loop-helix transcription factor bHLH, the Arabidopsis thaliana phosphatidylinositol transfer protein PITP and the auxin-independent growth regulator 1 (axi 1. The hydroponic experiments showed that after 100 min outside the nutrient solution photosynthesis completely stopped, stomata closed and leaf temperature rose. Both stress induction treatments produced significant decrease in the mitotic indices of root cells. Axi 1, PITP and bHLH were not only differentially expressed during dehydration in the hydroponics experiments but also during induced drought in the pot experiments. Although, there were differences between the two sets of experiments in the time at which up or down regulation occurred, the expression pattern of all three transcripts was related. Similar gene expression and cytological analysis results occurred in both systems, suggesting that hydroponics could be used to simulate drought detection by roots growing in soil and thus facilitate rapid and easy root sampling.

  4. The symbiotic biofilm of Sinorhizobium fredii SMH12, necessary for successful colonization and symbiosis of Glycine max cv Osumi, is regulated by Quorum Sensing systems and inducing flavonoids via NodD1.

    Directory of Open Access Journals (Sweden)

    Francisco Pérez-Montaño

    Full Text Available Bacterial surface components, especially exopolysaccharides, in combination with bacterial Quorum Sensing signals are crucial for the formation of biofilms in most species studied so far. Biofilm formation allows soil bacteria to colonize their surrounding habitat and survive common environmental stresses such as desiccation and nutrient limitation. This mode of life is often essential for survival in bacteria of the genera Mesorhizobium, Sinorhizobium, Bradyrhizobium, and Rhizobium. The role of biofilm formation in symbiosis has been investigated in detail for Sinorhizobium meliloti and Bradyrhizobium japonicum. However, for S. fredii this process has not been studied. In this work we have demonstrated that biofilm formation is crucial for an optimal root colonization and symbiosis between S. fredii SMH12 and Glycine max cv Osumi. In this bacterium, nod-gene inducing flavonoids and the NodD1 protein are required for the transition of the biofilm structure from monolayer to microcolony. Quorum Sensing systems are also required for the full development of both types of biofilms. In fact, both the nodD1 mutant and the lactonase strain (the lactonase enzyme prevents AHL accumulation are defective in soybean root colonization. The impairment of the lactonase strain in its colonization ability leads to a decrease in the symbiotic parameters. Interestingly, NodD1 together with flavonoids activates certain quorum sensing systems implicit in the development of the symbiotic biofilm. Thus, S. fredii SMH12 by means of a unique key molecule, the flavonoid, efficiently forms biofilm, colonizes the legume roots and activates the synthesis of Nod factors, required for successfully symbiosis.

  5. Weed Control in Soybean (Glycine max)

    International Nuclear Information System (INIS)

    Kipkemoi, P.L.


    Weed Compete for limited growth factors with crop plants. This result in loss of crop vigour and hence reduces crop yields. A study was conducted in 1997 and 2001 to evaluate the use of herbicides and hand hoeing for weed control in soybeans. Crop establishment was by hand planting. The herbicides were applied using CP3 Knap sack sprayer calibrated to deliver a spray volume of 150l/ha. Hand weeding treatment were done as appropriate. The trial layout was randomised complete block design with four replications in both years. The tested herbicides did not satisfactorily control the weeds present at the experimental site in both years. Hand weeding on the other hand gave good control of the weeds which were reflected in high soybean yields. In these trials yields were negatively correlated with the number of weeds present. The tested herbicides alone appeared to be inadequate in controlling weeds in soybean. Compared with the weed-free treatment a single application of soil-applied or post-emergence herbicides did not control a broad spectrum of weeds and reduced soybean yields. It can also be inferred that soybean yield losses are minimised if they are kept weed free for at most 6 weeks after emergence

  6. Seed-borne pathogens and electrical conductivity of soybean seeds

    Directory of Open Access Journals (Sweden)

    Adriana Luiza Wain-Tassi


    Full Text Available Adequate procedures to evaluate seed vigor are important. Regarding the electrical conductivity test (EC, the interference in the test results caused by seed-borne pathogens has not been clarified. This research was carried out to study the influence of Phomopsis sojae (Leh. and Colletotrichum dematium (Pers. ex Fr. Grove var. truncata (Schw. Arx. fungi on EC results. Soybean seeds (Glycine max L. were inoculated with those fungi using potato, agar and dextrose (PDA medium with manitol (-1.0 MPa and incubated for 20 h at 25 °C. The colony diameter, index of mycelial growth, seed water content, occurrence of seed-borne pathogens, physiological potential of the seeds, measured by germination and vigor tests (seed germination index, cold test, accelerated aging and electrical conductivity, and seedling field emergence were determined. The contents of K+, Ca2+, and Mg2+ in the seed and in the soaking solution were also determined. A complete 2 × 4 factorial design with two seed sizes (5.5 and 6.5 mm and four treatments (control, seeds incubated without fungi, seeds incubated with Phomopsis and seeds incubated with Colletotrichum were used with eight (5.5 mm large seeds and six (6.5 mm large seeds replications. All seeds submitted to PDA medium had their germination reduced in comparison to the control seeds. This reduction was also observed when seed vigor and leached ions were considered. The presence of Phomopsis sojae fungus in soybean seed samples submitted to the EC test may be the cause of misleading results.

  7. Laboratory evaluations of Lepidopteran-active soybean seed treatments on survivorship of fall armyworm (Lepidoptera:Noctuidae) larvae (United States)

    Two anthranilic diamide insecticides, chlorantraniliprole and cyantraniliprole, were evaluated as soybean, Glycine max L., seed treatments for control of fall armyworm, Spodoptera frugiperda (J. E. Smith). Bioassays were conducted using 2nd instar larvae and plants from both field and greenhouse gr...

  8. Development of SSR markers for genetic diversity and phylogenetic studies of Phomopsis longicolla causing Phomopsis seed decay in soybean (United States)

    Phomopsis longicolla T. W. Hobbs (syn. Diaporthe longicolla) is the primary cause of Phomopsis seed decay (PSD) in soybean, Glycine max (L.) Merrill. The genome of P. longicolla type strain TWH P74 represents one of the important fungal pathogens in the Diaporthe-Phomopsis complex. In this study, th...

  9. Aboveground feeding by soybean aphid, Aphis glycines, affects soybean cyst nematode, Heterodera glycines, reproduction belowground.

    Directory of Open Access Journals (Sweden)

    Michael T McCarville

    Full Text Available Heterodera glycines is a cyst nematode that causes significant lost soybean yield in the U.S. Recent studies observed the aphid Aphis glycines and H. glycines interacting via their shared host, soybean, Glycine max. A greenhouse experiment was conducted to discern the effect of A. glycines feeding on H. glycines reproduction. An H. glycines-susceptible cultivar, Kenwood 94, and a resistant cultivar, Dekalb 27-52, were grown in H. glycines-infested soil for 30 and 60 d. Ten days after planting, plants were infested with either zero, five, or ten aphids. At 30 and 60 d, the number of H. glycines females and cysts (dead females and the number of eggs within were counted. In general, H. glycines were less abundant on the resistant than the susceptible cultivar, and H. glycines abundance increased from 30 to 60 d. At 30 d, 33% more H. glycines females and eggs were produced on the resistant cultivar in the ten-aphid treatment compared to the zero-aphid treatment. However, at 30 d the susceptible cultivar had 50% fewer H. glycines females and eggs when infested with ten aphids. At 60 d, numbers of H. glycines females and cysts and numbers of eggs on the resistant cultivar were unaffected by A. glycines feeding, while numbers of both were decreased by A. glycines on the susceptible cultivar. These results indicate that A. glycines feeding improves the quality of soybean as a host for H. glycines, but at higher herbivore population densities, this effect is offset by a decrease in resource quantity.

  10. Avaliação de cultivares de soja (Glycine max (L. Merril em competição com Euphorbia heterophylla L. sob três densidades e dois períodos de ocorrência Evaluation of soybean (Glycine max (L. Merrill cultivars in competition with Euphorbia heterophylla L. in three densities and two periods of occurrence

    Directory of Open Access Journals (Sweden)

    V. M. Chemale


    Full Text Available O presente trabalho, conduzido durante o ano agrícola de 1979/80 na Estação Experimental Agronômica de UFRGS, em Guaíba, RS, apresentou como objetivo testar quatro cultivares de soja (Paraná, Prata, Hood e IAS-4 quanto à sua habilidade em concorrer com Euphorbia heterophylla L. (leiteira, amendoim-bravo estabelecida em três densidades (0, 12 e 54 plan-tas/m2, em média e dois períodos de duração da competição (45 e 115 dias após a emergência da soja. Constatou-se que houve redução no rendimento de grãos de soja por efeito dos dois períodos de competição e das densidades de E. heterophylla L. referidas. Também os números de grãos e de legumes por área foram consideravelmente reduzidos pela presença da planta daninha associada ao período mais prolongado de competição. A espessura do caule e o número de nós das plantas de soja decresceram apenas sob o efeito da maior densidade da Euphorbia; entretanto, o número de ramos e o índice de área foliar, este aos 75 dias após a emergência da cultura, sofreram redução com a infestação de 12 plantas de Euphorbia por m2.A field experiment was performed at the Agronomy Experimental Station of UFRGS, in Guaíba, RS, Brazil, during the 1979/80 growing season, in order to test four soybean cultivars (Paraná, Prata, Hood e IAS-4 in competition with Euphorbia heterophylla L. established in three densities (0, 12 and 54 plants/m2 during two periods (45 and 115 days after soybean emergence. It was observed that soybean cultivars presented reduction of seed yields under the effect of the pe riods of competition and densities of Euphorbia heterophylla L. The number of seeds and pods per area were considerably reduced in the presence of the weed associated with the longest competition period. The stem diameter and number of nodes were reduced only by competition of the highest Euphorbia density; however, the number of branches and leaf area index, this after a period of 75 days

  11. Detection of Seed-Borne Fungal pathogens on Soya beans

    International Nuclear Information System (INIS)

    Wanyera, R


    Soya beans (Glycine max max L.) are propagated by seed and are vulnerable to devastating seed-borne diseases where the importance of each disease varies greatly. Seed-borne diseases cause significant losses in seed, food production and quality of seed and grain. Studies on seed borne diseases in Kenya have not been given emphasis on very important seed crops among the soya beans. The identification and rejection of the seed crop is mainly based on visual appraisal in the field with little or no laboratory work undertaken. Three methods were used to analyse the health status of fifty two soyabean seed samples collected from the National Plant Breeding Research Centre-Njoro and farmers' fields in Bahati division of Nakuru district. The analysis was carried out in the laboratory. The objective of the analysis was to identify and inventory seed-borne fungal pathogens of soya beans grown in Kenya. The normal blotter, herbicide and germination test methods were used. The tests revealed the presence of several important fungal pathogens on soyabean seed samples. Among the pathogens recorded Phoma sp, phomopsis sp, fusarium sp, Hainesia lyhri and Cercospora kikuchii were frequently recorded on the seed samples. Results of the germination test between paper method showed low germination (0-6.7%) on the normal sedlings in all the test samples. Hainesia lyhri was a new record on the soyabean seeds

  12. Water deficiency at different developmental stages of Glycine max can improve drought tolerance Deficiência hídrica em diferentes estágios de desenvolvimento de soja pode aumentar a tolerância à seca

    Directory of Open Access Journals (Sweden)

    Alan Panaia Kron


    Full Text Available Developmental windows are specific periods of sensitivity during normal plant development in which a perturbation may be adaptively integrated. In these periods, sub-lethal environmental perturbations may improve the capacity to grow at lethal conditions. The aim of this study was to test the hypothesis that previous non-lethal water deficit applied in different developmental stages in soybean plants could enables them to improve the tolerance to environmental perturbations. In order to test this hypothesis we carried out an experiment with soybean plants submitted to water deficit in different stages of plant development, evaluating yield and physiological aspects. Our results indicated that water deficit experienced on V4 stage (vegetative induces more suitable response, enabling plants to develop a process of tolerance improvement to a further water shortage period, probably through a reduction of growth, which maintains a conservative strategy of energy use. On the other hand, water deficit in R1 stage (reproductive, increased the plant susceptibility to posterior water withholding. This " strategy" was the opposite of the one employed by plants on V4 stage, i.e., to maintain growth rate probably at the expense of a higher energetic cost.Janelas de desenvolvimento são períodos específicos durante o ciclo de vida das plantas em que uma perturbação ambiental pode ser incorporada através de um processo de adaptação. Nesses períodos, perturbações ambientais subletais podem capacitar as plantas a crescer em condições letais. O objetivo deste trabalho foi testar a hipótese de que plantas de soja (Glycine max submetidas à deficiência hídrica não-letal em diferentes estágios de seu desenvolvimento poderiam otimizar sua tolerância a estresses ambientais posteriores. Para testar essa hipótese, foi conduzido um experimento com plantas de soja submetidas à deficiência hídrica em diferentes estágios de desenvolvimento, avaliando

  13. Development of a Competent and Trouble Free DNA Isolation Protocol for Downstream Genetic Analyses in Glycine Species

    Directory of Open Access Journals (Sweden)

    Muhammad Amjad Nawaz


    Full Text Available Extraction of deoxyribose nucleic acid (DNA from plants is preliminary step in molecular biology. Fast and cost effective genomic DNA isolation from Glycine species for downstream application is a major bottleneck. Here we report a high throughput and trouble free method for genomic DNA extraction from leaf and seeds of Glycine species with high quality and quantity. Protocol reports the optimization by employing different concentrations of CTAB and PVP in extraction buffer. Efficiency of optimized protocol was compared with frequently used DNA extraction methods. Wide adoptability and utility of this protocol was confirmed by DNA extraction from leaves as well as seeds of G. max, G. soja, G. tomentella and G. latifolia. Extracted DNA was successfully subjected to PCR amplification of five microsatellite markers and four putative glycosyltransferase genes. DNA extraction protocol is reproducible, trouble free, rapid and can be adopted for plant molecular biology applications.

  14. Changes in seed water status as characterized by NMR in developing soybean seed grown under moisture stress conditions

    International Nuclear Information System (INIS)

    Krishnan, P.; Singh, Ravender; Verma, A.P.S.; Joshi, D.K.; Singh, Sheoraj


    Highlights: • In developing soybean seeds, moisture stress resulted in more proportion of water to bound state. • These changes are further corroborated by concomitant changes in seed metabolites. • Thus there exists a moisture stress and development stage dependence of seed tissue water status. - Abstract: Changes in water status of developing seeds of Soybean (Glycine max L. Merrill.) grown under different moisture stress conditions were characterized by proton nuclear magnetic resonance (NMR)- spin–spin relaxation time (T 2 ). A comparison of the seed development characteristics, composition and physical properties indicated that, characteristics like seed weight, seed number/ear, rate of seed filling increased with development stages but decreased with moisture stress conditions. The NMR- spin–spin relaxation (T 2 ) component like bound water increased with seed maturation (40–50%) but decreased with moisture stress conditions (30–40%). The changes in seed water status to increasing levels of moisture stress and seed maturity indicates that moisture stress resulted in more proportion of water to bound state and intermediate state and less proportion of water in free-state. These changes are further corroborated by significant changes in protein and starch contents in seeds under high moisture stress treatments. Thus seed water status during its development is not only affected by development processes but also by moisture stress conditions. This study strongly indicated a clear moisture stress and development stage dependence of seed tissue water status in developing soybean seeds

  15. Changes in seed water status as characterized by NMR in developing soybean seed grown under moisture stress conditions

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, P., E-mail:; Singh, Ravender; Verma, A.P.S.; Joshi, D.K.; Singh, Sheoraj


    Highlights: • In developing soybean seeds, moisture stress resulted in more proportion of water to bound state. • These changes are further corroborated by concomitant changes in seed metabolites. • Thus there exists a moisture stress and development stage dependence of seed tissue water status. - Abstract: Changes in water status of developing seeds of Soybean (Glycine max L. Merrill.) grown under different moisture stress conditions were characterized by proton nuclear magnetic resonance (NMR)- spin–spin relaxation time (T{sub 2}). A comparison of the seed development characteristics, composition and physical properties indicated that, characteristics like seed weight, seed number/ear, rate of seed filling increased with development stages but decreased with moisture stress conditions. The NMR- spin–spin relaxation (T{sub 2}) component like bound water increased with seed maturation (40–50%) but decreased with moisture stress conditions (30–40%). The changes in seed water status to increasing levels of moisture stress and seed maturity indicates that moisture stress resulted in more proportion of water to bound state and intermediate state and less proportion of water in free-state. These changes are further corroborated by significant changes in protein and starch contents in seeds under high moisture stress treatments. Thus seed water status during its development is not only affected by development processes but also by moisture stress conditions. This study strongly indicated a clear moisture stress and development stage dependence of seed tissue water status in developing soybean seeds.

  16. The Proteome of Seed Development in the Model Legume Lotus japonicus

    DEFF Research Database (Denmark)

    Dam, Svend; Laursen, Brian S.; Ornfelt, Jane H.


    three developmental phases of legume seeds and the presence of embryo, endosperm, and seed coat in desiccated seeds. Furthermore, protein, oil, starch, phytic acid, and ash contents were determined, and this indicates that the composition of mature Lotus seed is more similar to soybean than to pea......We have characterized the development of seeds in the model legume Lotus japonicus. Like soybean (Glycine max) and pea (Pisum sativum), Lotus develops straight seed pods and each pod contains approximately 20 seeds that reach maturity within 40 days. Histological sections show the characteristic...... proteins corresponding to gene accession numbers were identified for the two phases, respectively. All of the proteome data, including the experimental data and mass spectrometry spectra peaks, were collected in a database that is available to the scientific community via a Web interface (http...

  17. Organ-Specific Differential NMR-Based Metabonomic Analysis of Soybean [Glycine max (L. Merr.] Fruit Reveals the Metabolic Shifts and Potential Protection Mechanisms Involved in Field Mold Infection

    Directory of Open Access Journals (Sweden)

    Wen-yu Yang


    Full Text Available Prolonged, continuous rainfall is the main climatic characteristic of autumn in Southwest China, and it has been found to cause mildew outbreaks in pre-harvest soybean fields. Low temperature and humidity (LTH stress during soybean maturation in the field promotes pre-harvest mildew, resulting in damage to different organs of soybean fruits to different extents, but relatively little information on the resistance mechanisms in these fruits is available. Therefore, to understand the metabolic responses of soybean fruits to field mold (FM, the metabonomic variations induced by LTH were characterized using proton nuclear magnetic resonance spectroscopy (1H-NMR, and the primary metabolites from the pod, seed coat and cotyledon of pre-harvest soybean were quantified. Analysis of FM-damaged soybean germplasms with different degrees of resistance to FM showed that extracts were dominated by 66 primary metabolites, including amino acids, organic acids and sugars. Each tissue had a characteristic metabolic profile, indicating that the metabolism of proline in the cotyledon, lysine in the seed coat, and sulfur in the pod play important roles in FM resistance. The primary-secondary metabolism interface and its potential contribution to FM resistance was investigated by targeted analyses of secondary metabolites. Both the seed coat and the pod have distinct but nonexclusive metabolic responses to FM, and these are functionally integrated into FM resistance mechanisms.

  18. Aplicação em pré-colheita, de dessecante em duas cultivares de soja (Glycine max (L. Merril I - Efeitos imediatos sobre a germinação e produção de sementes

    Directory of Open Access Journals (Sweden)

    J.C. Durigan


    Full Text Available Plantas de soja das cultivares Santa Rosa e IAC-2 foram tratadas, em diferentes épocas após o início do florescimento, com o desse cante paraquat na dose de 2 l/ha do produto comercial. Objetivou-se avaliar os possíveis efeitos sobre a infecção de sementes por microorganismos prejudiciais a sua qualidade. As aplicações do produto foram feitas semanalmente a partir dos 72 e 75 dias após o início do fl orescimento, para as cultivares IAC -2 e Santa Rosa. respectivamente (teores de umidade das sementes de 56,8 e 57,5%. Para todas as épocas tratadas, existiam as suas respectivas comparações que não receberam o produto. As testemunhas foram colhidas seguindo-se os critérios usuais dos agricultores que trabalham com soja, aos 100 e 103 dias após o inicio do florescimento, respectivamente para as cultivares IAC-2 e Santa Rosa. A incidência de fungos prejudiciais à qualidade das sementes foi sempre menor para as parcelas que receberam dessecamento e aumentou com o retardamento da colheita, principalmente nas parcelas não tratadas.The plant desiccant paraquat was applied on soybean plants at different stages of development 1972 and 75 days after flowering, weekly and the harvested seeds examined as to fungus incidence. The data showed that the incidence of seed deteriorating fungi was always lower in the treated plots and increased when the harvest was delayed, mainly in the untreated plots.

  19. Assessing the value and pest management window provided by neonicotinoid seed treatments for management of soybean aphid (Aphis glycines Matsumura) in the Upper Midwestern United States. (United States)

    Krupke, Christian H; Alford, Adam M; Cullen, Eileen M; Hodgson, Erin W; Knodel, Janet J; McCornack, Brian; Potter, Bruce D; Spigler, Madeline I; Tilmon, Kelley; Welch, Kelton


    A 2-year, multi-state study was conducted to assess the benefits of using soybean seed treated with the neonicotinoid thiamethoxam to manage soybean aphid in the upper Midwestern USA and compare this approach with an integrated pest management (IPM) approach that included monitoring soybean aphids and treating with foliar-applied insecticide only when the economic threshold was reached. Concentrations of thiamethoxam in soybean foliage were also quantified throughout the growing season to estimate the pest management window afforded by insecticidal seed treatments. Both the IPM treatment and thiamethoxam-treated seed resulted in significant reductions in cumulative aphid days when soybean aphid populations reached threshold levels. However, only the IPM treatment resulted in significant yield increases. Analysis of soybean foliage from thiamethoxam-treated seeds indicated that tissue concentrations of thiamethoxam were statistically similar to plants grown from untreated seeds beginning at the V2 growth stage, indicating that the period of pest suppression for soybean aphid is likely to be relatively short. These data demonstrate that an IPM approach, combining scouting and foliar-applied insecticide where necessary, remains the best option for treatment of soybean aphids, both in terms of protecting the yield potential of the crop and of break-even probability for producers. Furthermore, we found that thiamethoxam concentrations in foliage are unlikely to effectively manage soybean aphids for most of the pests' activity period across the region. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  20. Sowing seasons and quality of soybean seeds

    Directory of Open Access Journals (Sweden)

    Ávila Marizangela Rizzatti


    Full Text Available Considering the difficulties of producing high quality soybean [Glycine max (L. Merrill] seeds during the traditional cropping period in some areas of the State of Paraná, Brazil, a research project was carried out with the objective of evaluating the influence of sowing dates on the physiological and sanitary quality of seeds, during the 1998/99 and 1999/00 cropping seasons, in Maringá, PR, Brazil. The experiment consisted of five cultivar competition assays, arranged in a completely randomized block design, with each assay sown at different dates (10/15, 10/30, 11/15, 11/30 and 12/15 for each cropping season. The evaluated cultivars were BRS 132 (early, BRS 133 (semi-early, BR 16 (semi-early, BRS 134 (intermediate and FT- Estrela (late. Seeds obtained at the sowing dates were evaluated in the laboratory by germination, accelerated aging, and health tests. Sowing in November resulted in seeds with superior physiological and health quality. Cultivar BRS 133 showed the greatest stability in seed production with better quality for the different sowing dates. Cultivars BRS 134 and BRS 133, which were sown during the period from 10/15 to 11/30, produced seeds that had higher percentages of normal seedlings in the germination and accelerated aging tests. Advancing or delaying sowing dates had adverse effects on soybean seed production with regard to their sanitary quality.

  1. Selection for a Zinc-Finger Protein Contributes to Seed Oil Increase during Soybean Domestication. (United States)

    Li, Qing-Tian; Lu, Xiang; Song, Qing-Xin; Chen, Hao-Wei; Wei, Wei; Tao, Jian-Jun; Bian, Xiao-Hua; Shen, Ming; Ma, Biao; Zhang, Wan-Ke; Bi, Ying-Dong; Li, Wei; Lai, Yong-Cai; Lam, Sin-Man; Shui, Guang-Hou; Chen, Shou-Yi; Zhang, Jin-Song


    Seed oil is a momentous agronomical trait of soybean ( Glycine max ) targeted by domestication in breeding. Although multiple oil-related genes have been uncovered, knowledge of the regulatory mechanism of seed oil biosynthesis is currently limited. We demonstrate that the seed-preferred gene GmZF351 , encoding a tandem CCCH zinc finger protein, is selected during domestication. Further analysis shows that GmZF351 facilitates oil accumulation by directly activating WRINKLED1 , BIOTIN CARBOXYL CARRIER PROTEIN2 , 3-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III , DIACYLGLYCEROL O-ACYLTRANSFERASE1 , and OLEOSIN2 in transgenic Arabidopsis ( Arabidopsis thaliana ) seeds. Overexpression of GmZF351 in transgenic soybean also activates lipid biosynthesis genes, thereby accelerating seed oil accumulation. The ZF351 haplotype from the cultivated soybean group and the wild soybean ( Glycine soja ) subgroup III correlates well with high gene expression level, seed oil contents and promoter activity, suggesting that selection of GmZF351 expression leads to increased seed oil content in cultivated soybean. Our study provides novel insights into the regulatory mechanism for seed oil accumulation, and the manipulation of GmZF351 may have great potential in the improvement of oil production in soybean and other related crops. © 2017 American Society of Plant Biologists. All Rights Reserved.

  2. seeds

    African Journals Online (AJOL)


    peptidohydrolase (8.0%) from mung bean seedlings. (Baumgartner and Chrispeels, 1977), EP-HG (4.5%) from horse gram seedlings ( Rajeswari, 1997), acidic protease (15%) from germinating winged-bean seeds. (Usha and Singh, 1996) and EP-1 (1.6%) from barley seedlings and GA3-induced cysteine protease (3.38%).

  3. Aplicación de diferentes fuentes de azufre en soya (Glycine max (L. Merrill en tres ordenes de suelos del Valle del río Cauca, Colombia, en condiciones de invernadero

    Directory of Open Access Journals (Sweden)

    Gómez L. Jairo A.


    Full Text Available Se utilizaron cuatro fuentes portadoras de S (sulfato de amonio, yeso, ácido sulfúrico y azufre micronizado en dosis de 20 y 40 kg de S/ha, aplicado en pre y al momento de la siembra , en tres órdenes de suelos (Vertisol, Inceptisol y Entisol del Valle geográfico del río Cauca, con la variedad ICA Tunía, como cultivo indicador. La unidad experimental estuvo constituida por bolsas de polietileno con dos kilos de suelo seco al aire, utilizando el horizonte Ap. El diseño experimental fue completamente al azar, el diseño de tratamientos fueron dos factoriales entrelazados con dos tratamientos adicionales, testigo absoluto (To, testigo comercial (Te. Este llevó fertilización basal con N, P, K, y doce tratamientos con fertilización basal más S (N, P, K +S. Al período de floración se cuantificó peso de materia seca, peso de nódulos, % S, % N Y N/S, a final de cosecha se determinó en el grano de soya % S, % N, N/ S, número de vainas, de granos, peso seco de grano y % de aceite. Los tres suelos respondieron a la fertilización de S. La fuente que presentó diferencias significativas con mayor incremento en producción de grano de soya, fue el azufre micronizado, en la dosis de 20 kg S/ha aplicado con anterioridad a la siembra.In order to fertilize, four sources of sulphur, ammonicum sulfate, gyppum, sulfuric acid and micronized sulphur, were used. Sulphur dose of 20 and 40 kg per hectare were applied before sowing and at the seeding moment, on three soils orders (Vertisol, Inceptisol and Entisol of the geographic Valley of the Cauca river, with the soybeam variety ICA Tunía. The experimental units were made of polyethilen bags with two kilograms of air dry soil, using the Ap. horizon. The experimental design was completyly ramdom. The treatment designs were two factorial s interlaced with two additional treatments, absolute indicator (To commercial indicator (Te. This carried basal fertilization with N, P, K and twelve treatments with

  4. Seed storage at elevated partial pressure of oxygen, a fast method for analysing seed ageing under dry conditions (United States)

    Groot, S. P. C.; Surki, A. A.; de Vos, R. C. H.; Kodde, J.


    Background and Aims Despite differences in physiology between dry and relative moist seeds, seed ageing tests most often use a temperature and seed moisture level that are higher than during dry storage used in commercial practice and gene banks. This study aimed to test whether seed ageing under dry conditions can be accelerated by storing under high-pressure oxygen. Methods Dry barley (Hordeum vulgare), cabbage (Brassica oleracea), lettuce (Lactuca sativa) and soybean (Glycine max) seeds were stored between 2 and 7 weeks in steel tanks under 18 MPa partial pressure of oxygen. Storage under high-pressure nitrogen gas or under ambient air pressure served as controls. The method was compared with storage at 45 °C after equilibration at 85 % relative humidity and long-term storage at the laboratory bench. Germination behaviour, seedling morphology and tocopherol levels were assessed. Key Results The ageing of the dry seeds was indeed accelerated by storing under high-pressure oxygen. The morphological ageing symptoms of the stored seeds resembled those observed after ageing under long-term dry storage conditions. Barley appeared more tolerant of this storage treatment compared with lettuce and soybean. Less-mature harvested cabbage seeds were more sensitive, as was the case for primed compared with non-primed lettuce seeds. Under high-pressure oxygen storage the tocopherol levels of dry seeds decreased, in a linear way with the decline in seed germination, but remained unchanged in seeds deteriorated during storage at 45 °C after equilibration at 85 % RH. Conclusions Seed storage under high-pressure oxygen offers a novel and relatively fast method to study the physiology and biochemistry of seed ageing at different seed moisture levels and temperatures, including those that are representative of the dry storage conditions as used in gene banks and commercial practice. PMID:22967856

  5. Seed storage at elevated partial pressure of oxygen, a fast method for analysing seed ageing under dry conditions. (United States)

    Groot, S P C; Surki, A A; de Vos, R C H; Kodde, J


    Despite differences in physiology between dry and relative moist seeds, seed ageing tests most often use a temperature and seed moisture level that are higher than during dry storage used in commercial practice and gene banks. This study aimed to test whether seed ageing under dry conditions can be accelerated by storing under high-pressure oxygen. methods: Dry barley (Hordeum vulgare), cabbage (Brassica oleracea), lettuce (Lactuca sativa) and soybean (Glycine max) seeds were stored between 2 and 7 weeks in steel tanks under 18 MPa partial pressure of oxygen. Storage under high-pressure nitrogen gas or under ambient air pressure served as controls. The method was compared with storage at 45 °C after equilibration at 85 % relative humidity and long-term storage at the laboratory bench. Germination behaviour, seedling morphology and tocopherol levels were assessed. The ageing of the dry seeds was indeed accelerated by storing under high-pressure oxygen. The morphological ageing symptoms of the stored seeds resembled those observed after ageing under long-term dry storage conditions. Barley appeared more tolerant of this storage treatment compared with lettuce and soybean. Less-mature harvested cabbage seeds were more sensitive, as was the case for primed compared with non-primed lettuce seeds. Under high-pressure oxygen storage the tocopherol levels of dry seeds decreased, in a linear way with the decline in seed germination, but remained unchanged in seeds deteriorated during storage at 45 °C after equilibration at 85 % RH. Seed storage under high-pressure oxygen offers a novel and relatively fast method to study the physiology and biochemistry of seed ageing at different seed moisture levels and temperatures, including those that are representative of the dry storage conditions as used in gene banks and commercial practice.

  6. Quinoa (Chenopodium quinoa Willd. versus soja (Glycine max [L.] Merr. en la nutrición humana: revisión sobre las características agroecológicas, de composición y tecnológicas

    Directory of Open Access Journals (Sweden)

    Diana Maria Chito Trujillo


    Full Text Available El diseño de alimentos funcionales a partir de productos vegetales muy estudiados como la soja (Glycine max [L.] Merr. y la potencialización de productos ancestrales como la quinoa (Chenopodium quinoa Willd. son estrategias factibles para contrarrestar la desnutrición mundial. El objetivo de la presente revisión es describir las características agroecológicas, de composición, nutricionales y tecnológicas de estas dos especies vegetales diferentes (leguminosa y pseudocereal, basado en las publicaciones previas. Se realizó una revisión en bases de datos (Scopus, Web of Science, Scielo y se complementó con una búsqueda manual en Google Scholar y páginas web de instituciones acreditadas. Los estudios incluidos (n=117 en esta revisión muestran que la soja se adapta mejor a altitudes bajas (~1.000 m s. n. m., mientras que la quinoa lo hace en un rango de mayores altitudes (500-4.000 m s. n. m. con mayor tolerancia a heladas. Ambas son fuente de una alta calidad proteica por suplir los requerimientos de aminoácidos esenciales sugeridos para niños y adultos sin diferencias significativas (p>0,05, particularmente triptófano y lisina y por los altos porcentajes de digestibilidad (>70%. Sus concentraciones bajas de prolaminas y aceptables de Fe, Zn, Ca, daidzeína y genisteína los convierten en productos de interés para la industria alimentaria.

  7. First report of the Soybean Cyst Nematode, Heterodera glycines, in New York (United States)

    The soybean cyst nematode (SCN), Heterodera glycines Ichinohe, is the most damaging pathogen of soybean (Glycine max (L.) Merr.), causing more than $1 billion in yield losses annually in the United States (Koenning and Wrather 2010). The SCN distribution map updated in 2014 showed that SCN were dete...

  8. Selection for a Zinc-Finger Protein Contributes to Seed Oil Increase during Soybean Domestication1[OPEN (United States)

    Li, Qing-Tian; Lu, Xiang; Song, Qing-Xin; Chen, Hao-Wei; Wei, Wei; Tao, Jian-Jun; Ma, Biao; Bi, Ying-Dong; Li, Wei; Lai, Yong-Cai; Shui, Guang-Hou; Chen, Shou-Yi


    Seed oil is a momentous agronomical trait of soybean (Glycine max) targeted by domestication in breeding. Although multiple oil-related genes have been uncovered, knowledge of the regulatory mechanism of seed oil biosynthesis is currently limited. We demonstrate that the seed-preferred gene GmZF351, encoding a tandem CCCH zinc finger protein, is selected during domestication. Further analysis shows that GmZF351 facilitates oil accumulation by directly activating WRINKLED1, BIOTIN CARBOXYL CARRIER PROTEIN2, 3-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III, DIACYLGLYCEROL O-ACYLTRANSFERASE1, and OLEOSIN2 in transgenic Arabidopsis (Arabidopsis thaliana) seeds. Overexpression of GmZF351 in transgenic soybean also activates lipid biosynthesis genes, thereby accelerating seed oil accumulation. The ZF351 haplotype from the cultivated soybean group and the wild soybean (Glycine soja) subgroup III correlates well with high gene expression level, seed oil contents and promoter activity, suggesting that selection of GmZF351 expression leads to increased seed oil content in cultivated soybean. Our study provides novel insights into the regulatory mechanism for seed oil accumulation, and the manipulation of GmZF351 may have great potential in the improvement of oil production in soybean and other related crops. PMID:28184009

  9. Oxyradical accumulation and rapid deterioration of soybean seeds due to field weathering. (United States)

    Yadav, Sanjeev; Bhatia, V S; Guruprasad, K N


    The effect of field weathering on oxyradical accumulation and subsequent changes were studied in the seeds of soybean [Glycine max (L.) Merr.] cv. JS 71-05. Electron spin resonance (ESR) quantification of oxyradical revealed that field weathering plays an important role in acceleration of their accumulation. One week of weathering increased the accumulation of oxyradicals to almost 2-fold and triggered the deteriorative cascade, by enhancing the lipid peroxidation and membrane perturbation, leading to cell death in seed tissues and poor germinability and vigour of soybean seeds. Thus, the weather conditions at the time of physiological maturity to harvesting of crop are very crucial and the field weathering plays a critical role for the maintenance of seed quality.

  10. effect of remediation on growth parameter of soybean (glycine max)

    African Journals Online (AJOL)

    Sir VIn

    African Journal of Environmental Science and Technology Vol. 7(2), pp. 61-67 ... 1979- 1997, the Nigeria petroleum industries spilled 5334 barrels of oil into ..... Oil and Gas Exploration and Production, Caracas, Venezuela, 7-10,. June 1998.

  11. Common sunflower (Helianthus annuus) interference in soybean (Glycine max)

    International Nuclear Information System (INIS)

    Geier, P.W.; Maddux, L.D.; Moshier, L.J.; Stahlman, P.W.


    Multiple weed species in the field combine to cause yield losses and can be described using one of several empirical models. Field studies were conducted to compare observed corn yield loss caused by common sunflower and shattercane populations with predicted yield losses modeled using a multiple species rectangular hyperbola model, an additive model, or the yield loss model in the decision support system, WeedSOFT, and to derive competitive indices for common sunflower and shattercane. Common sunflower and shattercane emerged with corn and selected densities established in field experiments at Scandia and Rossville, KS, between 2000 and 2002. The multiple species rectangular hyperbola model fit pooled data from three of five location–years with a predicted maximum corn yield loss of 60%. Initial slope parameter estimate for common sunflower was 49.2 and 4.2% for shattercane. A ratio of these estimates indicated that common sunflower was 11 times more competitive than shattercane. When common sunflower was assigned a competitive index (CI) value of 10, shattercane CI was 0.9. Predicted yield losses modeled for separate common sunflower or shattercane populations were additive when compared with observed yield losses caused by low-density mixed populations of common sunflower (0 to 0.5 plants m −2 ) and shattercane (0 to 4 plants m −2 ). However, a ratio of estimates of these models indicated that common sunflower was only four times as competitive as shattercane, with a CI of 2.5 for shattercane. The yield loss model in WeedSOFT underpredicted the same corn losses by 7.5%. Clearly, both the CI for shattercane and the yield loss model in WeedSOFT need to be reevaluated, and the multiple species rectangular hyperbola model is proposed. (author)

  12. Glycine max and Moringa oleifera : nutritional values, processing ...

    African Journals Online (AJOL)

    For fighting malnutrition in the developing countries, using soybean and Moringa oleifera plant materials can be considered as the cheaper and the most sustainable approach. The objective of our review is to identify and present the nutritional potential of these two agro-resources. We conducted a literature review on the ...

  13. Analysis of resource use efficiency among soybean ( Glycine max ...

    African Journals Online (AJOL)

    Also, 87.5% of the farmers were in their active age, and 81.7% utilized their personal saving as a major source of finance for production. The result of the production function analysis indicated that 87.21% of the variation in the output of soybean is explained for by the independent variables. Resource-use efficiency ...

  14. Effect of soybean derivatives (glycine max) on thyroid of rats

    International Nuclear Information System (INIS)

    Filisetti, T.M.C.C.


    The effect of a Brazilian variety soybean and their comercial products on thyroid gland is studied. Soybean derivatives are tested in rats through acute experiments of 3 to 24 hours and semichronic experiments of 16 to 29 days. The autoclaved extract administered after 6 to 24 hours decreases the percentage of iodine ( 131 I) uptake. Semichronic experiments show that the factor found in soybean provokes both an increase or a reduction in percentage of iodine ( 131 I) uptake, depending ou the oeriod of action [pt

  15. 135 - 146 Effect of Different Levels of Soybean /Glycine Max

    African Journals Online (AJOL)


    sheep were blocked into six blocks of four animals based on initial body weight and ... sheep on natural pasture hay supplemented with 375 g/day soybean meal .... sheep were made to fast for 12 hours and slaughtered ...... Swedish University of Agricultural sciences. ... Synthesis of working papers, Soil Science Bulletin.

  16. Radiation processing and functional properties of soybean (Glycine max)

    International Nuclear Information System (INIS)

    Pednekar, Mrinal; Das, Amit K.; Rajalakshmi, V; Sharma, Arun


    Effect of radiation processing (10, 20 and 30 kGy) on soybean for better utilization was studied. Radiation processing reduced the cooking time of soybean and increased the oil absorption capacity of soy flour without affecting its proximate composition. Irradiation improved the functional properties like solubility, emulsification activity and foam stability of soybean protein isolate. The value addition effect of radiation processing has been discussed for the products (soy milk, tofu and tofu fortified patties) prepared from soybean.

  17. Nodulin gene expression during soybean (Glycine max) nodule development.

    NARCIS (Netherlands)

    Gloudemans, T.; Vries, de S.; Bussink, H.J.; Malik, N.S.A.; Franssen, H.; Louwerse, J.; Bisseling, T.


    In vitro translation products of total RNA isolated from soybean nodules at successive stages of nodule development were analyzed by two-dimensional gel electrophoresis. In that way the occurrence of over 20 mRNAs specifically transcribed from nodulin genes was detected. The nodulin genes could be

  18. Soybean (Glycine max) as a versatile biocatalyst for organic synthesis

    African Journals Online (AJOL)



    Apr 12, 2012 ... Cetonas Aromáticas Utilizando a Casca da Passiflora como. Biocatalisador. MS Thesis, Edições UFC, Fortaleza, Brazil, 2003. Machado LL, Monte FJQ, de Oliveira MCF, de Mattos MC, Lemos TLG,. Gotor-Fernández V, Gonzalo G, Gotor V (2008). Bioreduction of aromatic aldehydes and ketones by fruits' ...

  19. Optimization of soybean (glycine max L.) regeneration for korean cultivars

    International Nuclear Information System (INIS)

    Phat, P.; Rehman, S. U.; Ju, H. J.; Jung, H. I.


    Tissue culture could provide key insights into the development of transgenic plants, production of good cultivars and secondary metabolites, conservation of endangered plants, and safeguarding of germplasms. In this study, the effects of shoot induction media, explants, cultivars, and phytohormone concentrations on the regeneration efficiency of Korean soybean cultivars were evaluated. Restricted dormancy and poor germination may affect regeneration, depending on the type of germination medium or initiation of phytohormone treatment. Therefore, we analyzed the effects of different germination media containing plant growth regulators, i.e. 6-benzyladenine (BAP), gibberellic acid 3 (GA /sub 3/), and naphthalene acetic acid (NAA), prior to investigating the influences of explant types, media with or without vitamins, cultivars, and different phytohormones (BAP and GA3). A high frequency of germination was observed in Murashige and Skooge (MS) medium with vitamins supplemented with 1 mg L /sup -1/ BAP and 0.25 mg L /sup -1/ GA /sub 3/. Cotyledonary node explants and Gamborg B5 with vitamins supplemented with 1 mg L /sup -1/ BAP and 0.17 mg L /sup -1/ GA /sub 3/ in callus induction medium (CIM) and 1 mg L /sup -1/ BAP in shoot induction medium (SIM) were found to be the most efficient conditions for induction of soybean regeneration, both in callus development and shoot regeneration. Two Korean soybean cultivars, cv. Daepung and Nampung, showed similar development of shoot regeneration efficiency, but significantly different shoot induction times. Therefore, the protocol reported here may be used for further development of regeneration efficiency and can be employed for efficient transformation in soybeans. (author)

  20. Antioxidant and Antimicrobial properties of Glycine Max-A review


    Babu Shankar Ponnusha, Sathiyamoorthy Subramaniyam, Palanisamy Pasupathi, Boopathi subramaniyam, Rajaram Virumandy, Int J Cur Bio Med Sci.


    Vegetable soybean is rich in phytochemicals beneficial to the human being and is therefore considered a neutraceutical or a functional food crop. Soybean as a “functional food” that reduces the risk of range of hazardous diseases like atherosclerosis, osteoporosis, various types of cancer (breast, uterus cancer, and prostrate) has attracted people’s attention across the globe. People in India are becoming increasingly aware about the health benefits of consuming soy food. Although isoflavones...

  1. Genetic Variability in Soybean (Glycine max L.) for Low Soil ...

    African Journals Online (AJOL)

    Abush Tesfaye

    component analysis also revealed that the first five principal components (PCs) accounted for more ... nutritional value with 40% protein and 20% oil (Fekadu et al., 2009) that makes it an important raw ...... protein and oil content under both conditions using molecular marker technologies. ... for global modeling. Soil Use and ...

  2. Genetic Variability in Soybean (Glycine max L.) for Low Soil ...

    African Journals Online (AJOL)

    Abush Tesfaye

    worldwide importance as food and market crop. This is mainly because of its high ... The application of inorganic P fertilizers is one of the possibilities for addressing the problem of low P availability. However ...... Soybean Research Conference held in Foz do Iguassu, Brazil, 1-5 March, 2004. Tong, X.J., X. Yan, Y.G. Lu, ...

  3. Soybean ( Glycine max ) complementation and the zinc status of HIV ...

    African Journals Online (AJOL)

    The HIV and AIDS pandemic continues to ravage families and communities throughout the world particularly Sub-Saharan Africa. The scourge is associated with malnutrition specifically underweight, stunting and wasting among school children most of whom are orphaned by HIV. Subsequently, inadequate food supply at ...

  4. Intercrop performance of different varieties of soybean (Glycine Max ...

    African Journals Online (AJOL)



    Dec 13, 2010 ... (TGX 1894-3E, medium maturing variety), gave the highest grain yield of Soybean and fresh tuber yield of cassava at 12MAP,. Key words: ... basic component of cropping systems in many areas of south eastern Nigeria. ... and aquatic environment, increased soil acidity and highly selective transport or ...

  5. Accumulation of proanthocyanidins and/or lignin deposition in buff-pigmented soybean seed coats may lead to frequent defective cracking. (United States)

    Senda, Mineo; Yamaguchi, Naoya; Hiraoka, Miho; Kawada, So; Iiyoshi, Ryota; Yamashita, Kazuki; Sonoki, Tomonori; Maeda, Hayato; Kawasaki, Michio


    Defective cracking frequently occurs in buff-pigmented soybean seed coats, where proanthocyanidins accumulate and lignin is deposited, suggesting that proanthocyanidins and/or lignin may change physical properties and lead to defective cracking. In the seed production of many yellow soybean (Glycine max) cultivars, very low percentages of self-pigmented seeds are commonly found. This phenomenon is derived from a recessive mutation of the I gene inhibiting seed coat pigmentation. In Japan, most of these self-pigmented seeds are buff-colored, and frequently show multiple defective cracks in the seed coat. However, it is not known why cracking occurs specifically in buff seed coats. In this study, quantitative analysis was performed between yellow and buff soybean seed coats. Compared with yellow soybeans, in which defective cracking rarely occurs, contents of proanthocyanidins (PAs) and lignin were significantly higher in buff seed coats. Histochemical data of PAs and lignin in the seed coats strongly supported this result. Measurements of the physical properties of seed coats using a texture analyzer showed that a hardness value was significantly decreased in the buff seed coats. These results suggest that PA accumulation and/or lignin deposition may affect the physical properties of buff seed coats and lead to the defective cracking. This work contributes to understanding of the mechanism of defective cracking, which decreases the seed quality of soybean and related legumes.

  6. Irradiation and storage effect on some characteristics of soy seeds

    International Nuclear Information System (INIS)

    Ramirez Ascheri, Diego Palmiro; Devilla, Ivano Alessandro


    The irradiation has been applied frequently in seeds conservation to obtain reduction of losses caused by physiologic processes, besides reducing the microbial load. However, the irradiation process for X-rays is not a common practice in seeds; for that, it is necessary to study that process, in order to know irradiation effect on the soy seeds quality. The objective of this work was to verify the irradiation effect of X-rays and the storage period on the water, oil and protein contends of soy seeds (Glycine max L.) variety Emgopa 302. The experiment was represented by the combination of two factors: X-rays dosage with four irradiation levels [0, 50, 65 and 70 kV] and storage period in laboratory atmosphere with five levels (0, 15, 30, 45 and 60 days). The water content, oil and protein in seeds were assayed in the beginning and every 15 days of storage. The results showed the seeds quality stayed unaffected in irradiation function in the beginning of the experience, with alterations after 15 days, was verified a quality decreasing with the increasing of the X-rays dosage. The soy seeds irradiated had reduced quality in elapsing of the storage period. (author)

  7. Remembering Max Boisot

    DEFF Research Database (Denmark)

    Sanchez, Ron


    This chapter offers some reflections on Max Boisot and his extraordinary intellect drawn from our 15 years of exchanging and crafting ideas together. I first comment on the process of working with Max, and then suggest some of the remarkable qualities of thought that I believe distinguished Max's...... these qualities of thought are also reflected in Max's individual work and especially in his crowning achievement, the Information-Space Model....

  8. Aplicação de dessecantes na cultura de soja: antecipação da colheita e produção de sementes Application of desiccants on soybean crop glycine max: harvest anticipation and seed yield

    Directory of Open Access Journals (Sweden)

    A.L.S. Lacerda


    Full Text Available Este trabalho foi conduzido no município de Selvíria-MS, semeando soja do cultivar IAC-15. O delineamento experimental utilizado foi o de blocos casualizados, estando os tratamentos dispostos em um esquema fatorial 3x3 e 4x4, sendo os fatores os produtos (dessecantes e as épocas de aplicação, nos anos agrícolas 1996/97 e 1997/98, respectivamente. Os dessecantes utilizados foram: paraquat, diquat e mistura paraquat + diquat, nas dosagens de 0,4; 0,3 e 0,2+0,15 em 1996/97, respectivamente, e os mesmos tratamentos em 1997/98, além do glufosinato de amônio na dosagem de 0,4 kg i.a. ha-1 em 1997/98. Como épocas, foram realizadas três aplicações em 1996/97 e quatro em 1997/98, todas espaçadas de cinco dias a partir do estádio fenológico médio da cultura R6. Concluiu-se que os dessecantes utilizados mostraram-se eficientes na dessecação da soja; foi possível obter antecipação da colheita de sementes de soja, sem alterar a produção, por um período máximo de sete dias.This research was carried out in Selvíria-MS, Brazil, during the growing seasons of 1996/97 and 1997/98, using the soybean cultivar IAC-15. The experimental design was arranged in randomized complete blocks in a 3x3 and 4x4 factorial scheme during 1996/97 and 1997/98, respectively, with the factors being the products (desiccants and timing of application. The desiccants sprayed were: paraquat, diquat and a mixture of paraquat + diquat at rates of 0.4; 0.3 and 0.2+0.15 in 1996/97 and the same treatments in 1997/98 added to ammonium glufosinate at 0.4 kg a.i. ha-1 in 1997/98. The timing of application was spaced every five days, starting from the soybean vegetative stage R6. The tested desiccants were efficient on the soybean desiccation ; it was possible to obtain grain harvest anticipation, without yield reduction, in a maximum period of seven days.

  9. Participation of Taxifolin in the Protection of Soya Seeds from the Effects of Heavy Metal Salts

    Directory of Open Access Journals (Sweden)

    V.A. Kuznetsova


    Full Text Available A correlation was revealed between the specific activity of peroxidases and their multiple forms during the germination of soya seeds (Glycine max (L. Merrill in the presence of heavy metal salts. It was shown that lead and cadmium sulfates cause emergence of new forms of the enzyme with high electrophoretic mobility, which indicates that the identified enzyme forms are involved in the molecular mechanism of adaptation to oxidative stress. Addition of taxifolin (dihydroquercetin, a bioflavonoid antioxidant, to the salts of heavy metals caused decrease in the specific activity of peroxidases and favored emergence of new forms of the enzyme, which were absent in the control samples.

  10. Reliability of different methods used for forming of working samples in the laboratory for seed testing

    Directory of Open Access Journals (Sweden)

    Opra Branislava


    Full Text Available The testing of seed quality starts from the moment a sample is formed in a warehouse during processing or packaging of the seed. The seed sampling as the process of obtaining the working sample also assumes each step undertaken during its testing in the laboratory. With the aim of appropriate forming of a seed sample in the laboratory, the usage of seed divider is prescribed for large seeded species (such as seed the size of wheat or larger (ISTA Rules, 1999. The aim of this paper was the comparison of different methods used for obtaining the working samples of maize and wheat seeds using conical, soil and centrifugal dividers. The number of seed of added admixtures confirmed the reliability of working samples formation. To each maize sample (1000 g 10 seeds of the following admixtures were added: Zea mays L. (red pericarp, Hordeum vulgäre L., Triticum aestivum L., and Glycine max (L. Merr. Two methods were used for formation of maze seed working sample. To wheat samples (1000 g 10 seeds of each of the following species were added: Avena saliva (hulled seeds, Hordeum vulgäre L., Galium tricorne Stokes, and Polygonum lapatifolmm L. For formation of wheat seed working samples four methods were used. Optimum of 9, but not less than 7 seeds of admixture were due to be determined in the maize seed working sample, while for wheat, at least one seed of admixture was expected to be found in the working sample. The obtained results confirmed that the formation of the maize seed working samples was the most reliable when centrifugal divider, the first method was used (average of admixture - 9.37. From the observed admixtures the seed of Triticum aestivum L. was the most uniformly distributed, the first method also being used (6.93. The second method gains high average values satisfying the given criterion, but it should be used with previous homogenization of the sample being tested. The forming of wheat seed working samples is the most reliable if the

  11. Quantitative proteomics of seed filling in castor: comparison with soybean and rapeseed reveals differences between photosynthetic and nonphotosynthetic seed metabolism. (United States)

    Houston, Norma L; Hajduch, Martin; Thelen, Jay J


    Seed maturation or seed filling is a phase of development that plays a major role in the storage reserve composition of a seed. In many plant seeds photosynthesis plays a major role in this process, although oilseeds, such as castor (Ricinus communis), are capable of accumulating oil without the benefit of photophosphorylation to augment energy demands. To characterize seed filling in castor, a systematic quantitative proteomics study was performed. Two-dimensional gel electrophoresis was used to resolve and quantify Cy-dye-labeled proteins expressed at 2, 3, 4, 5, and 6 weeks after flowering in biological triplicate. Expression profiles for 660 protein spot groups were established, and of these, 522 proteins were confidently identified by liquid chromatography-tandem mass spectrometry by mining against the castor genome. Identified proteins were classified according to function, and the most abundant groups of proteins were involved in protein destination and storage (34%), energy (19%), and metabolism (15%). Carbon assimilatory pathways in castor were compared with previous studies of photosynthetic oilseeds, soybean (Glycine max) and rapeseed (Brassica napus). These comparisons revealed differences in abundance and number of protein isoforms at numerous steps in glycolysis. One such difference was the number of enolase isoforms and their sum abundance; castor had approximately six times as many isoforms as soy and rapeseed. Furthermore, Rubisco was 11-fold less prominent in castor compared to rapeseed. These and other differences suggest some aspects of carbon flow, carbon recapture, as well as ATP and NADPH production in castor differs from photosynthetic oilseeds.

  12. Mini MAX - Medicaid Sample (United States)

    U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...

  13. MAX and Survey Linkages (United States)

    U.S. Department of Health & Human Services — CMS is interested in linking MAX files with survey data, including four surveys conducted by the National Center for Health Statistics (NCHS) - the National Health...

  14. MAX Provider Characteristics (United States)

    U.S. Department of Health & Human Services — The MAX Provider Characteristics (PC) File Implementation Report describes the design, implementation, and results of the MAXPC prototype, which was based on three...

  15. 不同环境条件下大豆籽粒蛋白质和油分含量与指数的遗传效应分析%Analysis of Genetic Effects on Contents and Indexed of Protein and Oil in Soybean Seeds in Different Environments

    Institute of Scientific and Technical Information of China (English)

    宁海龙; 李文霞; 李文滨; 王继安


    Protein and oil are two of the important quantitative traits closely related to the nutrient quality in soybean(Glycine max [L. ] Merry). The content and yield of protein and oil have become one of the main goals in soybean breeding. For soybean breeding programs, understanding the inheritance is of importance. Genetic analyses of protein and oil content in soybean seed have been reported. Most of the studies showed that protein and oil content are quantitatively inherited. Genetic effects, heritability and correlation of protein and oil content in soybean seeds have been estimated.

  16. Molecular mapping and genomics of soybean seed protein: a review and perspective for the future. (United States)

    Patil, Gunvant; Mian, Rouf; Vuong, Tri; Pantalone, Vince; Song, Qijian; Chen, Pengyin; Shannon, Grover J; Carter, Tommy C; Nguyen, Henry T


    Genetic improvement of soybean protein meal is a complex process because of negative correlation with oil, yield, and temperature. This review describes the progress in mapping and genomics, identifies knowledge gaps, and highlights the need of integrated approaches. Meal protein derived from soybean [Glycine max (L) Merr.] seed is the primary source of protein in poultry and livestock feed. Protein is a key factor that determines the nutritional and economical value of soybean. Genetic improvement of soybean seed protein content is highly desirable, and major quantitative trait loci (QTL) for soybean protein have been detected and repeatedly mapped on chromosomes (Chr.) 20 (LG-I), and 15 (LG-E). However, practical breeding progress is challenging because of seed protein content's negative genetic correlation with seed yield, other seed components such as oil and sucrose, and interaction with environmental effects such as temperature during seed development. In this review, we discuss rate-limiting factors related to soybean protein content and nutritional quality, and potential control factors regulating seed storage protein. In addition, we describe advances in next-generation sequencing technologies for precise detection of natural variants and their integration with conventional and high-throughput genotyping technologies. A syntenic analysis of QTL on Chr. 15 and 20 was performed. Finally, we discuss comprehensive approaches for integrating protein and amino acid QTL, genome-wide association studies, whole-genome resequencing, and transcriptome data to accelerate identification of genomic hot spots for allele introgression and soybean meal protein improvement.

  17. Qualidade fisiológica de sementes de soja tratadas e armazenadas - Physiological quality of treated and stored soybean seeds.

    Directory of Open Access Journals (Sweden)

    Gustavo Cruvinel Rocha


    During storage as seeds or grains may suffer in their chemical composition, because of the storage environment. In view of this, a production of high quality physiological seeds will depend on the sum of all genetic, physical, physiological and sanitary attributes. However, little is known about the effects of seeds by harvesting, drying, processing and storage for long periods of time. Therefore, it was conducted in the seed laboratory of the University of Rio Verde, in order to evaluate a physiological quality of seeds treated under different storage conditions. The experimental design was used for the completely randomized 2x5x7, two storage conditions (conventional and air conditioned warehouse, five seed treatments and seven evaluation periods, with four replications. At 0, 20, 40, 60, 80, 100, 120 days after an imposition of treatments for evaluated germination, emergence speed index, accelerated aging and root length. The chemical treatments applied in soybean seeds (cultivar M 7739 IPRO reduced seed vigor. Keywords: Glycine max, germination, vigor.

  18. AuroraMAX! (United States)

    Donovan, E.; Spanswick, E. L.; Chicoine, R.; Pugsley, J.; Langlois, P.


    AuroraMAX is a public outreach and education initiative that brings auroral images to the public in real time. AuroraMAX utilizes an observing station located just outside Yellowknife, Canada. The station houses a digital All-Sky Imager (ASI) that collects full-colour images of the night sky every six seconds. These images are then transmitted via satellite internet to our web server, where they are made instantly available to the public. Over the last two years this program has rapidly become one of the most successful outreach programs in the history of Space Science in Canada, with hundreds of thousands of distinct visitors to the CSA AuroraMAX website, thousands of followers on social media, and hundreds of newspaper, magazine, radio, and television spots. Over the next few years, the project will expand to include a high-resolution SLR delivering real-time auroral images (also from Yellowknife), as well as a program where astronauts on the ISS will take pictures of the aurora with a handheld SLR. The objectives of AuroraMAX are public outreach and education. The ASI design, operation, and software were based on infrastructure that was developed for the highly successful ASI component of the NASA THEMIS mission as well as the Canadian Space Agency (CSA) Canadian GeoSpace Monitoring (CGSM) program. So from an education and public outreach perspective, AuroraMAX is a single camera operating in the Canadian north. On the other hand, AuroraMAX is one of nearly 40 All-Sky Imagers that are operating across North America. The AuroraMAX camera produces data that is seamlessly integrated with the CGSM ASI data, and made widely available to the Space Science community through open-access web and FTP sites. One of our objectives in the next few years is to incorporate some of the data from the THEMIS and CGSM imagers into the AuroraMAX system, to maximize viewing opportunities and generate more real-time data for public outreach. This is an exemplar of a program that

  19. Genetics Home Reference: glycine encephalopathy (United States)

    ... seizures. As they get older, many develop intellectual disability, abnormal movements, and behavioral problems. Other atypical types of glycine encephalopathy appear later in childhood or adulthood ...

  20. Seed metabolomic study reveals significant metabolite variations and correlations among different soybean cultivars. (United States)

    Lin, Hong; Rao, Jun; Shi, Jianxin; Hu, Chaoyang; Cheng, Fang; Wilson, Zoe A; Zhang, Dabing; Quan, Sheng


    Soybean [Glycine max (L.) Merr.] is one of the world's major crops, and soybean seeds are a rich and important resource for proteins and oils. While "omics" studies, such as genomics, transcriptomics, and proteomics, have been widely applied in soybean molecular research, fewer metabolomic studies have been conducted for large-scale detection of low molecular weight metabolites, especially in soybean seeds. In this study, we investigated the seed metabolomes of 29 common soybean cultivars through combined gas chromatography-mass spectrometry and ultra-performance liquid chromatography-tandem mass spectrometry. One hundred sixty-nine named metabolites were identified and subsequently used to construct a metabolic network of mature soybean seed. Among the 169 detected metabolites, 104 were found to be significantly variable in their levels across tested cultivars. Metabolite markers that could be used to distinguish genetically related soybean cultivars were also identified, and metabolite-metabolite correlation analysis revealed some significant associations within the same or among different metabolite groups. Findings from this work may potentially provide the basis for further studies on both soybean seed metabolism and metabolic engineering to improve soybean seed quality and yield. © 2014 Institute of Botany, Chinese Academy of Sciences.

  1. Seed metabolomic study reveals significant metabolite variations and correlations among different soybean cultivars

    Institute of Scientific and Technical Information of China (English)

    Hong Lin; Jun Rao; Jianxin Shi; Chaoyang Hu; Fang Cheng; Zoe AWilson; Dabing Zhang; Sheng Quan


    Soybean [Glycine max (L.) Merr.] is one of the world’s major crops, and soybean seeds are a rich and important resource for proteins and oils. While “omics”studies, such as genomics, transcriptomics, and proteomics, have been widely applied in soybean molecular research, fewer metabolomic studies have been conducted for large-scale detection of low molecular weight metabolites, especial y in soybean seeds. In this study, we investigated the seed metabolomes of 29 common soybean cultivars through combined gas chromatography-mass spectrometry and ultra-performance liquid chromatography-tandem mass spectrometry. One hundred sixty-nine named metabolites were identified and subsequently used to construct a metabolic network of mature soybean seed. Among the 169 detected metabolites, 104 were found to be significantly variable in their levels across tested cultivars. Metabolite markers that could be used to distinguish genetical y related soybean cultivars were also identified, and metabolite-metabolite correlation analysis revealed some significant associations within the same or among different metabolite groups. Findings from this work may potentially provide the basis for further studies on both soybean seed metabolism and metabolic engineering to improve soybean seed quality and yield.

  2. Effect of abscisic acid on amino acid uptake and efflux in developing soybean seeds

    International Nuclear Information System (INIS)

    Guldan, S.J.; Brun, W.A.


    The role of abscisic acid (ABA) in regulating growth of developing soybean [Glycine max (L.) Merr.] seeds is not fully understood. The objectives of this study were to characterize the effect of ABA on the in vitro uptake of asparagine and glutamine by isolated immature cotyledons in three soybean plant introduction (PI) lines with genotypic differences in seed growth rate and final seed weight. Cotyledons were incubated in uptake buffer solutions plus 14 C-asparagine or 14 C-glutamine and treatment concentrations of ABA. The ABA levels in the uptake solutions were 0, 10 -7 , 10 -6 , and 10 -5 M. The uptake rate of glutamine was approximately three times that of asparagine. Among PI lines, the heavy seeded line had a greater rate of asparagine uptake while the light seeded line had a greater rate of glutamine uptake. For asparagine, 10 -6 M ABA depressed uptake compared to the control. For glutamine, ABA enhanced uptake compared to the control at both 10 -6 and 10 -5 M. In an additional experiment, the authors observed no effect of ABA and K on the release of labeled asparagine from excised soybean seed coats. These data indicate that amino acid uptake rates are genotypically dependent and may be influenced by ABA concentration

  3. Physiological quality of soybean seeds under different yield environments and plant density

    Directory of Open Access Journals (Sweden)

    Felipe A. Baron

    Full Text Available ABSTRACT Yield potential of agricultural fields associated with plant spatial arrangement could determine the physiological quality of soybean (Glycine max L. seeds. Thus, this study aimed to evaluate the physiological quality of soybean seeds from different yield environments and plant densities. Experiments were carried out in Boa Vista das Missões-RS, Brazil, during the 2014/2015 growing season. Yield environments were delineated by overlapping yield maps from the 2008, 2009/2010 and 2011/2012 growing seasons. The experimental design was a randomized complete block in a 2 x 5 factorial arrangement with two yield environments (low and high and five plant densities, with four replicates. Two varieties were tested: Brasmax Ativa RR (10, 15, 20, 25 and 30 plants m-1 and Nidera 5909 RR (5, 10, 15, 20 and 25 plants m-1. After harvested, the seeds were analysed as following: first count index, germination, abnormal seedlings, dead seeds, electrical conductivity, accelerate aging test, root length, hypocotyl length and seedling length. The spatial variability of seed vigor in the production field could be reduced by adjusting plant density, but the adjustment should consider the variety. Harvest according to yield environment is a strategy to separate lots of seeds with higher vigor, originated from high-yield environments.

  4. WiMax taking wireless to the max

    CERN Document Server

    Pareek, Deepak


    With market value expected to reach 5 billion by 2007 and the endorsement of some of the biggest names in telecommunications, World Interoperability for Microwave Access (WiMAX) is poised to change the broadband wireless landscape. But how much of WiMAX's touted potential is merely hype? Now that several pre-WiMAX networks have been deployed, what are the operators saying about QoS and ROI? How and when will device manufacturers integrate WiMAX into their products? What is the business case for using WiMAX rather than any number of other established wireless alternatives?WiMAX: Taking Wireless

  5. Sugars and Desiccation Tolerance in Seeds 1 (United States)

    Koster, Karen L.; Leopold, A. Carl


    Soluble sugars have been shown to protect liposomes and lobster microsomes from desiccation damage, and a protective role has been proposed for them in several anhydrous systems. We have studied the relationship between soluble sugar content and the loss of desiccation tolerance in the axes of germinating soybean (Glycine max L. Merr. cv Williams), pea (Pisum sativum L. cv Alaska), and corn (Zea mays L. cv Merit) axes. The loss of desiccation tolerance during imbibition was monitored by following the ability of seeds to germinate after desiccation following various periods of preimbibition and by following the rates of electrolyte leakage from dried, then rehydrated axes. Finally, we analyzed the soluble sugar contents of the axes throughout the transition from desiccation tolerance to intolerance. These analyses show that sucrose and larger oligosaccharides were consistently present during the tolerant stage, and that desiccation tolerance disappeared as the oligosaccharides were lost. The results support the idea that sucrose may serve as the principal agent of desiccation tolerance in these seeds, with the larger oligosaccharides serving to keep the sucrose from crystallizing. PMID:16666392

  6. Max Jakobson : Kommunismisse tuleb suhtuda objektiivselt / Max Jakobson

    Index Scriptorium Estoniae

    Jakobson, Max, 1923-2013


    President Rüütel andis Soome tuntud diplomaadile ja Inimsusevastaste Kuritegude Uurimise Rahvusvahelise Komisjoni (IKURK) esimehele Max Jakobsonile Maarjamaa Risti I klassi teenetemärgi. Tseremooniajärgne intervjuu Max Jakobsoniga

  7. Genetic control of soybean seed oil: II. QTL and genes that increase oil concentration without decreasing protein or with increased seed yield. (United States)

    Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan


    Soybean [Glycine max (L.) Merrill] seed oil is the primary global source of edible oil and a major renewable and sustainable feedstock for biodiesel production. Therefore, increasing the relative oil concentration in soybean is desirable; however, that goal is complex due to the quantitative nature of the oil concentration trait and possible effects on major agronomic traits such as seed yield or protein concentration. The objectives of the present study were to study the relationship between seed oil concentration and important agronomic and seed quality traits, including seed yield, 100-seed weight, protein concentration, plant height, and days to maturity, and to identify oil quantitative trait loci (QTL) that are co-localized with the traits evaluated. A population of 203 F4:6 recombinant inbred lines, derived from a cross between moderately high oil soybean genotypes OAC Wallace and OAC Glencoe, was developed and grown across multiple environments in Ontario, Canada, in 2009 and 2010. Among the 11 QTL associated with seed oil concentration in the population, which were detected using either single-factor ANOVA or multiple QTL mapping methods, the number of QTL that were co-localized with other important traits QTL were six for protein concentration, four for seed yield, two for 100-seed weight, one for days to maturity, and one for plant height. The oil-beneficial allele of the QTL tagged by marker Sat_020 was positively associated with seed protein concentration. The oil favorable alleles of markers Satt001 and GmDGAT2B were positively correlated with seed yield. In addition, significant two-way epistatic interactions, where one of the interacting markers was solely associated with seed oil concentration, were identified for the selected traits in this study. The number of significant epistatic interactions was seven for yield, four for days to maturity, two for 100-seed weight, one for protein concentration, and one for plant height. The identified molecular

  8. Compositions of (max, +) automata

    Czech Academy of Sciences Publication Activity Database

    Lahaye, S.; Komenda, Jan; Boimond, J.-L.


    Roč. 25, 1-2 (2015), s. 323-344 ISSN 0924-6703 R&D Projects: GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : (max,+) automata * synchronous product * asynchronous product Subject RIV: BA - General Mathematics Impact factor: 1.268, year: 2015

  9. Max Algebraic Complementary Basic Matrices

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav; Hall, F.J.


    Roč. 457, 15 September (2014), s. 287-292 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : CB-matrix * Max algebra * Max permanent * Max eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  10. Identification of geneticaly modified soybean seeds resistant to glyphosate

    Directory of Open Access Journals (Sweden)

    Tillmann Maria Ângela André


    Full Text Available Advances in genetic engineering permit the modification of plants to be tolerant to certain herbicides that are usually not selective. For practical and commercial purposes, it is important to be able to detect the presence or absence of these traits in genotypes. The objective of this research was to develop a procedure for identifying genetically modified soybean (Glycine max L. Merr. with resistance to the herbicide glyphosate. Two studies were conducted based on germination test. In the first study, soybean seeds were pre-imbibed in paper towel with the herbicide solutions, then transferred to moist paper towel for the germination test. In the second study, seeds were placed directly in herbicide solutions in plastic cups and tested for germination using the paper towel method. Eight soybean genotypes were compared: four Roundup Ready, that contained the gene resistant to the herbicide (G99-G725, Prichard RR, G99-G6682, and H7242 RR and four non-transgenic parental cultivars (Boggs, Haskell, Benning, and Prichard. In the first study, the seeds were imbibed for 16 hours at 25°C in herbicide concentrations between 0.0 and 1.5% of the glyphosate active ingredient. In the second, seeds were subjected to concentrations between 0.0 and 0.48%, for one hour, at 30°C. The evaluation parameters were: germination, hypocotyl length, root length and total length of the seedlings. Both methods are efficient in identifying glyphosate-resistant soybean genotypes. It is possible to identify the genetically modified soybean genotypes after three days, by imbibing the seed in 0.12% herbicide solution, and after six days if the substrate is pre-imbibed in a 0.6% herbicide solution. The resistance trait was identified in all cultivars, independent of the initial physiological quality of the seed.

  11. Electrical conductivity of the seed soaking solution and soybean seedling emergence

    Directory of Open Access Journals (Sweden)

    Vieira Roberval Daiton


    Full Text Available Vigor of soybean [Glycine max (L. Merrill] seeds can be evaluated by measuring the electrical conductivity (EC of the seed soaking solution, which has shown a satisfactory relationship with field seedling emergence, but has not had aproper definition of range yet. This work studies the relationship between EC and soybean seedling emergence both in the field and laboratory conditions, using twenty two seed lots. Seed water content, standard germination and vigor (EC, accelerated aging and cold tests were evaluated under laboratory conditions using -0.03; -0.20; -0.40 and -0.60 MPa matric potentials, and field seedling emergence was also observed. There was direct relationship between EC and field seedling emergence (FE. Under laboratory conditions, a decreasing relationship was found between EC and FE as water content in the substrate decreased. Relationships between these two parameters were also found when -0.03; -0.20 and -0.40 MPa matric potentials were used. EC tests can be used successfully to evaluate soybean seed vigor and identify lots with higher or lower field emergence potential.

  12. Quantitative Conversion of Phytate to Inorganic Phosphorus in Soybean Seeds Expressing a Bacterial Phytase1[OA (United States)

    Bilyeu, Kristin D.; Zeng, Peiyu; Coello, Patricia; Zhang, Zhanyuan J.; Krishnan, Hari B.; Bailey, April; Beuselinck, Paul R.; Polacco, Joe C.


    Phytic acid (PA) contains the major portion of the phosphorus in the soybean (Glycine max) seed and chelates divalent cations. During germination, both minerals and phosphate are released upon phytase-catalyzed degradation of PA. We generated a soybean line (CAPPA) in which an Escherichia coli periplasmic phytase, the product of the appA gene, was expressed in the cytoplasm of developing cotyledons. CAPPA exhibited high levels of phytase expression, ≥90% reduction in seed PA, and concomitant increases in total free phosphate. These traits were stable, and, although resulted in a trend for reduced emergence and a statistically significant reduction in germination rates, had no effect on the number of seeds per plant or seed weight. Because phytate is not digested by monogastric animals, untreated soymeal does not provide monogastrics with sufficient phosphorus and minerals, and PA in the waste stream leads to phosphorus runoff. The expression of a cytoplasmic phytase in the CAPPA line therefore improves phosphorus availability and surpasses gains achieved by other reported transgenic and mutational strategies by combining in seeds both high phytase expression and significant increases in available phosphorus. Thus, in addition to its value as a high-phosphate meal source, soymeal from CAPPA could be used to convert PA of admixed meals, such as cornmeal, directly to utilizable inorganic phosphorus. PMID:18162589

  13. maxAlike

    DEFF Research Database (Denmark)

    Menzel, Karl Peter; Stadler, Peter F.; Gorodkin, Jan


    MOTIVATION: The task of reconstructing a genomic sequence from a particular species is gaining more and more importance in the light of the rapid development of high-throughput sequencing technologies and their limitations. Applications include not only compensation for missing data in unsequenced...... genomic regions and the design of oligonucleotide primers for target genes in species with lacking sequence information but also the preparation of customized queries for homology searches. RESULTS: We introduce the maxAlike algorithm, which reconstructs a genomic sequence for a specific taxon based...... on sequence homologs in other species. The input is a multiple sequence alignment and a phylogenetic tree that also contains the target species. For this target species, the algorithm computes nucleotide probabilities at each sequence position. Consensus sequences are then reconstructed based on a certain...

  14. Influence of high glycine diets on the activity of glycine-catabolizing enzymes and on glycine catabolism in rats

    International Nuclear Information System (INIS)

    Petzke, K.J.; Albrecht, V.; Przybilski, H.


    Male albino rats were adapted to isocaloric purified diets that differed mainly in their glycine and casein contents. Controls received a 30% casein diet. In experimental diets gelatin or gelatin hydrolysate was substituted for half of the 30% casein. An additional group was fed a glycine-supplemented diet, which corresponded in glycine level to the gelatin diet but in which the protein level was nearly the same as that of the casein control diet. Another group received a 15% casein diet. Rat liver glycine cleavage system, serine hydroxymethyltransferase and serine dehydratase activities were measured. 14 CO 2 production from the catabolism of 14 C-labeled glycine was measured in vivo and in vitro (from isolated hepatocytes). Serine dehydratase and glycine cleavage system activities were higher in animals fed 30% casein diets than in those fed 15% casein diets. Serine hydroxymethyltransferase activity of the cytosolic and mitochondrial fractions was highest when a high glycine diet (glycine administered as pure, protein bound in gelatin or peptide bound in gelatin hydrolysate) was fed. 14 CO 2 formation from [1- 14 C]- and [2- 14 C]glycine both in vivo and in isolated hepatocytes was higher when a high glycine diet was fed than when a casein diet was fed. These results suggest that glycine catabolism is dependent on and adaptable to the glycine content of the diet. Serine hydroxymethyltransferase appears to play a major role in the regulation of glycine degradation via serine and pyruvate

  15. Main: 1FHF [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available oat Peroxidase; Glycine Max Molecule: Seed Coat Peroxidase; Chain: A, B, C; Engineered: Yes Oxidoreductase 1...LFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAI

  16. Factores asociados con la pérdida de germinación y vigor en la semilla de dos cultivares de soya Glycine max (L. en postcosecha Factors associated with low vigor and loss of germination of two soybean varieties in post harvest

    Directory of Open Access Journals (Sweden)

    Agudelo D. Orlando


    Full Text Available La investigación tuvo como finalidad evaluar algunos factores que inciden en la pérdida de germinación y vigor de la semilla de soya, tales como los contenidos de ácidos grasos libres y el índice de peróxidos, el tiempo de almacenamiento y el grosor de la cubierta seminal. También se pretendió evaluar los efectos de la profundidad de siembra (3 y 6 cm y textura del substrato de germinación (arena y suelo. La fase experimental se desarrolló en 1990 en ICA Palmira, Las semillas de los cultivares SOYICAP. 31 Y SOYICA P.33 permanecieron almacenados por espacio de noventa días en condiciones ambientales. Se hicieron evaluaciones mensuales de germinación, vigor, contenido de humedad, contenido de ácidos grasos libres y contenido de peróxidos; además se realizó un análisis del grosor de la cubierta seminal y de los cotiledones de cada cultivar. La más alta calidad fisiológica de la semilla se obtuvo a los noventa días de almacenamiento. El contenido de ácidos grasos libres y peróxidos afectó la capacidad del almacenamiento de ésta a través del tiempo. El mayor porcentaje de germinación e índice de vigor en cada variedad coincidió con menores valores tanto en el contenido de ácidos grasos como en el índice de peróxidos. El substrato suelo y la profundidad de siembra de seis centímetros, estuvieron asociados con el menor porcentaje de germinación e índice de vigor. La mejor expresión del vigor y germinación se obtuvo en el substrato arena y la profundidad de siembra de tres centímetros. Se encontró que la variedad SOYICA P. 33 presenta un menor grosor de la testa que la SOYICA P. 31. No existen diferencias sobresalientes, ni morfológicamente ni en cuanto a medidas en las estructuras cotiledonales de las dos variedades.In the National Center of Agricultural Research (ICA of Palmira and Facultad de Ciencias Agropecuarias of Palmira a experirnent with the objetive to see the loss of germination and low vigor in seed

  17. A Single-Nucleotide Polymorphism in an Endo-1,4-β-Glucanase Gene Controls Seed Coat Permeability in Soybean.

    Directory of Open Access Journals (Sweden)

    Seong-Jin Jang

    Full Text Available Physical dormancy, a structural feature of the seed coat known as hard seededness, is an important characteristic for adaptation of plants against unstable and unpredictable environments. To dissect the molecular basis of qHS1, a quantitative trait locus for hard seededness in soybean (Glycine max (L Merr., we developed a near-isogenic line (NIL of a permeable (soft-seeded cultivar, Tachinagaha, containing a hard-seed allele from wild soybean (G. soja introduced by successive backcrossings. The hard-seed allele made the seed coat of Tachinagaha more rigid by increasing the amount of β-1,4-glucans in the outer layer of palisade cells of the seed coat on the dorsal side of seeds, known to be a point of entrance of water. Fine-mapping and subsequent expression and sequencing analyses revealed that qHS1 encodes an endo-1,4-β-glucanase. A single-nucleotide polymorphism (SNP introduced an amino acid substitution in a substrate-binding cleft of the enzyme, possibly reducing or eliminating its affinity for substrates in permeable cultivars. Introduction of the genomic region of qHS1 from the impermeable (hard-seeded NIL into the permeable cultivar Kariyutaka resulted in accumulation of β-1,4-glucan in the outer layer of palisade cells and production of hard seeds. The SNP allele found in the NIL was further associated with the occurrence of hard seeds in soybean cultivars of various origins. The findings of this and previous studies may indicate that qHS1 is involved in the accumulation of β-1,4-glucan derivatives such as xyloglucan and/or β-(1,3(1,4-glucan that reinforce the impermeability of seed coats in soybean.

  18. Correlation between seed size, protein and oil contents, and fatty acid composition in soybean genotypes

    Directory of Open Access Journals (Sweden)

    Maestri, Damián M.


    Full Text Available Eighteen soybean genotypes (Glycine max (L. Merrill with maturity groups IV, V, VI or VII were grown in 1995/96 at the Estación Experimental Agropecuaria (EEA-INTA of Manfredi and Marcos Juárez, Argentina. The aim of this research was to determine possible associations between seed size, protein and oil contents, and fatty composition. Seed size varied between 13.9-21.0 g/100 seeds. Protein and oil contents ranged from 331 to 448 and from 198 to 267 g kg-1, respectively, and showed no significant correlation with seed size. There were significant correlations between seed size and individual fatty adds: positive with stearic and oleic and negative with linoleic. The results obtained suggest that seed size and its relationship with individual fatty acids must be considered in soybean breeding programs.

    Se analizaron 18 genotipos de soja (Glycine max (L. Merrill con grupos de madurez IV, V, VI o VIl, cultivados en 1995/96 en la Estación Experimental Agropecuaria (EEA-INTA de Manfredi y Marcos Juárez, Argentina. El propósito de la investigación fue determinar posibles asociaciones entre el tamaño del grano, los contenidos de proteínas y aceite y la composición de ácidos grasos del mismo. El tamaño del grano varió entre 13.9-21.0 g/100 granos. Los porcentajes de proteínas y aceite estuvieron comprendidos entre 331-448 y entre 198-267 g kg-1 respectivamente, y no mostraron correlaciones significativas con el tamaño del grano. Se observaron correlaciones significativas entre el tamaño del grano y determinados ácidos grasos: positivas con esteárico y oleico y negativa con linoleico. Las asociaciones encontradas podrían ser de utilidad en programas de mejoramiento de soja.

  19. Somatic embryogenesis in cell cultures of Glycine species. (United States)

    Gamborg, O L; Davis, B P; Stahlhut, R W


    This report describes the development of procedures for the production of somatic embryos in cell cultures of Glycine species including soybean. The conditions for callus induction and initiation of rapidly growing cell suspension cultures were defined. Methods for inducing embryogenesis were tested on 16 lines of several Glycine species and cultivars of soybean. The SB-26 Culture of a G. soja gave the best results and was used in the experiments. Embryogenesis required the presence of picloram or 2,4-D. AMO 1618, CCC, PP-333 and Ancymidol enhanced the embryogenesis frequency. Plants of the G. soja (SB-26) were grown to maturity from seed-derived shoot tips. Characteristics of the plants are discussed.

  20. Characterization of Natural and Simulated Herbivory on Wild Soybean (Glycine soja Seib. et Zucc. for Use in Ecological Risk Assessment of Insect Protected Soybean.

    Directory of Open Access Journals (Sweden)

    Hidetoshi Goto

    Full Text Available Insect-protected soybean (Glycine max (L. Merr. was developed to protect against foliage feeding by certain Lepidopteran insects. The assessment of potential consequences of transgene introgression from soybean to wild soybean (Glycine soja Seib. et Zucc. is required as one aspect of the environmental risk assessment (ERA in Japan. A potential hazard of insect-protected soybean may be hypothesized as transfer of a trait by gene flow to wild soybean and subsequent reduction in foliage feeding by Lepidopteran insects that result in increased weediness of wild soybean in Japan. To assess this potential hazard two studies were conducted. A three-year survey of wild soybean populations in Japan was conducted to establish basic information on foliage damage caused by different herbivores. When assessed across all populations and years within each prefecture, the total foliage from different herbivores was ≤ 30%, with the lowest levels of defoliation (< 2% caused by Lepidopteran insects. A separate experiment using five levels of simulated defoliation (0%, 10%, 25%, 50% and 100% was conducted to assess the impact on pod and seed production and time to maturity of wild soybean. The results indicated that there was no decrease in wild soybean plants pod or seed number or time to maturity at defoliation rates up to 50%. The results from these experiments indicate that wild soybean is not limited by lepidopteran feeding and has an ability to compensate for defoliation levels observed in nature. Therefore, the potential hazard to wild soybean from the importation of insect-protected soybean for food and feed into Japan is negligible.

  1. Acúmulo de massa seca e macronutrientes por plantas de Glycine max e Richardia brasiliensis Accumulation of biomass and macronutrients by Glycine max and Richardia brasiliensis

    Directory of Open Access Journals (Sweden)

    A.F.F. Pedrinho Júnior


    Full Text Available Foram realizados dois experimentos, em condições de casa de vegetação, no Departamento de Biologia Aplicada à Agropecuária da FCAV-UNESP de Jaboticabal, objetivando-se determinar o acúmulo de massa seca, assim como a distribuição e o acúmulo de macronutrientes durante os ciclos de vida de plantas de soja cultivar BR16, no período de outubro de 2000 a fevereiro de 2001, e de Richardia brasiliensis (poaia-branca, uma planta daninha de elevada importância para esta cultura no Brasil, especialmente em áreas de plantio direto, no período de outubro de 1998 a fevereiro de 1999. Os estudos foram realizados em delineamento experimental inteiramente casualizado, com quatro repetições. Quatro plantas cresceram em vasos com capacidade de sete litros, preenchidos com areia de rio lavada, peneirada e irrigada diariamente com solução nutritiva. Os tratamentos foram representados pelas épocas de amostragem, realizadas a intervalos de 14 dias, a saber: 22, 36, 50, 64, 78, 92, 106, 120, 134, 148, 162 e 176 dias após a emergência (DAE das plantas de R. brasiliensis; e 21, 35, 49, 63, 77, 91, 105 e 119 DAE das plantas de soja cv. BR-16 (precoce. Em ambas as plantas, as folhas tiveram a maior partição de biomassa durante sete semanas. Para este dado, a partição foi maior para as estruturas reprodutivas em soja e nos caules para a poaia-branca. O ponto de máximo acúmulo teórico de massa seca deu-se aos 104 DAE para a soja (36,6 g por planta e aos 146 DAE para a poaia-branca (16,4 g por planta. Da emergência até aos 50 DAE as folhas apresentaram maior participação no acúmulo de massa seca, nas duas espécies. Após 50 DAE notou-se, em ambas as espécies, uma inversão na representatividade das folhas por caules, para a espécie daninha, e por caules e posteriormente por estruturas reprodutivas, para a cultura. A taxa de absorção diária dos macronutrientes atingiu maiores valores entre 69 e 87 DAE para a soja e entre 106 a 111 DAE para a planta daninha. Levando em conta a média dos valores de pontos de inflexão observados para a cultura da soja, aos 78 DAE uma planta de soja acumula teoricamente 25,9 g de massa seca; 615,5 mg de N; 77,2 mg de P; 538,6 mg de K; 535,0 mg de Ca; 171,5 mg de Mg; e 39,5 mg de S. Para o mesmo período, uma planta de R. brasiliensis acumula teoricamente 3,7 g de massa seca; 50,8 mg de N; 3,2 mg de P; 104,4 mg de K; 127,8 mg de Ca; 18,8 mg de Mg; e 3,7 mg de S.Two greenhouse trials were carried out under greenhouse conditionsat the Department of Agricultural Biology at FCAV-UNESP in Jaboticabal, SP, Brazil to study tbiomass accumulation as well as macronutrient distribution and accumulation during the life cycle of the soybean cultivar BR 16 from October 2000 to February 2001, and Richardia brasiliensis (Brazilian pusley, from October 1998 to February 1999. Brazilian pusley is one of the most important weeds in the mid western soybean growing area, mainly under no tillage system. The studies were conducted in a randomized complete design with four replications. Four plants were grown in seven liter pots filled with sandy substrate irrigated daily with a nutritive solution. The treatments were represented by timing of sampling, performed at 14 day intervals, 22, 36, 50, 64, 78, 92, 106, 120, 134, 148, 162 and 176 days after emergence (DAE of R. brasiliensis plants; and 21, 35, 49, 63, 77, 91, 105 and 119 DAE of the soybean plants BR-16 (early maturity For both plants, the leaves had the highest biomass partition during seven weeks. For these data, partition was higher in reproductive structures in soybean and in the stems for Brazilian pusley. The maximumcritical biomass accumulation was estimated at 104 days for soybean (36.6 g plant-1 and at 146 days for R. brasiliensis (16.4 g planta-1. From emergence up to 50 DAE, the leaves presented higher participation in biomass accumulation, in both species. After 50 DAE, it was observed in both species an inversion in leaf representativity per shoots, for the weed species and per shoots and later per reproductive structures, for thecrop. The maximumdaily macronutrient uptake ratewas achieved between 69 and 87 days in soybean and 106 and 111 DAE in R. brasiliensis. Considering of the inflexion point average observed for the soybean culture, it is possible to estimate that, at 78 DAE, this plant theoretically accumulates 25.9 g of dry weight ; 615.6 mg oN; 77.2 mg P; 538.6 mg K; 535.0 mg Ca; 171.5 mg Mg and 39,5 mg S. In the same period, one razilian pusley plant accumulates 3.7 g dry weight; 50.8 mg N; 3.2 mg P; 104.4 mg K; 127.8 mg Ca; 18.8 mg Mg and 3. 7 mg oS.


    Directory of Open Access Journals (Sweden)

    Emanuel da Silva Barros


    Full Text Available

    Objetivou-se, com este trabalho, avaliar o efeito de diferentes sistemas de manejo do solo sobre os componentes de produção da soja cultivada solteira e em consórcio com B. decumbens, nos Tabuleiros Costeiros do Estado de Alagoas. Os tratamentos consistiram no cultivo da variedade de soja Monsoy 9350, nos sistemas preparo convencional do solo, cultivo mínimo e plantio direto. O delineamento experimental utilizado foi o em blocos casualizados, com parcelas subdivididas (com e sem B. decumbens, e quatro repetições. As variáveis analisadas foram: 1 cultura da soja: determinação dos estágios fenológicos, composição química das plantas, estande de plantas, diâmetro do colmo, altura de plantas, altura de inserção da primeira vagem, número de vagens por planta, número de grãos por vagem, número de grãos por planta, massa de 1.000 grãos e produtividade; e 2 B. decumbens: composição química das plantas, além do acúmulo de matéria seca, em cinco épocas de amostragens. Os sistemas de manejo do solo influenciaram o estande de plantas e a concentração de P, Cu, Fe e Zn, na soja, além do S, na Brachiaria decumbens. O sistema plantio direto apresentou maior produtividade de grãos e produção de fitomassa de B. decumbens, nas condições edafoclimáticas de Rio Largo (AL.

    PALAVRAS-CHAVE: Plantio direto; integração lavoura-pecuária; cultivo mínimo.

    The aim of this study was to evaluate the effects of different soil management systems on the soybean yield components intercropped or not with Brachiaria decumbens, in the coastal plateau of the Alagoas State, Brazil. For that, the 9350 Monsoy soybean was cultivated under conventional tillage, minimum tillage, and no-tillage. The experiment was carried out by using a split-plot randomized blocks design (with and without B. decumbens and four replications. The variables analyzed were: 1 soybean: determination of phenological stages, chemical composition of plants, stand of plants, stem diameter, plant height, first pod insertion height, number of grains per pod, number of pods, number of grains per plant, mass of 1,000 grains, and yield; and 2 B. decumbens: chemical composition of plants and accumulation of dry matter, in five different sampling times. The soil management systems influenced the stand of plants and the concentration of P, Cu, Fe, and Zn, in soybean, besides S, in B. decumbens. The no-tillage system showed higher grain and biomass yield for B. decumbens, under the edaphoclimatic conditions of Rio Largo, Alagoas State, Brazil.

    KEY-WORDS: No-tillage; crop-livestock integrated system; minimum tillage.

  3. Sensibilidade de cultivares de soja (Glycine max aos herbicidas diclosulam e flumetsulam Soybean (Glycine max cultivars sensibility to the herbicides diclosulam and flumetsulam

    Directory of Open Access Journals (Sweden)

    Célio R. F. Leite


    Full Text Available O objetivo deste trabalho foi verificar, no campo, no município de Londrina-PR, a resposta de 12 cultivares de soja em relação aos herbicidas diclosulam e flumetsulam aplicados e incorporados em Latossolo Roxo distrófico (80,84 % de argila, pH 5,4 e matéria orgânica 3,07 %. As cultivares foram: 'FT-Guaira', 'Embrapa-48', 'Ocepar-14', 'BR-16', 'Embrapa-4', 'Ocepar-13', 'BR-36', 'FT10-Princesa', 'FT-2000', 'FTAbyara', 'BR-37' e 'RS7- Jacuí'. O diclosulam foi utilizado nas doses de 35 g/ha (normal e 70 g/ha (dobrada; e o flumetsulam nas doses de 120 g/ha (normal e 240 g/ha (dobrada; também foi utilizada a mistura de diclosulam + flumetsulam (20 + 100 g/ha; e imazaquin à 150 g/ha. Nas doses normais utilizadas dos dois herbicidas não foi possível distinguir nenhuma cultivar suscetível. Em dose dobrada do diclosulam os rendimentos das cultivares 'FT-Guaira', 'Embrapa 4' e 'BR-37 ' foram reduzidos em 20,9 %, 11,8 % e 11,0 % respectivamente, em relação à testemunha. O flumetsulam à 240 g/ha e sua mistura com diclosulam também reduziu o rendimento destas cultivares, mais o da 'Ocepar-14'. A maioria das cultivares teve o estande reduzido, nas doses dobradas dos dois herbicidas, mas também sem significância. Somente o estande da cultivar 'Embrapa-48' não foi afetado, ao contrário da 'RS-7 Jacuí'. A altura de plantas foi menor em relação à testemunha no tratamento com flumetsulam à 240 g/ha. Na maioria das cultivares o peso da biomassa seca de nódulos foi menor nas doses dobradas, e em algumas também o peso por unidade de nódulos. A biomassa seca da parte aérea e da raiz não foram reduzidas.The objective of the present paper was to check the behaviour of 12 different soybean cultivars in relation to the tolerance to the herbicides flumetsulam and diclosulam applied on a soil classified as Latossolo Roxo distrófico (80,87% of clay, pH of 5,4 and 3,07 of organic matter in Londrina - PR. The cultivars were: 'FTGuaira', 'Embrapa-48', 'Ocepar-14', 'BR-16', 'Embrapa-4', 'Ocepar-13', 'BR-36', 'FT 10- Princesa', 'FT-2000', 'FT-Abyara', 'BR-37' and 'RS 7-Jacuí'. Diclosulam was used in the rates of 35 g/ha (normal rate and 70 g/ha (double rate and flumetsulam in the rates of 120 g and 240 g/ha (normal and double rate respectively. It was also used a mix of diclosulam and flumetsulam (20 + 100 g/ha and imazaquin at 150 g/ha. At the normal rates of both herbicides it was not poss to find any difference in suscetibily of the cultivars. At double rates of diclosulam the yields of 'FT-Guaira', 'Embrapa-4'and 'BR-37' were reduced in 20,9%, 11,8% and 11,0%, respectively, in relation to the check. Flumetsulam at 240 g/ha and its mix with diclosulam also reduced the yields of these cultivars, plus "Ocepar-14'. The major of the cultivars showed a reduced stand at the double rates of the both herbicides, but without significance. Only the stand of 'Embrapa- 48' was not affected, contrary to 'RS 7-Jacuí'. The plant height was reduced by flumetsulam at 240 g/ha. In all cultivars the nodule dry biomass was reduced in double rates, and in some of them the weight per unit of nodule. The dry biomass of aerial port and roots werw nor reduced.


    Directory of Open Access Journals (Sweden)



    Full Text Available The objective of this work was to study the behavior of ten soybean [Glycine max (L. Merr.] cultivars using the electrical conductivity (EC test by the comparison of curves of the accumulative electrolyte leakage along the time and to establish the statistical model that allow the best adjust of the curves. Ten soybean cultivars were used and they were mechanically harvested in 2004 in the EEA Oliveros, Santa Fe, Argentina. Measurements of EC were made for 100 individual seeds of each cultivar during 20 hours of immersion at intervals of 1 hour using an equipment that permit an individual seed analysis (Seed Automatic Analyzer SAD 9000S. There were proposed two statistical models to study the EC along the time of the 10 cultivars studied using SAS Statistics Program, to select the model that better allow us to understand the EC behavior along the time. Model 1 allowed to make comparisons of EC along the time between cultivars and to study the influence of the production environment on the physiological quality of soybean seeds. The time to reach the stabilization of the EC must not be lower than 19 hours for the different cultivars.

  5. Transgenic soya bean seeds accumulating β-carotene exhibit the collateral enhancements of oleate and protein content traits. (United States)

    Schmidt, Monica A; Parrott, Wayne A; Hildebrand, David F; Berg, R Howard; Cooksey, Amanda; Pendarvis, Ken; He, Yonghua; McCarthy, Fiona; Herman, Eliot M


    Transgenic soya bean (Glycine max) plants overexpressing a seed-specific bacterial phytoene synthase gene from Pantoea ananatis modified to target to plastids accumulated 845 μg β carotene g(-1) dry seed weight with a desirable 12:1 ratio of β to α. The β carotene accumulating seeds exhibited a shift in oil composition increasing oleic acid with a concomitant decrease in linoleic acid and an increase in seed protein content by at least 4% (w/w). Elevated β-carotene accumulating soya bean cotyledons contain 40% the amount of abscisic acid compared to nontransgenic cotyledons. Proteomic and nontargeted metabolomic analysis of the mid-maturation β-carotene cotyledons compared to the nontransgenic did not reveal any significant differences that would account for the altered phenotypes of both elevated oleate and protein content. Transcriptomic analysis, confirmed by RT-PCR, revealed a number of significant differences in ABA-responsive transcripton factor gene expression in the crtB transgenics compared to nontransgenic cotyledons of the same maturation stage. The altered seed composition traits seem to be attributed to altered ABA hormone levels varying transcription factor expression. The elevated β-carotene, oleic acid and protein traits in the β-carotene soya beans confer a substantial additive nutritional quality to soya beans. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  6. Vegetable soybean: seed composition and production research

    Directory of Open Access Journals (Sweden)

    Qiuying Zhang


    Full Text Available Vegetable soybean (edamame [Glycine max (L. Merr.] is a low input, high nutritional value, short crop cycle and soil-enriching profitable crop. It offers quick economic return and provides health benefits to the consumers. The market demand for edamame has begun to flourish and expand dramatically in recent decades due to increased awareness of nutritional properties, and the change in life styles towards healthier food. This article highlighted the importance of edamame as a nutraceutical and functional food-grade produce, summarised the research advances in seed composition and their roles, cultivar selection and crop establishment, planting date and fertilisation, weed management and harvesting. Current production problem of extensive labor at harvest and future research challenges in improving crop establishment, developing cultivars competitive to weed and resistant to pest insects/diseases, assessing biological activities of edamame elemental and phytochemical properties on cancer cell inhibition, and developing organic production system were also proposed with aims of enhancing farm profitability and expanding opportunities for extensive use of edamame.

  7. 3ds Max 2012 Bible

    CERN Document Server

    Murdock, Kelly L


    Updated version of the bestselling 3ds Max book on the market 3ds Max 2012 Bible is one of the most popular 3ds Max how-tos on the market. If you're a beginner just itching to create something right away, the Quick Start project in Part 1 is for you. If you're an experienced user checking out 3ds Max 2012's latest and greatest features, you'll love the fact that the 3ds Max 2012 Bible continues to be the most comprehensive reference on this highly complex application.Find out what's new, what's tried and true, and how creative you can get using the tips, tricks, and techniques in this must-hav

  8. 76 FR 8771 - Glycine From China (United States)


    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-718 (Third Review)] Glycine From China... order on glycine from China. SUMMARY: The Commission hereby gives notice that it will proceed with a... determine whether revocation of the antidumping duty order on glycine from China would be likely to lead to...

  9. 76 FR 55109 - Glycine From China (United States)


    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-718 (Third Review)] Glycine From China... U.S.C. 1675(c)), that revocation of the antidumping duty order on glycine from China would be likely... contained in USITC Publication 4255 (August 2011), entitled Glycine from China: Investigation No. 731-TA-718...

  10. Pruebas de vigor y calidad fisiológica de semillas de soja Vigor tests and physiological quality of soybean seeds

    Directory of Open Access Journals (Sweden)

    Adriana Rita Salinas


    Full Text Available El objetivo de este trabajo fue estudiar las alteraciones producidas por el deterioro en semillas de soja (Glycine max L. Merrill utilizando diferentes pruebas de vigor. Se utilizaron semillas de soja de diferentes cultivares en 1997 y 1998, las cuales fueron sometidas a la prueba de germinación y diferentes pruebas de vigor: envejecimiento acelerado; conductividad eléctrica; deterioro controlado y tetrazolio. El deterioro controlado en semillas con 22% de humedad mostró ser un mejor indicador de la disminución del vigor de la semilla de soja que el envejecimiento acelerado. La conductividad eléctrica en semillas individuales podría ser considerada una buena prueba de vigor para detectar alteraciones producidas en las membranas citoplasmáticas en un estadio temprano del deterioro de las semillas. La clasificación de la viabilidad y el vigor a través de la prueba de tetrazolio está dada por el lugar donde se produce el daño y no por el tipo de daño que sufre la semilla.The objective of this work was to study soybean (Glycine max L. Merrill seed alterations produced by deterioration using different vigor tests. Soybean seeds of different cultivars were used in 1997 and 1998, which were submitted to standard germination test and the vigor tests: accelerated aging; electric conductivity; controlled deterioration and tetrazolium. The controlled deterioration with an elevation of the seed humidity to 22%, showed to be a better indicator of the diminishing of soybean seed vigor than the accelerated aging. The electric conductivity in individual seeds would be considered a good vigor test to detect the alterations produced in the cytoplasmic membranes in an early stage of the seed deterioration. The tetrazolium test by the evaluation of the different kinds of injuries suffered by the seeds, depends on the place where the seed is damaged not on the kind of injury suffered by the seed.

  11. Gene expression in the lignin biosynthesis pathway during soybean seed development. (United States)

    Baldoni, A; Von Pinho, E V R; Fernandes, J S; Abreu, V M; Carvalho, M L M


    The study of gene expression in plants is fundamental, and understanding the molecular mechanisms involved in important biological processes, such as biochemical pathways or signaling that are used or manipulated in improvement programs, are key for the production of high-quality soybean seeds. Reports related to gene expression of lignin in seeds are scarce in the literature. We studied the expression of the phenylalanine ammonia-lyase (PAL), cinnamate 4-hydroxylase, 4-hydroxycinnamate 3-hydroxylase, and cinnamyl alcohol dehydrogenase genes involved in lignin biosynthesis during the development of soybean (Glycine max L. Merrill) seeds. As the endogenous control, the eukaryotic elongation factor 1-beta gene was used in two biological replicates performed in triplicate. Relative quantitative expression of these genes during the R4, R5, R6, and R7 development stages was analyzed. Real-time polymerase chain reaction was used for the gene expression study. The analyses were carried out in an ABI PRISM 7500 thermocycler using the comparative Ct method and SYBR Green to detect amplification. The seed samples at the R4 stage were chosen as calibrators. Increased expression of the cinnamate-4-hydroxylase and PAL genes occurred in soybean seeds at the R5 and R6 development stages. The cinnamyl alcohol dehydrogenase gene was expressed during the final development phases of soybean seeds. In low-lignin soybean cultivars, the higher expression of the PAL gene occurs at development stages R6 and R7. Activation of the genes involved in the lignin biosynthesis pathway occurs at the beginning of soybean seed development.

  12. Comparison of in Situ and in Vitro Regulation of Soybean Seed Growth and Development (United States)

    Dyer, Daniel J.; Cotterman, C. Daniel; Cotterman, Josephine C.


    The growth characteristics of soybean (Glycine max [L.] Merr.) embryos in culture and seeds in situ were found to be similar, but developmental differences were observed. Embryos placed in culture when very small (grow indefinitely, reaching dry weights far in excess of seeds matured in situ. Apparently, maternal factors were important in early and late development during the determination of maximum growth rate and the cessation of growth. Embryo growth rate was not affected by substituting glucose plus fructose for sucrose in the medium, nor by hormone treatments, including abscisic acid. Glutamine was found to give substantially better growth than glutamate, however. Contrary to prior reports, the response of soybean embryo growth rate to irradiance was found to be primarily an artifact of the effect of irradiance on media temperature. Across seven genotypes the correlation coefficient between seed growth rate in situ and embryo growth rate in vitro was 0.94, indicating essentially all of the variability of in situ seed growth rate between cultivars could be attributed to inherent growth rate differences associated with the embryos. The response to temperature was very similar for both embryos in culture and seeds in situ at temperatures below 30°C. Beyond that temperature, embryo growth rate continued to increase, while seed growth rate did not. The implication is that in situ seed growth rate is determined by the inherent growth potential of the embryo at low to moderate temperatures; however, at higher temperatures, the maternal plant is unable to support the rapid growth rates that the embryo is capable of attaining under conditions of unlimited assimilate supply. PMID:16665434

  13. OaMAX2 of Orobanche aegyptiaca and Arabidopsis AtMAX2 share conserved functions in both development and drought responses. (United States)

    Li, Weiqiang; Nguyen, Kien Huu; Watanabe, Yasuko; Yamaguchi, Shinjiro; Tran, Lam-Son Phan


    Previous studies in Arabidopsis reported that the MAX2 (more axillary growth 2) gene is a component of the strigolactone (SL) signaling pathway, which regulates a wide range of biological processes, from plant growth and development to environmental stress responses. Orobanche aegyptiaca is a harmful parasitic plant for many economically important crops. Seed germination of O. aegyptiaca is very sensitive to SLs, suggesting that O. aegyptiaca may contain components of the SL signaling pathway. To investigate this hypothesis, we identified and cloned a MAX2 ortholog from O. aegyptiaca for complementation analyses using the Arabidopsis Atmax2 mutant. The so-called OaMAX2 gene could rescue phenotypes of the Atmax2 mutant in various tested developmental aspects, including seed germination, shoot branching, leaf senescence and growth and development of hypocotyl, root hair, primary root and lateral root. More importantly, OaMAX2 could enhance the drought tolerance of Atmax2 mutant, suggesting its ability to restore the drought-tolerant phenotype of mutant plants defected in AtMAX2 function. Thus, this study provides genetic evidence that the functions of the MAX2 orthologs, and perhaps the MAX2 signaling pathways, are conserved in parasitic and non-parasitic plants. Furthermore, the results of our study enable us to develop a strategy to fight against parasitic plants by suppressing the MAX signaling, which ultimately leads to enhanced productivity of crop plants. Copyright © 2016 Elsevier Inc. All rights reserved.

  14. Max Scheler's Phenomenology of Interrelation

    African Journals Online (AJOL)


    German phenomenologist and sociologist Max Scheler accorded sympathy a central role in his philosophy .... process of deliberation or ask myself how the other person might be feeling .... Scheler believes that Nietzsche mistakenly identifies.

  15. President Ilves kohtus Max Jakobsoniga

    Index Scriptorium Estoniae


    President Toomas Hendrik Ilves ja Soome tuntud diplomaat Max Jakobson arutasid 16. septembril 2008 Tallinnas toimunud kohtumisel julgeolekuolukorda Euroopas pärast Venemaa-Gruusia sõda, Euroopa Liidu suhteid Venemaaga ja NATO tulevikku

  16. Crystallization of glycine with ultrasound

    DEFF Research Database (Denmark)

    Louhi-Kultanen, Marjatta; Karjalainen, Milja; Rantanen, Jukka


    Sonocrystallization has proved to be an efficient tool to influence the external appearance and structure of a crystalline product obtained by various crystallization methods. The present work focuses on high intensity sonocrystallization of glycine by varying amplitude of ultrasound with an ultr...... ultrasound power. This study also showed, the higher the ultrasound amplitude the smaller the crystals obtained.......Sonocrystallization has proved to be an efficient tool to influence the external appearance and structure of a crystalline product obtained by various crystallization methods. The present work focuses on high intensity sonocrystallization of glycine by varying amplitude of ultrasound...... with an ultrasound frequency of 20kHz at two temperature ranges 40-50 and 20-30 degrees C in a jacketed 250-ml cooling crystallizer equipped with a stirrer. The polymorph composition of the obtained crystals was analyzed with a temperature variable X-ray powder diffractometer (XRPD). XRPD results showed that...

  17. Efecto de la temperatura de almacenamiento sobre la viabilidad de bacterias simbióticas fijadoras de nitrógeno utilizadas en la elaboración de inoculantes biológicos para arveja (Pisum sativum y soya (Glycine max

    Directory of Open Access Journals (Sweden)

    Lina M. Moreno Conn


    fixation conducted by microorganisms. Fixing symbiotic bacteria nitrogen has been widely used for the production of inoculants, becoming a viable alternative to improve crop yields through a better supply of this element. These inoculants to be marketed must meet certain requirements quality to ensure the smooth operation of the product. This study assessed the viability of the strains ICA L9 and ICA J96 inoculants stored at temperatures 4±2, 18±3 y 28±2°C for 180 days and the biological activity in pea and soybean plants. The strains used belong to the collection of work Germplasm Bank CORPOICA Microorganisms; for biological assays were used pea seeds variety “Santa Isabel” and soybean variety "Superior Corpoica 6". In assessing the viability of inoculants stored at 4±2°C, 18±3°C y 28±2°C, evidenced that the temperature did not affect the survival and the concentration of rhizobia after 180 days of storage allowing to observe a number of colony forming units per gram than 108, value that guarantees the quality of the inoculant. Concerning the biological activity, it was observed that the strains were inoculated infective and effective biological nitrogen fixation, absolute compared to controls.

  18. Interactions of Heterodera glycines, Macrophomina phaseolina, and Mycorrhizal Fungi on Soybean in Kansas. (United States)

    Winkler, H E; Hetrick, B A; Todd, T C


    The impact of naturally occurring arbuscular mycorrhizal fungi on soybean growth and their interaction with Heterodera glycines were evaluated in nematode-infested and uninfested fields in Kansas. Ten soybean cultivars from Maturity Groups III-V with differential susceptibility to H. glycines were treated with the fungicide benomyl to suppress colonization by naturally occurring mycorrhizal fungi and compared with untreated control plots. In H. glycines-infested soil, susceptible cultivars exhibited 39% lower yields, 28% lower colonization by mycorrhizal fungi, and an eightfold increase in colonization by the charcoal rot fungus, Macrophomina phaseolina, compared with resistant cultivars. In the absence of the nematode, susceptible cultivars exhibited 10% lower yields than resistant cultivars, root colonization of resistant vs. susceptible soybean by mycorrhizal fungi varied with sampling date, and there were no differences in colonization by M. phaseolina between resistant and susceptible cultivars. Benomyl application resulted in 19% greater root growth and 9% higher seed yields in H. glycines-infested soil, but did not affect soybean growth and yield in the absence of the nematode. Colonization of soybean roots by mycorrhizal fungi was negatively correlated with H. glycines population densities due to nematode antagonism to the mycorrhizal fungi rather than suppression of nematode populations. Soybean yields were a function of the pathogenic effects of H. glycines and M. phaseolina, and, to a lesser degree, the stimulatory effects of mycorrhizal fungi.

  19. Contributions of Fusarium virguliforme and Heterodera glycines to the Disease Complex of Sudden Death Syndrome of Soybean (United States)

    Westphal, Andreas; Li, Chunge; Xing, Lijuan; McKay, Alan; Malvick, Dean


    Background Sudden death syndrome (SDS) of soybean caused by Fusarium virguliforme spreads and reduces soybean yields through the North Central region of the U.S. The fungal pathogen and Heterodera glycines are difficult to manage. Methodology/Principal Findings The objective was to determine the contributions of H. glycines and F. virguliforme to SDS severity and effects on soybean yield. To quantify DNA of F. virguliforme in soybean roots and soil, a specific real time qPCR assay was developed. The assay was used on materials from soybean field microplots that contained in a four-factor factorial-design: (i) untreated or methyl bromide-fumigated; (ii) non-infested or infested with F. virguliforme; (iii) non-infested or infested with H. glycines; (iv) natural precipitation or additional weekly watering. In years 2 and 3 of the trial, soil and watering treatments were maintained. Roots of soybean ‘Williams 82’ were collected for necrosis ratings at the full seed growth stage R6. Foliar symptoms of SDS (area under the disease progress curve, AUDPC), root necrosis, and seed yield parameters were related to population densities of H. glycines and the relative DNA concentrations of F. virguliforme in the roots and soil. The specific and sensitive real time qPCR was used. Data from microplots were introduced into models of AUDPC, root necrosis, and seed yield parameters with the frequency of H. glycines and F. virguliforme, and among each other. The models confirmed the close interrelationship of H. glycines with the development of SDS, and allowed for predictions of disease risk based on populations of these two pathogens in soil. Conclusions/Significance The results modeled the synergistic interaction between H. glycines and F. virguliforme quantitatively in previously infested field plots and explained previous findings of their interaction. Under these conditions, F. virguliforme was mildly aggressive and depended on infection of H. glycines to cause highly

  20. Reduced abscisic acid content is responsible for enhanced sucrose accumulation by potassium nutrition in vegetable soybean seeds. (United States)

    Tu, Bingjie; Liu, Changkai; Tian, Bowen; Zhang, Qiuying; Liu, Xiaobing; Herbert, Stephen J


    In order to understand the physiological mechanism of potassium (K) application in enhancing sugar content of vegetable soybean seeds, pot experiments were conducted in 2014 and 2015 with two vegetable soybean (Glycine max L. Merr.) cultivars (c.v. Zhongkemaodou 1 and c.v. 121) under normal rate of nitrogen and phosphorus application. Three potassium (K) fertilization treatments were imposed: No K application (K0), 120 kg K 2 SO 4 ha -1 at seeding (K1), and 120 kg K 2 SO 4 ha -1 at seedling + 1% K 2 SO 4 foliar application at flowering (K2). Contents of indole-3-acetic acid (IAA), gibberellins (GA), cytokinins (ZR) and abscisic acid (ABA) in seeds were determined from 4 to 8 weeks after flowering. K fertilization increased the contents of IAA, GA, ZR, soluble sugar, sucrose and fresh pod yield, but reduced ABA content consistently. When the contents of soluble sugar and sucrose reached the highest level at 7 weeks after flowering for the 2 cultivars, the contents of IAA、GA、ZR all reached the lowest level in general. The content of ABA in seed was negatively correlated with the sucrose content (P abscisic acid content plays a critical role in enhancing sucrose content, which might be a partial mechanism involved in K nutrition to improve the quality of vegetable soybean.

  1. Comparative Biochemical and Proteomic Analyses of Soybean Seed Cultivars Differing in Protein and Oil Content. (United States)

    Min, Chul Woo; Gupta, Ravi; Kim, So Wun; Lee, So Eui; Kim, Yong Chul; Bae, Dong Won; Han, Won Young; Lee, Byong Won; Ko, Jong Min; Agrawal, Ganesh Kumar; Rakwal, Randeep; Kim, Sun Tae


    This study develops differential protein profiles of soybean (Glycine max) seeds (cv. Saedanbaek and Daewon) varying in protein (47.9 and 39.2%) and oil (16.3 and 19.7%) content using protamine sulfate (PS) precipitation method coupled with a 2D gel electrophoresis (2DGE) approach. Of 71 detected differential spots between Daewon and Saedanbaek, 48 were successfully identified by MALDI-TOF/TOF. Gene ontology analysis revealed that up-regulated proteins in Saedanbaek were largely associated with nutrient reservoir activity (42.6%), which included mainly seed-storage proteins (SSPs; subunits of glycinin and β-conglycinin). Similar results were also obtained in two cultivars of wild soybean (G. soja cv. WS22 and WS15) differing in protein content. Western blots confirmed higher accumulation of SSPs in protein-rich Saedanbaek. Findings presented and discussed in this study highlight a possible involvement of the urea cycle for increased accumulation of SSPs and hence the higher protein content in soybean seeds.

  2. Max Planck and modern physics

    International Nuclear Information System (INIS)

    Hoffmann, Dieter


    Max Planck (1858-1947) is according to the words of Max von Laue the ''father of quantum physics''. This characteristic has until today continuance, although Planck stood for long time sceptically in front of his quantum hypothesis and so became a revolutionary in spite of his wishes. Eclipted by this pioneer role of the scholar for the foundation of the quantum theory are the numerous further works of the scholer, by which he has in many other fields provided eminent things. Starting with his fundamental contribution to thermodynamics, which make him to an excellent researcher of the field, until the works in the early history of relativity theory and the promotion of the young Einstein, which let him become also to a pioneer of the second central pillar of modern physics. The present collection attempts to show the whole spectrum of the physical works of Max Planck and his role in the formation of modern physics. [de

  3. A decline in transcript abundance for Heterodera glycines homologs of Caenorhabditis elegans uncoordinated genes accompanies its sedentary parasitic phase

    Directory of Open Access Journals (Sweden)

    Overall Christopher C


    Full Text Available Abstract Background Heterodera glycines (soybean cyst nematode [SCN], the major pathogen of Glycine max (soybean, undergoes muscle degradation (sarcopenia as it becomes sedentary inside the root. Many genes encoding muscular and neuromuscular components belong to the uncoordinated (unc family of genes originally identified in Caenorhabditis elegans. Previously, we reported a substantial decrease in transcript abundance for Hg-unc-87, the H. glycines homolog of unc-87 (calponin during the adult sedentary phase of SCN. These observations implied that changes in the expression of specific muscle genes occurred during sarcopenia. Results We developed a bioinformatics database that compares expressed sequence tag (est and genomic data of C. elegans and H. glycines (CeHg database. We identify H. glycines homologs of C. elegans unc genes whose protein products are involved in muscle composition and regulation. RT-PCR reveals the transcript abundance of H. glycines unc homologs at mobile and sedentary stages of its lifecycle. A prominent reduction in transcript abundance occurs in samples from sedentary nematodes for homologs of actin, unc-60B (cofilin, unc-89, unc-15 (paromyosin, unc-27 (troponin I, unc-54 (myosin, and the potassium channel unc-110 (twk-18. Less reduction is observed for the focal adhesion complex gene Hg-unc-97. Conclusion The CeHg bioinformatics database is shown to be useful in identifying homologs of genes whose protein products perform roles in specific aspects of H. glycines muscle biology. Our bioinformatics comparison of C. elegans and H. glycines genomic data and our Hg-unc-87 expression experiments demonstrate that the transcript abundance of specific H. glycines homologs of muscle gene decreases as the nematode becomes sedentary inside the root during its parasitic feeding stages.

  4. Analysis list: Max [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Max Blood,Muscle,Pluripotent stem cell + mm9,,

  5. Max Weber and Robert Michels. (United States)

    Scaff, Lawrence A.


    This paper investigates the unique intellectual partnership of Max Weber and Robert Michels, with particular emphasis on Weber's influence on Michel's inquiry into the sociology of parties and organization. Concludes with an evaluation of the import of Weber's critique of Michels' work. (DB)

  6. De Max-Planck medaille

    NARCIS (Netherlands)

    Heijmans, H.G.; van Woerkom, P.Th.L.M.; Ankersmit, W.; Hagman, R.; Heijmans, H.G.; Olsder, G.J.; van de Schootbrugge, G.


    De Max-Planck-Medaille is een onderscheiding die sinds 1929 jaarlijks wordt uitgereikt door de toentertijd grootste vereniging van natuurkundigen ter wereld: de Deutsche Physikalische Gesellschaft. Het is als het ware de Nobelprijs voor de theoretische natuurkunde, volgens de natuurkundigen zelf. In

  7. Max Weber - bedaget og aktuel

    DEFF Research Database (Denmark)

    Eistrup, Jens


    undervisningsartiklen introducerer en række af Max Webers centrale begreber om herredømme, bureaukrati, social handlen, rationalitet og profession. dernæst illustreres hvorledes Webers begreber kan tjene til at belyse spændingsfeltet mellem politik og profession i en socialfaglig kontekst....

  8. O pensamento de Max Weber

    Directory of Open Access Journals (Sweden)

    Maurício Tragtenberg


    Full Text Available Max Weber inicia sua carreira universitária em 1893, como professor extraordinário de Direito Mercantil e Romano, na Universidade de Berlim. Em 1894 assume a Cadeira de Economia Política na Universidade de Hamburgo e em 1897 leciona na Universidade de Heidelberg.

  9. (Glycine max L. (Merril) à l'apport des biomasses vertes de Tithonia ...

    African Journals Online (AJOL)


    30 mars 2013 ... des biomasses de Tithonia diversifolia (10143 kg /hectare) comme fertilisant constituerait un atout majeur pour l'accroissement des rendements du soja dans un contexte de dégradation des sols et de prix élevé des engrais minéraux. Mots clés : biomasse de Tithonia diversifolia, fumure organique, soja, ...

  10. Phenotypic Characterization and Genetic Dissection of Growth Period Traits in Soybean (Glycine max Using Association Mapping.

    Directory of Open Access Journals (Sweden)

    Zhangxiong Liu

    Full Text Available The growth period traits are important traits that affect soybean yield. The insights into the genetic basis of growth period traits can provide theoretical basis for cultivated area division, rational distribution, and molecular breeding for soybean varieties. In this study, genome-wide association analysis (GWAS was exploited to detect the quantitative trait loci (QTL for number of days to flowering (ETF, number of days from flowering to maturity (FTM, and number of days to maturity (ETM using 4032 single nucleotide polymorphism (SNP markers with 146 cultivars mainly from Northeast China. Results showed that abundant phenotypic variation was presented in the population, and variation explained by genotype, environment, and genotype by environment interaction were all significant for each trait. The whole accessions could be clearly clustered into two subpopulations based on their genetic relatedness, and accessions in the same group were almost from the same province. GWAS based on the unified mixed model identified 19 significant SNPs distributed on 11 soybean chromosomes, 12 of which can be consistently detected in both planting densities, and 5 of which were pleotropic QTL. Of 19 SNPs, 7 SNPs located in or close to the previously reported QTL or genes controlling growth period traits. The QTL identified with high resolution in this study will enrich our genomic understanding of growth period traits and could then be explored as genetic markers to be used in genomic applications in soybean breeding.

  11. Sensitivity to Glufosinate-ammonium herbicide in plants of Glycine max cultivar INCASoy-27

    Directory of Open Access Journals (Sweden)

    Jorge Liusvert Pérez Pérez


    Full Text Available This work had as objective to define the minimum concentration of herbicide Glufosinate-ammonium that inhibits the growth of the soybean plants in greenhouse condition. The soybean plants were tried with different concentrations of herbicide (5; 10; 1 5; 20; 25; 30 mg L-1 and a control without herbicide. The increase of the concentrations increased the necrosis of the plants and the use of 20 mgL-1 Glufosinato de amonio herbicide was sufficient to inhibit the plant growth. These results allow using this method of selection in programs of genetic improvement and selection of transgenic soybean plants

  12. Electronic tongue system to evaluate flavor of soybean (Glycine Max (L. Merrill genotypes

    Directory of Open Access Journals (Sweden)

    Sandra Maria Zoldan


    Full Text Available An electronic tongue system was tested as a fast and efficient analytical tool for flavor evaluation of soybean genotypes. Grain samples of 25 soybean lines were analyzed using 0.25 g of milled samples added to 100 mL of distilled water and mixing for one minute on a magnetic stirrer. An aliquot (50 mL from the filtered liquid was used for the analysis on a pre-fixed frequency of 1 kHz and alternate tension of 50 mV. Two analyses were conducted in a complete randomized design with three replicates. Electrical response (capacitance of eight polymeric chemical sensors used to analyze the soybean lines were submitted to Principal Component Analysis (PCA. In the spatial distribution of the PCA graphic, the lines close to each other were similar, while the distant ones showed different characteristics. The electronic tongue system was efficient in discriminating flavor of soybean lines.

  13. Serapan Fosfor dan Pertumbuhan Kedelai(Glycine max pada Tanah Ultisol dengan Pemberian Asam Humat

    Directory of Open Access Journals (Sweden)

    Wahyuningsih Wahyuningsih


    Full Text Available Ultisol merupakan salah satu jenis tanah asam yang memiliki kelarutan Al, Fe, dan Mn tinggi, serta kandungan P dan Moyang rendah. KelarutanAl dan Fe yangtinggiakan menjerap fosfat, sehingga ketersediaan dan serapan P bagi tanaman menjadi rendah. Salah satu upaya untuk mengatasi ketidaktersediaan P pada tanah Ultisol yaitu dengan penambahan asam humat. Asam humat merupakan makromolekul polielektrolit yang memiliki gugus fungsional seperti -COOH, -OH fenolat, maupun -OH alkoholat,sehingga asam humat memiliki kemampuan untuk membentuk kompleks dengan ion logam. Penelitian ini dilakukan dengan tujuan untuk: (1 mengetahui pengaruh asam humat terhadap serapan P dan pertumbuhan tanaman kedelai (2 menentukan konsentrasi asam humat yang paling baikdalam meningkatkan serapan P dan pertumbuhan tanaman kedelai. Metode penelitian yang digunakan adalah eksperimental dengan Rancangan Acak Kelompok (RAK. Pengelompokan didasarkan atas perbedaan intensitas cahaya yang ada di rumah kaca. Perlakuan berupa konsentrasi asam humat, dengan 5 konsentrasi yang berbeda yaitu 0 ppm, 400 ppm, 800 ppm, 1200 ppm dan 1600 ppm. Parameter yang diukur meliputi tinggi tanaman, luas daun, bobot basah, dan bobot kering, P tersedia serta P tanaman. Data yang diperoleh dianalisis menggunakananalisis ragam pada tingkat kepercayaan 95% dan 99%. Apabila hasil perlakuan berpengaruh nyata, maka dilanjutkan dengan uji Beda Nyata Terkecil (BNT. Hasil penelitian menunjukkan bahwa asam humat berpengaruh terhadap serapan P dan pertumbuhan kedelai pada tanah Ultisol. Asam humat 1200 ppm merupakan perlakuan paling baik dalam meningkatkan ketersediaan P, sehingga mampu meningkatkanpertumbuhan kedelai pada tanah Ultisol.

  14. Transcriptome changes in the phenylpropanoid pathway of Glycine max in response to Pseudomonas syringae infection

    Directory of Open Access Journals (Sweden)

    Gonzalez Delkin O


    Full Text Available Abstract Background Reports of plant molecular responses to pathogenic infections have pinpointed increases in activity of several genes of the phenylpropanoid pathway leading to the synthesis of lignin and flavonoids. The majority of those findings were derived from single gene studies and more recently from several global gene expression analyses. We undertook a global transcriptional analysis focused on the response of genes of the multiple branches of the phenylpropanoid pathway to infection by the Pseudomonas syringae pv. glycinea with or without the avirulence gene avrB to characterize more broadly the contribution of the multiple branches of the pathway to the resistance response in soybean. Transcript abundance in leaves was determined from analysis of soybean cDNA microarray data and hybridizations to RNA blots with specific gene probes. Results The majority of the genes surveyed presented patterns of increased transcript accumulation. Some increased rapidly, 2 and 4 hours after inoculation, while others started to accumulate slowly by 8 – 12 hours. In contrast, transcripts of a few genes decreased in abundance 2 hours post inoculation. Most interestingly was the opposite temporal fluctuation in transcript abundance between early responsive genes in defense (CHS and IFS1 and F3H, the gene encoding a pivotal enzyme in the synthesis of anthocyanins, proanthocyanidins and flavonols. F3H transcripts decreased rapidly 2 hours post inoculation and increased during periods when CHS and IFS transcripts decreased. It was also determined that all but one (CHS4 family member genes (CHS1, CHS2, CHS3, CHS5, CHS6 and CHS7/8 accumulated higher transcript levels during the defense response provoked by the avirulent pathogen challenge. Conclusion Based on the mRNA profiles, these results show the strong bias that soybean has towards increasing the synthesis of isoflavonoid phytoalexins concomitant with the down regulation of genes required for the synthesis of anthocyanins and proanthocyanins. Although proanthocyanins are known to be toxic compounds, the cells in the soybean leaves seem to be programmed to prioritize the synthesis and accumulation of isoflavonoid and pterocarpan phytoalexins during the resistance response. It was known that CHS transcripts accumulate in great abundance rapidly after inoculation of the soybean plants but our results have demonstrated that all but one (CHS4 member of the gene family member genes accumulated higher transcript levels during the defense response.

  15. Energy pattern and conservations of condiment produced from soybean (Glycine max)


    Ismaila B. Anjorin; Rahman Akinoso; Mayowa S. Sanusi


    Energy being one of the largest operating expenses in most organizations especially manufacturing and processing industries leading to considerable scope for energy conservation and hence cost. Information on energy utilization and conservation pattern were obtained based on time taken, number of person involved and sources of energy using standard energy equations. A total of 445.40 ± 17.32MJkg-1 where thermal energy (420MJ ≈ 94%) and manual energy (25.40MJ ≈ 6%) were the only forms of energ...

  16. Environmental assessment of organic soybean (Glycine max.) imported from China to Denmark

    DEFF Research Database (Denmark)

    Knudsen, Marie Trydeman; Yu-Hui, Qiao; Van, Luo


    Growing global trade with organic products has increased the demand for environmental impact assessments during both production and transport. Environmental hotspots of organic soybeans produced in China and imported to Denmark were identified in a case study using a life cycle assessment approach....... Furthermore, environmental impacts of organic and conventional soybeans at farm gate were compared in the case study. The total global warming potential (GWP) per ton organic soybeans imported to Denmark revealed that 51% came from transportation and 35% from the farm level. Comparing organic and conventional...

  17. Effect of Hf on the fine structure of mesophyll cells from Glycine max, Merr

    Energy Technology Data Exchange (ETDEWEB)

    Wei, L.; Miller, G.W.


    A series of ultrastructural changes were observed in soybean leaves fumigated with 40 to 50 ppb of hydrogen fluoride. In the cytoplasm the presence of small vacuoles was the first noticeable initial change. The fragmentation of the vacuolar membrane occurred either simultaneously or followed immediately. Lipid-droplet-like globules and numerous vesicles occurred subsequently in the cytoplasm and increased as the injury became more severe. There was a decrease in polysomes and a detachment of ribosome from the rough endoplasmic reticulum. Free ribosome concentration also decreased as the injury became severe. Mitochondrial modifications involving dilation of outer and cristae membranes followed by reduction of both cristae number and matrix electron density and the disappearance of mitochondrial granules were observed in the chlorotic leaves. Electron dense inclusions accumulated in some mitochondria as well. The first noticeable change observed in the chloroplast was the presence of clusters of phytoferritin granules within the stoma after only 2 days of fumigation. Alterations in nuclear structures were observed in later stages of injury. Numerous small electron dense particles were found on various types of membranes in cells of severely chlorotic leaves. They were distributed on outer mitochondrial membranes, endoplasmic reticula, dictyosomes, tonoplasts, plasmalemma, nuclear envelopes, and disintegrating organelles and vesicles, but were never observed on membranes of chloroplasts and microbodies. The presence of fluoride has attracted the attention of many workers primarily in certain industrial areas where the emitted atmospheric fluoride concentrates and is accumulated by plants initiating injury. 6 references.

  18. Analisis Sistem Proses Pindah Massa pada Ekstraksi secara Mekanik Minyak Kedelai (Glycine Max Oil

    Directory of Open Access Journals (Sweden)

    Bambang Dwi Argo


    Full Text Available Soybean, a vegetable protein-rich commodity needed to improve public nutrition, safe to consume, and the price affordable. The purpose of this research are to: 1. determine the effect of pressure and time of extraction the mass balance, yield and level of soybean oil extraction, 2. Gain mass transfer coefficient value in soybean oil extraction process, and 3. analyze the mechanism of mass changes during the extraction process soybean oil is mechanically using hydraulic pressing. Oil obtained results indicate an increase due to the influence of a given amount of pressure and length of time silenced. The greater the pressure exerted, the more oil produced this shows soybean oil can come out with a maximum at the greatest pressure of 200 kg/cm2. Mass transfer coefficient in soybean oil extraction process at a pressure of 100 kg/cm2 5.57x10-5 gcm3/cm seconds. In the pressure is 200 kg/cm2 15.39 x 10-5g cm3/cm seconds.

  19. Identification of environmentally stable QTLs controlling Saponin content in Glycine max


    Teraishi, Masayoshi; Tojo, Yuka; Yamada, Naohiro; Okumoto, Yutaka


    Saponins are secondary metabolites that are widely distributed in plants. There are two major saponin precursors in soybean: soyasapogenol A, contributing to the undesirable taste, and soyasapogenol B, some of which have health benefits. It is important to control the ratio and content of the two major saponin groups to enhance the appeal of soybean as a health food. The structural diversity of saponin in the sugar chain composition makes it hard to quantify the saponin content. We measured t...

  20. Leaf movement, photosynthesis and resource use efficiency responses to multiple environmental stress in Glycine max (soybean)

    International Nuclear Information System (INIS)

    Rosa, L.M.G.


    Increases in the concentration of greenhouse gases in the atmosphere, may cause a significant increase in temperature, with implications for general wind patterns and precipitation. Reductions in stratospheric ozone will result in increased levels of UV-B reaching earth's surface. During their lifetime plants must deal with a variety of co-occurring environmental stresses. Accordingly, studies into plant responses to multiple environmental factors is important to our understanding of limits to their growth, productivity, and distribution. Heliotropic leaf movements are a generalized plant response to environmental stresses, and the pattern of these movements can be altered by resource availability (e.g., water, and nitrogen). Previous greenhouse and field studies have demonstrated damaging effects of UV-B radiation in crop species, including soybean. Documented in this paper are Leaf movement and gas exchange responses of four soybean cultivars with different sensitivity to UV-B radiation to enhanced levels of UV-B, and modifications of these responses caused by water stress and nitrogen fertilization. UV-B radiation had no effect on the patterns of leaf orientation in soybean; however, a ranking of the cultivars based on midday leaf angles was the same as the ranking of these cultivars based on their sensitivity to UV-B radiation. Water and nitrogen altered the leaf movement patterns of soybeans. Gas exchange parameters in all four cultivars responded in a similar fashion to changes in leaf water potential. Reductions in water availability resulted in lower discrimination. Nitrogen fertilization in cv Forrest, also resulted in lower discrimination, especially under low water regimes, indicating a higher water use efficiency for fertilized plants. UV-B radiation resulted in lower discrimination in the UV-B sensitive CNS cultivar, indicating a stronger stomatal limitation to photosynthesis under increased UV-B levels

  1. Specific binding of a fungal glucan phytoalexin elicitor to membrane fractions from soybean Glycine max

    International Nuclear Information System (INIS)

    Schmidt, W.E.; Ebel, J.


    Treatment of soybean tissues with elicitors results in the production of phytoalexins, one of a number of inducible plant defense reactions against microbial infections. The present study uses a β-1,3-[ 3 H] glucan elicitor fraction from Phytophthora megasperma f.sp. glycinea, a fungal pathogen of soybean, to identify putative elicitor targets in soybean tissues. Use of the radiolabeled elicitor disclosed saturable high-affinity elicitor binding site(s) in membrane fractions of soybean roots. Highest binding activity is associated with a plasma membrane-enriched fraction. The apparent K/sub d/ value for β-glucan elicitor binding is ≅ 0.2 x 10 -6 M and the maximum number of binding sites is 0.5 pmol per mg of protein. Competition studies the [ 3 H]glucan elicitor and a number of polysaccharides demonstrate that only polysaccharides of a branched β-glucan type effectively displace the radiolabeled ligand from membrane binding. Differential displacing activity of the glucans on P. megasperma elicitor binding corresponds closely to their respective ability to elicit phytoalexin production in a cotyledon bioassay

  2. Effect of the ingestion of soybeans derivatives (Glycine max) on rat thyroid

    International Nuclear Information System (INIS)

    Filisetti, T.M.C.C.


    Soybean derivatives were tested in rat through acute experiments of 3 to 24 hours and two semichronic experiments of 16 and 29 days. The acute essay were realized with Total Extract (TEs) obtained from Defated Soybean Flour by precipitation in an aqueous medium and posteriorly in acetone. The percentage of iodine ( 131 I) uptake by 100 gr. of rat was decreased by the Total Autoclaved Extract administered by gastric tube after 6 and 24 hours. The Total Extract, without previous autoclaving showed effect on the gland after 6 hours and lost its activity 24 hours after its administration. TEs obtained from Comercial Soybean Products as: Proteic Concentrate, Tosted Flour and Milk also provoked a decrease in percentage of iodine ( 131 I) uptake after 24 hours by 100 gr. of rat. The semichronic experiments were realized with Soybean fraction products, which were incorporated to experimental diet. The first of 16 days, showed a reduction in percentage of iodide ( 131 I) uptake by 10mg of thyroid and an increase of the triiodothyronine-binding capacity of rat serm. In the second of 29 days an increase was observed in the percentage of iodine ( 131 I) uptake by 10mg of thyroid, caused by the factor in study and no alteration of seric hormones. The thyroid hormones and their precursors were also assayed and an increase of monoiodotyrosine (MIT), triiodothyronine (T3) and thyroxine (T4) was noted, as well as a decrease of diiodotyrosine (DIT) and inorganic iodine. An increase in the MIT/DIT ratio and decrease in T 3 /T 4 ratio, were observed. In preliminary physicochemical tests, the fraction sephadex G-25 showed a positive reaction for ninhidrin, Molish and flavenoids [pt

  3. Expression of Root-Related Transcription Factors Associated with Flooding Tolerance of Soybean (Glycine max

    Directory of Open Access Journals (Sweden)

    Babu Valliyodan


    Full Text Available Much research has been conducted on the changes in gene expression of the model plant Arabidopsis to low-oxygen stress. Flooding results in a low oxygen environment in the root zone. However, there is ample evidence that tolerance to soil flooding is more than tolerance to low oxygen alone. In this study, we investigated the physiological response and differential expression of root-related transcription factors (TFs associated with the tolerance of soybean plants to soil flooding. Differential responses of PI408105A and S99-2281 plants to ten days of soil flooding were evaluated at physiological, morphological and anatomical levels. Gene expression underlying the tolerance response was investigated using qRT-PCR of root-related TFs, known anaerobic genes, and housekeeping genes. Biomass of flood-sensitive S99-2281 roots remained unchanged during the entire 10 days of flooding. Flood-tolerant PI408105A plants exhibited recovery of root growth after 3 days of flooding. Flooding induced the development of aerenchyma and adventitious roots more rapidly in the flood-tolerant than the flood-sensitive genotype. Roots of tolerant plants also contained more ATP than roots of sensitive plants at the 7th and 10th days of flooding. Quantitative transcript analysis identified 132 genes differentially expressed between the two genotypes at one or more time points of flooding. Expression of genes related to the ethylene biosynthesis pathway and formation of adventitious roots was induced earlier and to higher levels in roots of the flood-tolerant genotype. Three potential flood-tolerance TFs which were differentially expressed between the two genotypes during the entire 10-day flooding duration were identified. This study confirmed the expression of anaerobic genes in response to soil flooding. Additionally, the differential expression of TFs associated with soil flooding tolerance was not qualitative but quantitative and temporal. Functional analyses of these genes will be necessary to reveal their potential to enhance flooding tolerance of soybean cultivars.

  4. Effects of spent engine oil contamination on soybean (Glycine max L ...

    African Journals Online (AJOL)


    Research Farm to determine the effect of spent auto-engine oil on soil and soybean ... importance and diverse domestic usage, nevertheless, ... 3 % equivalent to 0, 10, 000, 20,000 and 30,000 mg ... moisture content to obtain the yield. ... (Table 1) revealed that the texture of the ..... cowpea in two contrasting soil types from.

  5. Evaluation of genetic diversity among soybean (Glycine max) genotypes using univariate and multivariate analysis. (United States)

    Oliveira, M M; Sousa, L B; Reis, M C; Silva Junior, E G; Cardoso, D B O; Hamawaki, O T; Nogueira, A P O


    The genetic diversity study has paramount importance in breeding programs; hence, it allows selection and choice of the parental genetic divergence, which have the agronomic traits desired by the breeder. This study aimed to characterize the genetic divergence between 24 soybean genotypes through their agronomic traits, using multivariate clustering methods to select the potential genitors for the promising hybrid combinations. Six agronomic traits evaluated were number of days to flowering and maturity, plant height at flowering and maturity, insertion height of the first pod, and yield. The genetic divergence evaluated by multivariate analysis that esteemed first the Mahalanobis' generalized distance (D 2 ), then the clustering using Tocher's optimization methods, and then the unweighted pair group method with arithmetic average (UPGMA). Tocher's optimization method and the UPGMA agreed with the groups' constitution between each other, the formation of eight distinct groups according Tocher's method and seven distinct groups using UPGMA. The trait number of days for flowering (45.66%) was the most efficient to explain dissimilarity between genotypes, and must be one of the main traits considered by the breeder in the moment of genitors choice in soybean-breeding programs. The genetic variability allowed the identification of dissimilar genotypes and with superior performances. The hybridizations UFU 18 x UFUS CARAJÁS, UFU 15 x UFU 13, and UFU 13 x UFUS CARAJÁS are promising to obtain superior segregating populations, which enable the development of more productive genotypes.

  6. Transcriptomic characterization of soybean (Glycine max) roots in response to rhizobium infection by RNA sequencing

    International Nuclear Information System (INIS)

    He, Q.; Li, Z.; Wang, S.; Huang, S.; Yang, H.


    Legumes interacting with rhizobium to convert N2 into ammonia for plant use has attracted worldwide interest. However, the plant basal nitrogen fixation mechanisms induced in response to Rhizobium, giving differential gene expression of plants, have not yet been fully realized. The differential expressed genes of soybean between inoculated and mock-inoculated were analyzed by a RNA-Seq. The results of the sequencing were aligned against the Williams 82 genome sequence, which contain 55787 transcripts; 280 and 316 transcripts were found to be up- and down-regulated, respectively, for inoculated and mock-inoculated soybean roots at stage V1. Gene ontology (GO) analyses detected 104, 182 and 178 genes associated with the cell component category, molecular function category and biological process category, respectively. Pathway analysis revealed that 98 differentially expressed genes (115 transcripts) were involved in 169 biological pathways. We selected 19 differentially expressed genes and analyzed their expressions in mock-inoculated, inoculated USDA110 and CCBAU45436 using qRT-PCR. The results were in accordance with those obtained from rhizobia infected RNA-Seq data. These showed that the results of RNA-Seq had reliability and universality. Additionally, this study showed some novel genes associated with the nitrogen fixation process in comparison to previously identified QTLs. (author)

  7. Chemical composition and lipoxygenase activity in soybeans (Glycine max L. Merr.) submitted to gamma irradiation (United States)

    Barros, Érica Amanda de; Broetto, Fernando; Bressan, Dayanne F.; Sartori, Maria M. P.; Costa, Vladimir E.


    Soybeans are an important food due to their functional and nutritional characteristics. However, consumption by western populations is limited by the astringent taste of soybeans and their derivatives which results from the action of lipoxygenase, an enzyme activated during product processing. The aim of this study was to evaluate the effect of gamma irradiation on the chemical composition and specific activity of lipoxygenase in different soybean cultivars. Soybeans were stored in plastic bags and irradiated with doses of 2.5, 5 and 10 kGy. The chemical composition (moisture, protein, lipids, ashes, crude fiber, and carbohydrates) and lipoxygenase specific activity were determined for each sample. Gamma irradiation induced a small increase of protein and lipid content in some soybean cultivars, which did not exceed the highest content of 5% and 26%, respectively, when compared to control. Lipoxygenase specific activity decreased in the three cultivars with increasing gamma irradiation dose. In conclusion, the gamma irradiation doses used are suitable to inactivate part of lipoxygenase while not causing expressive changes in the chemical composition of the cultivars studied.

  8. Production of peptone from soya beans (Glycine max L merr) and ...

    African Journals Online (AJOL)



    Sep 18, 2006 ... Peptone was produced from soya beans and African locust beans. The produced peptones were evaluated as component of microbiological media for the growth of some bacteria and compared with some commercial peptones. Some of the tested bacteria are Escherichia coli, Pseudomonas aeruginosa ...

  9. Fungi and bacteria inventory on soybean (Glycine max (L.) merill) planting media applied by local microorganisms (United States)

    Akhsan, Ni'matuljannah; Vionita


    An experiment aimed to determine the effect of application of several types of local microorganisms (MOL) and the number of doses to the development of fungi and bacteria on soybean planting media, have been conducted in Samarinda for 3 (three) months. Factorial experiment arranged in a completely randomized design and repeated three times, was used in this experiment. The first factor was the type of MOL consisted of cow dung (m1), snails (m2), banana peel (m3) and bamboo roots (m4), and the second factor was the dose MOL zero mL (d0), 100 mL (d1), 200 mL (d2), 300 mL (d3), 400 mL (d4) analyzed with Anova and Least Significance Difference (LSD) at 5%. Fungi and bacteria contained in the local microorganisms (cow dung, snails, banana peel and bamboo root) are: fungus Aspergillus sp, Penicillium sp., Trichoderma sp., cellulotic and lignolitic bacteria. An increase in the type and amount of fungus is happened for some genus. The dominant bacteria in the planting medium is a gram-negative bacteria. Cow dung seemed the best source at the dosages level of 400 ml.

  10. Early Identification of Herbicide Stress in Soybean (Glycine max (L.) Merr.) Using Chlorophyll Fluorescence Imaging Technology. (United States)

    Li, Hui; Wang, Pei; Weber, Jonas Felix; Gerhards, Roland


    Herbicides may damage soybean in conventional production systems. Chlorophyll fluorescence imaging technology has been applied to identify herbicide stress in weed species a few days after application. In this study, greenhouse experiments followed by field experiments at five sites were conducted to investigate if the chlorophyll fluorescence imaging is capable of identifying herbicide stress in soybean shortly after application. Measurements were carried out from emergence until the three-to-four-leaf stage of the soybean plants. Results showed that maximal photosystem II (PS II) quantum yield and shoot dry biomass was significantly reduced in soybean by herbicides compared to the untreated control plants. The stress of PS II inhibiting herbicides occurred on the cotyledons of soybean and plants recovered after one week. The stress induced by DOXP synthase-, microtubule assembly-, or cell division-inhibitors was measured from the two-leaf stage until four-leaf stage of soybean. We could demonstrate that the chlorophyll fluorescence imaging technology is capable for detecting herbicide stress in soybean. The system can be applied under both greenhouse and field conditions. This helps farmers to select weed control strategies with less phytotoxicity in soybean and avoid yield losses due to herbicide stress.

  11. Expression of root-related transcription factors associated with flooding tolerance of soybean (Glycine max). (United States)

    Valliyodan, Babu; Van Toai, Tara T; Alves, Jose Donizeti; de Fátima P Goulart, Patricia; Lee, Jeong Dong; Fritschi, Felix B; Rahman, Mohammed Atiqur; Islam, Rafiq; Shannon, J Grover; Nguyen, Henry T


    Much research has been conducted on the changes in gene expression of the model plant Arabidopsis to low-oxygen stress. Flooding results in a low oxygen environment in the root zone. However, there is ample evidence that tolerance to soil flooding is more than tolerance to low oxygen alone. In this study, we investigated the physiological response and differential expression of root-related transcription factors (TFs) associated with the tolerance of soybean plants to soil flooding. Differential responses of PI408105A and S99-2281 plants to ten days of soil flooding were evaluated at physiological, morphological and anatomical levels. Gene expression underlying the tolerance response was investigated using qRT-PCR of root-related TFs, known anaerobic genes, and housekeeping genes. Biomass of flood-sensitive S99-2281 roots remained unchanged during the entire 10 days of flooding. Flood-tolerant PI408105A plants exhibited recovery of root growth after 3 days of flooding. Flooding induced the development of aerenchyma and adventitious roots more rapidly in the flood-tolerant than the flood-sensitive genotype. Roots of tolerant plants also contained more ATP than roots of sensitive plants at the 7th and 10th days of flooding. Quantitative transcript analysis identified 132 genes differentially expressed between the two genotypes at one or more time points of flooding. Expression of genes related to the ethylene biosynthesis pathway and formation of adventitious roots was induced earlier and to higher levels in roots of the flood-tolerant genotype. Three potential flood-tolerance TFs which were differentially expressed between the two genotypes during the entire 10-day flooding duration were identified. This study confirmed the expression of anaerobic genes in response to soil flooding. Additionally, the differential expression of TFs associated with soil flooding tolerance was not qualitative but quantitative and temporal. Functional analyses of these genes will be necessary to reveal their potential to enhance flooding tolerance of soybean cultivars.

  12. Producción de soya (Glycine max L. bajo tres sistemas de labranza

    Directory of Open Access Journals (Sweden)

    Rojas Palacio Hernán


    Full Text Available

    The goals of this consisted in economically analyzing the conventional pattern with regard to minimum tillage and non tillage; evaluating the influence of the tillage systems on the physical properties of the soil and on the soybean's growth and yield. The experiment was stablished on clay soil. The experimental design employed was that of hierarchy-arranged random blocks with three repetitions (9 experimental units. The conventional tillage permitts the improvement of the physical conditions of the soil, performs a better control on the weeds, gives the soybean plant a full growth and yield causing the highest profitability. The second treatment showing the best efficiency was the minimum tillage.

    Se evaluó la influencia de los sistemas de labranza convencional, mínima y no labranza sobre las propiedades físicas del suelo, en el desarrollo y producción de la soya. El experimento se estableció en suelo arcilloso. El diseño experimental fue el de bloques al azar jerarquizados con tres repeticiones (9 unidades experimentales. La labranza convencional mejora las condiciones físicas del suelo, ejerce mayor control sobre las malezas, confiere a la planta de soya apropiado desarrollo y producción ocasionando así la mayor rentabilidad. El segundo tratamiento en eficiencia fue el de la labranza mínima.

  13. Wind tunnel and field assessment of pollen dispersal in soybean [Glycine max (L.) Merr.]. (United States)

    Yoshimura, Yasuyuki


    Although genetically modified (GM) soybean has never been cultivated commercially in Japan, it is essential to set up the isolation distance required to prevent out-crossing between GM and conventional soybean in preparation for any future possibility of pollen transfer. The airborne soybean pollen was sampled using some Durham pollen samplers located in the range of 20 m from the field edge. In addition, the dispersal distance was assessed in a wind tunnel under constant air flow and then it was compared with the anticipated distances based on the pollen diameter. In the field, the maximum pollen density per day observed was 1.235 grains cm(-2) day(-1) at three observation points within 2.5 m from the field and inside the field the mean density did not reach the rate of 1 grain cm(-2 )day(-1) during 19 flowering days. The results of the wind tunnel experiment also showed that the plants had almost no airborne release of pollen and the dispersal distance was shorter than theoretical value due to clustered dispersal. This study showed little airborne pollen in and around the soybean field and the dispersal is restricted to a small area. Therefore, wind-mediated pollination appears to be negligible.

  14. Protein and metabolite composition of xylem sap from field-grown soybeans (Glycine max). (United States)

    Krishnan, Hari B; Natarajan, Savithiry S; Bennett, John O; Sicher, Richard C


    The xylem, in addition to transporting water, nutrients and metabolites, is also involved in long-distance signaling in response to pathogens, symbionts and environmental stresses. Xylem sap has been shown to contain a number of proteins including metabolic enzymes, stress-related proteins, signal transduction proteins and putative transcription factors. Previous studies on xylem sap have mostly utilized plants grown in controlled environmental chambers. However, plants in the field are subjected to high light and to environmental stress that is not normally found in growth chambers. In this study, we have examined the protein and metabolite composition of xylem sap from field-grown cultivated soybean plants. One-dimensional gel electrophoresis of xylem sap from determinate, indeterminate, nodulating and non-nodulating soybean cultivars revealed similar protein profiles consisting of about 8-10 prominent polypeptides. Two-dimensional gel electrophoresis of soybean xylem sap resulted in the visualization of about 60 distinct protein spots. A total of 38 protein spots were identified using MALDI-TOF MS and LC-MS/MS. The most abundant proteins present in the xylem sap were identified as 31 and 28 kDa vegetative storage proteins. In addition, several proteins that are conserved among different plant species were also identified. Diurnal changes in the metabolite profile of xylem sap collected during a 24-h cycle revealed that asparagine and aspartate were the two predominant amino acids irrespective of the time collected. Pinitol (D-3-O-methyl-chiro-inositol) was the most abundant carbohydrate present. The possible roles of xylem sap proteins and metabolites as nutrient reserves for sink tissue and as an indicator of biotic stress are also discussed.

  15. Some biochemistry characteristics of soja (Glycine Max.L.) Tshibashi and its two mutants

    International Nuclear Information System (INIS)

    Botula, Manyala; Kasende, Mundeke; Kembola, Kejuni.


    Two mutants of a variety of soybeans (Thibashi) obtained by neutron irradiation in a reactor have been compared to their parents for their proteins and lipids contents. Analysis have been made by a modified micro-kjedhal method for proteins and by gaz chromatography for lipids converted into methylic esters. A slight lysine and hyptidine increase and a slight linolenic acid decrease are observed in the two mutants

  16. Effect of salt on the fermentation of soybean (Glycine max) into ...

    African Journals Online (AJOL)

    Previous studies showed that 1% salt improved the organoleptic attributes of traditional fermented daddawa. Also, Bacillus subtilis as a monoculture starter produced daddawa of same quality with traditional daddawa. The aim of this study was to investigate the effect of 1% salt on some biochemical changes occurring in the ...

  17. The Effect of Soya bean ( Glycine max ) on Pefloxacin Absorption in ...

    African Journals Online (AJOL)

    The study was to investigate the effect of soya bean on the absorption of pefloxacin when given by oral route in rats. The first group of animals feeding on standard pellet feeds was given pefloxacin (8 mg/kg, p.o), while the second and third groups were also given the drug at the same dosage level but were fed with 50 ...

  18. Utilization of nitrogen by soybean (Glycine max) influenced by the addition of sugar cane bagasse

    International Nuclear Information System (INIS)

    Bonetti, R.; Saito, S.M.T.


    N 2 -fixation in soybean and soil-N and 15 N-urea utilization where studied in a glasshouse. Doses of fertilizer were 0, 40 and 80 kgN/ha added either to cultivated - or virgin soil, where sugar cane bagasse was also added (20 ton/ha). Non-nodulating soybean was used as a control to determine the absorption of the three N-sources: soil, fertilizer and N 2 -fixation. The N-immobilization effect caused by bagasse addition was observed even after a pre-incubation period of 40 days, being greater in the cultivated than in the soil without organic matter. Accumulations of N, P and S where also smaller in these plants. Additions of N were not sufficient to equal the values observed in soils without organic matter. Addition of 40 kgN/ha showed a sinergistic and positive effect on treatments that had N-immobilization, reinforcing the idea that starter doses of N are necessary for maximization of nodulation and N 2 -fixation in soybean, in soils with low N. N 2 -fixation contributed with mean values of 54% and 84% N, respectively, in the aerial part and pools in non-treated soil. When bagasse was added, the percentages of N 2 -fixed increased, however in smaller amounts, showing a necessity of different sources of N to increase the total N in plant. The greatest N 2 -fixation (48,6 kgN/ha) was found in the cultivated soil, where only bagasse had been added. (M.A.) [pt

  19. Isolation of low-molecular albumins of 2S fraction from soybean (Glycine max (L.) Merrill). (United States)

    Galbas, Mariola; Porzucek, Filip; Woźniak, Anna; Słomski, Ryszard; Selwet, Marek


    Numerous studies have shown that consumption of soybean products decrease the risk of cancers in humans. Experiments at the molecular level have demonstrated that in most cases proteins and peptides are responsible for the anticancer properties of soybeen. Special attention should be paid to lunasin - a peptide described for the first time 16 years ago. Due to its structure it causes i.a., inhibition of cancer cell proliferation. A novel procedure for the isolation and purification of low-molecular-mass 2S soybean albumin protein is described in the present paper. A fraction of four peptides one of them corresponding to molecular mass and isoelectric point characteristic for lunasin. The obtained peptides decreased on the rate of HeLa cell proliferation.

  20. Polygenic Inheritance of Canopy Wilting in Soybean [Glycine max (L.) Merr. (United States)

    As water demand for agriculture exceeds water availability, cropping systems need to become more efficient in water usage, such as deployment of cultivars that sustain yield under drought conditions. Soybean cultivars differ in how quickly they wilt during water-deficit stress, and this trait may l...


    Directory of Open Access Journals (Sweden)

    Elaine Cristina de Souza LIMA


    Full Text Available Na atualidade, as indústrias alimentícias vêm buscando novas formulações de produtos, devido ao aumento da demanda do consumidor por alimentos funcionais. A acerola e a soja são consideradas alimentos funcionais, no entanto, a soja apresenta teores limitantes de cálcio. O objetivo deste estudo foi avaliar o efeito da adição de diferentes sais de cálcio sobre as propriedades sensoriais de bebida formulada com adição de soja e acerola. Amostras dessa bebida natural (sem adição de cálcio e enriquecidas com quatro diferentes sais de cálcio - lactato de cálcio, carbonato de cálcio, gluconato de cálcio e fosfato tricálcio foram analisadas sensorialmente por 50 provadores, segundo escala hedônica estruturada de 7 pontos. A bebida enriquecida com melhor qualidade sensorial foi caracterizada físicoquímica e microbiologicamente. Dentre as bebidas de soja e acerola enriquecidas com sais de cálcio a que se destacou em termos de sabor global foi aquela enriquecida com lactato de cálcio. O teor de cálcio encontrado em 200 mL dessa bebida na forma pasteurizada foi capaz de suprir em torno de 38% da ingestão diária recomendável para adultos constituindo, assim, uma bebida funcional à base de soja, com alto valor nutritivo e boa qualidade sensorial.

  2. Soybean (Glycine max L. Response to Fungicides in the Absence of Disease Pressure

    Directory of Open Access Journals (Sweden)

    W. James Grichar


    Full Text Available Field studies were conducted during the 2010 and 2011 growing seasons along the Texas Upper Gulf Coast region to study the effects of fungicides on soybean disease development and to evaluate the response of four soybean cultivars to prothioconazole plus trifloxystrobin and pyraclostrobin. In neither year did any soybean diseases develop enough to be an issue. Only NKS 51-T8 responded to a fungicide treatment in 2010 while HBK 5025 responded in 2011. Prothioconazole plus trifloxystrobin increased NKS 51-T8 yield by 23% in 2010 while in 2011 the yield of HBK 5025 was increased 14% over the unsprayed check. No yield response was noted with pyraclostrobin on any soybean cultivar. Only prothioconazole + trifloxystrobin applied to either NKS 51-T8 or DP5335 in 2010 resulted in a net increase in dollars per hectare over the unsprayed check of the respective cultivar. In 2011, under extremely dry conditions, all fungicides with the exception of prothioconazole + trifloxystrobin applied to HBK 5025 resulted in a net decrease in returns over the unsprayed check.

  3. Comprehensive analysis of the soybean (Glycine max GmLAX auxin transporter gene family

    Directory of Open Access Journals (Sweden)

    Chenglin eChai


    Full Text Available The phytohormone auxin plays a critical role in regulation of plant growth and development as well as plant responses to abiotic stresses. This is mainly achieved through its uneven distribution in plants via a polar auxin transport process. Auxin transporters are major players in polar auxin transport. The AUXIN RESISTANT 1 ⁄ LIKE AUX1 (AUX⁄LAX auxin influx carriers belong to the amino acid permease family of proton-driven transporters and function in the uptake of indole-3-acetic acid (IAA. In this study, genome-wide comprehensive analysis of the soybean AUX⁄LAX (GmLAX gene family, including phylogenic relationships, chromosome localization, and gene structure, were carried out. A total of 15 GmLAX genes, including seven duplicated gene pairs, were identified in the soybean genome. They were distributed on 10 chromosomes. Despite their higher percentage identities at the protein level, GmLAXs exhibited versatile tissue-specific expression patterns, indicating coordinated functioning during plant growth and development. Most GmLAXs were responsive to drought and dehydration stresses and auxin and abscisic acid (ABA stimuli, in a tissue- and/or time point- sensitive mode. Several GmLAX members were involved in responding to salt stress. Sequence analysis revealed that promoters of GmLAXs contained different combinations of stress-related cis-regulatory elements. These studies suggest that the soybean GmLAXs were under control of a very complex regulatory network, responding to various internal and external signals. This study helps to identity candidate GmLAXs for further analysis of their roles in soybean development and adaption to adverse environments.

  4. Use of remote sensing, geographic information systems, and spatial statistics to assess spatio-temporal population dynamics of Heterodera glycines and soybean yield quantity and quality (United States)

    Moreira, Antonio Jose De Araujo

    Soybean, Glycine max (L.) Merr., is an important source of oil and protein worldwide, and soybean cyst nematode (SCN), Heterodera glycines, is among the most important yield-limiting factors in soybean production worldwide. Early detection of SCN is difficult because soybean plants infected by SCN often do not exhibit visible symptoms. It was hypothesized, however, that reflectance data obtained by remote sensing from soybean canopies may be used to detect plant stress caused by SCN infection. Moreover, reflectance measurements may be related to soybean growth and yield. Two field experiments were conducted from 2000 to 2002 to study the relationships among reflectance data, quantity and quality of soybean yield, and SCN population densities. The best relationships between reflectance and the quantity of soybean grain yield occurred when reflectance data were obtained late August to early September. Similarly, reflectance was best related to seed oil and seed protein content and seed size when measured during late August/early September. Grain quality-reflectance relationships varied spatially and temporally. Reflectance measured early or late in the season had the best relationships with SCN population densities measured at planting. Soil properties likely affected reflectance measurements obtained at the beginning of the season and somehow may have been related to SCN population densities at planting. Reflectance data obtained at the end of the growing season likely was affected by early senescence of SCN-infected soybeans. Spatio-temporal aspects of SCN population densities in both experiments were assessed using spatial statistics and regression analyses. In the 2000 and 2001 growing seasons, spring-to-fall changes in SCN population densities were best related to SCN population densities at planting for both experiments. However, within-season changes in SCN population densities were best related to SCN population densities at harvest for both experiments in

  5. Conformational Structure of Tyrosine, Tyrosyl-Glycine, and Tyrosyl-Glycyl-Glycine by Double Resonance Spectroscopy (United States)

    Abo-Riziq, Ali; Grace, Louis; Crews, Bridgit; Callahan, Michael P,; van Mourik, Tanja; de Vries, Mattanjah S,


    We investigated the variation in conformation for the amino acid tyrosine (Y), alone and in the small peptides tyrosine-glycine (YC) and tyrosine-glycine-glycine (YGG), in the gas phase by using UV-UV and IR-UV double resonance spectroscopy and density functional theory calculations. For tyrosine we found seven different conformations, for YG we found four different conformations, and for YGG we found three different conformations. As the peptides get larger, we observe fewer stable conformers, despite the increasing complexity and number of degrees of freedom. We find structural trends similar to those in phenylalanine-glycine glycine (FGG) and tryptophan-glycine-glycine (WGG)j however) the effect of dispersive forces in FGG for stabilizing a folded structure is replaced by that of hydrogen bonding in YGG.

  6. Quantitative trait loci controlling sulfur containing amino acids, methionine and cysteine, in soybean seeds. (United States)

    Panthee, D R; Pantalone, V R; Sams, C E; Saxton, A M; West, D R; Orf, J H; Killam, A S


    Soybean [Glycine max (L.) Merr.] is the single largest source of protein in animal feed. However, a major limitation of soy proteins is their deficiency in sulfur-containing amino acids, methionine (Met) and cysteine (Cys). The objective of this study was to identify quantitative trait loci (QTL) associated with Met and Cys concentration in soybean seed. To achieve this objective, 101 F(6)-derived recombinant inbred lines (RIL) from a population developed from a cross of N87-984-16 x TN93-99 were used. Ground soybean seed samples were analyzed for Met and Cys concentration using a near infrared spectroscopy instrument. Data were analyzed using SAS software and QTL Cartographer. RIL differed (Pseed dry weight) for Cys and 4.4-8.8 (g kg(-1) seed dry weight) for Met. Heritability estimates on an entry mean basis were 0.14 and 0.57 for Cys and Met, respectively. A total of 94 polymorphic simple sequence repeat molecular genetic markers were screened in the RIL. Single factor ANOVA was used to identify candidate QTL, which were confirmed by composite interval mapping using QTL Cartographer. Four QTL linked to molecular markers Satt235, Satt252, Satt427 and Satt436 distributed on three molecular linkage groups (MLG) D1a, F and G were associated with Cys and three QTL linked to molecular markers Satt252, Satt564 and Satt590 distributed on MLG F, G and M were associated with Met concentration in soybean seed. QTL associated with Met and Cys in soybean seed will provide important information to breeders targeting improvements in the nutritional quality of soybean.

  7. A new species of Lysiphlebus Förster 1862 (Hymenoptera: Braconidae, Aphidiinae) attacking soybean aphid, Aphis glycines Matsumura (Hemiptera: Aphididae) from China

    Czech Academy of Sciences Publication Activity Database

    Starý, Petr; Rakhshani, E.; Tomanović, Ž.; Hoelmer, K.; Kavallieratos, N. G.; Yu, J.; Wang, M.; Heimpel, G. E.


    Roč. 19, č. 1 (2010), s. 179-186 ISSN 1070-9428 Grant - others:Ministry of Science and Technological Developments of the Republic of Serbia(SR) 143006B Institutional research plan: CEZ:AV0Z50070508 Keywords : Lysiphlebus orientalis sp. n. * aphid parasitoids * Glycine max Subject RIV: EG - Zoology Impact factor: 0.500, year: 2010

  8. Transgenic soybean overexpressing GmSamT1 exhibits resistance to multiple-HG types of soybean cyst nematode Heterodera glycines (United States)

    Soybean (Glycine max (L.) Merr.) salicylic acid methyl transferase (GmSAMT1) catalyzes the conversion of salicylic acid to methyl salicylate. Prior results showed that when GmSAMT1 was overexpressed in transgenic soybean hairy roots, resistance is conferred against soybean cyst nematode (SCN), Heter...

  9. Constitutive expression of feedback-insensitive cystathionine γ-synthase increases methionine levels in soybean leaves and seeds

    Institute of Scientific and Technical Information of China (English)

    YU Yang; HOU Wen-sheng; YaeI Hacham; SUN Shi; WU Cun-xiang; Ifat Matityahu; SONG Shikui; RacheI Amir; HAN Tian-fu


    Soybean (Glycine max (L.) Merr.) is a major crop that provides plant-origin protein and oil for humans and livestock. Although the soybean vegetative tissues and seeds provide a major source of high-quality protein, they suffer from low concentration of an essential sulfur-containing amino acid, methionine, which significantly limits their nutritional quality. The level of methionine is mainly controlled by the first unique enzyme of methionine synthesis, cystathione γ-synthase (CGS). Aiming to elevate methionine level in vegetative tissues and seeds, we constitutively over-expressed a feedback-insensitive Arabidopsis CGS (AtD-CGS) in soybean cultivars, Zigongdongdou (ZD) and Jilinxiaoli 1 (JX). The levels of soluble methionine increased remarkably in leaves of transgenic soybeans compared to wild-type plants (6.6- and 7.3-fold in two transgenic ZD lines, and 3.7-fold in one transgenic JX line). Furthermore, the total methionine contents were significantly increased in seeds of the transgenic ZD lines (1.5- to 4.8-fold increase) and the transgenic JX lines (1.3- to 2.3-fold increase) than in the wild type. The protein contents of the transgenic soybean seeds were significantly elevated compared to the wild type, suggesting that the scarcity of methionine in soybeans may limit protein accumulation in soybean seeds. The increased protein content did not alter the profile of major storage proteins in the seeds. Generally, this study provides a promising strategy to increase the levels of methionine and protein in soybean through the breeding programs.

  10. Fermentation of aqueous plant seed extracts by lactic acid bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Schafner, D.W.; Beuchat, R.L.


    The effects of lactic acid bacterial fermentation on chemical and physical changes in aqueous extracts of cowpea (Vigna unguiculata), peanut (Arachis hypogea), soybean (Glycine max), and sorghum (Sorghum vulgare) were studied. The bacteria investigated were Lactobacillus helveticus, L. delbrueckii, L. casei, L. bulgaricus, L. acidophilus, and Streptococcus thermophilus. Organisms were inoculated individually into all of the seed extracts; L. bulgaricus and S. thermophilus were also evaluated together as inocula for fermenting the legume extracts. During fermentation, bacterial population and changes in titratable acidity, pH, viscosity, and color were measured over a 72 h period at 37 degrees C. Maximum bacterial populations, titratable acidity, pH, and viscosity varied depending upon the type of extract and bacterial strain. The maximum population of each organism was influenced by fermentable carbohydrates, which, in turn, influenced acid production and change in pH. Change in viscosity was correlated with the amount of protein and titratable acidity of products. Color was affected by pasteurization treatment and fermentation as well as the source of extract. In the extracts inoculated simultaneously with L. bulgaricus and S. thermophilus, a synergistic effect resulted in increased bacterial populations, titratable acidity, and viscosity, and decreased pH in all the legume extracts when compared to the extracts fermented with either of these organisms individually. Fermented extracts offer potential as substitutes for cultured dairy products. 24 references.

  11. Synthesis and distribution of N-benzyloxycarbonyl-[14C]-glycine, a lipophilic derivative of glycine

    International Nuclear Information System (INIS)

    Lambert, D.M.; Gallez, Bernard; Poupaert, J.H.


    N-benzyloxycarbonyl[ 14 C]-glycine, a lipophilic derivative of glycine exhibiting anticonvulsant properties, was prepared in one step from [U- 14 C] glycine and benzyl chloroformate in alkali medium. a comparative study of biodistribution was carried on mice between this compound and the parent amino-acid after intravenous administration. Dimethylsulfoxide was used as injection vehicle for N-benzyloxycarbonylglycine. The influence of this injection vehicle was studied comparing glycine injected in a saline solution and glycine co-administered with dimethylsulfoxide. No significant difference was found between these two treatments. Compared to glycine, N-benzyloxycarbonylglycine reached quickly the central nervous system and exhibited an enhanced brain penetration index, 13-fold superior to the parent aminoacid value. (Author)

  12. A min-max variational principle

    International Nuclear Information System (INIS)

    Georgiev, P.G.


    In this paper a variational principle for min-max problems is proved that is of the same spirit as Deville-Godefroy-Zizler's variational principle for minimization problems. A localization theorem in which the mini-max points for the perturbed function with respect top a given ε-min-max point are localized is presented. 3 refs

  13. Atração e penetração de Meloidogyne javanica e Heterodera glycines em raízes excisadas de soja Attraction and penetration of Meloidogyne javanica and Heterodera glycines in excised soybean roots

    Directory of Open Access Journals (Sweden)

    Hercules Diniz Campos


    Full Text Available Com vista ao estudo de atração e penetração de Meloidogyne javanica (Treub Chitwood e Heterodera glycines (Ichinoe em soja (Glycine max L., desenvolveu-se uma técnica empregando-se segmento de raiz com 2cm de comprimento. Nos segmentos de raiz de soja infectados, observou-se que a penetração de juvenis de segundo estádio (J2 de M. javanica ocorre pela coifa seguida de migração entre os feixes vasculares do cilindro central. Juvenis de H. glycines penetraram, aproximadamente, 15mm da coifa. A região seccionada da raiz de soja atraiu três vezes mais J2 de M. javanica do que a região da coifa, mas esta não foi tão atrativa para J2 de H. glycines. A obstrução conjunta da coifa e do local seccionado reduziu (83% a penetração de J2, tanto de M. javanica quanto de H. glycines. Quando apenas um desses locais foi obstruído, a outra extremidade livre compensou o processo atrativo. Portanto, as substâncias atrativas são liberadas por essas extremidades. A penetração de J2 de M. javanica foi maior no segmento de raiz quando comparada com a plântula intacta de soja. Entretanto, os J2 de H. glycines penetraram menos em segmentos de raiz e em plântulas sem folhas, quando comparados com plântulas intactas e com as seccionadas no colo. Portanto, na cultivar de soja "Embrapa 20", a atração e os locais de penetração de J2 de H. glycines e M. javanica são diferenciados. Esta técnica poderá ser útil nos estudos de atração e penetração de outros nematoides endoparasitas.To study the attraction and penetration of Meloidogyne javanica (Treub Chitwood and Heterodera glycines (Ichinoe in soybean (Glycine max L., a technique using 2-cm long root segments was developed. In infected soybean root segments penetration of second stage juveniles (J2 of M. javanica occured through the root cap following migration between the vascular bundles of the central cylinder. Juveniles of H. glycines penetrated about 15mm from the root cap. The cut

  14. Glycine serine interconversion in the rooster

    International Nuclear Information System (INIS)

    Sugahara, Michihiro; Kandatsu, Makoto


    Serine was isolated by the column chromatography from the hydrolyzates of proteins of the serum, the liver and the pectoral muscle which were obtained from the roosters fed a diet containing 2- 14 C glycine for 16 - 17 days. The carbon chain of serine was cut off by treating with sodium periodate. The specific activity of each carbon (as barium carbonate) was estimated. Carboxyl carbon had little radioactivity. The specific activity of hydroxymethyl carbon was 10 - 19% of that of methylene carbon. Glycine isolated from the same hydrolyzates was degraded by ninhydrin oxidation. Formaldehyde produced from 2-C was oxidized to carbon dioxide by treating with mercuric chloride. Carboxyl carbon had little radioactivity. The specific activities of 2-C of glycine and 2-C of serine in the same tissue protein were compared. The ratio of serine 2-C/glycine 2-C was between 0.7 - 1.5. These results seem to indicate that glycine directly converts to serine in the rooster. The quantitative significance of the pathways of glycine (serine) biosynthesis is discussed. (auth.)

  15. Functional reconstitution of the glycine receptor

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Calvo, M.; Ruiz-Gomez, A.; Vazquez, J.; Morato, E.; Valdivieso, F.; Mayor, F. Jr. (Universidad Autonoma de Madrid (Spain))


    The functional reconstitution of the chloride channel coupled glycine receptor is described. Glycine receptors were purified from the cholate extract of rat spinal cord membranes by affinity chromatography and incorporated into phospholipid vesicles by the addition of phosphatidylcholine and removal of detergent by gel filtration. The reconstituted vesicles showed the same polypeptide composition as the purified receptor. The pharmacological characteristics of the glycine receptor were also preserved in the proteoliposomes, as demonstrated by the displacement of ({sup 3}H)strychnine binding by several glycinergic ligands and by photoaffinity labeling experiments. In order to observe functional responses (i.e., specific agonist-induced anion translocation), the authors have developed an assay based on the fluorescence quenching of an anion-sensitive entrapped probe, SPQ (6-methoxy-N-(3-sulfopropyl)quinolinium). Reconstituted vesicles were loaded with the fluorescent probe during a freeze-thaw-sonication cycle in the presence of added liposomes containing cholesterol. In such a reconstituted system, glycine receptor agonists are able to increase the rate of anion influx into the vesicles. The action of agonists is blocked by the simultaneous presence of strychnine or other glycine antagonists. The results show that the purified 48,000- and 58,000-dalton polypeptides reconstituted into phospholipid vesicles can bind ligands and promote specific ion translocation in a way similar to the glycine receptor in its native environment.

  16. Max Reinharz (1923-2012)

    CERN Multimedia


    Max Reinharz was born in Vienna, Austria, in 1923. In 1939 he was obliged to emigrate to the UK. At the beginning of the Second World War he was interned as an enemy alien and then deported to Australia at a time when the British feared an invasion by Germany. He returned to the UK in 1943 and joined the British Army. After he was demobbed in 1947, he studied physics in Vienna, where he took his doctorate in 1953.   Max Reinharz (centre) with Gordon Munday (left) and Henri Laporte (right) in 1979. After working in Brussels, at the physics Institute of Genoa and the University of Pisa, he joined CERN in 1960 as a fellow and in 1964 became a senior physicist in the NP Division. His name is associated with many publications, such as those of the CERN neutrino experiment and the CERN-Geneva-Lund collaboration to verify T symmetry conservation in lambda decays. He then joined a small team in the Proton Synchrotron Division (MPS) responsible for assisting external physics groups to prepare and i...

  17. Max Planck et les quanta

    CERN Document Server

    Boudenot, Jean-Claude


    « Les atomes, dit Jean Perrin en 1913, ne sont pas ces éléments éternels et insécables dont l'irréductible simplicité donnait au possible une borne, et, dans leur inimaginable petitesse, nous commençons à pressentir un fourmillement prodigieux de mondes nouveaux ». C'est bien dans un monde totalement nouveau, le monde quantique, que nous a fait pénétrer la découverte des quanta par Max Planck. Son article de 1900 est le déclencheur de l'une des plus grandes révolutions scientifiques de tous les temps. Les trente années qui suivent sont les plus riches de la physique ; Planck, Einstein, Bohr, Sommerfeld, de Broglie, Schrödinger, Heisenberg, Dirac, Born, Pauli… reconstruisent la physique sur de nouvelles bases sur fond de conflit des générations. Le monde est par ailleurs secoué par la guerre, Max Planck est tourmenté et vit des épreuves personnelles dramatiques. C'est l'homme, aussi bien que l'oeuvre, que les auteurs ont tenté de dépeindre dans cet ouvrage. Ils ont également souhait�...

  18. (Heckel) seeds

    African Journals Online (AJOL)


    Garcinia kola seeds to six different hormonal pre-germination treatments. This consisted of ... Thus, seed dormancy in this case is not a coat- imposed .... development of the cultivation of the species. The cause .... Hormonal regulation of seed ...

  19. Alternative procedure for the cold test for soybean seeds Procedimento alternativo para o teste de frio em semente de soja

    Directory of Open Access Journals (Sweden)

    Bruno Guilherme Torres Licursi Vieira


    Full Text Available The growing demand for high quality soybean [Glycine max (L. Merrill] seeds requires a precise seed quality control system from the seed industry. One way to accomplish this is by improving vigor testing. Cold test has been traditionally employed for corn seeds. However, it has also been used for other seed crops such as cotton (Gossypium spp., soybean (Glycine Max, dry bean (Phaseolus vulgaris and pea (Pisum sativum. This study was carried out with the objective of adjusting an alternative procedure for the cold test to determine soybean seed vigor. Six commercial soybean seed lots of the cultivar BRS 133 were used. The physiological potential of the seed lots was evaluated by germination on paper towel and sand box, seedling field emergence, tetrazolium, accelerated aging and electrical conductivity tests. Seed moisture content was also determined. The temperature used for the cold test procedures was 10ºC during five days. Four cold test procedures were evaluated: i plastic boxes with soil; ii rolled paper towel with soil; iii rolled paper towel without soil, and iv an alternative procedure, using rolled paper towel without soil under cold water. A completely randomized experimental design with eight replications was used and the means were compared by the Tukey test (p = 0.05. To verify the dependence between the alternative test and others single linear correlation was used. All cold test procedures had similar coefficients of variation (CV, highlighting that rolled paper towel with soil and the alternative procedure had the best performance, with an average of 94% and 93% normal seedlings and CV of 3.2% and 3.6%, respectively. The alternative procedure has satisfactory results for estimating soybean seed vigor, yielding consistent results compared to the traditional procedure.A crescente demanda por semente de soja [Glycine max (L. Merrill] de alta qualidade tem requerido da indústria de sementes um controle de qualidade mais preciso

  20. Glycine Polymerization on Oxide Minerals (United States)

    Kitadai, Norio; Oonishi, Hiroyuki; Umemoto, Koichiro; Usui, Tomohiro; Fukushi, Keisuke; Nakashima, Satoru


    It has long been suggested that mineral surfaces played an important role in peptide bond formation on the primitive Earth. However, it remains unclear which mineral species was key to the prebiotic processes. This is because great discrepancies exist among the reported catalytic efficiencies of minerals for amino acid polymerizations, owing to mutually different experimental conditions. This study examined polymerization of glycine (Gly) on nine oxide minerals (amorphous silica, quartz, α-alumina and γ-alumina, anatase, rutile, hematite, magnetite, and forsterite) using identical preparation, heating, and analytical procedures. Results showed that a rutile surface is the most effective site for Gly polymerization in terms of both amounts and lengths of Gly polymers synthesized. The catalytic efficiency decreased as rutile > anatase > γ-alumina > forsterite > α- alumina > magnetite > hematite > quartz > amorphous silica. Based on reported molecular-level information for adsorption of Gly on these minerals, polymerization activation was inferred to have arisen from deprotonation of the NH3 + group of adsorbed Gly to the nucleophilic NH2 group, and from withdrawal of electron density from the carboxyl carbon to the surface metal ions. The orientation of adsorbed Gly on minerals is also a factor influencing the Gly reactivity. The examination of Gly-mineral interactions under identical experimental conditions has enabled the direct comparison of various minerals' catalytic efficiencies and has made discussion of polymerization mechanisms and their relative influences possible Further systematic investigations using the approach reported herein (which are expected to be fruitful) combined with future microscopic surface analyses will elucidate the role of minerals in the process of abiotic peptide bond formation.

  1. Glycine Polymerization on Oxide Minerals. (United States)

    Kitadai, Norio; Oonishi, Hiroyuki; Umemoto, Koichiro; Usui, Tomohiro; Fukushi, Keisuke; Nakashima, Satoru


    It has long been suggested that mineral surfaces played an important role in peptide bond formation on the primitive Earth. However, it remains unclear which mineral species was key to the prebiotic processes. This is because great discrepancies exist among the reported catalytic efficiencies of minerals for amino acid polymerizations, owing to mutually different experimental conditions. This study examined polymerization of glycine (Gly) on nine oxide minerals (amorphous silica, quartz, α-alumina and γ-alumina, anatase, rutile, hematite, magnetite, and forsterite) using identical preparation, heating, and analytical procedures. Results showed that a rutile surface is the most effective site for Gly polymerization in terms of both amounts and lengths of Gly polymers synthesized. The catalytic efficiency decreased as rutile > anatase > γ-alumina > forsterite > α- alumina > magnetite > hematite > quartz > amorphous silica. Based on reported molecular-level information for adsorption of Gly on these minerals, polymerization activation was inferred to have arisen from deprotonation of the NH 3 + group of adsorbed Gly to the nucleophilic NH 2 group, and from withdrawal of electron density from the carboxyl carbon to the surface metal ions. The orientation of adsorbed Gly on minerals is also a factor influencing the Gly reactivity. The examination of Gly-mineral interactions under identical experimental conditions has enabled the direct comparison of various minerals' catalytic efficiencies and has made discussion of polymerization mechanisms and their relative influences possible Further systematic investigations using the approach reported herein (which are expected to be fruitful) combined with future microscopic surface analyses will elucidate the role of minerals in the process of abiotic peptide bond formation.

  2. Glycine metabolism by Pseudomonas aeruginosa: hydrogen cyanide biosynthesis

    International Nuclear Information System (INIS)

    Castric, P.A.


    Hydrogen cyanide (HCN) production by Pseudomonas aeruginosa in a synthetic medium is stimulated by the presence of glycine. Methionine enhances this stimulation but will not substitute for glycine as a stimulator of cyanogenesis. Threonine and phenylalanine are effective substitutes for glycine in the stimulation of HCN production. Glycine, threonine, and serine are good radioisotope precursors of HCN, but methionine and phenylalanine are not. Cell extracts of P. aeruginosa convert [ 14 C]threonine to [ 14 C]glycine. H14CN is produced with low dilution of label from either [1- 14 C]glycine or [2- 14 C]glycine, indicating a randomization of label either in the primary or secondary metabolism of glycine. When whole cells were fed [1,2- 14 C]glycine, cyanide and bicarbonate were the only radioactive extracellular products observed

  3. HuMax-CD4

    DEFF Research Database (Denmark)

    Skov, Lone; Kragballe, Knud; Zachariae, Claus


    BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE......: To test safety and efficacy of a fully human monoclonal anti-CD4 antibody (HuMax-CD4) in the treatment of psoriasis. DESIGN: Multicenter, double-blind, placebo-controlled, randomized clinical trial. Patients Eighty-five patients with moderate to severe psoriasis. INTERVENTIONS: Subcutaneous infusions...... dose level, 6 (38%) of 16 patients obtained more than 25% reduction of PASI and 3 (19%) obtained more than 50% reduction of PASI. A dose-dependent decrease in total lymphocyte count was seen and was parallel to a dose-dependent decrease in CD4+ T cells. This decrease was due to a decrease in the memory...

  4. German science. Max Planck charts new path. (United States)

    Koenig, R


    Germany's premier basic research organization, the Max Planck Society, released a long-awaited blueprint for change during its annual meeting this week, recommending that the society's nearly 3000 scientists embrace more interdisciplinary and international projects in a range of new research priorities. The report, called Max Planck 2000-Plus, is the product of an 18-month-long internal review. Its recommendations were formulated by some two dozen Max Planck researchers and administrators, who sought input from every institute.

  5. Mastering Autodesk 3ds Max 2013

    CERN Document Server

    Harper, Jeffrey


    Get professional training in 3ds Max from this Autodesk Official Training Guide Extremely popular with video game designers as well as architects, 3ds Max offers integrated 3D modeling, animation, rendering, and compositing tools designed to streamline production. If you already have a working knowledge of 3ds Max basics, this official guide will take your skills to the next level. Detailed tutorials cover all the latest features of 3ds Max. From modeling, texturing, animation, and architectural visualization to high-level techniques for film, television, games, and more, this book provides

  6. Distribución e identificación de especies hospedantes de Heterodera glycines Ichinohe raza 3 en el Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Varón de Agudelo Francia


    Full Text Available Se dividió la parte plana del Valle del Cauca en tres zonas (norte, centro y sur, habiéndose visitado 33 fincas. En la zona norte las malezas con mayor porcentaje de frecuencia y distribución en los cultivos de soya fueron Digitaria horizontalis, Echinochloa colonum y Leptochloa filiformis; en la zona centro Ipomoea hirta, Amaranthus dubius y Echinochloa colonum y en la zona sur predominaron Ipomoea hirta, Portulaca oleracea Cyperus rotundus. Los análisis de muestras de suelo y raíces indicaron que H. glycines se encuentra distribuido en todo el Valle del Cauca, presentando la zona sur (Candelaria, Palmira y Puerto Tejada las mayores poblaciones. Entre las especies evaluadas (malezas, cultivos, leguminosas forrajeras y silvestres, solamente Glycine max y Phaseolus vulgaris se consideraron como susceptibles a H. glycines raza 3. y P. angularis y P. multiflora permitieron muy poca infección y multiplicación del nemátodo.A nematode recognition of Heterodera glycines was focused on crops of soybean. Valle del Cauca was divided in three zones (northen, central and southern and 33 farms were visited. The results of the analysis on samples of soils and roots showe that Heterodera glycines is scattered throughout Valle del Cauca, being the southern zone (Palmira, Candelaria and Puerto Tejada the one having the highest standards in nematode population. Weeds showing a greater frequency percentage were : Digitaria horizontalis, Echinochloa colonum and Leptochloa filiformis, in the northen zone; Ipomoea hirta, Amaranthus dubius and Echinochloa colonum, in the central zone, and Ipomoea hirta, Portulaca oleracea and Cyperus rotundus, in the southern zone , From among the whole species evaluated (weeds, crops, leguminous a n d fodder plants, Glycine max and Phaseolus vulgaris were considered to be susceptible to H. Glycines race 3. Phaseolus angularis y P. multiflora let low population levels.

  7. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae (United States)

    Fauteux, François; Strömvik, Martina V


    Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

  8. Identification and characterisation of seed storage protein transcripts from Lupinus angustifolius

    Directory of Open Access Journals (Sweden)

    Goggin Danica E


    Full Text Available Abstract Background In legumes, seed storage proteins are important for the developing seedling and are an important source of protein for humans and animals. Lupinus angustifolius (L., also known as narrow-leaf lupin (NLL is a grain legume crop that is gaining recognition as a potential human health food as the grain is high in protein and dietary fibre, gluten-free and low in fat and starch. Results Genes encoding the seed storage proteins of NLL were characterised by sequencing cDNA clones derived from developing seeds. Four families of seed storage proteins were identified and comprised three unique α, seven β, two γ and four δ conglutins. This study added eleven new expressed storage protein genes for the species. A comparison of the deduced amino acid sequences of NLL conglutins with those available for the storage proteins of Lupinus albus (L., Pisum sativum (L., Medicago truncatula (L., Arachis hypogaea (L. and Glycine max (L. permitted the analysis of a phylogenetic relationships between proteins and demonstrated, in general, that the strongest conservation occurred within species. In the case of 7S globulin (β conglutins and 2S sulphur-rich albumin (δ conglutins, the analysis suggests that gene duplication occurred after legume speciation. This contrasted with 11S globulin (α conglutin and basic 7S (γ conglutin sequences where some of these sequences appear to have diverged prior to speciation. The most abundant NLL conglutin family was β (56%, followed by α (24%, δ (15% and γ (6% and the transcript levels of these genes increased 103 to 106 fold during seed development. We used the 16 NLL conglutin sequences identified here to determine that for individuals specifically allergic to lupin, all seven members of the β conglutin family were potential allergens. Conclusion This study has characterised 16 seed storage protein genes in NLL including 11 newly-identified members. It has helped lay the foundation for efforts to use

  9. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Directory of Open Access Journals (Sweden)

    Fauteux François


    Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

  10. Mechanisms of glycine release, which build up synaptic and extrasynaptic glycine levels: the role of synaptic and non-synaptic glycine transporters. (United States)

    Harsing, Laszlo G; Matyus, Peter


    Glycine is an amino acid neurotransmitter that is involved in both inhibitory and excitatory neurochemical transmission in the central nervous system. The role of glycine in excitatory neurotransmission is related to its coagonist action at glutamatergic N-methyl-D-aspartate receptors. The glycine levels in the synaptic cleft rise many times higher during synaptic activation assuring that glycine spills over into the extrasynaptic space. Another possible origin of extrasynaptic glycine is the efflux of glycine occurring from astrocytes associated with glutamatergic synapses. The release of glycine from neuronal or glial origins exhibits several differences compared to that of biogenic amines or other amino acid neurotransmitters. These differences appear in an external Ca(2+)- and temperature-dependent manner, conferring unique characteristics on glycine as a neurotransmitter. Glycine transporter type-1 at synapses may exhibit neural and glial forms and plays a role in controlling synaptic glycine levels and the spill over rate of glycine from the synaptic cleft into the extrasynaptic biophase. Non-synaptic glycine transporter type-1 regulates extrasynaptic glycine concentrations, either increasing or decreasing them depending on the reverse or normal mode operation of the carrier molecule. While we can, at best, only estimate synaptic glycine levels at rest and during synaptic activation, glycine concentrations are readily measurable via brain microdialysis technique applied in the extrasynaptic space. The non-synaptic N-methyl-D-aspartate receptor may obtain glycine for activation following its spill over from highly active synapses or from its release mediated by the reverse operation of non-synaptic glycine transporter-1. The sensitivity of non-synaptic N-methyl-D-aspartate receptors to glutamate and glycine is many times higher than that of synaptic N-methyl-D-aspartate receptors making the former type of receptor the primary target for drug action. Synaptic

  11. A weak link in metabolism: the metabolic capacity for glycine ...

    Indian Academy of Sciences (India)



    Dec 3, 2009 ... glyoxylate, threonine and trimethyllysine (carnitine synthesis), most of them ...... Participation of glycine in porphyrin biosynthesis. Eight glycine ...... normal and streptozotocin-induced diabetic rats; J. Dent. Res. 63 23–27.

  12. Max Jakobson õiendab arveid ajalooga / Imbi Paju

    Index Scriptorium Estoniae

    Paju, Imbi, 1959-


    Soome politoloogi ja diplomaadi Max Jakobsoni raamatust "Tilinpäätos" ("Arve sulgemine"), milles ta käsitleb Eesti ja Soome suhteid 20. sajandil. Vt samas: Lennart Meri meelitas Jakobsoni sõjakuritegusid uurima; lühiintervjuu Max Jakobsoniga

  13. Veteranpoliitik Max Jakobson õpetab ajalugu / Sirje Kiin

    Index Scriptorium Estoniae

    Kiin, Sirje, 1949-


    Soome sõltumatu välispoliitika konsultant ja ajakirjanik Max Jakobson. Ülevaade Max Jakobsoni intervjuust soomerootsi majandusajakirjale "Forum för ekonomi och teknik" 1998. aasta aprillinumbris Venemaa Baltimaade-vastasest propagandast ning EL-i ja NATO laienemisest

  14. Transcriptome Profile of Near-Isogenic Soybean Lines for β-Conglycinin α-Subunit Deficiency during Seed Maturation. (United States)

    Song, Bo; An, Lixin; Han, Yanjing; Gao, Hongxiu; Ren, Hongbo; Zhao, Xue; Wei, Xiaoshuang; Krishnan, Hari B; Liu, Shanshan


    Crossing, backcrossing, and molecular marker-assisted background selection produced a soybean (Glycine max) near-isogenic line (cgy-2-NIL) containing the cgy-2 allele, which is responsible for the absence of the allergenic α-subunit of β-conglycinin. To identify α-null-related transcriptional changes, the gene expressions of cgy-2-NIL and its recurrent parent DN47 were compared using Illumina high-throughput RNA-sequencing of samples at 25, 35, 50, and 55 days after flowering (DAF). Seeds at 18 DAF served as the control. Comparison of the transcript profiles identified 3,543 differentially expressed genes (DEGs) between the two genotypes, with 2,193 genes downregulated and 1,350 genes upregulated. The largest numbers of DEGs were identified at 55 DAF. The DEGs identified at 25 DAF represented a unique pattern of GO category distributions. KEGG pathway analyses identified 541 altered metabolic pathways in cgy-2-NIL. At 18DAF, 12 DEGs were involved in arginine and proline metabolism. The cgy-2 allele in the homozygous form modified the expression of several Cupin allergen genes. The cgy-2 allele is an alteration of a functional allele that is closely related to soybean protein amino acid quality, and is useful for hypoallergenic soybean breeding programs that aim to improve seed protein quality.

  15. Effects of UV-B radiation on soybean yield and seed quality: a 6-year field study

    International Nuclear Information System (INIS)

    Teramura, A.H.; Sullivan, J.H.; Lydon, J.


    Two soybean [Glycine max (L.) Merr.] cultivars, Essex and Williams, were grown in the field for 6 consecutive seasons under ambient and supplemental levels of ultravio-Set-B radiation to determine the potential for alterations in yield or seed quality with a reduction in the stratospheric ozone column. The supplemental UV-B fluences simulated a 16 or 25% ozone depletion. The data presented here represent the first field experiment conducted over multiple seasons which assesses the effects of increased UV-B radiation on seed yield. Overall, the cultivar Essex was found to be sensitive to UV-B radiation (yield reductions of 20%) while the cultivar Williams was tolerant. However, the effectiveness of UV-B radiation in altering yield was strongly influenced by the seasonal microclimate, and the 2 cultivars responded differently to these changing factors. Yield was reduced most in Essex during seasons in which water availability was high and was reduced in Williams only when water was severely limiting. The results of these experiments demonstrate the necessity for multiple-year experiments and the need to increase our understanding of the interaction between UV-B radiation and other environmental stresses in order to assess the potential consequences of stratospheric ozone depletion. (author)

  16. 21 CFR 520.550 - Dextrose/glycine/electrolyte. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Dextrose/glycine/electrolyte. 520.550 Section 520...) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.550 Dextrose/glycine..., potassium citrate 0.12 gram, aminoacetic acid (glycine) 6.36 grams, and dextrose 44.0 grams. (b) Sponsor...

  17. Soybean roots retain the seed urease isozyme synthesized during embryo development

    International Nuclear Information System (INIS)

    Torisky, R.S.; Polacco, J.C.


    Roots of young soybean (Glycine max [L.] Merr.) plants (up to 25 days old) contain two distinct urease isozymes, which are separable by hydroxyapatite chromatography. These two urease species (URE1 and URE2) differ in: (a) electrophoretic mobility in native gels, (b) pH dependence, and (c) recognition by a monoclonal antibody specific for the seed (embryo-specific) urease. By these parameters root URE1 urease is similar to the abundant embryo-specific urease isozyme, while root URE2 resembles the ubiquitous urease which has previously been found in all soybean tissues examined (leaf, embryo, seed coat, and cultured cells). The embryo-specific and ubiquitous urease isozymes are products of the Eu1 and Eu4 structural genes, respectively. Roots of the eu1-sun/eu1-sun genotype, which lacks the embryo-specific urease (i.e. seed urease-null), contain no URE1 urease activity. Roots of eu4/eu4, which lacks ubiquitous urease, lack the URE2 (leaflike) urease activity. From these genetic and biochemical criteria, then, we conclude that URE1 and URE2 are the embryo-specific and ubiquitous ureases, respectively. Adventitious roots generated from cuttings of any urease genotype lack URE1 activity. In seedling roots the seedlike (URE1) activity declines during development. Roots of 3-week-old plants contain 5% of the total URE1 activity of the radicle of 4-day-old seedlings, which, in turn, has approximately the same urease activity level as the dormant embryonic axis. The embryo-specific urease incorporates label from [ 35 S]methionine during embryo development but not during germination, indicating that there is no de novo synthesis of the embryo-specific (URE1) urease in the germinating root

  18. The Interactomic Analysis Reveals Pathogenic Protein Networks in Phomopsis longicolla Underlying Seed Decay of Soybean

    Directory of Open Access Journals (Sweden)

    Shuxian Li


    Full Text Available Phomopsis longicolla T. W. Hobbs (syn. Diaporthe longicolla is the primary cause of Phomopsis seed decay (PSD in soybean, Glycine max (L. Merrill. This disease results in poor seed quality and is one of the most economically important seed diseases in soybean. The objectives of this study were to infer protein–protein interactions (PPI and to identify conserved global networks and pathogenicity subnetworks in P. longicolla including orthologous pathways for cell signaling and pathogenesis. The interlog method used in the study identified 215,255 unique PPIs among 3,868 proteins. There were 1,414 pathogenicity related genes in P. longicolla identified using the pathogen host interaction (PHI database. Additionally, 149 plant cell wall degrading enzymes (PCWDE were detected. The network captured five different classes of carbohydrate degrading enzymes, including the auxiliary activities, carbohydrate esterases, glycoside hydrolases, glycosyl transferases, and carbohydrate binding molecules. From the PPI analysis, novel interacting partners were determined for each of the PCWDE classes. The most predominant class of PCWDE was a group of 60 glycoside hydrolases proteins. The glycoside hydrolase subnetwork was found to be interacting with 1,442 proteins within the network and was among the largest clusters. The orthologous proteins FUS3, HOG, CYP1, SGE1, and the g5566t.1 gene identified in this study could play an important role in pathogenicity. Therefore, the P. longicolla protein interactome (PiPhom generated in this study can lead to a better understanding of PPIs in soybean pathogens. Furthermore, the PPI may aid in targeting of genes and proteins for further studies of the pathogenicity mechanisms.

  19. Identification of miRNAs and their target genes in developing soybean seeds by deep sequencing

    Directory of Open Access Journals (Sweden)

    Chen Shou-Yi


    Full Text Available Abstract Background MicroRNAs (miRNAs regulate gene expression by mediating gene silencing at transcriptional and post-transcriptional levels in higher plants. miRNAs and related target genes have been widely studied in model plants such as Arabidopsis and rice; however, the number of identified miRNAs in soybean (Glycine max is limited, and global identification of the related miRNA targets has not been reported in previous research. Results In our study, a small RNA library and a degradome library were constructed from developing soybean seeds for deep sequencing. We identified 26 new miRNAs in soybean by bioinformatic analysis and further confirmed their expression by stem-loop RT-PCR. The miRNA star sequences of 38 known miRNAs and 8 new miRNAs were also discovered, providing additional evidence for the existence of miRNAs. Through degradome sequencing, 145 and 25 genes were identified as targets of annotated miRNAs and new miRNAs, respectively. GO analysis indicated that many of the identified miRNA targets may function in soybean seed development. Additionally, a soybean homolog of Arabidopsis SUPPRESSOR OF GENE SLIENCING 3 (AtSGS3 was detected as a target of the newly identified miRNA Soy_25, suggesting the presence of feedback control of miRNA biogenesis. Conclusions We have identified large numbers of miRNAs and their related target genes through deep sequencing of a small RNA library and a degradome library. Our study provides more information about the regulatory network of miRNAs in soybean and advances our understanding of miRNA functions during seed development.

  20. The light activated alkylation of glycine

    International Nuclear Information System (INIS)

    Knowles, H.S.


    The work contained in this thesis focuses on the light-initiated alkylation of the α-centre of glycine compounds. The elaboration of the glycines in this manner represents a versatile, clean and cost effective alternative to ionic routes to higher α-amino acids. Preliminary investigations demonstrated that a range of nitrogen protecting groups were compatible with the radical alkylation. A variety of solvents could also be used although solvents with easily removable hydrogen atoms were found to interfere with the alkylation. Furthermore, a number of photo-initiators were investigated and the use of di-tert-butyl peroxide was found to afford the desired phenylalanine products in up to 27% yield (54% based on recovered starting material) when toluene was used as the alkylating agent. A range of different precursor concentrations was investigated and it was found that the optimum concentration of the glycine precursor was 0.13 mol dm -3 ; the phenylalanine yields were reduced when the concentration was less than this value. Owing to the poor UV absorption by di-tert-butyl peroxide, benzophenone (an effective photosensitiser) was added to the reaction mixture and this was shown to increase the alkylation yields. The ratio of reagents which produced the highest yield of phenylalanine products was found to be 1 : 5 : 5 : 10 for glycine : di-tert-butyl peroxide : benzophenone : toluene. This produced the phenylalanine product in up to 37% yield (57% based on recovered starting material). A number of substituents. (e.g. F, Cl etc.) could be attached to the aromatic ring of the toluene alkylating agent, affording substituted phenylalanines in 5 - 36% under these conditions. The formation of chiral phenylalanine products was probed by reacting glycine precursors bearing chiral auxiliaries. However, low diastereoselectivities were observed; the d.r. ranged from 1 : 1.1 to 1 : 1.5 only when chiral ester and amide protecting groups were used. In the final chapter, the

  1. Dissecting genomic hotspots underlying seed protein, oil, and sucrose content in an interspecific mapping population of soybean using high-density linkage mapping. (United States)

    Patil, Gunvant; Vuong, Tri D; Kale, Sandip; Valliyodan, Babu; Deshmukh, Rupesh; Zhu, Chengsong; Wu, Xiaolei; Bai, Yonghe; Yungbluth, Dennis; Lu, Fang; Kumpatla, Siva; Grover Shannon, J; Varshney, Rajeev K; Nguyen, Henry T


    The cultivated [Glycine max (L) Merr.] and wild [Glycine soja Siebold & Zucc.] soybean species comprise wide variation in seed composition traits. Compared to wild soybean, cultivated soybean contains low protein, high oil and high sucrose. In this study, an inter-specific population was derived from a cross between G. max (Williams 82) and G. soja (PI 483460B). This recombinant inbred line (RIL) population of 188 lines was sequenced at 0.3x depth. Based on 91,342 single nucleotide polymorphisms (SNPs), recombination events in RILs were defined, and a high-resolution bin map was developed (4,070 bins). In addition to bin mapping, QTL analysis for protein, oil and sucrose was performed using 3,343 polymorphic SNPs (3K-SNP), derived from Illumina Infinium BeadChip sequencing platform. The QTL regions from both platforms were compared and a significant concordance was observed between bin and 3K-SNP markers. Importantly, the bin map derived from next generation sequencing technology enhanced mapping resolution (from 1325 Kb to 50 Kb). A total of 5, 9 and 4 QTLs were identified for protein, oil and sucrose content, respectively and some of the QTLs coincided with soybean domestication related genomic loci. The major QTL for protein and oil was mapped on Chr. 20 (qPro_20) and suggested negative correlation between oil and protein. In terms of sucrose content, a novel and major QTL was identified on Chr. 8 (qSuc_08) and harbors putative genes involved in sugar transport. In addition, genome-wide association (GWAS) using 91,342 SNPs confirmed the genomic loci derived from QTL mapping. A QTL based haplotype using whole genome resequencing of 106 diverse soybean lines identified unique allelic variation in wild soybean that could be utilized to widen the genetic base in cultivated soybean. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  2. Formation of intercalation compound of kaolinite-glycine via displacing guest water by glycine. (United States)

    Zheng, Wan; Zhou, Jing; Zhang, Zhenqian; Chen, Likun; Zhang, Zhongfei; Li, Yong; Ma, Ning; Du, Piyi


    The kaolinite-glycine intercalation compound was successfully formed by displacing intercalated guest water molecules in kaolinite hydrate as a precursor. The microstructure of the compound was characterized by X-ray diffraction, Fourier Transform Infrared Spectroscopy and Scanning Electron Microscope. Results show that glycine can only be intercalated into hydrated kaolinite to form glycine-kaolinite by utilizing water molecules as a transition phase. The intercalated glycine molecules were squeezed partially into the ditrigonal holes in the silicate layer, resulting in the interlayer distance of kaolinite reaching 1.03nm. The proper intercalation temperature range was between 20°C and 80°C. An intercalation time of 24h or above was necessary to ensure the complete formation of kaolinite-glycine. The highest intercalation degree of about 84% appeared when the system was reacted at the temperature of 80°C for 48h. There were two activation energies for the intercalation of glycine into kaolinite, one being 21kJ/mol within the temperature range of 20-65°C and the other 5.8kJ/mol between 65°C and 80°C. The intercalation degree (N) and intercalation velocity (v) of as a function of intercalation time (t) can be empirically expressed as N=-79.35e(-)(t)(/14.8)+80.1 and v=5.37e(-)(t)(/14.8), respectively. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Do glycine-extended hormone precursors have clinical significance?

    DEFF Research Database (Denmark)

    Rehfeld, Jens Frederik


    Half of the known peptide hormones are C-terminally amidated. Subsequent biogenesis studies have shown that the immediate precursor is a glycine-extended peptide. The clinical interest in glycine-extended hormones began in 1994, when it was suggested that glycine-extended gastrin stimulated cancer...... and clinical effects of glycine-extended precursors for most other amidated hormones than gastrin and cholecystokinin (CCK). The idea of glycine-extended peptides as independent messengers was interesting. But clinical science has to move ahead from ideas that cannot be supported at key points after decades...

  4. WiMax network planning and optimization

    CERN Document Server

    Zhang, Yan


    This book offers a comprehensive explanation on how to dimension, plan, and optimize WiMAX networks. The first part of the text introduces WiMAX networks architecture, physical layer, standard, protocols, security mechanisms, and highly related radio access technologies. It covers system framework, topology, capacity, mobility management, handoff management, congestion control, medium access control (MAC), scheduling, Quality of Service (QoS), and WiMAX mesh networks and security. Enabling easy understanding of key concepts and technologies, the second part presents practical examples and illu

  5. Introducing Autodesk 3ds Max 2011

    CERN Document Server

    Derakhshani, Dariush


    An Autodesk Official Training Guide to 3ds Max 2011. 3ds Max is a popular 3D animation-and-effects software used in movies, visual effects, games, cartoons, short films, commercials, and other animation. However, it also presents a number of challenges to newcomers. This introduction to the latest version breaks down the complexities of learning 3D software and walks you through the basics of modeling, texturing, animating, and using visual effects. Real-world examples from talented beginning 3ds max users motivate you to learn the software and helpful tutorials offer realistic, professional c

  6. Allelopathic Effect of Echinochloa colona L. and Cyperus iria L. Weed Extracts on the Seed Germination and Seedling Growth of Rice and Soyabean

    Directory of Open Access Journals (Sweden)

    Neha Chopra


    Full Text Available The present study was undertaken to assess the allelopathic effect of Echinochloa colona L. and Cyperus iria L. in relation to the germination and primary growth of Oryza sativa L. (rice and Glycine max L. (soyabean. Effects of dichloromethane (DCM and double distilled water soluble (DDW fractions of E. colona L. and C. iria L. root and aerial part extracts reduced germination and suppressed early seedling growth of rice and soyabean. With increase in extract concentration from 1 to 100 mg/mL, a gradual decrease in seed germination and seedling length occurred. The highest growth of G. max seedling was recorded in DDW fraction of E. colona aerial part extract at 1 mg/mL concentration with 94% germination and the lowest length was found in DCM fraction of C. iria root extract at 100 mg/mL concentration with 65% germination. In O. sativa, the highest length was noted at 1 mg/mL concentration in DDW fraction of E. colona aerial part extract with 82% germination and the lowest length was found in DCM fraction of C. iria and E. colona root extracts with germination 57% and 62%, respectively, at 100 mg/mL concentration. The results suggested that these weeds had good allelopathic potential which reduces germination and plant growth.

  7. Microspectroscopy At Beamline 73 MAX-lab

    International Nuclear Information System (INIS)

    Engdahl, Anders


    Presentation of some projects at the infrared microspectroscopy experimental station at beamline 73 MAX-lab. Among the subjects are found identification of organic residues in fossil material and examination of the chemistry in an old oak wood wreck.

  8. Approximation by max-product type operators

    CERN Document Server

    Bede, Barnabás; Gal, Sorin G


    This monograph presents a broad treatment of developments in an area of constructive approximation involving the so-called "max-product" type operators. The exposition highlights the max-product operators as those which allow one to obtain, in many cases, more valuable estimates than those obtained by classical approaches. The text considers a wide variety of operators which are studied for a number of interesting problems such as quantitative estimates, convergence, saturation results, localization, to name several. Additionally, the book discusses the perfect analogies between the probabilistic approaches of the classical Bernstein type operators and of the classical convolution operators (non-periodic and periodic cases), and the possibilistic approaches of the max-product variants of these operators. These approaches allow for two natural interpretations of the max-product Bernstein type operators and convolution type operators: firstly, as possibilistic expectations of some fuzzy variables, and secondly,...

  9. Max Reinhardt Haus Berliini / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-


    Arhitekt Peter Eisenmani projekteeritud multifunktsionaalne maja on planeeritud II maailmasõjas hävinud Max Reinhardti teatrihoone kohale. Ühte hoonetahukasse kui uude maamärki on 'volditud' kokku aktiivse linnaelu kõik aspektid.

  10. WiMAX technology and network evolution

    CERN Document Server

    Etemad, Kamran


    WiMAX, the Worldwide Interoperability for Microwave Access, represents a paradigm shift in telecommunications technology. It offers the promise of cheaper, smaller, and simpler technology compared to existing broadband options such as DSL, cable, fiber, and 3G wireless.

  11. Tukey max-stable processes for spatial extremes

    KAUST Repository

    Xu, Ganggang; Genton, Marc G.


    We propose a new type of max-stable process that we call the Tukey max-stable process for spatial extremes. It brings additional flexibility to modeling dependence structures among spatial extremes. The statistical properties of the Tukey max


    Directory of Open Access Journals (Sweden)

    Purnawan Adi Wicaksono


    Full Text Available Kapasitas fisik maksimum seseorang direpresentasikan dengan nilai konsumsi oksigen maksimum (VO2 Max dan denyut nadi maksimum (HR Max yang memberikan suatu informasi batasan kemampuan fisik maksimum seseorang dalam melakukan pekerjaan. Penelitian kali ini mempunyai tujuan untuk mencari nilai VO2 Max pekerja pria Indonesia untuk nantinya akan dikembangkan suatu persamaan prediksi VO2 Max yang didekati dengan hubungan linier antara denyut nadi (Heart Rate seperti yang dilakukan Astrand (2003, tinggi badan (Chatterjee et al, 2006, berat badan (Akalan et al, 2008, usia (Magrani et al, 2009 dan mengevaluasi persamaan HR Max manakah yang dapat diaplikasikan untuk mendekati nilai denyut nadi maksimum pekerja Indonesia. Responden dalam penelitian kali ini adalah 12  pekerja industri pria yang diambil dari beberapa industri di Depok dan sekitarnya. Kriteria responden yang berpartisipasi dalam penelitian kali ini adalah: berusia 20-40 tahun, bukan perokok baik aktif maupun pasif, sehat , tidak mengkonsumsi makanan, kafein, alkohol minimal 2 jam sebelum eksperimen (Balderrama et. al, 2007.Eksperimen yang dilakukan menggunakan metode maximal test dengan protokol treadmill. Adapun peralatan yang digunakan adalah seperangkat alat pengukur kondisi fisiologi Fitmate MED (COSMED srl-Italy terdiri dari Heart Rate Transmitter, Heart Rate Receiver, V mask (Hans Rudolph Inc,dan treadmill SportArt@60.  Eksperimen dilakukan menjadi dua bagian, yaitu istirahat dan tahap bekerja.Aktivitas istirahat terdiri dari tidur selama 20 menit, duduk selama 20 menit dan berdiri selama 10 menit. Eksperimen tahap kedua yaitu tahap kerja yang terdiri dari latihan selama 5 menit. Responden dipersilakan beristirahat selama 15 menit, setelah itu responden melaksanakan maximal test detik hingga responden merasa tidak sanggup lagi melanjutkan eksperimen. Hasil penelitian model prediksi VO2 max untuk pekerja industri pria mempunyai nilai 2,78 ± 0,5 liter/menit dan dengan regresi linier

  13. Overexpression of four Arabidopsis thaliana NHLgenes in soybean (Glycine max) roots and their effect over resistance to the soybean cyst nematode (Heterodera glycines) (United States)

    In the US, the soybean cyst nematode (SCN) is the most destructive pathogen of soybean. Currently grown soybean varieties are not resistant to all field populations of SCN. We genetically engineered soybean roots so they expressed genes from the model plant, Arabidopsis. When the Arabidopsis genes, ...

  14. Genetic control of soybean seed oil: I. QTL and genes associated with seed oil concentration in RIL populations derived from crossing moderately high-oil parents. (United States)

    Eskandari, Mehrzad; Cober, Elroy R; Rajcan, Istvan


    Soybean seed is a major source of oil for human consumption worldwide and the main renewable feedstock for biodiesel production in North America. Increasing seed oil concentration in soybean [Glycine max (L.) Merrill] with no or minimal impact on protein concentration could be accelerated by exploiting quantitative trait loci (QTL) or gene-specific markers. Oil concentration in soybean is a polygenic trait regulated by many genes with mostly small effects and which is negatively associated with protein concentration. The objectives of this study were to discover and validate oil QTL in two recombinant inbred line (RIL) populations derived from crosses between three moderately high-oil soybean cultivars, OAC Wallace, OAC Glencoe, and RCAT Angora. The RIL populations were grown across several environments over 2 years in Ontario, Canada. In a population of 203 F(3:6) RILs from a cross of OAC Wallace and OAC Glencoe, a total of 11 genomic regions on nine different chromosomes were identified as associated with oil concentration using multiple QTL mapping and single-factor ANOVA. The percentage of the phenotypic variation accounted for by each QTL ranged from 4 to 11 %. Of the five QTL that were tested in a population of 211 F(3:5) RILs from the cross RCAT Angora × OAC Wallace, a "trait-based" bidirectional selective genotyping analysis validated four QTL (80 %). In addition, a total of seven two-way epistatic interactions were identified for oil concentration in this study. The QTL and epistatic interactions identified in this study could be used in marker-assisted introgression aimed at pyramiding high-oil alleles in soybean cultivars to increase oil concentration for biodiesel as well as edible oil applications.

  15. Multifarious Beneficial Effect of Nonessential Amino Acid, Glycine: A Review

    Directory of Open Access Journals (Sweden)

    Meerza Abdul Razak


    Full Text Available Glycine is most important and simple, nonessential amino acid in humans, animals, and many mammals. Generally, glycine is synthesized from choline, serine, hydroxyproline, and threonine through interorgan metabolism in which kidneys and liver are the primarily involved. Generally in common feeding conditions, glycine is not sufficiently synthesized in humans, animals, and birds. Glycine acts as precursor for several key metabolites of low molecular weight such as creatine, glutathione, haem, purines, and porphyrins. Glycine is very effective in improving the health and supports the growth and well-being of humans and animals. There are overwhelming reports supporting the role of supplementary glycine in prevention of many diseases and disorders including cancer. Dietary supplementation of proper dose of glycine is effectual in treating metabolic disorders in patients with cardiovascular diseases, several inflammatory diseases, obesity, cancers, and diabetes. Glycine also has the property to enhance the quality of sleep and neurological functions. In this review we will focus on the metabolism of glycine in humans and animals and the recent findings and advances about the beneficial effects and protection of glycine in different disease states.

  16. Min-Max Spaces and Complexity Reduction in Min-Max Expansions

    Energy Technology Data Exchange (ETDEWEB)

    Gaubert, Stephane, E-mail: [Ecole Polytechnique, INRIA and CMAP (France); McEneaney, William M., E-mail: [University of California San Diego, Dept. of Mech. and Aero. Eng. (United States)


    Idempotent methods have been found to be extremely helpful in the numerical solution of certain classes of nonlinear control problems. In those methods, one uses the fact that the value function lies in the space of semiconvex functions (in the case of maximizing controllers), and approximates this value using a truncated max-plus basis expansion. In some classes, the value function is actually convex, and then one specifically approximates with suprema (i.e., max-plus sums) of affine functions. Note that the space of convex functions is a max-plus linear space, or moduloid. In extending those concepts to game problems, one finds a different function space, and different algebra, to be appropriate. Here we consider functions which may be represented using infima (i.e., min-max sums) of max-plus affine functions. It is natural to refer to the class of functions so represented as the min-max linear space (or moduloid) of max-plus hypo-convex functions. We examine this space, the associated notion of duality and min-max basis expansions. In using these methods for solution of control problems, and now games, a critical step is complexity-reduction. In particular, one needs to find reduced-complexity expansions which approximate the function as well as possible. We obtain a solution to this complexity-reduction problem in the case of min-max expansions.

  17. Studying Plant–Insect Interactions with Solid Phase Microextraction: Screening for Airborne Volatile Emissions Response of Soybeans to the Soybean Aphid, Aphis glycines Matsumura (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Lingshuang Cai


    Full Text Available Insects trigger plants to release volatile compounds that mediate the interaction with both pest and beneficial insects. Soybean aphids (Aphis glycines induces soybean (Glycine max leaves to produce volatiles that attract predators of the aphid. In this research, we describe the use of solid-phase microextraction (SPME for extraction of volatiles from A. glycines-infested plant. Objectives were to (1 determine if SPME can be used to collect soybean plant volatiles and to (2 use headspace SPME-GC-MS approach to screen compounds associated with A. glycines-infested soybeans, grown in the laboratory and in the field, to identify previously known and potentially novel chemical markers of infestation. A total of 62 plant volatiles were identified, representing 10 chemical classes. 39 compounds had not been found in previous studies of soybean volatile emissions. 3-hexen-1-ol, dimethyl nonatriene, indole, caryophyllene, benzaldehyde, linalool, methyl salicylate (MeSA, benzene ethanol, and farnesene were considered herbivore-induced plant volatiles (HIPVs. For reproductive field-grown soybeans, three compounds were emitted in greater abundance from leaves infested with A. glycines, cis-3-hexen-1-ol acetate, MeSA and farnesene. In summary, SPME can detect the emission of HIPVs from plants infested with insect herbivores.

  18. Correlation of maturity groups with seed composition in soybeans, as influenced by genotypic variation.

    Directory of Open Access Journals (Sweden)

    Maestri, Damián M.


    Full Text Available Seeds of 19 soybean cultivars (Glycine max (L. Merrill with maturity groups V, VI or VII were analyzed for proximate composition, fatty acids and sterols. Protein, oil, carbohydrate and ash contents varied between 344-463 g kg-1, 178-233 g kg-1, 234-338 g kg-1, and 40.0-49.3 g kg-1 of dry matter, respectively. Fatty acid profiles revealed that the major acids were palmitic (9.2-12.5%, oleic (17.7-22.1% and linoleic (53.6-56.9%. Linolenic acid ranged from 8.6 to 10.4%. Sitosterol (48.1-56.8% was the main component of the sterol fraction, followed by campesterol (18.4-21.7% and stigmasterol (13.4-18.0%. Statistically significant differences between genotypes were found for the majority of parameters evaluated, but there are not significant variations among maturity groups.

    Se analizaron la humedad, contenido en proteínas, carbohidratos, grasas y cenizas, y las composiciones en ácidos grasos y esteróles de las semillas de 19 cultivares de soja (Glycine max (L. Merrill con grupos de madurez V, VI o VIl. Los contenidos de proteínas, aceites, carbohidratos y cenizas variaron entre 344-463 g kg-1, 178-233 g kg-1, 234-338 g kg-1 y 40.0-49.3 g kg-1 de materia seca, respectivamente. Los ácidos grasos mayoritarios fueron palmítico (9.2-12.5%, oleico (17.7-22.1% y linoleico (53.6-56.9%. El porcentaje de ácido linolénico varió desde 8.6 hasta 10.4%. El principal componente de la fracción de esteroles del aceite fue el sitosterol (48.1-56.8%, seguido por el campesterol (18.4-21.7% y el estigmasterol (13.4-18.0%. Se encontraron diferencias estadísticamente significativas entre los genotipos para la mayoría de los parámetros evaluados, pero no hubo variaciones significativas entre grupos de madurez.

  19. Habitat affinity of resident natural enemies of the invasive Aphis glycines (Hemiptera: Aphididae), on soybean, with comments on biological control. (United States)

    Brewer, Michael J; Noma, Takuji


    We integrated a natural enemy survey of the broader landscape into a more traditional survey for Aphis glycines Matsumura (Hemiptera: Aphididae), parasitoids and predatory flies on soybean using A. glycines-infested soybean, Glycine max (L.) Merr., placed in cropped and noncropped plant systems to complement visual field observations. Across three sites and 5 yr, 18 parasitoids and predatory flies in total (Hymenoptera: Aphelinidae [two species] and Bracondae [seven species], Diptera: Cecidomyiidae [one species], Syrphidae [seven species], Chamaemyiidae [one species]) were detected, with significant variability in recoveries detected across plant system treatments and strong contrasts in habitat affinity detected among species. Lysiphlebus testaceipes Cresson was the most frequently detected parasitoid, and no differences in abundance were detected in cropped (soybean, wheat [Triticum aestivum L.], corn [Zea mays L.], and alfalfa [Medicago sativa L.]) and noncropped (poplar [Populus euramericana (Dode) Guinier] and early successional vegetation) areas. In contrast, Binodoxys kelloggensis Pike, Starý & Brewer had strong habitat affinity for poplar and early successional vegetation. The low recoveries seasonally and across habitats of Aphelinus asychis Walker, Aphelinus sp., and Aphidius colemoni Viereck make their suitability to A. glycines on soybean highly suspect. The widespread occurrence of many of the flies reflects their broad habitat affinity and host aphid ranges. The consistent low field observations of parasitism and predation suggest that resident parasitoids and predatory flies are unlikely to contribute substantially to A. glycines suppression, at least during the conventional time period early in the pest invasion when classical biological control activities are considered. For selected species that were relatively well represented across plant systems (i.e., L. testaceipes and Aphidoletes aphidimyza Rondani), conservation biological control efforts

  20. Quantum Max-flow/Min-cut

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Shawn X., E-mail: [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Quantum Architectures and Computation Group, Microsoft Research, Redmond, Washington 98052 (United States); Freedman, Michael H., E-mail: [Department of Mathematics, University of California, Santa Barbara, California 93106 (United States); Microsoft Research, Station Q, University of California, Santa Barbara, California 93106 (United States); Sattath, Or, E-mail: [Computer Science Division, University of California, Berkeley, California 94720 (United States); Stong, Richard, E-mail:; Minton, Greg, E-mail: [Center for Communications Research, La Jolla, California 92121 (United States)


    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  1. Quantum Max-flow/Min-cut (United States)

    Cui, Shawn X.; Freedman, Michael H.; Sattath, Or; Stong, Richard; Minton, Greg


    The classical max-flow min-cut theorem describes transport through certain idealized classical networks. We consider the quantum analog for tensor networks. By associating an integral capacity to each edge and a tensor to each vertex in a flow network, we can also interpret it as a tensor network and, more specifically, as a linear map from the input space to the output space. The quantum max-flow is defined to be the maximal rank of this linear map over all choices of tensors. The quantum min-cut is defined to be the minimum product of the capacities of edges over all cuts of the tensor network. We show that unlike the classical case, the quantum max-flow=min-cut conjecture is not true in general. Under certain conditions, e.g., when the capacity on each edge is some power of a fixed integer, the quantum max-flow is proved to equal the quantum min-cut. However, concrete examples are also provided where the equality does not hold. We also found connections of quantum max-flow/min-cut with entropy of entanglement and the quantum satisfiability problem. We speculate that the phenomena revealed may be of interest both in spin systems in condensed matter and in quantum gravity.

  2. Seed quality in informal seed systems

    NARCIS (Netherlands)

    Biemond, P.C.


    Keywords: informal seed systems, seed recycling, seed quality, germination, seed pathology, seed health, seed-borne diseases, mycotoxigenic fungi, Fusarium verticillioides, mycotoxins, Vigna unguiculata, Zea mays, Nigeria.

    Seed is a crucial input for agricultural production.

  3. Enhancement of germination, growth, and photosynthesis in soybean by pre-treatment of seeds with magnetic field. (United States)

    Shine, M B; Guruprasad, K N; Anand, Anjali


    Experiments were conducted to study the effect of static magnetic fields on the seeds of soybean (Glycine max (L.) Merr. var: JS-335) by exposing the seeds to different magnetic field strengths from 0 to 300 mT in steps of 50 mT for 30, 60, and 90 min. Treatment with magnetic fields improved germination-related parameters like water uptake, speed of germination, seedling length, fresh weight, dry weight and vigor indices of soybean seeds under laboratory conditions. Improvement over untreated control was 5-42% for speed of germination, 4-73% for seedling length, 9-53% for fresh weight, 5-16% for dry weight, and 3-88% and 4-27% for vigor indices I and II, respectively. Treatment of 200 mT (60 min) and 150 mT (60 min), which were more effective than others in increasing most of the seedling parameters, were further explored for their effect on plant growth, leaf photosynthetic efficiency, and leaf protein content under field conditions. Among different growth parameters, leaf area, and leaf fresh weight showed maximum enhancement (more than twofold) in 1-month-old plants. Polyphasic chlorophyll a fluorescence (OJIP) transients from magnetically treated plants gave a higher fluorescence yield at the J-I-P phase. The total soluble protein map (SDS-polyacrylamide gel) of leaves showed increased intensities of the bands corresponding to a larger subunit (53 KDa) and smaller subunit (14 KDa) of Rubisco in the treated plants. We report here the beneficial effect of pre-sowing magnetic treatment for improving germination parameters and biomass accumulation in soybean. Copyright © 2011 Wiley-Liss, Inc.

  4. Plant Glycine-Rich Proteins in Stress Response: An Emerging, Still Prospective Story

    Directory of Open Access Journals (Sweden)

    Magdalena Czolpinska


    Full Text Available Seed plants are sessile organisms that have developed a plethora of strategies for sensing, avoiding, and responding to stress. Several proteins, including the glycine-rich protein (GRP superfamily, are involved in cellular stress responses and signaling. GRPs are characterized by high glycine content and the presence of conserved segments including glycine-containing structural motifs composed of repetitive amino acid residues. The general structure of this superfamily facilitates division of GRPs into five main subclasses. Although the participation of GRPs in plant stress response has been indicated in numerous model and non-model plant species, relatively little is known about the key physiological processes and molecular mechanisms in which those proteins are engaged. Class I, II, and IV members are known to be involved in hormone signaling, stress acclimation, and floral development, and are crucial for regulation of plant cells growth. GRPs of class IV [RNA-binding proteins (RBPs] are involved in alternative splicing or regulation of transcription and stomatal movement, seed, pollen, and stamen development; their accumulation is regulated by the circadian clock. Owing to the fact that the overexpression of GRPs can confer tolerance to stress (e.g., some are involved in cold acclimation and may improve growth at low temperatures, these proteins could play a promising role in agriculture through plant genetic engineering. Consequently, isolation, cloning, characterization, and functional validation of novel GRPs expressed in response to the diverse stress conditions are expected to be growing areas of research in the coming years. According to our knowledge, this is the first comprehensive review on participation of plant GRPs in the response to diverse stress stimuli.

  5. FLECH PowerMax Service Requirement Specification

    DEFF Research Database (Denmark)

    It is expected that in the future, ancillary services will be required at distribution level. This work describes how one of these ancillary services, the PowerMax service, must be spec ified within a market framework. The basis of this work is the Flexibility Clearing House (FLE CH) platform...... and the Distribution System Operator (DSO) services defined in [1]. The PowerMax service has been further discussed in [2], and this technical report seeks to clarify the implementation details first discussed in that paper. The aim of the PowerMax service it to relieve congestion issue s in the distribution system...... by establishing a maximum power that a cluster of consumer devices may draw from the syste m. The consumers will receive a payment for providing this service, and the DSO will be able to postpone grid reinfo rcement...

  6. WiMAX network performance monitoring & optimization

    DEFF Research Database (Denmark)

    Zhang, Qi; Dam, H


    frequency reuse, capacity planning, proper network dimensioning, multi-class data services and so on. Furthermore, as a small operator we also want to reduce the demand for sophisticated technicians and man labour hours. To meet these critical demands, we design a generic integrated network performance......In this paper we present our WiMAX (worldwide interoperability for microwave access) network performance monitoring and optimization solution. As a new and small WiMAX network operator, there are many demanding issues that we have to deal with, such as limited available frequency resource, tight...... this integrated network performance monitoring and optimization system in our WiMAX networks. This integrated monitoring and optimization system has such good flexibility and scalability that individual function component can be used by other operators with special needs and more advanced function components can...

  7. Protective effects of dietary glycine and glutamic acid toward the toxic effects of oxidized mustard oil in rabbits. (United States)

    Zeb, Alam; Rahman, Saleem Ur


    The protective role of glycine and glutamic acid against the toxic effects of oxidized oil was studied for the first time. Mustard seed oil was thermally oxidized and characterized for quality characteristics and polyphenolic composition using reversed phase HPLC-DAD. Significant changes in the quality characteristics occurred with thermal oxidation. Fourteen polyphenolic compounds were identified and quantified in oils. Quercetin-3-glucoside, quercetin-3-feruloylsophoroside, catechin, quercetin-3-rutinoside, quercetin-3,7-diglucoside, sinapic acid and vanillic acid hexoside were the major compounds in the fresh and oxidized oil. Oxidized, un-oxidized mustard oils, glycine and glutamic acid were given to rabbits alone or in combination. The biochemical responses were studied in terms of haematological and biochemical parameters and histopathology. It has been observed that biochemical and haematological parameters were adversely affected by the oxidized oil, while supplementation of both amino acids was beneficial in normalizing these parameters. Both amino acids alone have no significant effects, however, oxidized oil affected the liver by enhancing fat accumulation, causing hepatitis, reactive Kupffer cells and necrosis. The co-administration of oxidized oils with glycine or glutamic acid revealed significant recovery of the liver structure and function. In conclusion, glycine or glutamic acid is beneficial and protective against food toxicity and can be considered as an ameliorative food supplement.

  8. Synthesis and distribution of N-benzyloxycarbonyl-[{sup 14}C]-glycine, a lipophilic derivative of glycine

    Energy Technology Data Exchange (ETDEWEB)

    Lambert, D.M.; Gallez, Bernard; Poupaert, J.H. [Universite Catholique de Louvain, Brussels (Belgium). Dept. des Sciences Pharmaceutiques


    N-benzyloxycarbonyl[{sup 14}C]-glycine, a lipophilic derivative of glycine exhibiting anticonvulsant properties, was prepared in one step from [U-{sup 14}C] glycine and benzyl chloroformate in alkali medium. a comparative study of biodistribution was carried on mice between this compound and the parent amino-acid after intravenous administration. Dimethylsulfoxide was used as injection vehicle for N-benzyloxycarbonylglycine. The influence of this injection vehicle was studied comparing glycine injected in a saline solution and glycine co-administered with dimethylsulfoxide. No significant difference was found between these two treatments. Compared to glycine, N-benzyloxycarbonylglycine reached quickly the central nervous system and exhibited an enhanced brain penetration index, 13-fold superior to the parent aminoacid value. (Author).

  9. Dry matter production, seed yield and water use efficiency of some grain legumes grown under different water regimes using nuclear technique

    International Nuclear Information System (INIS)

    Harb, O.M.S.; Salem, M.S.A.; Abdalla, A.A.; Abd-Elwahed, N.M.


    Two field experiments were performed in the experimental farm at the Atomic Energy Authority, Inshas, Egypt, during 2002 and 2004 growing seasons to evaluate the responses of dry matter production, seed yield, water use efficiency and root characteristics for three legumes species, i.e. soybean (Glycine max cv. clark), cowpea (Vigna unguiculata cv. Kafr El-Sheikh) and mungbean (Vigna radiate cv. kawmy 1) grown on a new reclaimed sandy soil under different water regimes. The experiments were laid out using a single line source sprinkler irrigation system which allows a gradual variation of irrigation water, i.e. full irrigation (W1), medium water stress (W2) and severe water stress (W3). The obtained results indicated that normal irrigation (W1) gave the highest above ground dry matter production at flowering stage and total dry matter yield at maturity for the tested legumes. Water stress decreased significantly seed yields for all the tested legume seeds. The seed yield of normal watering condition treatment (W1) out yielded seed yield of those irrigated with medium water stress (W2) and severe water stress (W3). Mungbean and cowpea were more adapted to severe water stress than soybean. Most of the reduction in yield arose from a decrease in pod number. Pod number, number of seeds per pod and the thousand seed weight were significantly affected by water stress. The highest water use efficiency based on seed yield or dry matter yield were obtained by exposing the legume plants to medium water stress (W2), while the lowest value was obtained by exposing the plants to severe water stress (W3). There were significant differences in WUE among the tested species, whereas, mungbean showed the highest value in response to water stress, followed by soybean while cowpea showed the lowest value of water use efficiency. Rooting depth was increased under the severe water stress treatment as compared with well watered condition in the tested legume plants. Mungbean had the

  10. Anatomical, biochemical, and photosynthetic responses to recent allopolyploidy in Glycine dolichocarpa (Fabaceae). (United States)

    Coate, Jeremy E; Luciano, Amelia K; Seralathan, Vasu; Minchew, Kevin J; Owens, Tom G; Doyle, Jeff J


    Previous studies have shown that polyploidy has pronounced effects on photosynthesis. Most of these studies have focused on synthetic or recently formed autopolyploids, and comparatively little is known about the integrated effects of natural allopolyploidy, which involves hybridity and genome doubling and often incorporates multiple genotypes through recurrent origins and lineage recombination. Glycine dolichocarpa (designated T2) is a natural allotetraploid with multiple origins. We quantified 21 anatomical, biochemical, and physiological phenotypes relating to photosynthesis in T2 and its diploid progenitors, G. tomentella (D3) and G. syndetika (D4). To assess how direction of cross affects these phenotypes, we included three T2 accessions having D3-like plastids (T2(D3)) and two accessions having D4-like plastids (T2(D4)). T2 accessions were transgressive (more extreme than any diploid accession) for 17 of 21 phenotypes, and species means differed significantly in T2 vs. both progenitors for four of 21 phenotypes (higher for guard cell length, electron transport capacity [J(max)] per palisade cell, and J(max) per mesophyll cell; lower for palisade cells per unit leaf area). Within T2, four of 21 parameters differed significantly between T2(D3) and T2(D4) (palisade cell volume; chloroplast number and volume per unit leaf area; and J(max) per unit leaf area). T2 is characterized by transgressive photosynthesis-related phenotypes (including an ca. 2-fold increase in J(max) per cell), as well as by significant intraspecies variation correlating with plastid type. These data indicate prominent roles for both nucleotypic effects and cytoplasmic factors in photosynthetic responses to allopolyploidy.

  11. Autodesk 3ds Max 2013 essentials

    CERN Document Server

    Derakhshani, Dariush


    A four-color, task-based Autodesk Official Training Guide covering the core features of 3ds Max Beginning users of this popular 3D animation and effects software will find everything they need for a thorough understanding of the software's key features and functions in this colorful guide. The authors break down the complexities of learning 3D software and get you going right away with interesting, job-related projects. You'll learn the basics of modeling, texturing, animating, lighting, visualization, and visual effects with 3ds Max, exploring the methods and why they are used as they are.

  12. Autodesk 3ds Max 2012 Essentials

    CERN Document Server

    Derakhshani, Randi L


    Get a jump-start on Autodesk 3ds Max 2012 essentials-with the Essentials! The new Essentials books from Sybex are beautiful, task-based, full-color Autodesk Official Training Guides that help you get up to speed on Autodesk topics quickly and easily. Autodesk 3ds Max 2012 Essentials thoroughly covers the fundamentals of this popular 3D animation effects, and visualization software, teaching you what you need to become quickly productive. By following the book's clear explanations, practical tutorials, and step-by-step exercises, you'll cover all the bases. Topics include modeling, animation,

  13. Autodesk 3ds Max 2014 bible

    CERN Document Server

    Murdock, Kelly L


    A complete reference covering the newest version of 3ds Max software Autodesk 3ds Max is the popular 3D modeling, animation, rendering, and compositing software preferred by game developers and graphic designers in film and television. This comprehensive reference not only introduces beginners to this pricey and complex software, but also serves as a reference for experienced users. Packed with expert advice from popular author Kelly Murdock, it begins with a Quick Start tutorial to get you up and running, then continues with more than 150 step-by-step tutorials, advanced coverage, and plenty

  14. seed oils

    African Journals Online (AJOL)

    Timothy Ademakinwa

    processes, production of biodiesel, as lubricant and in deep-frying purposes. They could ... for its juice, nectars and fruit while its seeds are ... Malaysia. The fine seed powder was stored in a plastic container inside a refrigerator at between 4 o.

  15. seed flour

    African Journals Online (AJOL)



    Sep 6, 2010 ... and with a nice taste, used for cooking or as lamp oil. The fatty acid ... Pra seeds were obtained from a local market in Nakhon Si Thammarat. Page 2. Table 1. Proximate composition of pra seed flour. Constituent. Percentage ...

  16. Energy demand in the system sowing in different (Glycine max (L) Merril) systems planting and covering; Demanda energetica na semeadura de soja (Glycine max (L) Merril) em diferentes sistemas de manejo e cobertura do solo

    Energy Technology Data Exchange (ETDEWEB)

    Yano, Elcio Hiroyoshi [Universidade Estadual Paulista (UNESP), Ilha Solteira, SP (Brazil)], E-mail:; Benez, Sergio Hugo; Silva, Paulo Roberto Arbex; Seki, Andre Satoshi [Universidade Estadual Paulista (UNESP), Botucatu, SP (Brazil); Mahl, Denise [Universidade Estadual de Maringa (UEM), Cidade Gaucha, PR (Brazil)


    The difficulty of producing quality forage associated to the high tax of decomposition of the covering killed of the soil and the low operational efficiency of agricultural machines did with that the present work was accomplished in the Experimental Farm Lageado, FCA/ UNESP of the Campus of Botucatu, on an Alsisol, with objective to analyze the energy demand requested in the soy sowing in different systems of handling of the soil (no-tillage, conventional tillage and reduced tillage), on cultural remains of black oats picked for hay, sorghum picked for humid silage of grains and spontaneous vegetation. The used experimental design was a split plot to the factorial type 3x3 with four repetitions and portions of 140 m{sup 2}, Meantime to the results, was ended that the coverings of the soil didn't influence in the values of traction force, potency, displacement speed and increase of the consumption of fuel happened and non accommodation of the turned of the tractor-seeder-fertilizer. Associate to the structural conditions of the soil as absence of traffic of machines and low index of rain fall. (author)

  17. Evaluation of the use of waste of soybeans (Glycine max (L.)) combined with wood waste in making briquet; Avaliacao da utilizacao de residuo de soja (Glycine max (L.)) combinado com residuo de madeira de confeccao de briquetes

    Energy Technology Data Exchange (ETDEWEB)

    Travessini, Rosana; Schutz, Fabiana Costa de Araujo; Anami, Marcelo Hidemassa; Scherpinski, Neusa Idick [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil)], Emails:,,,


    The agricultural industry produces a large amount of which use biomass is an alternative energy economically viable through the compression portion of ligno-cellulose as raw material to replace the wood with an equivalent product, by briquetting. This study aimed to evaluate the technical feasibility of manufacturing fuel briquettes made from soybean residues combined with waste wood. The making of briquettes was performed in the laboratory of Electromechanics of UTFPR campus Medianeira PR. For this analysis, we assessed the content of moisture, ash, fixed carbon content of porosity and higher calorific value. From the results we can conclude that the manufacture of briquettes from lignocellulosic raw materials is an extremely viable energy flashlight for the region of the Bacia do Rio Parana III. (author)

  18. Comportamento de cultivares de soja [Glycine max (L. Merrill] em resposta ao metribuzin aplicado em diferentes doses Response of soybean [Glycine max (L. Merrill] cultivars to rates of metribuzin

    Directory of Open Access Journals (Sweden)

    J.A.R.O. Velloso


    Full Text Available Durante o ano agrícola de 1978/79, foi realizado um experimento a campo, na re gião da Depressão Central do Rio Grande do Sul, com o objetivo de conhecer o comportamento das cultivares de soja BR1, Bragg, Davis, IAS4, IAS5, Paraná e Planalto em relação ao metribuzin aplicado em pré-emergência nas doses de 0, 490 e 980 g/ha. Os efeitos dos tratamentos foram estimados através de avaliação visual de fitotoxicidade, contagem da população de plantas, determinações do peso seco da parte aérea e do número de grãos e obtenção do rendimento de grãos. Para a maioria das variáveis em estudo, constatou-se que ocorreram reduções proporcionais aos acréscimos das doses do herbicida. Os resultados da avaliação visual de fitotoxicidade mostraram que houve diferenças significativas entre os tratamentos de doses, tendo as cultivares Bragg e Davis demonstrado o menor efeito fito-tóxico, enquanto BR1 foi a que apresentou maior grau de injúria. Quanto ao rendimento de grãos alcançado pelas cultivares, foi constatado que Bragg comportou-se como altamente tolerante; BR1 e Davis como moderadamente tolerantes; IAS5 como intermediária e Paraná, Planalto e IAS4 como moderadamente suscetíveis.A field experiment was conducted during the 1978/79 growing season at the Central Depression Region of Rio Grande do Sul, Brazil, in order to evaluate the response soybean cultivars BR1, Bragg, Davis, IAS4, IAS5, Paraná, and Planalto to metribuzin applied in pre-emergence at rates of 0, 490 and 980 g/ha. The effects of the treatments were evaluated through visual rating of phytotoxicity, counting of soybean population, and determinations of dry weight of soybean stems, number of grains per unit area and grain yield. For most of the variables measured there were reductions proportional to increasing rates of metribuzin appl ied. Results of visual evaluation of soybean injury showed statistical differences among rates of the herbicide, being Bragg and Davis the cultivars that presented the lowest injury symptons, while BR1 showed the highest degree of phytotoxicity from metribuzin. For grain yi elds, it was determined that Bragg behaved as a highly tolerant cultivar; BR1 and Davis as moderately tolerants, IAS5 as intermediate; Paraná, Planalto and IAS 4 as moderately susceptibles.

  19. Otimização da aplicação de Fluazifop-P-Butil em pós-emergência na cultura de soja (Glycine max Optimizing Fluazifop-P-Butyl application on postemergence soybeans (Glycine max

    Directory of Open Access Journals (Sweden)

    P.R.F. Lima


    Full Text Available O objetivo deste trabalho foi avaliar a possibilidade de redução da dosagem e do volume de calda em função do horário de aplicação do herbicida fluazifop-p-butil em pós-emergência na cultura de soja, mantendo-se o controle das plantas daninhas e a seletividade para a cultura. O experimento foi conduzido na área experimental da Fazenda de Ensino e Pesquisa da FCAV/UNESP - Jaboticabal, no ano agrícola 1998/99, na cultura de soja, cultivar FT 2009. O delineamento experimental utilizado foi o de blocos ao acaso com 24 tratamentos, sendo 20 dispostos no esquema fatorial 2 x 2 x 5 e quatro testemunhas. Os fatores testados foram: volume de calda (100 e 200 L de calda/ha; dosagens reduzidas -75,2 e 112,8 g de fluazifop-p-butil/ha (respectivamente a 40 e 60% da dosagem recomendada; e horário de aplicação (5, 9, 13, 17 e 21 horas. As testemunhas foram aplicadas com a dosagem recomendada (188,0 g do fluazifop-p-butil/ha e com os volumes de 100 e 200 L de calda/ha, no mato (sem controle das plantas daninhas e "no limpo" (plantas daninhas controladas com enxada manual. As principais espécies de plantas daninhas que emergiram na área experimental foram capim-carrapicho (Cenchrus echinatus, que compunha 60% da comunidade infestante; capim-colchão (Digitaria horizontalis, 10%; e capim-pé-de-galinha (Eleusine indica, 30%. Todas as aplicações do herbicida fluazifop-p-butil, nos horários até as 9 horas e a partir das 17 horas, controlaram eficientemente as três espécies de plantas daninhas e foram seletivas para a cultura de soja. Portanto, o uso do herbicida fluazifop-p-butil pode ser otimizado por meio de reduções na dosagem e no volume de calda em aplicações durante os horários com condições ambientais favoráveis à pulverização.The objective of this study was to evaluate the possibility of reducing spray concentration and volume of Fluazifop-p-butyl applications on postemergence soybeans, while maintaining weed control and growth selectivity. The study was conducted in the experimental area of the Teaching and Research Farm of FCAV/Unesp - Jaboticabal Campus, during the agricultural season of 1998/99, carried out on a crop of soybean cultivar FT 2009. The experimental setup utilized was a randomized block design with 24 treatments, 20 following a factorial scheme 2 x 2 x 5 and 4 control treatments. The factors examined were: spray volume (100 and 200 L ha-1; reduced spray concentration - 75.2 and 112.8 g of fluazifop-p-butyl/ha (40 and 60% of the recommended concentration, respectively; and application schedule (5 A.M., 9 A.M., 1 P.M., 5 P.M. and 9 P.M.. The controls were applications at the recommended concentration (188.0 g fluazifop-p-butyl/ha, using volumes of 100 and 200 L ha-1, and treatments without weed control and weeds controlled with manual hoeing. The main species of weeds that emerged in the experimental area were: Cenchrus echinatus, comprising 60% of the infested sections; Digitaria horizontalis, 10%, and Eleusine indica, 30%. All fluazifop-p-butyl applications made up to 9 A.M. and from 5 P.M. effectively controlled the three species of weeds and provided a selective growth of soybeans. Therefore, the use of fluazifop-p-butyl can be optimized by reducing both the concentration and the volume of the spray for applications times providing favorable conditions for crop dusting.

  20. Acúmulo de massa seca e de macronutrientes por plantas de Glycine max e Solanum americanum Accumulation of dry mass and macronutrients by Glycine max and Solanum americanum plants

    Directory of Open Access Journals (Sweden)

    S. Bianco


    Full Text Available A soja é uma das principais culturas agrícolas do Brasil, sendo a sua produtividade muito influenciada pela competição exercida pelas plantas daninhas. Foram realizados dois experimentos em casa de vegetação, em Jaboticabal, SP, objetivando determinar o acúmulo de massa seca, assim como a distribuição e o acúmulo de macronutrientes em plantas de soja, no período de outubro de 2000 a fevereiro de 2001, e de Solanum americanum, no período de janeiro a maio de 1995. As plantas cresceram em vasos com capacidade de 7 litros, preenchidos com areia de rio lavada e peneirada; elas foram irrigadas diariamente com solução nutritiva. Os tratamentos foram representados pelas épocas de amostragem, realizada a intervalos de 14 dias, iniciando-se 21 dias após a emergência (DAE, até 161 DAE para S. americanum e 119 DAE para soja cv. BR-16 (precoce. O ponto de máximo acúmulo teórico de massa seca deu-se aos 104 DAE para a soja (35,0 g por planta e 143 DAE para S. americanum (179,62 g por planta. Da emergência até 49 e 63 DAE, as folhas apresentaram maior participação no acúmulo de massa seca para soja e S. americanum, respectivamente. Após esses períodos, verificou-se, em ambas as espécies, inversão na representatividade das folhas por caules para a espécie daninha e por caules e, posteriormente, por estruturas reprodutivas, para a cultura. A taxa de absorção diária dos macronutrientes atingiu maiores valores entre 69 e 87 DAE para a soja e entre 105 e 119 DAE para a planta daninha. Considerando a média dos valores de pontos de inflexão observados para a cultura da soja, tem-se que aos 75 DAE uma planta de soja acumula teoricamente 23,9 g de massa seca, 564,4 mg de N, 7,1 mg de P, 490,8 mg de K, 487,0 mg de Ca, 156,6 mg de Mg e 36,0 mg de S. Para o mesmo período, uma planta de S. americanum acumula teoricamente 33,75 g de massa seca, 875,96 mg de N, 88,46 mg de P, 983,54 mg de K, 647,60 mg de Ca, 100,93 mg de Mg e 42,15 mg de S.Soybean is one of the main crops in Brazil, but its productivity is very affected by weed competition. Two experiments were carried out in Jaboticabal, SP, Brazil, under greenhouse conditions to determine the accumulation and distribution of dry mass and macronutrients in soybean cv. BR-16, from October 2000 to February 2001, and Solanum americanum plants, from January to May 1995. Plants were grown in seven liter pots filled with river sand substrate and were daily irrigated with nutrient solution. The treatments were constituted by the times of samplings carried out at 14 day intervals, starting 21 days after emergence (DAE. Soybean evaluation was extended to 161 DAE, while S. americanum was extended to 119 DAE. The point of maximum theoretical accumulation of dry mass in soybean occurred at 104 DAE (35.00 g per plant while for S. americanum, it occurred at 143 DAE (179.62 g per plant. From emergence until 49 and 63 DAE, leaves showed higher participation in dry mass accumulation of soybean and S. americanum, respectively. After these periods, an inversion could be observed, with leaves being surpassed by stems for the weeds, and by stems and later, by reproductive structures, for the crop. Macronutrient uptake rate reached higher values between 69 to 87 DAE for soybean and between 105 to 119 DAE for S. americanum. Considering the mean inflexion point values observed in soybean crop, at 75 DAE, it can be evidenced that one soybean plant theoretically accumulated 23.90 g of dry mass, 564.40 mg of N, 7.10 mg of P, 490.80 mg of K, 487.00 mg of Ca, 156.60 mg of Mg and 36.00 mg of S, while one S. americanum plant theoretically accumulated 33.75 g of dry mass, 875.96 mg of N, 88.46 mg of P, 983.54 mg of K, 647.60 mg of Ca, 100.93 mg of Mg, and 42.15 mg of S.

  1. Carboidratos das fibras de cotilédones e proteínas de produtos derivados de soja (Glycine max (L. Merril Carbohydrates from cotyledon fibers and proteins of soybean (Glycine max (L. Merril derivatives

    Directory of Open Access Journals (Sweden)

    Neusa Fátima Seibel


    Full Text Available Fibras alimentares obtidas de cotilédones de soja original (FAO e micronizada (FAM foram fracionadas e avaliadas quanto a polissacarídeos e monossacarídeos constituintes. O componente majoritário foi a hemicelulose, totalizando 59% em FAO e 51% na FAM, a pectina representou em média 14% e a celulose 8,5%. As duas amostras de fibras apresentaram 17 mg.g-1 de ácidos urônicos e a mesma composição de monossacarídeos, sendo galactose, glicose e arabinose/ramnose os principais componentes. As proteínas de concentrado protéico, farinha desengordurada e fibras alimentares (FAO e FAM foram avaliadas quanto à solubilidade em diferentes solventes (NaCl, água, etanol e NaOH e quanto ao peso molecular. A farinha desengordurada de soja teve a maior parte das proteínas passível de extração com solução salina, e o concentrado protéico e as fibras de cotilédones com solução alcalina. A fração protéica que não foi extraída com nenhum dos quatro solventes utilizados permaneceu no resíduo, o maior percentual estava no concentrado, seguido pela fibra alimentar micronizada e a farinha, já a menor quantidade estava na fibra alimentar original. A eletroforese das proteínas dos quatro ingredientes alimentares mostrou as subunidades que constituem as frações β-conglicinina e glicinina. Bandas com peso molecular próximo aos 30 kDa foram reveladas nas proteínas extraídas das fibras de cotilédones de soja, sendo provavelmente glicoproteínas de parede celular, ricas em hidroxiprolina.Dietary fibers from soybean cotyledons classified as original (ODF and milled (MDF were fractionated and evaluated as to fractions and monosaccharide composition. The major constituent was hemicellulose, 59% in ODF and 51% MDF, pectin was in average 14% and cellulose, 8.5%. Both samples had 17 mg.g-1 uronic acids and the same composition in monosaccharides: galactose, glucose and arabinose/rhamnose, after hydrolysis. Protein fractions extracted from protein concentrate, defatted flour and dietary fibers were evaluated for protein solubility in different solvents (NaCl, water, ethanol and NaOH and for molecular weight. Defatted flour had the highest concentration of proteins soluble in saline solution, while protein concentrate and dietary fibers had the highest protein solubility in alkaline solution. Residual protein, not extracted with any of the solvents used, remained in the insoluble fraction and the highest concentration was in the protein concentrate, followed by MDF, defatted flour and ODF. Protein electrophoresis of the four food ingredients showed subunits that constitute the fractions β-conglycinin and glycinin. Protein extracted from the dietary fibers showed bands with molecular weight of about 30 kDa, probably glycoproteins from cell wall material, rich in hydroxyproline.

  2. Robotic seeding

    DEFF Research Database (Denmark)

    Pedersen, Søren Marcus; Fountas, Spyros; Sørensen, Claus Aage Grøn


    Agricultural robotics has received attention for approximately 20 years, but today there are only a few examples of the application of robots in agricultural practice. The lack of uptake may be (at least partly) because in many cases there is either no compelling economic benefit......, or there is a benefit but it is not recognized. The aim of this chapter is to quantify the economic benefits from the application of agricultural robots under a specific condition where such a benefit is assumed to exist, namely the case of early seeding and re-seeding in sugar beet. With some predefined assumptions...... with regard to speed, capacity and seed mapping, we found that among these two technical systems both early seeding with a small robot and re-seeding using a robot for a smaller part of the field appear to be financially viable solutions in sugar beet production....

  3. The Statue of Liberty Peter Max Style! (United States)

    Cunningham, Kathy


    The author's school is only 30 minutes from New York City, so every year when second-graders study towns and cities, the students do a project based on New York City landmarks. This year was the Statue of Liberty. The author introduced Peter Max's famous Pop art to her students, and explained that, as the art world kept changing, artists decided…

  4. Max Roach's Adventures in Higher Music Education. (United States)

    Hentoff, Nat


    Max Roach and the author discuss Roach's efforts to gain recognition of the complexity and importance of American musical forms, particularly jazz, by American university music departments. In addition, Roach describes his approach to marketing his music, an approach which avoids the economic exploitation often suffered by American jazz musicians.…

  5. Exact simulation of max-stable processes. (United States)

    Dombry, Clément; Engelke, Sebastian; Oesting, Marco


    Max-stable processes play an important role as models for spatial extreme events. Their complex structure as the pointwise maximum over an infinite number of random functions makes their simulation difficult. Algorithms based on finite approximations are often inexact and computationally inefficient. We present a new algorithm for exact simulation of a max-stable process at a finite number of locations. It relies on the idea of simulating only the extremal functions, that is, those functions in the construction of a max-stable process that effectively contribute to the pointwise maximum. We further generalize the algorithm by Dieker & Mikosch (2015) for Brown-Resnick processes and use it for exact simulation via the spectral measure. We study the complexity of both algorithms, prove that our new approach via extremal functions is always more efficient, and provide closed-form expressions for their implementation that cover most popular models for max-stable processes and multivariate extreme value distributions. For simulation on dense grids, an adaptive design of the extremal function algorithm is proposed.

  6. Teaching Financial Literacy with Max and Ruby (United States)

    Brown, Natalya; Ferguson, Kristen


    Teaching financial literacy is important at all stages of life, but is often neglected with elementary students. In this article, the authors describe a strategy for teaching financial literacy using the books about Max and Ruby by Rosemary Wells. These books can help introduce the five key concepts of financial literacy: scarcity, exchange,…

  7. On the spectrum in max algebra

    Czech Academy of Sciences Publication Activity Database

    Müller, Vladimír; Peperko, A.


    Roč. 485, November (2015), s. 250-266 ISSN 0024-3795 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : non-negativ matrices * max algebra * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015

  8. 15N-labelled glycine synthesis

    International Nuclear Information System (INIS)

    Tavares, Claudineia R.O.; Bendassolli, Jose A.; Sant'Ana Filho, Carlos R.; Prestes, Clelber V.; Coelho, Fernando


    This work describes a method for 15 N-isotope-labeled glycine synthesis, as well as details about a recovery line for nitrogen residues. To that effect, amination of α-haloacids was performed, using carboxylic chloroacetic acid and labeled aqueous ammonia ( 15 NH 3 ). Special care was taken to avoid possible 15 NH 3 losses, since its production cost is high. In that respect, although the purchase cost of the 13 N-labeled compound (radioactive) is lower, the stable tracer produced constitutes an important tool for N cycling studies in living organisms, also minimizing labor and environmental hazards, as well as time limitation problems in field studies. The tests were carried out with three replications, and variable 15 NH 3(aq) volumes in the reaction were used (50, 100, and 150 mL), in order to calibrate the best operational condition; glycine masses obtained were 1.7, 2, and 3.2 g, respectively. With the development of a system for 15 NH 3 recovery, it was possible to recover 71, 83, and 87% of the ammonia initially used in the synthesis. With the required adaptations, the same system was used to recover methanol, and 75% of the methanol initially used in the amino acid purification process were recovered. (author)

  9. Seed regulations and local seed systems

    NARCIS (Netherlands)

    Louwaars, N.


    Seed regulations have been introduced in most countries based on the development of formal seed production. Concerns about seed quality and about the varietal identity of the seeds have commonly led to seed laws. However, formal regulations are often inappropriate for informal seed systems, which

  10. Evaluation of constitutive iron reductase (AtFRO2) expression on mineral accumulation and distribution in soybean (Glycine max L.) (United States)

    Iron is an important micronutrient in human and plant nutrition. Adequate iron nutrition during crop production is central for assuring appropriate iron concentrations in the harvestable organs, for human food or animal feed. The whole-plant movement of iron involves several processes, including the...

  11. Signatures of soft sweeps across the Dt1 locus underlying determinate growth habit in soya bean [Glycine max (L.) Merr.]. (United States)

    Zhong, Limei; Yang, Qiaomei; Yan, Xin; Yu, Chao; Su, Liu; Zhang, Xifeng; Zhu, Youlin


    Determinate growth habit is an agronomically important trait associated with domestication in soya bean. Previous studies have demonstrated that the emergence of determinacy is correlated with artificial selection on four nonsynonymous mutations in the Dt1 gene. To better understand the signatures of the soft sweeps across the Dt1 locus and track the origins of the determinate alleles, we examined patterns of nucleotide variation in Dt1 and the surrounding genomic region of approximately 800 kb. Four local, asymmetrical hard sweeps on four determinate alleles, sized approximately 660, 120, 220 and 150 kb, were identified, which constitute the soft sweeps for the adaptation. These variable-sized sweeps substantially reflected the strength and timing of selection and indicated that the selection on the alleles had been completed rapidly within half a century. Statistics of EHH, iHS, H12 and H2/H1 based on haplotype data had the power to detect the soft sweeps, revealing distinct signatures of extensive long-range LD and haplotype homozygosity, and multiple frequent adaptive haplotypes. A haplotype network constructed for Dt1 and a phylogenetic tree based on its extended haplotype block implied independent sources of the adaptive alleles through de novo mutations or rare standing variation in quick succession during the selective phase, strongly supporting multiple origins of the determinacy. We propose that the adaptation of soya bean determinacy is guided by a model of soft sweeps and that this model might be indispensable during crop domestication or evolution. © 2017 The Authors. Molecular Ecology Published by John Wiley & Sons Ltd.

  12. Growth and stress response in Arabidopsis thaliana, Nicotiana benthamiana, Glycine max, Solanum tuberosum and Brassica napus cultivated under polychromatic LEDs

    Czech Academy of Sciences Publication Activity Database

    Janda, Martin; Navrátil, Oldřich; Haisel, Daniel; Jindřichová, Barbora; Fousek, Jan; Burketová, Lenka; Čeřovská, Noemi; Moravec, Tomáš


    Roč. 11, MAY 3 (2015) ISSN 1746-4811 R&D Projects: GA ČR GA13-26798S; GA ČR(CZ) GAP501/12/1942; GA ČR(CZ) GAP501/12/1761; GA ČR(CZ) GA15-10768S Institutional support: RVO:61389030 Keywords : LED * Fluorescent tubes * Plant physiology Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 3.449, year: 2015

  13. Metal pollution (Cd, Pb, Zn, and As) in agricultural soils and soybean, Glycine max, in southern China. (United States)

    Zhao, Yunyun; Fang, Xiaolong; Mu, Yinghui; Cheng, Yanbo; Ma, Qibin; Nian, Hai; Yang, Cunyi


    Crops produced on metal-polluted agricultural soils may lead to chronic toxicity to humans via the food chain. To assess metal pollution in agricultural soils and soybean in southern China, 30 soybean grain samples and 17 soybean-field soil samples were collected from 17 sites in southern China, and metal concentrations of samples were analyzed by graphite furnace atomic absorption spectrophotometer. The integrated pollution index was used to evaluate if the samples were contaminated by Cd, Pb, Zn and As. Results showed that Cd concentration of 12 samples, Pb concentration of 2 samples, Zn concentration of 2 samples, and As concentrations of 2 samples were above the maximum permissible levels in soils. The integrated pollution index indicated that 11 of 17 soil samples were polluted by metals. Metal concentrations in soybean grain samples ranged from 0.11 to 0.91 mg kg(-1) for Cd; 0.34 to 2.83 mg kg(-1) for Pb; 42 to 88 mg kg(-1) for Zn; and 0.26 to 5.07 mg kg(-1) for As, which means all 30 soybean grain samples were polluted by Pb, Pb/Cd, Cd/Pb/As or Pb/As. Taken together, our study provides evidence that metal pollution is an important concern in agricultural soils and soybeans in southern China.

  14. Germinaton performance of selected local soybean (Glycine max (L.) Merrills) cultivars during drought stress induced by Polyethylene Glycol (PEG) (United States)

    Pane, R. F.; Damanik, R. I.; Khardinata, E. H.


    Drought stress is one of the factors that can decreased growth and production, so that required a variety that has the ability to sustain cellular metabolism, and growth during the stress. This research was aimed to investigated the involvement of germination performance invitro of five local soybean cultivars, Grobogan, Kaba, Anjasmoro, Argomulyo, and Dering to drought stress induced by polyethylene glycol (PEG) 6000 (0%, 2%, 4%, and 6%). The measurable seedling traits as the day appearance of shoots and roots, total of leaves, shoot length, root length, fresh plant weight, dry plant weight, fresh root weight, and dry root weight under control as well as water stress condition were recorded. The experiment units were arranged in factorial completely randomized design with four replications. The result showed that the value for most parameters was recorded highest for Argomulyo cultivar compared with Dering cultivar which is known to be tolerant to drought. In terms of roots performance, Grobogan and Argomulyo cultivars produced the longest and heaviest of roots, while Grobogan cultivar had no significant different for root length compared with control. In conclusion, the root length and fresh weight root parameters can be used as quick criteria for drought tolerance.

  15. Influences of Soaking Temperature and Storage Conditions on Hardening of Soybeans (Glycine max) and Red Kidney Beans (Phaseolus vulgaris). (United States)

    Koriyama, Takako; Sato, Yoko; Iijima, Kumiko; Kasai, Midori


    The influences of soaking treatment and storage conditions on the softening of cooked beans, namely, soybeans and red kidney beans, were investigated. It was revealed that the softening of fresh soybeans and fresh red kidney beans was suppressed during subsequent boiling after soaking treatment at 50 and 60 °C. Furthermore, in treated aged soybeans and red kidney beans that were subjected to storage at 30 °C/75% relative humidity for 6 mo and soaking treatment at 50 to 60 °C, the hardness during cooking was further amplified. This suggested that the mechanism of softening suppression differs depending on the influences of soaking and storage. Analysis of the pectin fraction in alcohol insoluble solid showed insolubilization of metal ions upon storage at high temperature and high humidity in both soybeans and red kidney beans, which suggests interaction between Ca ions and hemicellulose or cellulose as cell wall polysaccharides. The results of differential scanning calorimetry (DSC) showed that aged soybeans exhibited a shift in the thermal transition temperature of glycinin-based protein to a higher temperature compared with fresh soybeans. From the results of DSC and scanning electron microscopy for aged red kidney beans, damaged starch is not conspicuous in the raw state after storage but is abundant upon soaking treatment. As for the influence of soaking at 60 °C, it can be suggested that its influence on cell wall crosslinking was large in soybeans and red kidney beans in both a fresh state and an aged state. © 2017 Institute of Food Technologists®.

  16. The large soybean (Glycine max) WRKY TF family expanded by segmental duplication events and subsequent divergent selection among subgroups. (United States)

    Yin, Guangjun; Xu, Hongliang; Xiao, Shuyang; Qin, Yajuan; Li, Yaxuan; Yan, Yueming; Hu, Yingkao


    WRKY genes encode one of the most abundant groups of transcription factors in higher plants, and its members regulate important biological process such as growth, development, and responses to biotic and abiotic stresses. Although the soybean genome sequence has been published, functional studies on soybean genes still lag behind those of other species. We identified a total of 133 WRKY members in the soybean genome. According to structural features of their encoded proteins and to the phylogenetic tree, the soybean WRKY family could be classified into three groups (groups I, II, and III). A majority of WRKY genes (76.7%; 102 of 133) were segmentally duplicated and 13.5% (18 of 133) of the genes were tandemly duplicated. This pattern was not apparent in Arabidopsis or rice. The transcriptome atlas revealed notable differential expression in either transcript abundance or in expression patterns under normal growth conditions, which indicated wide functional divergence in this family. Furthermore, some critical amino acids were detected using DIVERGE v2.0 in specific comparisons, suggesting that these sites have contributed to functional divergence among groups or subgroups. In addition, site model and branch-site model analyses of positive Darwinian selection (PDS) showed that different selection regimes could have affected the evolution of these groups. Sites with high probabilities of having been under PDS were found in groups I, II c, II e, and III. Together, these results contribute to a detailed understanding of the molecular evolution of the WRKY gene family in soybean. In this work, all the WRKY genes, which were generated mainly through segmental duplication, were identified in the soybean genome. Moreover, differential expression and functional divergence of the duplicated WRKY genes were two major features of this family throughout their evolutionary history. Positive selection analysis revealed that the different groups have different evolutionary rates. Together, these results contribute to a detailed understanding of the molecular evolution of the WRKY gene family in soybean.

  17. Ectopic phytocystatin expression increases nodule numbers and influences the responses of soybean (Glycine max) to nitrogen deficiency. (United States)

    Quain, Marian D; Makgopa, Matome E; Cooper, James W; Kunert, Karl J; Foyer, Christine H


    Cysteine proteases and cystatins have many functions that remain poorly characterised, particularly in crop plants. We therefore investigated the responses of these proteins to nitrogen deficiency in wild-type soybeans and in two independent transgenic soybean lines (OCI-1 and OCI-2) that express the rice cystatin, oryzacystatin-I (OCI). Plants were grown for four weeks under either a high (5 mM) nitrate (HN) regime or in the absence of added nitrate (LN) in the absence or presence of symbiotic rhizobial bacteria. Under the LN regime all lines showed similar classic symptoms of nitrogen deficiency including lower shoot biomass and leaf chlorophyll. However, the LN-induced decreases in leaf protein and increases in root protein tended to be smaller in the OCI-1 and OCI-2 lines than in the wild type. When LN-plants were grown with rhizobia, OCI-1 and OCI-2 roots had significantly more crown nodules than wild-type plants. The growth nitrogen regime had a significant effect on the abundance of transcripts encoding vacuolar processing enzymes (VPEs), LN-dependent increases in VPE2 and VPE3 transcripts in all lines. However, the LN-dependent increases of VPE2 and VPE3 transcripts were significantly lower in the leaves of OCI-1 and OCI-2 plants than in the wild type. These results show that nitrogen availability regulates the leaf and root cysteine protease, VPE and cystatin transcript profiles in a manner that is in some cases influenced by ectopic OCI expression. Moreover, the OCI-dependent inhibition of papain-like cysteine proteases favours increased nodulation and enhanced tolerance to nitrogen limitation, as shown by the smaller LN-dependent decreases in leaf protein observed in the OCI-1 and OCI-2 plants relative to the wild type. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Evaluación agronómica de germoplasma de soya (Glycine max L. Merr. En Cuba

    Directory of Open Access Journals (Sweden)

    Zoila Fundora


    Full Text Available La caracterización y evaluación de las colecciones de soya de que se dispone en Cuba, es uno de los pasos iniciales en la potenciación del germoplasma de esta especie con vistas a su utilización en programas de desarrollo y/o mejoramiento. En el presente trabajo se estudiaron 50 cultivares procedentes de la colección cubana de esta especie, los cuales fueron clasificados preliminarmente, considerando los atributos de mayor variabilidad. Los cultivares fueron agrupados como precoces, intermedios y tardíos, de acuerdo a los días a floración. Se destacan los cultivares más promisorios en el grupo de los precoces y en el grupo de los intermedios + los tardíos respectivamente, recomendándose para su inclusión en los programas de mejoramiento de esta especie.

  19. Potential production and growth analysis of local variety and Americana variety of soybean (Glycine max (L) Merril)

    International Nuclear Information System (INIS)

    Sumakud, M.Y.M.A.


    Soybean needs high radiation intensity for photosynthesis process; therefore 100 percent of the sunlight are needed. Due to increasing the soybean production, the environment factor such as climate, soil and management are needed. One