Heterologous expression of Hordeum vulgare cysteine protease in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B
Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w......Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp.
Indian Academy of Sciences (India)
Genetic diversity in barley landraces (Hordeum vulgare L. subsp. vulgare) originated from Crescent Fertile region as detected by seed storage proteins. RIM MZID FARHAT CHIBANI RAYDA BEN AYED MOHSEN HANANA JOELLE BREIDI RABIH KABALAN SAMIH EL-HAJJ HASSAN MACHLAB AHMED REBAI LAMIS ...
Wang, Qifei; Sun, Genlou; Ren, Xifeng; Wang, Jibin; Du, Binbin; Li, Chengdao; Sun, Dongfa
2017-11-07
Seedling characteristics play significant roles in the growth and development of barley (Hordeum vulgare L.), including stable stand establishment, water and nutrients uptake, biotic resistance and abiotic stresses, and can influence yield and quality. However, the genetic mechanisms underlying seedling characteristics in barley are largely unknown and little research has been done. In the present work, 21 seedling-related characteristics are assessed in a barley double haploid (DH) population, grown under hydroponic conditions. Of them, leaf age (LAG), shoot height (SH), maximum root length (MRL), main root number (MRN) and seedling fresh weight (SFW) were investigated at the 13th, 20th, 27th, and 34th day after germination. The objectives were to identify quantitative trait loci (QTLs) underlying these seedling characteristics using a high-density linkage map and to reveal the QTL expression pattern by comparing the QTLs among four different seedling growth stages. A total of 70 QTLs were distributed over all chromosomes except 4H, and, individually, accounted for 5.01%-77.78% of phenotypic variation. Out of the 70 detected QTLs, 23 showed a major effect on 14 seedling-related characteristics. Ten co-localized chromosomal regions on 2H (five regions), 3H (two regions) and 7H (three regions) involved 39 QTLs (55.71%), each simultaneously influenced more than one trait. Meanwhile, 9 co-localized genomic regions involving 22 QTLs for five seedling characteristics (LAG, SH, MRL, MRN and SFW) at the 13th, 20th, 27th and 34th day-old seedling were common for two or more growth stages of seedling. QTL in the vicinity of Vrs1 locus on chromosome 2H with the favorable alleles from Huadamai 6 was found to have the largest main effects on multiple seedling-related traits. Six QTL cluster regions associated with 16 seedling-related characteristics were observed on chromosome 2H, 3H and 7H. The majority of the 29 regions identified for five seedling characteristics were
Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.
Directory of Open Access Journals (Sweden)
Weiwei Deng
Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.
Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis
DEFF Research Database (Denmark)
Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke
1984-01-01
The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...
Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Bothmer, R. von; Claesson, L.; Flink, J.
1989-01-01
A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...
Molecular characterization of barley ( Hordeum vulgare L.) genome ...
African Journals Online (AJOL)
The present work aimed to select drought tolerant barley (Hordeum vulgare L.) cultivars through identification of stress genes responsible for drought tolerance. Several barley genotypes were tested for drought resistance using specific molecular markers, nine out of all the genotypes were chosen for this study; five out of ...
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.
1986-01-01
Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....
Hordeum vulgare cysteine protease heterologous expressed in yeast
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach
, (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...
Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum
Lange, W.
1969-01-01
Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties arose in the cross: seed abortion necessitating
Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...
African Journals Online (AJOL)
User
2015-06-03
Jun 3, 2015 ... were kernel weight per spike and thousand seed weight. ...... Ser. Biol. 17:65-70. CSA (2010) Area and production of crops (private peasant holdings, ... (Hordeum vulgare L.) landraces in variable production system,. Ethiopia.
Evaluation of genetic diversity in barley ( Hordeum vulgare L.) from ...
African Journals Online (AJOL)
This study aimed to determine the genetic diversity and relationships among barley varieties (Hordeum vulgare L.) growing at Wollo Highland areas by using hordein and agro-morphological traits. Twenty (20) varieties were laid down in randomized complete block design (RCBD) design with three replications; they were ...
DEFF Research Database (Denmark)
Jensen, J.; Linde-Laursen, Ib
1984-01-01
In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...
Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)
DEFF Research Database (Denmark)
Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib
1986-01-01
The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...
Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)
DEFF Research Database (Denmark)
Podzimska, Dagmara Agata
, such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...
Geras'kin, Stanislav A; Oudalova, Alla A; Kim, Jin Kyu; Dikarev, Vladimir G; Dikareva, Nina S
2007-03-01
The induction of chromosome aberrations in Hordeum vulgare germinated seeds was studied after ionizing irradiation with doses in the range of 10-1,000 mGy. The relationship between the frequency of aberrant cells and the absorbed dose was found to be nonlinear. A dose-independent plateau in the dose range from about 50 to 500 mGy was observed, where the level of cytogenetic damage was significantly different from the spontaneous level. The comparison of the goodness of the experimental data fitting with mathematical models of different complexity, using the most common quantitative criteria, demonstrated the advantage of a piecewise linear model over linear and polynomial models in approximating the frequency of cytogenetical disturbances. The results of the study support the hypothesis of indirect mechanisms of mutagenesis induced by low doses. Fundamental and applied implications of these findings are discussed.
DEFF Research Database (Denmark)
Bothmer, R. von; Bengtsson, M.; Flink, J.
1988-01-01
Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were...
NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence
DEFF Research Database (Denmark)
Wagner, Michael
parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...
Informed collecting, conservation, monitoring and utilization of genetic diversity require knowledge of the distribution and structure of genetic variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic...
Directory of Open Access Journals (Sweden)
Lucie Maršálová
2016-08-01
Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H
Directory of Open Access Journals (Sweden)
Bouhaouel, I.
2016-01-01
Full Text Available Description of the subject. The present study focuses on the description of the allelopathic interactions between wild and crop species that may occur in a given ecosystem. Objectives. The objective is the evaluation of the allo- and autoinhibition activity of root exudates of barley (Hordeum vulgare L. subsp. vulgare and great brome (Bromus diandrus Roth. seedlings by water-soluble allelochemicals. Method. The allelopathic activities of five Tunisian barley genotypes (modern varieties and landraces, one Saudi Arabian barley landrace and great brome were assessed using a modified laboratory bioassay named "seedling-after-seedling agar method". Results. The barley or the great brome reduced, to a greater extent, the root growth compared to the shoot growth of receiver species. The response of the root system architecture of the great brome towards barley root exudates was studied in detail. All the measured root traits were highly sensitive to the presence of barley. In our conditions, the allelopathic activity of barley root exudates had no apparent relationship with the size of the root and a prominent action of genetic determinants in the allelopathic potential between genotypes is proposed. The alloinhibitory activity of barley or great brome root exudates deferred between the receiver species but was always higher than the autoinhibition potential. The autoinhibition in barley proved to depend on whether the genotypes used as donor and receiver are identical or different, suggesting a specific interaction of allelochemicals with the receiver plant. These molecules seem to be the main actors in the allelopathic barley potential as external factors such variations of pH have no evident relevance in the inhibition process. Conclusions. Barley and great brome exude molecules in their surroundings. This affects the growth of the receiver plants, suggesting that these compounds might contribute to the plant community dynamics.
DEFF Research Database (Denmark)
Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine
2009-01-01
to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The dimeric protein...
DEFF Research Database (Denmark)
Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik
2016-01-01
Barley (Hordeum vulgare L.) produces five leucine-derived hydroxynitrile glucosides (HNGs), of which only epiheterodendrin is a cyanogenic glucoside. The four non-cyanogenic HNGs are the β-HNG epidermin and the γ-HNGs osmaronin, dihydroosmaronin and sutherlandin. By analyzing 247 spring barley...
DEFF Research Database (Denmark)
Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.
1993-01-01
The plasma membrane bound beta-1,3-D-glucan (callose) synthase. assumed to be involved in the resistance to the powdery mildew fungus (Erysiphe graminis f.sp. hordei), was partially purified from a microsomal fraction of green barley leaves (Hordeum vulgare L.). Plasma membranes were enriched...
Saski, Christopher; Lee, Seung-Bum; Fjellheim, Siri; Guda, Chittibabu; Jansen, Robert K.; Luo, Hong; Tomkins, Jeffrey; Rognli, Odd Arne; Clarke, Jihong Liu
2009-01-01
Comparisons of complete chloroplast genome sequences of Hordeum vulgare, Sorghum bicolor and Agrostis stolonifera to six published grass chloroplast genomes reveal that gene content and order are similar but two microstructural changes have occurred. First, the expansion of the IR at the SSC/IRa boundary that duplicates a portion of the 5′ end of ndhH is restricted to the three genera of the subfamily Pooideae (Agrostis, Hordeum and Triticum). Second, a 6 bp deletion in ndhK is shared by Agrostis, Hordeum, Oryza and Triticum, and this event supports the sister relationship between the subfamilies Erhartoideae and Pooideae. Repeat analysis identified 19–37 direct and inverted repeats 30 bp or longer with a sequence identity of at least 90%. Seventeen of the 26 shared repeats are found in all the grass chloroplast genomes examined and are located in the same genes or intergenic spacer (IGS) regions. Examination of simple sequence repeats (SSRs) identified 16–21 potential polymorphic SSRs. Five IGS regions have 100% sequence identity among Zea mays, Saccharum officinarum and Sorghum bicolor, whereas no spacer regions were identical among Oryza sativa, Triticum aestivum, H. vulgare and A. stolonifera despite their close phylogenetic relationship. Alignment of EST sequences and DNA coding sequences identified six C–U conversions in both Sorghum bicolor and H. vulgare but only one in A. stolonifera. Phylogenetic trees based on DNA sequences of 61 protein-coding genes of 38 taxa using both maximum parsimony and likelihood methods provide moderate support for a sister relationship between the subfamilies Erhartoideae and Pooideae. PMID:17534593
Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan.
Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M
2016-01-01
Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum.
International Nuclear Information System (INIS)
Bornman, J.F.; Bjoern, L.O.; Bornman, C.H.
1982-01-01
Estimates of viability as measured by vital straining with fluorescein diacetate were carried out on freshly isolated and partially aged (16-hour-old) Beta vulgaris and Hordeum vulgare mesophyll protoplasts following irradiation with UV-B. Damage to the photosynthetic system by UV-B was determined by delayed light emission (DLE). In the case of freshly isolated Protoplasts Beta was approximately 30% more susceptible than Hordeum following 3h irradiation, with viability decreasing from 90% to 40%. After storage of protoplasts on ice for 16 h UV-B radiation markedly depressed viability in both species, but in the case of Hordeum there was a substantial initial loss of nearly 70% in viability over the first hour of irradiation. The first 10 min of UV-B radiation decreased the intensity of DLE by 40% without appreciably affecting the decay rate. Longer treatment times did not give a proportional effect so that even after 60 min of UV-B the inhibition did not exceed 60%. This suggested that although the enzyme system responsible for FDA hydrolysis may be partially inactivated (viability was 75-80% as compared with 90% in the control), the UV-B did not penetrate the innermost parts of the chloroplasts, but left some thylakoids undamaged. (orig.)
International Nuclear Information System (INIS)
Cowan, A.K.; Railton, I.D.
1987-01-01
Excised light-grown leaves and etiolated leaves of Hordeum vulgare L. cv Dyan catabolized applied (+/-)-[2- 14 C]abscisic acid ([+/-]-[2- 14 C]ABA) to phaseic acid (PA), dihydrophaseic acid (DPA), and 2'-hydroxymethyl ABA (2'-HMABA). Identification of these catabolites was made by microchemical methods and by combined capillary gas chromatography-mass spectrometry (GC-MS) following high dose feeds of nonlabeled substrate to leaves. Circular dichroism analysis revealed that 2'-HMABA was derived from the (-) enantiomer of ABA. Refeeding studies were used to confirm the catabolic route. The methyl ester of (+/-)-[2 14 C]-ABA was hydrolyzed efficiently by light-grown leaves of H. vulgare. Leaf age played a significant role in (+/-)-ABA catabolism, with younger leaves being less able than their older counterparts to catabolize this compound. The catabolism of (+/-)-ABA was inhibited markedly in water-stressed Hordeum leaves which was characterized by a decreased incorporation of label into 2'-HMABA, DPA, and conjugates. The specific, mixed function oxidase inhibitor, ancymidol, did not inhibit, dramatically (+/-)-ABA catabolism in light-grown leaves of Hordeum whereas the 80s ribosome, translational inhibitor, cycloheximide, inhibited this process markedly. The 70s ribosome translational inhibitors, lincomycin and chloramphenicol, were less effective than cycloheximide in inhibiting (+/-)-ABA catabolism, implying that cytoplasmic protein synthesis is necessary for the catabolism of (+/-)-ABA in Hordeum leaves whereas chloroplast protein synthesis plays only a minor role. This further suggests that the enzymes involved in (+/-)-ABA catabolism in this plant are cytoplasmically synthesized and are turned-over rapidly, although the enzyme responsible for glycosylating (+/-)-ABA itself appeared to be stable
Zhou, Hong; Liu, Shihang; Liu, Yujiao; Liu, Yaxi; You, Jing; Deng, Mei; Ma, Jian; Chen, Guangdeng; Wei, Yuming; Liu, Chunji; Zheng, Youliang
2016-09-13
Kernel length is an important target trait in barley (Hordeum vulgare L.) breeding programs. However, the number of known quantitative trait loci (QTLs) controlling kernel length is limited. In the present study, we aimed to identify major QTLs for kernel length, as well as putative candidate genes that might influence kernel length in wild barley. A recombinant inbred line (RIL) population derived from the barley cultivar Baudin (H. vulgare ssp. vulgare) and the long-kernel wild barley genotype Awcs276 (H.vulgare ssp. spontaneum) was evaluated at one location over three years. A high-density genetic linkage map was constructed using 1,832 genome-wide diversity array technology (DArT) markers, spanning a total of 927.07 cM with an average interval of approximately 0.49 cM. Two major QTLs for kernel length, LEN-3H and LEN-4H, were detected across environments and further validated in a second RIL population derived from Fleet (H. vulgare ssp. vulgare) and Awcs276. In addition, a systematic search of public databases identified four candidate genes and four categories of proteins related to LEN-3H and LEN-4H. This study establishes a fundamental research platform for genomic studies and marker-assisted selection, since LEN-3H and LEN-4H could be used for accelerating progress in barley breeding programs that aim to improve kernel length.
Rankl, Simone
2017-01-01
N-Acyl-D/L-homoserine lactones (AHLs) are produced as microbial signaling compounds during bacterial intra- and inter-specific communication in the rhizosphere. Thus, plants are naturally exposed to these compounds and respond with tissue-specific reactions. In the present study the impact of AHLs on the monocot barley (Hordeum vulgare L.) was investigated. The treatment with C8- and C12- homoserine lactones (HSL) resulted in root and shoot biomass gain as well as in the formation of lat...
DEFF Research Database (Denmark)
Backes, G.; Madsen, L.H.; Jaiser, H.
2003-01-01
The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... (Hordeum vulgare ssp. spontaneum) line "1B-87" originating from Israel. The population consisted of 121 recombinant inbred lines. Resistance against leaf rust and powdery mildew was tested on detached leaves. The leaf rust isolate "I-80" and the powdery mildew isolate "Va-4", respectively, were used...
Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm
International Nuclear Information System (INIS)
Tyagi, K.; Park, M.R.; Lee, H.J.; Lee, C.A.; Rehman, S.; Steffenson, B.; Lee, K.J.; Yun, S.J.
2011-01-01
Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)
Directory of Open Access Journals (Sweden)
C.F. Azevedo
2012-01-01
Full Text Available A erva-doce, Foeniculum vulgare Mill. (Apiaceae, é uma erva entouceirada, aromática que apresenta propriedades condimentares e medicinais; tem origem Européia e é amplamente cultivada em todo o Brasil. Devido à deficiência de informações relativas à organização estrutural de plântulas de espécies medicinais, o presente estudo teve como objetivo fornecer informações sobre a anatomia e o desenvolvimento de plântulas de F. vulgare. As sementes de erva-doce foram semeadas em areia e mantidas em casa de vegetação por 25 dias, sendo realizadas regas diárias. Foram selecionadas plântulas normais e de padrão uniforme, que tiveram raiz, zona de transição, caule, cotilédones e primeiras folhas seccionados à mão livre. Este material foi corado e montado em lâminas com glicerina para observação em microscópio. Em todos os órgãos da plântula de erva-doce a epiderme é unisseriada, cuticularizada e com estômatos; sendo que as duas últimas estruturas não são encontradas na raiz, porém esta apresenta pêlos unicelulares e cônicos. Os cotilédones e as folhas apresentam funções fotossintéticas e nutricionais, indicadas pela presença de grande quantidade de estômatos, cloroplastos e amido. A caracterização anatômica de plântulas de F. vulgare auxilia na identificação da espécie e no conhecimento da organização celular, fornecendo informações que auxiliam em estudos fisiológicos, taxonômicos e ecológicos.Fennel, Foeniculum vulgare Mill. (Apiaceae, is a forming clumps herb and presents aromatic, medicinal and condimental properties. It has European origin and is widely cultivated and used in Brazil. Due to lack of information concerning the structural organization of seedlings of medicinal species, this study aimed to provide information about the anatomy and development of F. vulgare seedlings. The seeds fennel was sowed in sand and maintained in greenhouse for 25 days, with daily waterings. Were selected
Directory of Open Access Journals (Sweden)
Pavlova Violetta Aleksandrovna
2014-04-01
Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.
Genome-Wide Association Mapping of Stem Rust Resistance in Hordeum vulgare subsp. spontaneum.
Sallam, Ahmad H; Tyagi, Priyanka; Brown-Guedira, Gina; Muehlbauer, Gary J; Hulse, Alex; Steffenson, Brian J
2017-10-05
Stem rust was one of the most devastating diseases of barley in North America. Through the deployment of cultivars with the resistance gene Rpg1 , losses to stem rust have been minimal over the past 70 yr. However, there exist both domestic (QCCJB) and foreign (TTKSK aka isolate Ug99) pathotypes with virulence for this important gene. To identify new sources of stem rust resistance for barley, we evaluated the Wild Barley Diversity Collection (WBDC) (314 ecogeographically diverse accessions of Hordeum vulgare subsp. spontaneum ) for seedling resistance to four pathotypes (TTKSK, QCCJB, MCCFC, and HKHJC) of the wheat stem rust pathogen ( Puccinia graminis f. sp. tritici , Pgt ) and one isolate (92-MN-90) of the rye stem rust pathogen ( P. graminis f. sp. secalis , Pgs ). Based on a coefficient of infection, the frequency of resistance in the WBDC was low ranging from 0.6% with HKHJC to 19.4% with 92-MN-90. None of the accessions was resistant to all five cultures of P. graminis A genome-wide association study (GWAS) was conducted to map stem rust resistance loci using 50,842 single-nucleotide polymorphic markers generated by genotype-by-sequencing and ordered using the new barley reference genome assembly. After proper accounting for genetic relatedness and structure among accessions, 45 quantitative trait loci were identified for resistance to P. graminis across all seven barley chromosomes. Three novel loci associated with resistance to TTKSK, QCCJB, MCCFC, and 92-MN-90 were identified on chromosomes 5H and 7H, and two novel loci associated with resistance to HKHJC were identified on chromosomes 1H and 3H. These novel alleles will enhance the diversity of resistance available for cultivated barley. Copyright © 2017 Sallam et al.
Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences
DEFF Research Database (Denmark)
Svitashev, S.; Bryngelsson, T.; Vershinin, A.
1994-01-01
A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...
Zinc blotting assay for detection of zinc binding prolamin in barley (Hordeum vulgare) grain
DEFF Research Database (Denmark)
Uddin, Mohammad Nasir; Nielsen, Ane Langkilde-Lauesen; Vincze, Eva
2014-01-01
In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc......-binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...
Qiu, Hao; Versieren, Liske; Rangel, Georgina Guzman; Smolders, Erik
2016-01-19
Soil contamination with copper (Cu) is often associated with zinc (Zn), and the biological response to such mixed contamination is complex. Here, we investigated Cu and Zn mixture toxicity to Hordeum vulgare in three different soils, the premise being that the observed interactions are mainly due to effects on bioavailability. The toxic effect of Cu and Zn mixtures on seedling root elongation was more than additive (i.e., synergism) in soils with high and medium cation-exchange capacity (CEC) but less than additive (antagonism) in a low-CEC soil. This was found when we expressed the dose as the conventional total soil concentration. In contrast, antagonism was found in all soils when we expressed the dose as free-ion activities in soil solution, indicating that there is metal-ion competition for binding to the plant roots. Neither a concentration addition nor an independent action model explained mixture effects, irrespective of the dose expressions. In contrast, a multimetal BLM model and a WHAM-Ftox model successfully explained the mixture effects across all soils and showed that bioavailability factors mainly explain the interactions in soils. The WHAM-Ftox model is a promising tool for the risk assessment of mixed-metal contamination in soils.
Directory of Open Access Journals (Sweden)
Z Amini
2013-08-01
Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P
Powdery Mildew Resistance in 268 Entries of Hordeum vulgare
DEFF Research Database (Denmark)
Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J
1984-01-01
A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...
Bengtsson, Therése; Åhman, Inger; Manninen, Outi; Reitan, Lars; Christerson, Therese; Due Jensen, Jens; Krusell, Lene; Jahoor, Ahmed; Orabi, Jihad
2017-01-01
The powdery mildew fungus, Blumeria graminis f. sp. hordei is a worldwide threat to barley ( Hordeum vulgare L. ssp. vulgare ) production. One way to control the disease is by the development and deployment of resistant cultivars. A genome-wide association study was performed in a Nordic spring barley panel consisting of 169 genotypes, to identify marker-trait associations significant for powdery mildew. Powdery mildew was scored during three years (2012-2014) in four different locations within the Nordic region. There were strong correlations between data from all locations and years. In total four QTLs were identified, one located on chromosome 4H in the same region as the previously identified mlo locus and three on chromosome 6H. Out of these three QTLs identified on chromosome 6H, two are in the same region as previously reported QTLs for powdery mildew resistance, whereas one QTL appears to be novel. The top NCBI BLASTn hit of the SNP markers within the novel QTL predicted the responsible gene to be the 26S proteasome regulatory subunit, RPN1, which is required for innate immunity and powdery mildew-induced cell death in Arabidopsis . The results from this study have revealed SNP marker candidates that can be exploited for use in marker-assisted selection and stacking of genes for powdery mildew resistance in barley.
Lipid and sugar profiles of various barley cultivars (Hordeum vulgare
Directory of Open Access Journals (Sweden)
Pastor Kristian A.
2015-01-01
Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066
Resistance genes in barley (Hordeum vulgare L.) and their identification with molecular markers.
Chełkowski, Jerzy; Tyrka, Mirosław; Sobkiewicz, Andrzej
2003-01-01
Current information on barley resistance genes available from scientific papers and on-line databases is summarised. The recent literature contains information on 107 major resistance genes (R genes) against fungal pathogens (excluding powdery mildew), pathogenic viruses and aphids identified in Hordeum vulgare accessions. The highest number of resistance genes was identified against Puccinia hordei, Rhynchosporium secalis, and the viruses BaYMV and BaMMV, with 17, 14 and 13 genes respectively. There is still a lot of confusion regarding symbols for R genes against powdery mildew. Among the 23 loci described to date, two regions Mla and Mlo comprise approximately 31 and 25 alleles. Over 50 R genes have already been localised and over 30 mapped on 7 barley chromosomes. Four barley R genes have been cloned recently: Mlo, Rpg1, Mla1 and Mla6, and their structures (sequences) are available. The paper presents a catalogue of barley resistance gene symbols, their chromosomalocation and the list of available DNA markers useful in characterising cultivars and breeding accessions.
Piacentini, Karim Cristina
2015-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Agrárias, Programa de Pós-Graduação em Ciência dos Alimentos, Florianópolis, 2015. A cevada (Hordeum vulgare L sp. vulgare) é considerada um dos cereais mais importantes no contexto mundial. Atualmente, uma preocupação latente da indústria cervejeira é o crescimento de fungos filamentosos nos grãos, que acorre devido ao manejo inadequado da matéria prima durante o armazenamento (excesso de umidade), a conde...
Cardinal, Marie-Josée; Kaur, Rajvinder; Singh, Jaswinder
2016-10-01
Domestication and intensive selective breeding of plants has triggered erosion of genetic diversity of important stress-related alleles. Researchers highlight the potential of using wild accessions as a gene source for improvement of cereals such as barley, which has major economic and social importance worldwide. Previously, we have successfully introduced the maize Ac/Ds transposon system for gene identification in cultivated barley. The objective of current research was to investigate the response of Hordeum vulgare ssp. spontaneum wild barley accessions in tissue culture to standardize parameters for introduction of Ac/Ds transposons through genetic transformation. We investigated the response of ten wild barley genotypes for callus induction, regenerative green callus induction and regeneration of fertile plants. The activity of exogenous Ac/Ds elements was observed through a transient assay on immature wild barley embryos/callus whereby transformed embryos/calli were identified by the expression of GUS. Transient Ds expression bombardment experiments were performed on 352 pieces of callus (3-5 mm each) or immature embryos in 4 genotypes of wild barley. The transformation frequency of putative transgenic callus lines based on transient GUS expression ranged between 72 and100 % in wild barley genotypes. This is the first report of a transformation system in H. vulgare ssp. spontaneum.
Farmers without borders-genetic structuring in century old barley (Hordeum vulgare).
Forsberg, N E G; Russell, J; Macaulay, M; Leino, M W; Hagenblad, J
2015-02-01
The geographic distribution of genetic diversity can reveal the evolutionary history of a species. For crop plants, phylogeographic patterns also indicate how seed has been exchanged and spread in agrarian communities. Such patterns are, however, easily blurred by the intense seed trade, plant improvement and even genebank conservation during the twentieth century, and discerning fine-scale phylogeographic patterns is thus particularly challenging. Using historical crop specimens, these problems are circumvented and we show here how high-throughput genotyping of historical nineteenth century crop specimens can reveal detailed geographic population structure. Thirty-one historical and nine extant accessions of North European landrace barley (Hordeum vulgare L.), in total 231 individuals, were genotyped on a 384 single nucleotide polymorphism assay. The historical material shows constant high levels of within-accession diversity, whereas the extant accessions show more varying levels of diversity and a higher degree of total genotype sharing. Structure, discriminant analysis of principal components and principal component analysis cluster the accessions in latitudinal groups across country borders in Finland, Norway and Sweden. FST statistics indicate strong differentiation between accessions from southern Fennoscandia and accessions from central or northern Fennoscandia, and less differentiation between central and northern accessions. These findings are discussed in the context of contrasting historical records on intense within-country south to north seed movement. Our results suggest that although seeds were traded long distances, long-term cultivation has instead been of locally available, possibly better adapted, genotypes.
International Nuclear Information System (INIS)
Negi, Mahima; Tilak, K.V.B.R.; Sachdev, M.S.
1991-01-01
Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N 0 P 1 (0 kg N and 30 kg P 2 O 5 ha -1 ) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15 N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs
Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress
International Nuclear Information System (INIS)
Saleem, A.; Qurainy, F.A.; Akram, N.A.
2014-01-01
To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)
International Nuclear Information System (INIS)
Forster, B.P.; Pakniyat, H.; Macaulay, M.; Matheson, W.; Phillips, M.S.; Thomas, W.T.B.; Powell, W.
1994-01-01
Tests for shoot and root sodium content were carried out on various barley cultivars (Hordeum vulgare) and experimental lines including wild barley (H. spontaneum) and derivatives. Lines were grown in hydroculture with and without the addition of salt (NaCl), and sodium concentrations in shoots and roots were determined. Variation in shoot sodium content was found between the various lines; in contrast, no significant differences were found between the lines tested for root sodium content. The most significant finding was the variation in shoot sodium content between the two cultivars Golden Promise and Maythorpe. Golden Promise is a direct gamma-ray induced mutant of the cultivar Maythorpe and the reduced shoot sodium content of Golden Promise can be attributed to radiation treatment. (author)
Variation of Qingke (Hordeum vulgare linn.var.nudum Hook.f) induced by space flight treatment
International Nuclear Information System (INIS)
Li Xin; Peng Zhengsong; Yang Jun
2007-01-01
108 Dry seeds of Qingke (Hordeum vulgate linn. var. nudum Hook. f) were carried into space by recoverable satellite. after wards, the seeds were germinated into 108 seedlings at room temperature, and root tips were observed with Night microscope, and results and normal mitotic division was found without microkemel at interphase or chromosome bridges at anaphase, which means that chromosomal structure change didn't occur in Qingke seeds during space flight. To investigate whether there were morphology variations taken place, the seedlings were transplanted into field and managed normal. All of plants grew as strong as normal Qingke plants (CK) by eye abservation, except two plants showed abnormal inflorescence morphology, which had two spikes on one tiller. 21 SSR markers on 7 linkage groups were used to analysis the polymorphism of genomic DNA for these Qingke plants. No polymorphism was detected with 20 SSR markers among 63 plants investigated. But varied electrophoretic bands were tested in 10 plants using the marker HVM54 on chromosome 2H, and all the 10 plants showed uniform electrophoretypes. It was concluded that the DNA of the Qingke could be changed during space flight. (authors)
Genetic analysis on the competitive ability of barley ( Hordeum ...
African Journals Online (AJOL)
Genetic analysis on the competitive ability of barley ( Hordeum vulgare L.) recombinant inbred lines intercropped with oat ( Avena sativa L.) weeds. ... Furthermore, the commonly used herbicide price is soaring from time to time and out of the reach of the poor farmers in the developing countries. Therefore, this method is an ...
Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María
2015-01-01
The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.
Directory of Open Access Journals (Sweden)
Šurlan-Momirović Gordana
2013-01-01
Full Text Available Molecular diversity of 145 barley (Hordeum vulgare subsp. vulgare L. accessions from the Serbian GenBank was assessed by single sequence repeats (SSR markers. A set of 15 SSRs, covering all chromosomes of the diploid barley genome with 2-3 SSR markers per chromosome, with a range of 4-18 alleles per locus were used. In total, 15 loci and 119 alleles were detected, with an average of 7.93 alleles per locus. The Polymorphic information content value ranged from 0.220 to 0.782 with a mean value of 0.534. Regarding the growth habit and row type groups, gene diversity was comparatively higher for the spring (0.616 and six-rowed accessions (0.616 than for the winter and two- rowed accessions (0.322 and 0.478, respectively. Analysis of molecular variance showed that all sources of variation were significant (P < 0.01, but the between-group component was predominant (76.85% for growth habit and 89.45% for row type. Unweighted Pair Group Method with Arithmetic Mean (UPGMA cluster analysis based on the shared allele distance (DSA matrix estimated on the SSR data assigned the genotypes into two clusters - the first smaller consisting of the six 6-rowed spring cultivars and the second comprising six subclusters. Genotype MBR1012 was separated from all other genotypes that constitute UPGMA tree. The associations of genotypes belonging to different growth habit and row type groups were assessed using Principal Coordinate Analysis revealing separation of winter growth habit group from facultative one. The use of the STRUCTURE clustering algorithm allowed the identification of 2 subpopulations of genotypes. [Projekat Ministarstva nauke Republike Srbije, br. TR31092
Klobus, G.; Ward, M. R.; Huffaker, R. C.
1988-01-01
The nature of the injury and recovery of nitrate uptake (net uptake) from NaCl stress in young barley (Hordeum vulgare L, var CM 72) seedlings was investigated. Nitrate uptake was inhibited rapidly by NaCl, within 1 minute after exposure to 200 millimolar NaCl. The duration of exposure to saline conditions determined the time of recovery of NO3- uptake from NaCl stress. Recovery was dependent on the presence of NO3- and was inhibited by cycloheximide, 6-methylpurine, and cerulenin, respective inhibitors of protein, RNA, and sterol/fatty acid synthesis. These inhibitors also prevented the induction of the NO3- uptake system in uninduced seedlings. Uninduced seedlings exhibited endogenous NO3- transport activity that appeared to be constitutive. This constitutive activity was also inhibited by NaCl. Recovery of constitutive NO3- uptake did not require the presence of NO3-.
Directory of Open Access Journals (Sweden)
Miriama Kopernická
2016-01-01
Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was
Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare
Scheu, Arne Hagen August
2017-05-01
Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.
High-throughput transcriptome analysis of barley (Hordeum vulgare) exposed to excessive boron.
Tombuloglu, Guzin; Tombuloglu, Huseyin; Sakcali, M Serdal; Unver, Turgay
2015-02-15
Boron (B) is an essential micronutrient for optimum plant growth. However, above certain threshold B is toxic and causes yield loss in agricultural lands. While a number of studies were conducted to understand B tolerance mechanism, a transcriptome-wide approach for B tolerant barley is performed here for the first time. A high-throughput RNA-Seq (cDNA) sequencing technology (Illumina) was used with barley (Hordeum vulgare), yielding 208 million clean reads. In total, 256,874 unigenes were generated and assigned to known peptide databases: Gene Ontology (GO) (99,043), Swiss-Prot (38,266), Clusters of Orthologous Groups (COG) (26,250), and the Kyoto Encyclopedia of Genes and Genomes (KEGG) (36,860), as determined by BLASTx search. According to the digital gene expression (DGE) analyses, 16% and 17% of the transcripts were found to be differentially regulated in root and leaf tissues, respectively. Most of them were involved in cell wall, stress response, membrane, protein kinase and transporter mechanisms. Some of the genes detected as highly expressed in root tissue are phospholipases, predicted divalent heavy-metal cation transporters, formin-like proteins and calmodulin/Ca(2+)-binding proteins. In addition, chitin-binding lectin precursor, ubiquitin carboxyl-terminal hydrolase, and serine/threonine-protein kinase AFC2 genes were indicated to be highly regulated in leaf tissue upon excess B treatment. Some pathways, such as the Ca(2+)-calmodulin system, are activated in response to B toxicity. The differential regulation of 10 transcripts was confirmed by qRT-PCR, revealing the tissue-specific responses against B toxicity and their putative function in B-tolerance mechanisms. Copyright © 2014. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
M.A. Urchei
1994-12-01
Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and
International Nuclear Information System (INIS)
Kirkensgaard, Kristine G.; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, Anette
2009-01-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R cryst of 19.0% and an R free of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation
Energy Technology Data Exchange (ETDEWEB)
Kirkensgaard, Kristine G. [Carlsberg Laboratory (Denmark); Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Hägglund, Per; Finnie, Christine; Svensson, Birte [Enzyme and Protein Chemistry, Department of Systems BioIogy, Technical University of Denmark (Denmark); Henriksen, Anette, E-mail: anette@crc.dk [Carlsberg Laboratory (Denmark)
2009-09-01
The first crystal structure of a cereal NTR, a protein involved in seed development and germination, has been determined. The structure is in a conformation that excludes NADPH binding and indicates that a domain reorientation facilitated by Trx binding precedes NADPH binding in the reaction mechanism. Thioredoxins (Trxs) are protein disulfide reductases that regulate the intracellular redox environment and are important for seed germination in plants. Trxs are in turn regulated by NADPH-dependent thioredoxin reductases (NTRs), which provide reducing equivalents to Trx using NADPH to recycle Trxs to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 Å resolution and refined to an R{sub cryst} of 19.0% and an R{sub free} of 23.8%. The dimeric protein is structurally similar to the structures of AtNTR-B from Arabidopsis thaliana and other known low-molecular-weight NTRs. However, the relative position of the two NTR cofactor-binding domains, the FAD and the NADPH domains, is not the same. The NADPH domain is rotated by 25° and bent by a 38% closure relative to the FAD domain in comparison with AtNTR-B. The structure may represent an intermediate between the two conformations described previously: the flavin-oxidizing (FO) and the flavin-reducing (FR) conformations. Here, analysis of interdomain contacts as well as phylogenetic studies lead to the proposal of a new reaction scheme in which NTR–Trx interactions mediate the FO to FR transformation.
Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley
DEFF Research Database (Denmark)
Doll, Hans; Brown, A. H. D.
1979-01-01
The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...
Directory of Open Access Journals (Sweden)
F. Taghavi Ghasemkheyli
2015-01-01
Full Text Available To investigate the effect of Trichoderma harzianum, as a bioabsorbant to ameliorate the harmful effects of cadmium (Cd on growth and yield of barley (Hordeum vulgare L. variety ‘Sahra’, a factorial pot experiment based on completely randomized design with three replicates was conducted. Trichoderma harzianum withtwo levels (with and without inoculation and cadmium nitrate with four levels (0, 50, 100 and 150 mg.L-1 were the treatments. Results of ANOVA revealed that there was a significant interaction between Trichoderma and cadmium nitrate in terms of biological yield, straw yield, harvest index, spike number per plant and seed number per spike. Mean comparisons showed that Trichoderma inoculation at all Cd levels significantly improved both biological and straw yields. Trichoderma at 50 and 100 mg.L-1 of Cd also increased the spike number per plant (up to 120 and 66%, respectively significantly. Increasing Cd levels decreased seed yield (19%, 1000 seed weight (18%, partitioning coefficient (57% and tolerance index (23% significantly. Inoculation of Trichoderma into growth medium had a significant effect on seed yield and tolerance index (up to 17 and 22%, respectively. In conclusion, Trichoderma harzianum inoculation at lower concentrations of Cd (50 and 100 mg.L-1 could be effective to improve growth parameters of barley plant.
Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)
DEFF Research Database (Denmark)
Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B
1998-01-01
Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...
Ford, Brett; Deng, Weiwei; Clausen, Jenni; Oliver, Sandra; Boden, Scott; Hemming, Megan; Trevaskis, Ben
2016-01-01
An increase in global temperatures will impact future crop yields. In the cereal crops wheat and barley, high temperatures accelerate reproductive development, reducing the number of grains per plant and final grain yield. Despite this relationship between temperature and cereal yield, it is not clear what genes and molecular pathways mediate the developmental response to increased temperatures. The plant circadian clock can respond to changes in temperature and is important for photoperiod-dependent flowering, and so is a potential mechanism controlling temperature responses in cereal crops. This study examines the relationship between temperature, the circadian clock, and the expression of flowering-time genes in barley (Hordeum vulgare), a crop model for temperate cereals. Transcript levels of barley core circadian clock genes were assayed over a range of temperatures. Transcript levels of core clock genes CCA1, GI, PRR59, PRR73, PRR95, and LUX are increased at higher temperatures. CCA1 and PRR73 respond rapidly to a decrease in temperature whereas GI and PRR59 respond rapidly to an increase in temperature. The response of GI and the PRR genes to changes in temperature is lost in the elf3 mutant indicating that their response to temperature may be dependent on a functional ELF3 gene. PMID:27580625
International Nuclear Information System (INIS)
Lock, K.; De Schamphelaere, K.A.C.; Becaus, S.; Criel, P.; Van Eeckhout, H.; Janssen, C.R.
2007-01-01
A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca 2+ , Mg 2+ , Na + , K + ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg 2+ , and to a lesser extent also K + , the 4-d EC50 Co2+ increased linearly, while Ca 2+ , Na + and H + activities did not affect Co 2+ toxicity. Stability constants for the binding of Co 2+ , Mg 2+ and K + to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50 Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants
Szoboszlay, Márton; Näther, Astrid; Mitterbauer, Esther; Bender, Jürgen; Weigel, Hans-Joachim; Tebbe, Christoph C
2017-08-01
The effect of elevated atmospheric CO 2 concentration [CO 2 ] on the diversity and composition of the prokaryotic community inhabiting the rhizosphere of winter barley (Hordeum vulgare L.) was investigated in a field experiment, using open-top chambers. Rhizosphere samples were collected at anthesis (flowering stage) from six chambers with ambient [CO 2 ] (approximately 400 ppm) and six chambers with elevated [CO 2 ] (700 ppm). The V4 region of the 16S rRNA gene was PCR-amplified from the extracted DNA and sequenced on an Illumina MiSeq instrument. Above-ground plant biomass was not affected by elevated [CO 2 ] at anthesis, but plants exposed to elevated [CO 2 ] had significantly higher grain yield. The composition of the rhizosphere prokaryotic communities was very similar under ambient and elevated [CO 2 ]. The dominant taxa were Bacteroidetes, Actinobacteria, Alpha-, Gamma-, and Betaproteobacteria. Elevated [CO 2 ] resulted in lower prokaryotic diversity in the rhizosphere, but did not cause a significant difference in community structure. © 2017 The Authors. MicrobiologyOpen published by John Wiley & Sons Ltd.
Leaf rust of cultivated barley: pathology and control.
Park, Robert F; Golegaonkar, Prashant G; Derevnina, Lida; Sandhu, Karanjeet S; Karaoglu, Haydar; Elmansour, Huda M; Dracatos, Peter M; Singh, Davinder
2015-01-01
Leaf rust of barley is caused by the macrocyclic, heteroecious rust pathogen Puccinia hordei, with aecia reported from selected species of the genera Ornithogalum, Leopoldia, and Dipcadi, and uredinia and telia occurring on Hordeum vulgare, H. vulgare ssp. spontaneum, Hordeum bulbosum, and Hordeum murinum, on which distinct parasitic specialization occurs. Although Puccinia hordei is sporadic in its occurrence, it is probably the most common and widely distributed rust disease of barley. Leaf rust has increased in importance in recent decades in temperate barley-growing regions, presumably because of more intensive agricultural practices. Although total crop loss does not occur, under epidemic conditions yield reductions of up to 62% have been reported in susceptible varieties. Leaf rust is primarily controlled by the use of resistant cultivars, and, to date, 21 seedling resistance genes and two adult plant resistance (APR) genes have been identified. Virulence has been detected for most seedling resistance genes but is unknown for the APR genes Rph20 and Rph23. Other potentially new sources of APR have been reported, and additivity has been described for some of these resistances. Approaches to achieving durable resistance to leaf rust in barley are discussed.
The Role of alpha-Glucosidase in Germinating Barley Grains
DEFF Research Database (Denmark)
Stanley, Duncan; Rejzek, Martin; Næsted, Henrik
2011-01-01
The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...
Directory of Open Access Journals (Sweden)
Laura Lopez Del Egido
2017-05-01
Full Text Available A comparative analysis was carried out of published methods to assess seed viability using 2,3,5-triphenyltetrazolium chloride (TTC based assays of seed batches. The tests were carried out on seeds of barley (Hordeum vulgare cv. Optic as a model. We established that 10% [w/v] trichloroacetic acid (TCA/methanol is superior to the acetone and methanol-only based methods: allowing the highest recovery of formazan and the lowest background optical density (OD readings, across seed lots comprising different ratios of viable and dead seeds. The method allowed a linear-model to accurately capture the statistically significant relationship between the quantity of formazan that could be extracted using the method we developed and the seed temperature-response, and seed viability as a function of artificially aged seed lots. Other quality control steps are defined to help ensure the assay is robust and these are reported in a Standard Operating Procedure.
Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping
2015-06-11
In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.
Responses of growth and primary metabolism of water-stressed barley roots to rehydration
Barley seedlings [Hordeum vulgare L. Brant] were grown in pots in controlled environment chambers and drought treatments were imposed 11 days after sowing. Soil water content decreased from 92% to 10% after an additional 14 days of water stress. Shoot and root growth ceased after 4 and 9 days of wat...
Radiosensitivity study of cultured barley (hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang
1991-07-01
For studying the radioactivity, forty seven varieties of dormant barley seeds were irradiated with various doses (0 ∼ 400 Gy) of 137 Cs γ-rays. The results showed that the dose-effects relations of seedling growth inhibition could be fitted by an equation of F(D) = 1 - (1 - e -a 1 D ) N , and the dose-effects of cell-nucleus, the frequency of root tip cell with chromosome aberations and peroxidase isoenzyme band could be expressed by a linear regression equation Y = A + B · X. The radioactivity of naked barley was much higher than of covered barley. According to different radiosensitivities the varieties studied could be divided into five types i.e. extreme resistant, resistant, intermediate, sensitive, and extreme sensitive. The results also showed that there was close relationship between the DNA content of cell-nucleus, peroxidase isoenzyme zymogram and radioactivity. The radiosensitivty was proportional to the DNA content. The volume of cell-nucleus varied inversly as D 50 of nucleus volume and no obvious correlation with the D 50 of seedling growth inhibition
Williams, Alwyn; Manoharan, Lokeshwaran; Rosenstock, Nicholas P; Olsson, Pål Axel; Hedlund, Katarina
2017-01-01
Agricultural fertilization significantly affects arbuscular mycorrhizal fungal (AMF) community composition. However, the functional implications of community shifts are unknown, limiting understanding of the role of AMF in agriculture. We assessed AMF community composition at four sites managed under the same nitrogen (N) and phosphorus (P) fertilizer regimes for 55 yr. We also established a glasshouse experiment with the same soils to investigate AMF-barley (Hordeum vulgare) nutrient exchange, using carbon ( 13 C) and 33 P isotopic labelling. N fertilization affected AMF community composition, reducing diversity; P had no effect. In the glasshouse, AMF contribution to plant P declined with P fertilization, but was unaffected by N. Barley C allocation to AMF also declined with P fertilization. As N fertilization increased, C allocation to AMF per unit of P exchanged increased. This occurred with and without P fertilization, and was concomitant with reduced barley biomass. AMF community composition showed no relationship with glasshouse experiment results. The results indicate that plants can reduce C allocation to AMF in response to P fertilization. Under N fertilization, plants allocate an increasing amount of C to AMF and receive relatively less P. This suggests an alteration in the terms of P-C exchange under N fertilization regardless of soil P status. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
Langridge Peter
2007-12-01
Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.
DOES JASMONIC ACID PREVENT THE GERMINATION
ÇAVUŞOĞLU, Kürşat
2009-01-01
Abstract: Effect of jasmonic acid on seed germination and seedling growth of barley (Hordeum vulgare L. cv. Bülbül 89) was investigated in the present study. Jasmonic acid concentrations less than 1500 µM have not inhibited the seed germination, while 1500 and 2000 µM jasmonic acid levels caused atypical germination. The germination was completely inhibited at 3000 µM level of jasmonic acid. However, the seedling growth clearly slowed down with increasing concentrations of jasmonic acid. Furt...
International Nuclear Information System (INIS)
Mico, C.; Li, H.F.; Zhao, F.J.; McGrath, S.P.
2008-01-01
The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl 2 . Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC 50 ) ranged from 45 to 863 mg kg -1 , representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co 2+ activity in soil solution. The EC 50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co 2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC 50 values based on soil added Co. - Soil eCEC and exchangeable Ca were found to be the best predictors of the toxicity threshold values of Co to barley root growth on different soils
KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
KESKİNBALTA, Mehmet; HAMZAOĞLU, Gökhan; ÇELİK, Meryem; DERNEKBAŞI, Seval
2015-01-01
Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...
Differential responses of two Egyptian barley (Hordeum vulgare L.) cultivars to salt stress.
Elsawy, Hayam I A; Mekawy, Ahmad Mohammad M; Elhity, Mahmoud A; Abdel-Dayem, Sherif M; Abdelaziz, Maha Nagy; Assaha, Dekoum V M; Ueda, Akihiro; Saneoka, Hirofumi
2018-06-01
Although barley (Hordeum vulgare L.) is considered a salt tolerant crop species, productivity of barley is affected differently by ionic, osmotic, and oxidative stresses resulting from a salty rhizosphere. The current study was conducted to elucidate the mechanism of salt tolerance in two barley cultivars, Giza128 and Giza126. The two cultivars were exposed to 200 mM NaCl hydroponically for 12 days. Although both cultivars accumulated a large amount of Na + in their leaves with similar concentrations, the growth of Giza128 was much better than that of Giza126, as measured by maintaining a higher dry weight, relative growth rate, leaf area, and plant height. To ascertain the underlying mechanisms of this differential tolerance, first, the relative expression patterns of the genes encoding Na + /H + antiporters (NHX) and the associated proton pumps (V-PPase and V-ATPase) as well as the gene encoding the plasma membrane PM H + -ATPase were analyzed in leaf tissues. Salt stress induced higher HvNHX1 expression in Giza128 (3.3-fold) than in Giza126 (1.9-fold), whereas the expression of the other two genes, HvNHX2 and HvNHX3, showed no induction in either cultivar. The expression of HvHVP1 and HvHVA was higher in Giza128 (3.8- and 2.1-fold, respectively) than in Giza126 (1.6- and 1.1-fold, respectively). The expression of the PM H + -ATPase (ha1) gene was induced more in Giza128 (8.8-fold) than in Giza126 (1.8-fold). Second, the capacity for ROS detoxification was assessed using the oxidative stress biomarkers electrolyte leakage ratio (ELR) and the concentrations of malondialdehyde (MDA) and hydrogen peroxide (H 2 O 2 ), and these parameters sharply increased in Giza126 leaves by 66.5%, 42.8% and 50.0%, respectively, compared with those in Giza128 leaves. The antioxidant enzyme (CAT, APX, sPOD, GR, and SOD) activities were significantly elevated by salt treatment in Giza128 leaves, whereas in Giza126, these activities were not significantly altered. Overall, the
Hildebrandt, Ulrich; Marsell, Alexander; Riederer, Markus
2018-04-04
Several anthraquinone derivatives are active components of fungicidal formulations particularly effective against powdery mildew fungi. The antimildew effect of compounds such as physcion and chrysophanol is largely attributed to host plant defense induction. However, so far a direct fungistatic/fungicidal effect of anthraquinone derivatives on powdery mildew fungi has not been unequivocally demonstrated. By applying a Formvar-based in vitro system we demonstrate a direct, dose-dependent effect of physcion, chrysophanol, emodin, and pachybasin on conidial germination and appressorium formation of Blumeria graminis f. sp. hordei (DC.) Speer, the causative agent of barley ( Hordeum vulgare L.) powdery mildew. Physcion was the most effective among the tested compounds. At higher doses, physcion mainly inhibited conidial germination. At lower rates, however, a distinct interference with appressorium formation became discernible. Physcion and others may act by modulating both the infection capacity of the powdery mildew pathogen and host plant defense. Our results suggest a specific arrangement of substituents at the anthraquinone backbone structure being crucial for the direct antimildew effect.
Ramakrishna, Ramnarain; Sarkar, Dipayan; Manduri, Avani; Iyer, Shreyas Ganesan; Shetty, Kalidas
2017-10-01
Sprouts of cereal grains, such as barley ( Hordeum vulgare L.), are a good source of beneficial phenolic bioactives. Such health relevant phenolic bioactives of cereal sprouts can be targeted to manage chronic hyperglycemia and oxidative stress commonly associated with type 2 diabetes (T2D). Therefore improving phenolic bioactives by stimulating plant endogenous defense responses such as protective pentose phosphate pathway (PPP) during sprouting has significant merit. Based on this metabolic rationale, this study aimed to enhance phenolic bioactives and associated antioxidant and anti-hyperglycemic functions in dark germinated barley sprouts using exogenous elicitor treatments. Dark-germinated sprouts of two malting barley cultivars (Pinnacle and Celebration), treated with chitosan oligosaccharide (COS) and marine protein hydrolysate (GP), were evaluated. Total soluble phenolic content (TSP), phenolic acid profiles, total antioxidant activity (TA) and in vitro inhibitory activities of hyperglycemia relevant α-amylase and α-glucosidase enzymes of the dark germinated barley sprouts were evaluated at day 2, 4, and 6 post elicitor treatments. Overall, TSP content, TA, and α-amylase inhibitory activity of dark germinated barley sprouts decreased, while α-glucosidase inhibitory activity and gallic acid content increased from day 2 to day 6. Among barley cultivars, high phenolic antioxidant-linked anti-hyperglycemic bioactives were observed in Celebration. Furthermore, GP and COS seed elicitor treatments in selective doses improved T2D relevant phenolic-linked anti-hyperglycemic bioactives of barley spouts at day 6. Therefore, such seed elicitation approach can be strategically used to develop bioactive enriched functional food ingredients from cereal sprouts targeting chronic hyperglycemia and oxidative stress linked to T2D.
Directory of Open Access Journals (Sweden)
Filip Pošćić
2016-06-01
Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.
Directory of Open Access Journals (Sweden)
Petr Škarpa
2006-01-01
Full Text Available The effect of three different doses of basic fertilisers and a subsequent pre-sowing supplementary fertilisation on production parameters (yield of grain, number of spikes, and thousand grains weight was evaluated using experimental data obtained within the framework of a one-year pot experiment with spring barley (Hordeum vulgare L. established at the Department of Agrochemistry and Plant Nutrition, Faculty of Agronomy, Mendel University of Agriculture and Forestry Brno in 2003. Results of statistical analysis indicated that the yield of grain was significantly influenced by different doses of fertilisers especially on sandy soils. As compared with control, the second highest dose of fertilisers (i.e. 83 kg N, 31 kg P and 92 kg K.ha–1 increased the yield by 91.7 % and the third one (i.e. 113 kg N, 43 kg P and 125 kg K.ha–1 even by 124.8 %. This increase in the grain yield was positively affected above all by increasing doses of nitrogen fertilisers. A pre-sowing application of P, K and Mg showed also a positive effect on grain yield not only on sandy but above all on clay soils (as compared with non-fertilised control, this increase ranged from 40.6 to 50.2%. Fertilisation showed also a marked effect on the number of spikes. This factor showed a similar trend as the yield of grain. The thousand grains weight was not significantly influenced on both soil types. This value was increased (by 2.9% to 14.8% after the application of fertilisers prior to sowing but the difference was statistically non-significant.
Pandey, Bharati; Grover, Abhinav; Sharma, Pradeep
2018-02-12
The WRKY transcription factors are a class of DNA-binding proteins involved in diverse plant processes play critical roles in response to abiotic and biotic stresses. Genome-wide divergence analysis of WRKY gene family in Hordeum vulgare provided a framework for molecular evolution and functional roles. So far, the crystal structure of WRKY from barley has not been resolved; moreover, knowledge of the three-dimensional structure of WRKY domain is pre-requisites for exploring the protein-DNA recognition mechanisms. Homology modelling based approach was used to generate structures for WRKY DNA binding domain (DBD) and its variants using AtWRKY1 as a template. Finally, the stability and conformational changes of the generated model in unbound and bound form was examined through atomistic molecular dynamics (MD) simulations for 100 ns time period. In this study, we investigated the comparative binding pattern of WRKY domain and its variants with W-box cis-regulatory element using molecular docking and dynamics (MD) simulations assays. The atomic insight into WRKY domain exhibited significant variation in the intermolecular hydrogen bonding pattern, leading to the structural anomalies in the variant type and differences in the DNA-binding specificities. Based on the MD analysis, residual contribution and interaction contour, wild-type WRKY (HvWRKY46) were found to interact with DNA through highly conserved heptapeptide in the pre- and post-MD simulated complexes, whereas heptapeptide interaction with DNA was missing in variants (I and II) in post-MD complexes. Consequently, through principal component analysis, wild-type WRKY was also found to be more stable by obscuring a reduced conformational space than the variant I (HvWRKY34). Lastly, high binding free energy for wild-type and variant II allowed us to conclude that wild-type WRKY-DNA complex was more stable relative to variants I. The results of our study revealed complete dynamic and structural information
International Nuclear Information System (INIS)
Reuber, S.; Bornman, J.F.; Weissenböck, G.
1996-01-01
The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves
The Effects of Designated Pollutants on Plants
1978-11-01
Persea americana Mill. Haas and Bacon Barley Hordeum vulgare L. CM 67 Bean Phaseolus vulgaris L. Pinto, U.I. III Briza Briza maxima L. Ornamental...Tagetes patula L. French dwarf double goldie Marigold Tagetes erecta L. American ,Senator Dirksen Petunia Petunia hybrida Vilm. White cascade Radish...Probit analysis of five plant species: citrus seedlings, lemon, orange,, grape, French marigold, American marigold. Probit scale is the probability that a
Taube, Michał; Pieńkowska, Joanna R.; Jarmołowski, Artur; Kozak, Maciej
2014-01-01
SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR), the CHORD- and SGT1-containing domain (CS), and the SGT1-specific domain (SGS)), and two less conserved variable regions (VR1 and VR2). In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare) SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS) was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed. PMID:24714665
Nakurte, Ilva; Keisa, Anete; Rostoks, Nils
2012-01-01
A simple, sensitive, precise, and specific reverse HPLC method was developed and validated for the determination of plant hormones in barley (Hordeum vulgare L.). The method includes extraction in aqueous organic solvent followed by solid-phase extraction, sample evaporation, and reversed-phase HPLC analysis in a general purpose UV-visible (abscisic acid (ABA)) and fluorescence detection (indole-3-acetic acid (IAA) and indole-3-pyruvic acid (IPA)), high-performance liquid chromatography system. The separation was carried out on Zorbax Eclipse XDB C8 column (150 × 4.6 mm I.D) with a mobile phase composed of methanol and 1% acetic acid (60 : 40 v/v) in isocratic mode at a flow rate of 1 ml min(-1). The detection was monitored at 270 nm (ABA) and at 282 nm (Ex) and 360 nm (Em) (IAA, IPA). The developed method was validated in terms of accuracy, precision, linearity, limit of detection, limit of quantification, and robustness. The determined validation parameters are in the commonly acceptable ranges for that kind of analysis.
International Nuclear Information System (INIS)
Mahmood, K.
2011-01-01
Although barley (Hordeum vulgare L.) is regarded as salt tolerant among crop plants, its growth and plant development is severely affected by ionic and osmotic stresses in salt-affected soils. To elucidate the tolerance mechanism, growth and ion uptake of three barley cultivars, differing in salt tolerance, were examined under different levels of NaCl, K/sup +/ Na/sup +/ and NaHCO/sub 3/ in the root medium. The cultivars differed greatly in their responses to varying root medium conditions. Plant growth was more adversely affected by NaHCO/sub 3/ than NaCl. In general, biomass yields were comparable under control and 100 mM NaCl. However, growth of all three cultivars was significantly inhibited by NaHCO/sub 3/ even at low concentration (10 mM). Improved K/sup +/ supply in saline medium increased K/sup +/ uptake and growth of less tolerant cultivars. K/sup +/ uptake was more adversely affected by NaHCO/sub 3/ than NaCl salinity. Selective K/sup +/ uptake and lower Cl/sup -/ in shoots seemed to be associated with the growth responses. K application would help better growth of these cultivars on K-deficient saline-sodic soils and under irrigation with poor quality water having high Residual Sodium Carbonate (RSC) and/or Sodium Adsorption Ratio (SAR). (author)
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von
1986-01-01
. The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...
Radiosensitivities of cultured barley of different type (Hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan
1990-01-01
The dormant seeds (with 13% moisture) of 47 barley varieties were irradiated with various doses (0-40 krad) of 137 Cs γ-rays. The radiosensitivities of naked barley was significantly higher than that of hulled barley. The sensitive coefficients of seedling height were 0.04945 and 0.03667 for naked barley and hulled barley, respectively. The radiosensitivity of four-row naked barley was significantly higher than that of two-row hulled barley and six-row hulled barley. 47 varieties studied could be divided into five types with different radiosensitivities, i.e. extreme resistant, resistant, intermediate, sensitive and extreme sensitive. It was also found that the dose-effect curves of cell nucleus volume had a peal at 30 krad
Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong
2013-03-01
Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.
Energy Technology Data Exchange (ETDEWEB)
Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk
2008-02-01
WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.
International Nuclear Information System (INIS)
Balachandran, R.; Kesavan, P.C.
1978-01-01
The influence of caffeine during and after gamma radiation of barley seeds was studied using seedling injury and peroxidase activity as parameters. The radiation-induced stimulation of peroxidase activity is evident in eight-day only seedlings but not in embryos (i.e. immediately after irradiation). Caffeine present during irradiation of seeds soaked in oxygenated water diminishes seedling injury and also reduces the peroxidase activity to the level observed in eight-day old seedlings of unirradiated seeds. Caffeine, however, produces just the opposite effect (i.e. enhances the seedling injury and peroxidase activity of eight-day old seedlings) when applied during irradiation of seeds soaked in oxygen-free water. There is no evidence that caffeine effects enzyme activity under in vitro conditions. (author)
Directory of Open Access Journals (Sweden)
Victor Raboy
2015-04-01
Full Text Available The potential benefits of the low phytic acid (lpa seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yield in lines homozygous for each of six barley (Hordeum vulgare L. lpa mutations that greatly differ in their seed phytic acid levels. Performance comparisons were between sibling wild-type and mutant lines obtained following backcrossing, and across two years in five Idaho (USA locations that greatly differ in crop yield potential. We found that one lpa mutation (Hvlpa1-1 had no detectable effect on yield and a second (Hvlpa4-1 resulted in yield losses of only 3.5%, across all locations. When comparing yields in three relatively non-stressful production environments, at least three lpa mutations (Hvlpa1-1, Hvlpa3-1, and Hvlpa4-1 typically had yields similar to or within 5% of the wild-type sibling isoline. Therefore in the case of barley, lpa mutations can be readily identified that when simply incorporated into a cultivar result in adequately performing lines, even with no additional breeding for performance within the lpa line. In conclusion, while some barley lpa mutations do impact field performance, a substantial fraction appears to have little or no effect on yield.
Directory of Open Access Journals (Sweden)
Žaltauskaitė J.
2013-04-01
Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.
Alikhani, Mehdi; Khatabi, Behnam; Sepehri, Mozhgan; Nekouei, Mojtaba Khayam; Mardi, Mohsen; Salekdeh, Ghasem Hosseini
2013-06-01
Piriformospora indica is a root-interacting mutualistic fungus capable of enhancing plant growth, increasing plant resistance to a wide variety of pathogens, and improving plant stress tolerance under extreme environmental conditions. Understanding the molecular mechanisms by which P. indica can improve plant tolerance to stresses will pave the way to identifying the major mechanisms underlying plant adaptability to environmental stresses. We conducted greenhouse experiments at three different salt levels (0, 100 and 300 mM NaCl) on barley (Hordeum vulgare L.) cultivar "Pallas" inoculated with P. indica. Based on the analysis of variance, P. indica had a significant impact on the barley growth and shoot biomass under normal and salt stress conditions. P. indica modulated ion accumulation in colonized plants by increasing the foliar potassium (K(+))/sodium (Na(+)) ratio, as it is considered a reliable indicator of salt stress tolerance. P. indica induced calcium (Ca(2+)) accumulation and likely influenced the stress signal transduction. Subsequently, proteomic analysis of the barley leaf sheath using two-dimensional electrophoresis resulted in detection of 968 protein spots. Of these detected spots, the abundance of 72 protein spots changed significantly in response to salt treatment and P. indica-root colonization. Mass spectrometry analysis of responsive proteins led to the identification of 51 proteins. These proteins belonged to different functional categories including photosynthesis, cell antioxidant defense, protein translation and degradation, energy production, signal transduction and cell wall arrangement. Our results showed that P. indica induced a systemic response to salt stress by altering the physiological and proteome responses of the plant host.
Directory of Open Access Journals (Sweden)
A. Derakhshan
2017-01-01
Full Text Available Introduction: Seed germination is one of the key stages in the life cycle of plants that can ultimately affect their fitness in the environment. The temporal pattern of seed germination is extremely depended on the soil water potential (Ψ of the germination medium, as this determines the equilibrium water content of the seed. As for temperature, there is a minimum Ψ that must be exceeded in order for seeds complete germination, and seeds in a population vary in the value of this minimum or base Ψ. The germination of a seed population in response to the reduced water potential is modeled using the hydrotime model. According to this model, the time to germination for a given seed fraction (g is inversely related to the difference between the current seed Ψ and the base water potential (Ψb for that fraction (Ψb(g. The hydrotime model functions are well in matching both the timing and the percentage of germination of seed populations in relation to their Ψ environment. In addition, the model outputs which are significant physiologically and ecologically and the parameters of the model can be used to characterize the properties of seed populations. Normal distribution of Ψb among seeds within a population is one of the assumptions of the hydrotime model. However, this assumption may not be met in many species and thus can result in poor predictions. We tried to investigate empirically the validity of this assumption, to compare the fit of alternative distributions and make recommendations to improve germination modeling procedures. Materials and Methods: Seed germination of Melilotus officinalis, Sinapis arvensis and Hordeum vulgare were tested across a range of water potentials (0, -0.2, -0.4, -0.6 and -0.8 MPa for M. officinalis and S. arvensis and 0, -0.3, -0.6, -0.9, -1.2 and -1.5 MPa for H. vulgare and germination responses were described by the hydrotime models based on twelve statistical functions including Normal, Beta, Gamma
Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad
2015-06-01
Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if
International Nuclear Information System (INIS)
Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.
2015-01-01
The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)
Verhoeven, K.J.F.; Biere, A.; Nevo, E.; Van Damme, J.M.M.
2004-01-01
Very young seedlings of wild barley Hordeum spontaneum have the ability to survive extended periods of severe drought. This desiccation tolerance is considered an adaptation to the rain-limited and unpredictable habitats that the species occupies. Genetic variation has been observed for this trait,
The influence of enhanced UV-B irradiation on the growth and composition of plants
International Nuclear Information System (INIS)
Tevini, M.; Iwanzik, W.
1982-02-01
Barley (Hordeum vulgare), corn (Zea mays), bean (Phaseolus vulgaris), and radish (Raphanus Sativus) were irradiated under a lighting device for 5 to 10 days continuously at an increased UV-B fluence rate. These four species reacted differently to the elevated UV-radiation in their growth parameters, composition and leaf surface. Bean seedlings incurred the greatest damage, radish and barley seedlings less damage, and corn seedlings were hardly affected. The fresh weight, loaf area and chlorophyll, carstenoid and galactolipid contents were reduced in all species, whereas protein contents were increased throughout compared to controls. An approx. 50% increase in flavaroid content was noted in barley and radish seedlings. Studies on barley seedlings showed the effects on growth parameters and composition to be more market with increasing UV-B fluence rate. Fresh weights, chlorophyll and carotinoid contents were reduced proportionately, in contrast to flavaroid content which increased with increasing fluence rate to 180% of the control value. A bronze discolouration of the leaves appeared regularly at the highest fluence rate. (orig./AJ) [de
Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E
2009-06-01
Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.
Analysis of chlorophyll mutations induced by γ-rays in barley (hordeum vulgare)
International Nuclear Information System (INIS)
Wang Cailian; Shen Mei; Xu Gang; Zhao Kongnan; Chen Qiufang
1991-06-01
Thirty varieties of dormant barley seeds were irradiated with 137 Cs γ-rays. Dose-effect relations of chlorophyll mutation frequency in M 2 seedling and differences resulting from cultured types or radiosensitive types were investigated. Experimental results show that the relations between chlorophyll mutation frequency and doses can be fitted by a linear regression equation Y = A + BX. According to analysis of covariance, there is no considerable difference in various cultured types, but the difference of five different radiosensitive types is remarkable. The sensitive and intermediate types need much lower doses than other types to induce maximum chlorophyll mutation
DEFF Research Database (Denmark)
Chen, Fei; Wang, Fang; Sun, Hongyan
2010-01-01
M Cd increased the accumulation of O2•-, H2O2, and malondialdehyde (MDA) but reduced plant height, chlorophyll content, net photosynthetic rate (P n), and biomass, with a much more severe response in the Cd-sensitive genotype. Antioxidant enzyme activities increased significantly under Cd stress......A greenhouse hydroponic experiment was performed using Cd-sensitive (cv. Dong 17) and Cd-tolerant (Weisuobuzhi) barley seedlings to evaluate how different genotypes responded to cadmium (Cd) toxicity in the presence of sodium nitroprusside (SNP), a nitric oxide (NO) donor. Results showed that 5 μ...... in the roots of the tolerant genotype, whereas in leaves of the sensitive genotype, superoxide dismutase (SOD) and ascorbate peroxide (APX), especially cytosol ascorbate peroxidase (cAPX), decreased after 5-15 days Cd exposure. Moreover, Cd induces NO synthesis by stimulating nitrate reductase and nitric oxide...
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A. M.; Voesenek, Laurentius A. C. J.; Pierik, Ronald
2015-01-01
Background and Aims Volatile organic compounds (VOCs) play various roles in plant–plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar ‘Alva’ cause changes in biomass allocation in plants of the cultivar ‘Kara’. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant–plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant–plant signalling between ‘Alva’ and ‘Kara’. Methods The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by ‘Alva’ under control and far-red light-enriched conditions were analysed using gas chromatography–mass spectrometry (GC-MS). ‘Kara’ plants were exposed to the VOC blend emitted by the ‘Alva’ plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for ‘Kara’ plants exposed to ‘Alva’ VOCs, and also for ‘Alva’ plants exposed to either control or far-red-enriched light treatments. Key Results Total VOC emissions by ‘Alva’ were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by ‘Alva’ plants exposed to low R:FR was found to affect carbon allocation in receiver plants of ‘Kara’. Conclusions The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions
Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald
2015-05-01
Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on
Two New American Species of Hordeum (Poaceae)
DEFF Research Database (Denmark)
Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke
1985-01-01
Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....
International Nuclear Information System (INIS)
Sah, N.K.; Kesavan, P.C.
1986-01-01
Barley seeds (IB65) of 4 per cent moisture content were irradiated in vacuo with 350 Gy gamma radiation and post-treated with or without caffeine under oxygenated and oxygen-free conditions. 8-day old seedling height was measured, chromosomal aberrations in 48 hr old shoot-tips were scored and DNA synthesis was assayed by tritiated thymidine incorporation studies at 12, 24 and 36 hr after hydration (these hrs coincide with the first three S-phases). Caffeine has been found to reduce the level of radiation-induced seedling injury and chromosomal aberration and to enhance the magnitude of DNA synthesis under oxygenated condition. The level of seedling injury and chromosomal aberration and the magnitude of DNA synthesis are, however, enhanced under oxygen-free condition by caffeine. (author)
Dicty_cDB: Contig-U03338-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) 486099E06.x1 486 - leaf primordia cDNA library fr... 155 1e-33 1 ( FL885969 ) CCGN6504.b1 CCGN Panicum virgatum eti...( CF272843 ) EST3049 Zea mays sperm cell cDNA library Zea mays... 105 1e-18 1 ( FE623651 ) CBYY4925.g1 CBYY Panicum virgatu...22B2F04.f1 BG01 - normalized library Leymus ... 266 1e-90 2 ( EX580446 ) HDP26H23w HDP Hordeum vulgare subsp. vulgare... 2 ( EX571824 ) HDP35N10T HDP Hordeum vulgare subsp. vulgare cDNA... 287 5e-90 2 ( CV056143 ) BNEL14D8 Barley EST endosperm library... rachis EST library... 161 2e-35 1 ( AU173547 ) Oryza sativa Japonica Group cDNA, parti
African Journals Online (AJOL)
A. Thameur
2012-05-17
adjustment trait variation in barley (Hordeum vulgare L.). Theor. Appl. Genet., 96: 688-698. Thameur A, Ferchichi A, López-Carbonell M (2011). Quantification of free and conjugated abscisic acid in five genotypes of barley. (Hordeum ...
Cultivate In Vitro Of Anthers Of Barley (Hordeum Vulgare L.) Vars. UNAGRO V-PM6 And DISSA
International Nuclear Information System (INIS)
Marquinez Casas, Xavier
1994-01-01
The barley is a autonomous cereal originated of the wild subspecies H. vulgare L. Only at the end of last century it acquired commercial importance with the establishment of the industry brewer (Chaparro and Moreno 1894); at the moment its national production is far from supplying the demand of the market. The Andean area is the most appropriate region for its cultivation in Colombia, mainly between 1800 and 3200 meters on the level of the sea, in the Boyaca, Cundinamarca and Narino departments. Their production is dedicated in a 80 at 85 for the industry brewer and malt industry and of the 15 at 20 for seeds, human food and animal
International Nuclear Information System (INIS)
Kal'chenko, V.A.; Lotareva, O.V.; Spirin, D.A.; Karaban', R.T.; Mal'tseva, L.N.; Ignat'ev, A.A.
1988-01-01
Effect of combined action of of gamma-irradiation and sulfur dioxide or N-methyl-N-nitro-N-nitrosoguanidin on baceria (Bacillus subtilis) and higher plants (Hordeum vulgare L., Pinus sylvestris L.) have been studied. The number of barley germ root cells with chromosomal aberrations depends on the order of treatment with the studied agents. The coefficients of SO 2 and gamma-irradiation correlation fluctuate from 1,3 to 2,6 in the above experiments. In experiments with pine seedlings, these correlation coefficients were similar to additive ones. The data obtained suggest that the pattern of action of the agents is determined by the radiation sensitivity of objects and the order of action of the agents
DEFF Research Database (Denmark)
Jacobsen, S.; Hauschild, M.Z.; Rasmussen, U.
1992-01-01
Barley and rape seedlings were grown in hydroponic culture with increasing concentrations of CrO3 (Cr(VI)) or CrCl3 (Cr(III)). The chitinase activity and the concentrations of putrescine, spennidine and spermine were determined in the third leaf of barley seed-lings and in the second leaf of rape...
DEFF Research Database (Denmark)
Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob
2015-01-01
Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...
Directory of Open Access Journals (Sweden)
E. R. Baseggio
2017-12-01
Full Text Available The use of bioprotectors in the coating of seeds is increasing, and these become an alternative for the use of chemical fungicides. The aim of this work was to evaluate the use of Trichoderma spp., with or without polymerization, in the control of pathogens associated with black oats (Avena strigosa and barley (Hordeum vulgare seeds of the cultivars 'Comum' (black oats and BRS Cauê (barley, 2014 crop. After asepsis and dried of the seeds, the treatments were applied, using a dose of 5 mL of Trichoderma spp. kg-1 and 10 mL of seed polymer kg-1 of seeds. Sanity tests; germination; germination and emergency rate index; length of seedling (shoot and root; and fresh and dry weight were performed. The coating of oat and barley seeds with Trichoderma spp. was efficient in the control of pathogens, as well as increased the germination and development of the seedlings for both cultures evaluated.
Lopes, Marta S; Araus, José L
2008-09-01
Long-term differences in photosynthesis, respiration and growth of plants receiving distinct nitrogen (N) sources imply that N metabolism generates signals that regulate metabolism and development. The molecular basis of these signals remains unclear. Here we studied the gene expression profiles of barley (Hordeum vulgare L. cv. Graphic) seedlings fertilized either with ammonium (NH4+), with ammonium and nitrate (NH4+:NO3-), or with nitrate (NO3-) only. Our transcriptome analysis after 48 h of growth in these N sources showed major changes in the expression of genes involved in N metabolism (nitrate reductase), signalling (protein kinases and protein phosphatases), photosynthesis (chlorophyll a/b-binding protein and a PsbQ domain), where increases in NO3- as compared with NH4+ were observed. Moreover, NH4+ assimilation induced genes participating in C and sugars metabolism (phosphoglycerate kinase, glucosyltranferase and galactokinase), respiration (cytochrome c oxidase), protein fate (heat shock proteins) and development (MTN3-like protein). These changes in gene expression could well explain the long-term growth depression observed in NH4+ plants. Even if a few genes participating in protein fate (proteases) and development (OsNAC5) were upregulated in NH4+ as compared with NH4+:NO3-, the general pattern of expression was quite similar between these two N sources. Taken together, these results indicated that other downstream mechanisms should be involved in the synergetic long-term response of NH4+:NO3-.
International Nuclear Information System (INIS)
Popova, L.P.; Tsonev, T.D.; Vaklinova, S.G.
1987-01-01
The influence of abscisic acid (ABA) on carbon metabolism, rate of photorespiration, and the activity of the photorespiratory enzymes ribulose bisphosphate oxygenase and glycolate oxidase in 7-day-old barley seedlings (Hordeum vulgare L. var. Alfa) was investigated. Plants treated with ABA had enhanced incorporation of labeled carbon from 14 CO 2 into glycolic acid, glycine, and serine, while 14 C incorporation into 3-phosphoglyceric acid and sugarphosphate esters was depressed. Parallel with this effect, treated plants showed a rise in activity of RuBP oxygenase and glycolic acid oxidase. The rate of photorespiration was increased twofold by ABA treatment at IO -6 molar while the CO 2 -compensation point increased 46% and stomatal resistance increased more than twofold over control plants
Directory of Open Access Journals (Sweden)
Bojović Biljana M.
2015-01-01
Full Text Available Allelopathy is the direct or indirect harmful effect which one plant produces on another through the production of chemical compounds that escape into the environment. In the presence paper allelopathic relationships were determined in three cereals - wheat (Triticum aestivum L., barley (Hordeum vulgare L., oat (Avena sativa L. and vegetable crops - spinach (Spinacia oleracea L., radish (Raphanus sativus L., pepper (Capsicum annum L.. In addition to the percentage of germination, allelopathic potential was tested measuring root and stem length of tested plant species germinated either alone or in combination with others. The obtained results showed that seed germination and plant growth of cereals and vegetables are depended on the presence of other plants in all tested combinations. In this study has proven largely inhibitory allelopathic effect on germination and plant growth.
Ramos, Guadalupe E; Lopez, Martin H; Flores, Antonio M; Figueroa, Guadalupe T; De Leon, Fernando G
2010-01-01
Xochimilco is an area of Mexico City fulfilling important ecological functions. However, the water of the canal network in the lacustrine zone of Xochimilco is supplied by the water treatment plants of the city, implying a risk of accumulated contaminants in the sediments. This study reports the effect of lixiviates obtained from sediments collected in the canals of Xochimilco on the growth of the alga Selenastrum capricornutum and the angiosperm Origanum vulgare. Three factors were tested: (a) water source in terms of the effluent from the two water treatment plants (urban waste-water, located at Cerro de la Estrella (CE) and urban-rural waters at San Luis Tlaxialtemalco (SLT); (b) sampling season (January, dry season; May and September, rainy season; and (c) distances from the water discharge point in the Xochimilco's main canal (5200 and 1000 m for CE, and 0, 200 m for SLT). The chemical water properties analyzed were: pH, electrical conductivity, N-NO(3), N-NH(3), N(Total), P-PO(4) and P(Total). The alga was more sensitive to the contaminants than O. vulgare, showing growth inhibition of 93-100%. The effect of sampling season on the inhibition of algal growth was ordered as follows: September > May > January. Lixiviates obtained from sediment samples 200 and 1000 m from the main point of water discharge caused a higher algal growth inhibition than the samples obtained at the source point. Lixiviate promoted the growth of seedlings of O. vulgare.
Read, J J; Jensen, E H
1989-02-01
Problems associated with continuously planting alfalfa (Medicago saliva L.) or seeding to thicken depleted alfalfa stands may be due to autotoxicity, an intraspecific form of allelopathy. A bioassay approach was utilized to characterize the specificity and chemical nature of phytotoxins in extracts of alfalfa soils as compared to fallow soil or soil where a cereal was the previous crop. In germination chamber experiments, water-soluble substances present in methanol extracts of soil cropped to alfalfa or barley (Hordeum vulgare L.) decreased seedling root length of alfalfa L-720, winter wheat (Triticum aestivum L. Nugaines) and radish (Raphanus sativa L. Crimson Giant). Five days after germination, seedling dry weights of alfalfa and radish in alfalfa soil extracts were lower compared to wheat or red clover (Trifolium pralense L. Kenland). Growth of red clover was not significantly reduced by soil extracts from cropped soil. Extracts of crop residue screened from soil cropped to alfalfa or barley significantly reduced seedling root length; extracts of alfalfa residue caused a greater inhibition of seedling dry weight than extracts of barely residue. A phytotoxic, unidentified substance present in extracts of crop residue screened from alfalfa soil, which inhibited seedling root length of alfalfa, was isolated by thin-layer chromatography (TLC). Residues from a soil cropped continuously to alfalfa for 10 years had the greatest phytotoxic activity.
Foliar flavonoids from Tanacetum vulgare var. boreale and their geographical variation.
Uehara, Ayumi; Akiyama, Shinobu; Iwashina, Tsukasa
2015-03-01
Foliar flavonoids of Tanacetum vulgare var. boreale were isolated. Eight flavonoid glycosides, 7-O-glucosides of apigenin, luteolin, scutellarein and 6- hydroxyluteolin, and 7-O-glucuronides of apigenin, luteolin, chrysoeriol and eriodictyol were identified. Moreover, eight flavonoid aglycones, apigenin, luteolin, hispidulin, nepetin, eupatilin, jaceosidin, pectolinarigenin and axillarin were also isolated and identified. The flavonoid composition of two varieties of T. vulgare, i.e. var. boreale and var. vulgare, were compared. All samples of var. boreale and one sample of var. vulgare had the same flavonoid pattern, and could be distinguished from almost all the samples of var. vulgare. Thus, the occurrence of chemotypes, which are characterized by either the presence or absence of scutellarein 7-O-glucoside, eriodictyol 7-O-glucuronide and pectolinarigenin was shown in T. vulgare sensu lato.
Foeniculum vulgare Mill (Umbelliferae) Attenuates Stress and ...
African Journals Online (AJOL)
Purpose: To evaluate the anti-stress and memory-enhancing properties of F. vulgare extract in experimental rats. Methods: F. vulgare plant extract was obtained using Soxhlet extraction technique. The extract, at doses of 50, 100 and 200 mg/kg body weight, was administered orally with an orogastric tube. Urinary levels of ...
Tahaei, Amirreza; Soleymani, Ali; Shams, Majid
2016-09-01
Reduced seed germination is among the most important factors adversely affecting crop stand and subsequent plant growth. Fennel (Foeniculum vulgare Mill) is an important medicinal plant with poor seed germination rate, occasionally. It is accordingly pertinent to find methods which can enhance fennel seed germination and remove the barriers of dormancy breaking. The present experiments studied the effects of two different priming (cold moist stratification and osmopriming) and 14 dormancy breaking techniques (hormonal, osmopriming, biopriming, chemical priming, and hydropriming) on the seed germination and seedling growth of two different fennel genotypes under growth chamber conditions. In the first and second experiment, the priming techniques including the time lengths of cold moist stratification (0, 15, 30, and 45 days) and the concentrations of polyethylene glycol 6000 (PEG6000, osmopriming at -0.99, -1.35, and -2.33 MPa) were used as the main plots. However, in both experiments, the dormancy breaking techniques and fennel genotypes were factorially combined and used as the subplots. Different seed- and seedling-related parameters including germination (%), plumule, radicle and seedling length, average germination time, rate and homogeneity of germination, and seed vigor index were determined. Both priming techniques were efficient on the enhancement of seed germination and seedling growth. Among the dormancy breaking techniques, Aminol Forte (biopriming), kadostim (biopriming), benzyl adenine + kinetin (biopriming), distilled water (hydropriming), gibberellin + kinetin (hormonal priming), and benzyl adenine + kinetin + gibberellin (biopriming) were the most effective ones. The related concentrations were equal to 100 mg/l, 10(-5) M, and 0.4 %. The fennel genotypes reacted significantly different under priming conditions. It is possible to enhance seed germination and seedling growth of fennel using priming and dormancy breaking
Marrubium vulgare L.: A review on phytochemical and pharmacological aspects
Directory of Open Access Journals (Sweden)
Santram Lodhi
2017-12-01
Full Text Available Marrubium vulgare L. (family: Lamiaceae, also known as white horehound, is widely used as herbal remedy for chronic coughs and colds. It is used in various disorders related to skin, liver, gastric, heart and immune system. This review abridges phytochemical, pharmacological studies and medicinal uses of M. vulgare and provides scientific proof for various ethnobotanical claims in order to identify gaps, which will give impulsion for novel research on M. vulgare based herbal medicines. This review summarizes selected scientific evidence on phytochemistry and pharmacological properties of M. vulgare over the past 48 years (1968 to 2016. The work reported on M. vulgare was reviewed from various sources like books, internet source i.e. google search engine, pubmed, sciencedirect and chemical abstract. The exhaustive literature was studied and critical analysis was done according to their phytochemical and pharmacological properties. Phytochemical investigations on different parts of M. vulgare have been reported the presence of flavonoids, steroids, terpenoids, tannins, saponins and volatile oils (0.05%. The aerial parts contain marrubiin, together with ursolic acid and choline. Pharmacological activities like, anti-nociceptive, anti-spasmodic, anti-hypertensive, anti-diabetic, gastroprotective, anti-inflammatory, anti-microbial, anti-cancer, antioxidant, and anti-hepatotoxic activity have been reported. M. vulgare has therapeutic potential in the treatment of inflammatory conditions, liver disorders, pain, cardiovascular, gastric and diabetic conditions. Aerial parts of M. vulgare is a good source of labdane type diterpene especially marrubiin which is present in high concentrations. However, further scientific studies are needed to explore clinical efficacy, toxicity and to explore the therapeutic effect of major secondary metabolites like diterpenes, phenylpropanoid and phenylethanoid glycosides of M. vulgare. [J Complement Med Res 2017; 6
Directory of Open Access Journals (Sweden)
M Belén eMontero-Palmero
2014-08-01
Full Text Available The induction of oxidative stress is one of the quickest symptoms appearing in plants subjected to metal stress. A transcriptional analysis of the early responses of alfalfa (Medicago sativa seedlings to mercury (Hg; 3 µM for 3, 6 and 24 h showed that up-regulation of genes responding to ethylene were up-regulated, a phytohormone known to mediate in the cellular redox homeostasis. In this mini-review we have compared these quick responses with two other concurrent transcriptomic analysis in Barrel medic (Medicago truncatula and barley (Hordeum vulgare under Hg stress. Besides ethylene, ABA and jasmonate related genes were up-regulated, all of them are endogenous factors known to intervene in oxidative stress responses. The information obtained may target future work to understand the cellular mechanisms triggered by Hg, enabling biotechnological approaches to diminish Hg-induced phytotoxicity.
Czech Academy of Sciences Publication Activity Database
Yeo, F. K. S.; Wang, Y.; Vozábová, Tereza; Huneau, C.; LeRoy, P.; Chalhoub, B.; Qi, X. Q.; Niks, R. E.; Marcel, T. C.
2016-01-01
Roč. 129, č. 2 (2016), s. 289-304 ISSN 0040-5752 Institutional support: RVO:67985939 Keywords : cartial resistance genes * cloning * Hordeum vulgare Subject RIV: EF - Botanics Impact factor: 4.132, year: 2016
Konečná, Hana; Müller, Lukáš; Dosoudilová, Hana; Potěšil, David; Buršíková, Jana; Sedo, Ondrej; Márová, Ivana; Zdráhal, Zbyněk
2012-03-14
Two-dimensional gel electrophoresis in combination with mass spectrometry has already been applied successfully to study beer proteome. Due to the abundance of protein Z in beer samples, prefractionation techniques might help to improve beer proteome coverage. Proteins from four lager beers of different origins were separated by two-dimensional electrophoresis (2-DE) followed by tandem mass spectrometric analysis. Initially 52 proteins mostly from Hordeum vulgare (22 proteins) and Saccharomyces species (25 proteins) were identified. Preparative isoelectric focusing by OFFGEL Fractionator was applied prior to 2-DE to improve its resolution power. As a result of this combined approach, a total of 70 beer proteins from Hordeum vulgare (30 proteins), from Saccharomyces species (31 proteins), and from other sources (9 proteins) were identified. Of these, 37 proteins have not been previously reported in beer samples.
Energy Technology Data Exchange (ETDEWEB)
Kotaka, S; Krueger, A P; Andriese, P C
1964-12-19
An attempt is made to investigate the effect of Fe-EDTA on catalase activity of the enzyme preparation from iron-chlorotic barley. It has been observed that the addition of iron in the form of iron-potassium-ethylene-tetraacetate to cell-free extracts prepared from barley seedlings which had developed chlorosis produced a marked increase in the catalase activity of the extracts. Results are presented which indicate that the pattern of increase in catalase activity is related to the extent of chlorosis. 7 references, 3 figures.
Czech Academy of Sciences Publication Activity Database
Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.
2014-01-01
Roč. 201, č. 2 (2014), s. 545-555 ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.545, year: 2013
Journal of Genetics Online Resources
Indian Academy of Sciences (India)
pdf. Jaiswal S. K., Pandey S. P., Sharma S., Prasad R., Prasad L. C., Verma R. P. S. and Joshi A. K. 2010 Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
M. T. Tinoco; M. R. Martins; J. Cruz-Morais
2007-01-01
O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva co...
Directory of Open Access Journals (Sweden)
Ming-Zhu Ding
Full Text Available The cooperative adaptation of subcultivated Bacillus cereus and Ketogulonicigenium vulgare significantly increased the productivity of 2-keto-L-gulonic acid, the precursor of vitamin C. The mechanism of cooperative adaptation of the serial subcultivated B. cereus and K. vulgare was investigated in this study by culturing the two strains orthogonally on agar plates. It was found that the swarming distance of B. cereus along the trace of K. vulgare on the plate decreased after 150 days' subcultivation. Metabolomic analysis on these co-cultured B. cereus and K. vulgare strains showed that their cooperative adaptation was accomplished by three key events: (i the ability of nutrients (e.g., amino acids and purines searching and intaking, and proteins biosynthesis is increased in the evolved B. cereus; (ii the capability of protein degradation and amino acids transportation is enhanced in evolved K. vulgare; (iii the evolved B. cereus was found to provide more nutrients (mostly amino acids and purines to K. vulgare, thus strengthening the oxidation and energy generation of K. vulgare. Our results provided novel insights into the systems-level understanding of the cooperative adaptation between strains in synergistic consortium.
COMPARISON OF THE FROST RESISTANCE OF BARLEY ...
African Journals Online (AJOL)
Preferred Customer
immediate recovery of the photosynthetic quantum yield after freezing. Landraces which showed the highest cold tolerance were found to acclimatize best. Key words/phrases: Barley, chlorophyll fluorescence, cold acclimation, Ethiopia, frost tolerance. INTRODUCTION. Barley (Hordeum vulgare L.) is a traditional crop.
Wheat and barley exposure to nanoceria: Implications for agricultural productivity
The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...
Significance and value of non.traded ecosystem services on farmland
DEFF Research Database (Denmark)
Sandhu, Harpinder; Wratten, Steve; Costanza, Robert
2015-01-01
peas (Pisum sativum), beans (Phaseolus vulgaris), barley (Hordeum vulgare), and wheat (Triticum aestivum). Organic systems were chosen as comparators not because they are the only forms of sustainable agriculture, but because they are subject to easily understood standards. Results. We found...
Studies on the histology of partial resistance in barley to leafrust, Puccinia hordei
Niks, R.E.
1983-01-01
In de gerst (Hordeum vulgare) - dwergroest (Puccinia hordei) relatie zijn twee typen van resistentie te onderscheiden, namelijk overgevoeligheidsresistentie en partiële resistentie. Deze typen kunnen beschouwd worden als voorbeelden van Van der Plank's verticale en horizontale
Czech Academy of Sciences Publication Activity Database
Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.
2014-01-01
Roč. 166, č. 4 (2014), s. 1912-1927 ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe c...
Lifescience Database Archive (English)
Full Text Available me=Ltp1; Synonyms=Papi; Hordeum Vulgare Molecule: Lipid Transfer Protein; Chain: Null; Synonym: Ltp Lipid Tr...ansport M.H.Lerche, F.M.Poulsen M.H.Lerche, F.M.Poulsen Two Different Binding Modes Of Palmitate In The Homologous Mai
Nitrogen accumulation and residual effects of nitrogen catch crops
DEFF Research Database (Denmark)
Jensen, E.S.
1991-01-01
The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...
Wheat and barley seed systems in Ethiopia and Syria
Bishaw, Z.
2004-01-01
Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,
Chernobyl Doses. Volume 3. Habitat and Vegetation Near the Chernobyl Nuclear Reactor Station
1993-01-01
Hordeum vulgare, Avena sativa, Fagopyrum esculentum, Beta vulgaris, Solanum tuberosum, Linum usitatissimum , Cannabis satii, Humulus lupulus, Daucus carota... USITATISSIMUM flax It is grown for fiber. Fine-quality fiber can be obtained from plants grown on podzolic and gley soils with considerable fertilizing. In the
Lopez, S.; Davies, D.; Dhanoa, M.S.; Dijkstra, J.; France, J.
2005-01-01
The nutritive value of 17 straws was determined on the basis of their chemical composition, in vitro dry matter (DM) digestibility and rumen fermentation kinetics (from gas production curves measured in vitro). Five roughages were from the cereal species Avena sativa (oat), Hordeum vulgare (barley),
Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome
Czech Academy of Sciences Publication Activity Database
Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.
2015-01-01
Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015
Farmer’s seed sources and seed quality: 2. seed health
Bishaw, Z.; Struik, P.C.; Gastel, van A.J.G.
2013-01-01
The study assessed the health quality of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) seed samples collected from formal and informal sector in Ethiopia and Syria. In Ethiopia, several seed-borne fungi were found on wheat samples: Cochliobolus sativum, Fusarium avenaceum, F.
Synthesis of the major storage protein, hordein, in barley
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Andersen, B.; Doll, Hans
1983-01-01
A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptides...
Ceretta, S.S.E.; Eeuwijk, van F.A.
2008-01-01
The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was
DEFF Research Database (Denmark)
Schelde, Kirsten; Ringgaard, Rasmus; Herbst, Mathias
2011-01-01
limit estimate (disregarding dew evaporation) of evapotranspiration on dry days. During a period of 7 wk, the two independent measuring techniques were applied in a barley (Hordeum vulgare L.) field, and six dry periods were identified. Measurements of daily root zone soil moisture depletion were...
Investigation of GMO and ancient Grains for Bioplastic and Food Applications
DEFF Research Database (Denmark)
Sagnelli, Domenico
I dette projekt er der udviklet nye koncepter for helt naturlige bioplast systemer og sunde diætfibre. Termoplastisk stivelse (TPS) fremstilles ved anvendelse af traditionelle processer, såsom ekstrudering. I dette projekt anvendes transgen byg (Hordeum vulgare, Hv) med en stivelse der indeholder...
PLANT REMAINS FROM ASIKLI-HOYUK, A PRE-POTTERY NEOLITHIC SITE IN CENTRAL ANATOLIA
VANZEIST, W; DEROLLER, GJ
Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)
Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.
2012-01-01
Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be
Suwa, Tomomi; Louda, Svata M
2012-06-01
The biotic resistance hypothesis is a dominant paradigm for why some introduced species fail to become invasive in novel environments. However, predictions of this hypothesis require further empirical field tests. Here, we focus on evaluating two biotic factors known to severely limit plants, interspecific competition and insect herbivory, as mechanisms of biotic resistance. We experimentally evaluated the independent and combined effects of three levels of competition by tallgrass prairie vegetation and two levels of herbivory by native insects on seedling regeneration, size, and subsequent flowering of the Eurasian Cirsium vulgare, a known invasive species elsewhere, and compared its responses to those of the ecologically similar and co-occurring native congener C. altissimum. Seedling emergence of C. vulgare was greater than that of C. altissimum, and that emergence was reduced by the highest level of interspecific competition. Insect leaf herbivory was also greater on C. vulgare than on C. altissimum at all levels of competition. Herbivory on seedlings dramatically decreased the proportion of C. vulgare producing flower heads at all competition levels, but especially at the high competition level. Competition and herbivory interacted to significantly decrease plant survival and biomass, especially for C. vulgare. Thus, both competition and herbivory limited regeneration of both thistles, but their effects on seedling emergence, survival, size and subsequent reproduction were greater for C. vulgare than for C. altissimum. These results help explain the unexpectedly low abundance recorded for C. vulgare in western tallgrass prairie, and also provide strong support for the biotic resistance hypothesis.
Directory of Open Access Journals (Sweden)
C.F. Azevedo
2012-01-01
fennel and has great medicinal and commercial importance, both in Brazil and in several other countries. The objective of this research was to study the development of stomata of F. vulgare seedlings grown from seeds produced in intercropping systems fennel and cotton, with application of insecticide monocrotophos. The fennel was grown in association with colored cotton BRS Safira, with the following treatments: 1A2E, one rows of cotton and two fennel; 2A1E, two rows of cotton and one fennel; ES, fennel single; were distributed with and without application of insecticide, total six treatments. The seeds were sown in sand and kept in a greenhouse for 25 days. Parts of seedlings (transition zone, stem, cotyledons and leaves were cut freehand, stained and mounted on slides with glycerol for observation under microscope. Were evaluated the following characteristics: stomata number, polar and equatorial diameter of the stomata and chloroplasts number in guard cells. The data were analyzed in completely randomized and distributed in factorial 3x2, being conducted Tukey test at 5% probability. The transition zone and stem showed an increase of the stomata number and polar diameter the when consortium systems were used. In cotyledons, fennel single provided the highest stomata number, but with smaller diameter and fewer chloroplasts. In leaf, the consortia have positively influenced the stomata and chloroplasts number. In general, the intercropping systems and insecticide positively influenced the development of stomata in fennel plants.
Directory of Open Access Journals (Sweden)
IAN S ACUÑA-RODRÍGUEZ
2006-09-01
Full Text Available Nurse effects, which occur when one plant species enhances the survival or growth of another plant species, are predicted to be most relevant in stressful environments. These effects are particulary important during seedling establishment due to their vulnerability to both biotic and abiotic factors, such as herbivory and drought. Tolerance to herbivory reflects the degree to which plants are able to regrow and reproduce after damage, and should vary with resource availability. In the high Andes of central Chile, the cushion plant Laretia acaulis (Apiaceae acts as a buffer against environmental stress, enhancing survival of several associated plant species. We hypothesized that tolerance to herbivory of seedlings growing inside the canopy of L. acaulis should be greater than that of seedlings growing outside the cushion plant. We conducted a field experiment to test this hypothesis for two native perennial species in the high Andes of central Chile: Hordeum comosum (Poaceae and Haplopappus anthylloides (Asteraceae. Seedlings of each species were planted inside and outside L. acaulis cushions and half of them received manual damage (50 % foliar tissue removed. Seedlings growing inside the nurse species showed high survival independent of the damage treatment. Whereas position (inside or outside the cushion plant did not affect tolerance of Haplopappus anthylloides, it significantly affected tolerance of Hordeum comosum. Thus, we found similar survival of damaged and control seedlings of H. comosum inside the cushions, but survival of damaged seedlings in the bare ground was lower than that of control seedlings. We verified the occurrence of nurse effects of Laretia acaulis on the establishment of both species, and detected enhancement of tolerance to damage in Hordeum comosum in this stressful habitatSe ha sugerido que el efecto nodriza, el cual se evidencia cuando una especie vegetal incrementa la supervivencia o el crecimiento de otra, es m
The Role of α-Glucosidase in Germinating Barley Grains1[W][OA
Stanley, Duncan; Rejzek, Martin; Naested, Henrik; Smedley, Mark; Otero, Sofía; Fahy, Brendan; Thorpe, Frazer; Nash, Robert J.; Harwood, Wendy; Svensson, Birte; Denyer, Kay; Field, Robert A.; Smith, Alison M.
2011-01-01
The importance of α-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementary chemical-genetic and reverse-genetic approaches. We identified iminosugar inhibitors of a recombinant form of an α-glucosidase previously discovered in barley endosperm (ALPHA-GLUCOSIDASE97 [HvAGL97]), and applied four of them to germinating grains. All four decreased the Glc-to-maltose ratio in the endosperm 10 d after imbibition, implying inhibition of maltase activity. Three of the four inhibitors also reduced starch degradation and seedling growth, but the fourth did not affect these parameters. Inhibition of starch degradation was apparently not due to inhibition of amylases. Inhibition of seedling growth was primarily a direct effect of the inhibitors on roots and coleoptiles rather than an indirect effect of the inhibition of endosperm metabolism. It may reflect inhibition of glycoprotein-processing glucosidases in these organs. In transgenic seedlings carrying an RNA interference silencing cassette for HvAgl97, α-glucosidase activity was reduced by up to 50%. There was a large decrease in the Glc-to-maltose ratio in these lines but no effect on starch degradation or seedling growth. Our results suggest that the α-glucosidase HvAGL97 is the major endosperm enzyme catalyzing the conversion of maltose to Glc but is not required for starch degradation. However, the effects of three glucosidase inhibitors on starch degradation in the endosperm indicate the existence of unidentified glucosidase(s) required for this process. PMID:21098673
Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye
2015-01-01
Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension · Shivani Vadapalli Sujana Katta B. K. S. Sastry Pratibha Nallari · More Details Fulltext PDF. pp e46-e54. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers.
DEFF Research Database (Denmark)
Rötter, R P; Palosuo, T; Kersebaum, K C
2012-01-01
In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...
Effects of free and chelated iron on in vitro androgenesis in barley and wheat
Czech Academy of Sciences Publication Activity Database
Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila
2000-01-01
Roč. 63, - (2000), s. 35-40 ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000
A new agro-climatic classification for crop suitability zoning in northern semi-arid Ethiopia
Araya, A.; Keesstra, S.D.; Stroosnijder, L.
2010-01-01
The agro-climatic resources of Giba catchment in northern Ethiopia were assessed and characterized. The objectives were (i) to ascertain the suitability of the climate for growing teff (Eragrostis tef) and barley (Hordeum vulgare); (ii) to determine the onset and length of the growing period (LGP),
DEFF Research Database (Denmark)
Andersen, M.K.; Hauggaard-Nielsen, H.; Ambus, P.
2005-01-01
The interspecific complementary and competitive interactions between pea (Pisum sativum L.), barley (Hordeum vulgare L.) and oilseed rape (Brassica napus L.), grown as dual and tri-component intercrops were assessed in a field study in Denmark. Total biomass production and N use at two levels of ...
Classification and salt tolerance analysis of barley varieties
Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.
2006-01-01
Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter
Yield and grain quality of spring barley as affected by biomass formation at early growth stages
Czech Academy of Sciences Publication Activity Database
Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.
2014-01-01
Roč. 60, č. 5 (2014), s. 221-227 ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014
Kim, Joonyup; Wilson, Rebecca L.; Case, J. Brett; Binder, Brad M.
2012-01-01
Time-lapse imaging of dark-grown Arabidopsis (Arabidopsis thaliana) hypocotyls has revealed new aspects about ethylene signaling. This study expands upon these results by examining ethylene growth response kinetics of seedlings of several plant species. Although the response kinetics varied between the eudicots studied, all had prolonged growth inhibition for as long as ethylene was present. In contrast, with continued application of ethylene, white millet (Panicum miliaceum) seedlings had a rapid and transient growth inhibition response, rice (Oryza sativa ‘Nipponbare’) seedlings had a slow onset of growth stimulation, and barley (Hordeum vulgare) had a transient growth inhibition response followed, after a delay, by a prolonged inhibition response. Growth stimulation in rice correlated with a decrease in the levels of rice ETHYLENE INSENSTIVE3-LIKE2 (OsEIL2) and an increase in rice F-BOX DOMAIN AND LRR CONTAINING PROTEIN7 transcripts. The gibberellin (GA) biosynthesis inhibitor paclobutrazol caused millet seedlings to have a prolonged growth inhibition response when ethylene was applied. A transient ethylene growth inhibition response has previously been reported for Arabidopsis ethylene insensitive3-1 (ein3-1) eil1-1 double mutants. Paclobutrazol caused these mutants to have a prolonged response to ethylene, whereas constitutive GA signaling in this background eliminated ethylene responses. Sensitivity to paclobutrazol inversely correlated with the levels of EIN3 in Arabidopsis. Wild-type Arabidopsis seedlings treated with paclobutrazol and mutants deficient in GA levels or signaling had a delayed growth recovery after ethylene removal. It is interesting to note that ethylene caused alterations in gene expression that are predicted to increase GA levels in the ein3-1 eil1-1 seedlings. These results indicate that ethylene affects GA levels leading to modulation of ethylene growth inhibition kinetics. PMID:22977279
Kim, Joonyup; Wilson, Rebecca L; Case, J Brett; Binder, Brad M
2012-11-01
Time-lapse imaging of dark-grown Arabidopsis (Arabidopsis thaliana) hypocotyls has revealed new aspects about ethylene signaling. This study expands upon these results by examining ethylene growth response kinetics of seedlings of several plant species. Although the response kinetics varied between the eudicots studied, all had prolonged growth inhibition for as long as ethylene was present. In contrast, with continued application of ethylene, white millet (Panicum miliaceum) seedlings had a rapid and transient growth inhibition response, rice (Oryza sativa 'Nipponbare') seedlings had a slow onset of growth stimulation, and barley (Hordeum vulgare) had a transient growth inhibition response followed, after a delay, by a prolonged inhibition response. Growth stimulation in rice correlated with a decrease in the levels of rice ETHYLENE INSENSTIVE3-LIKE2 (OsEIL2) and an increase in rice F-BOX DOMAIN AND LRR CONTAINING PROTEIN7 transcripts. The gibberellin (GA) biosynthesis inhibitor paclobutrazol caused millet seedlings to have a prolonged growth inhibition response when ethylene was applied. A transient ethylene growth inhibition response has previously been reported for Arabidopsis ethylene insensitive3-1 (ein3-1) eil1-1 double mutants. Paclobutrazol caused these mutants to have a prolonged response to ethylene, whereas constitutive GA signaling in this background eliminated ethylene responses. Sensitivity to paclobutrazol inversely correlated with the levels of EIN3 in Arabidopsis. Wild-type Arabidopsis seedlings treated with paclobutrazol and mutants deficient in GA levels or signaling had a delayed growth recovery after ethylene removal. It is interesting to note that ethylene caused alterations in gene expression that are predicted to increase GA levels in the ein3-1 eil1-1 seedlings. These results indicate that ethylene affects GA levels leading to modulation of ethylene growth inhibition kinetics.
Genomic restructuring in Hordeum chilense durum wheat hybrids ...
Indian Academy of Sciences (India)
ANDREIA DELGADO
4John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK. 5Departament of Genetics and Biotechnology, University of Tras-os-Montes and Alto ... [Delgado A., Carvalho A., Martín A. C., Martín A. and Lima-Brito J. 2017 Genomic restructuring in F1 Hordeum chilense × durum ...... Academic Press, Burlington,.
PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH
Directory of Open Access Journals (Sweden)
Sa'roni Sa'roni
2012-10-01
Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi
cultivars and identification of genotype-specific fingerprints using ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Genetics; Volume 89; Online resources. Diversity in Indian barley (Hordeum vulgare) cultivars and identification of genotype-specific fingerprints using microsatellite markers. S. K. Jaiswal Shree P. Pandey S. Sharma R. Prasad L. C. Prasad R. P. S. Verma Arun K. Joshi. Volume 89 Online ...
Zinc biofortification of cereals: rice differs from wheat and barley
Stomph, T.J.; Jiang, W.; Struik, P.C.
2009-01-01
In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View
DEFF Research Database (Denmark)
Gerhards, R; Christensen, Svend
2003-01-01
with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...
Czech Academy of Sciences Publication Activity Database
Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.
2014-01-01
Roč. 60, č. 2 (2014), s. 50-59 ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy
Agricultural drought and spring barley yields in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Trnka, M.; Hlavinka, P.; Semerádová, Daniela; Dubrovský, Martin; Žalud, Z.; Možný, M.
2007-01-01
Roč. 53, č. 7 (2007), s. 306-316 ISSN 1214-1178 Institutional research plan: CEZ:AV0Z30420517 Keywords : Hordeum vulgare L * Palmer Z-index * climatic conditions * yield * drought Subject RIV: DG - Athmosphere Sciences, Meteorology http://journals.uzpi.cz:8050/web/_generovani_8050/pse_2007.htm
Osipenkova, O V; Ermokhina, O V; Belkina, G G; Oleskina, Iu P; Fattakhov, S G; Iurina, N P
2008-01-01
The effect of melafen, a plant growth regulator of a new generation, on the growth, pigment composition, and expression of nuclear genes Elip1 and Elip2 encoding chloroplast light-stress proteins in barley (Hordeum vulgare L) seedlings was studied. It is shown that the height of seedlings treated with melafen at concentrations of 0.5 x 10(-10) and 0.5 x 10(-8) M increased by approximately 10 and 20%, respectively, as compared to the control. At high concentrations (10(-5) and 10(-3) M), melafen had no effect on the growth of seedlings. The content of chlorophylls and carotenoids in chloroplasts barely differed from the control at all melafen concentrations tested. Reverse transcription-polymerase chain reaction (RT-PCR) showed that melafen did not influence the expression of the nuclear gene encoding the low-molecular-weight plastid stress protein ELIP1. At the same time, the expression of the nuclear gene encoding the high-molecular-weight light-inducible stress protein ELIP2 in the plants treated with melafen at a concentration of 0.5 x 10(-8) M, increased by approximately 70 %. At higher concentrations, melafen suppressed the Elip2 gene expression. Thus, melafen affects the expression of the Elip2 gene, which is involved in the regulation of chlorophyll synthesis and chloroplast biogenesis, which, in turn, may lead to changes in the resistance of plants to light-induced stress.
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne
2017-09-27
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Variation in shoot tolerance mechanisms not related to ion toxicity in barley
Tilbrook, Joanne; Schilling, Rhiannon K.; Berger, Bettina; Garcia, Alexandre F.; Trittermann, Christine; Coventry, Stewart; Rabie, Huwaida; Brien, Chris; Nguyen, Martin; Tester, Mark A.; Roy, Stuart J.
2017-01-01
Soil salinity can severely reduce crop growth and yield. Many studies have investigated salinity tolerance mechanisms in cereals using phenotypes that are relatively easy to measure. The majority of these studies measured the accumulation of shoot Na+ and the effect this has on plant growth. However, plant growth is reduced immediately after exposure to NaCl before Na+ accumulates to toxic concentrations in the shoot. In this study, nondestructive and destructive measurements are used to evaluate the responses of 24 predominately Australian barley (Hordeum vulgare L.) lines at 0, 150 and 250mMNaCl. Considerable variation for shoot tolerance mechanisms not related to ion toxicity (shoot ion-independent tolerance) was found, withsome lines being able to maintain substantial growth rates under salt stress, whereas others stopped growing. Hordeum vulgare spp. spontaneum accessions and barley landraces predominantly had the best shoot ion independent tolerance, although two commercial cultivars, Fathom and Skiff, also had high tolerance. The tolerance of cv. Fathom may be caused by a recent introgression from H. vulgare L. spp. spontaneum. This study shows that the most salt-tolerant barley lines are those that contain both shoot ion-independent tolerance and the ability to exclude Na+ from the shoot (and thus maintain high K+: Na+ ratios).
Chromosome aberration assays in barley (Hordeum vulgare)
Energy Technology Data Exchange (ETDEWEB)
Constantin, M J [Univ. of Tennessee, Knoxville; Nilan, R A
1982-01-01
Barley is an exceellent organism for studies of induced chromosome aberrations because of its few (2n = 2x = 14) relatively large chromosomes. Root-tip and shoot-tip cells have been used extensively for the study of ionizing radiation-induced chromosome aberrations. The general procedures are well known, the technology is simple and easy to learn, and the assays are relatively quick and inexpensive. Both root tips and shoot tips can be used for the study of chemical mutagens as well as ionizing radiations. Pollen mother cells are well suited for studying the effects of mutagens on meiotic chromosomes. The literature review for the Gene-Tox Program reported on 61 chemicals tested for their effects on barley chromosomes. Of these, 90% were reported to be either positive or positive dose-related, while 7% were negative and 3% were questionable. Barley assays based on chromosomal aberrations are useful to detect the clastogenic potency of chemicals under laboratory conditions. Indications are that the data from barley can be used to corroborate data obtained from other organisms. Among the classes of chemicals assayed were: alcohols and phenols; alkaloids; epoxides; alkyl sulfates; amides and sulfonamides; aromatic amines; aryl halides; aziridines; alkenes; carbamates; hydroazides; nitroaromatics; nitrosamides; nitrosources; phenothiazines; and polycyclic aromatic hydrocarbons.
(Hordeum Vulgare) Crop Coefficient and Comparative Assessment
African Journals Online (AJOL)
Bheema
The second prerequisite for sustainable use of water was developing/ ... Following the construction of .... pond capacity, the irrigation method, soil type, major crops grown in the area, and the ... determines the viability of any irrigation project. .... lack of awareness, lack of skill, technology and lack of adequate knowledge in ...
Chemical weed control in barley (hordeum vulgare)
International Nuclear Information System (INIS)
Sarwar, M.; Hassan, S.W.; Abid, A.A.
2008-01-01
Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)
Giemsa C-banded karyotypes of Hordeum taxa from North America
DEFF Research Database (Denmark)
Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.
1986-01-01
submetacentrics than previously reported in Hordeum distinguished the genomes of H. arizonicum and H. brachyantherum (4x) from Newfoundland. A partial inactivation of the nucleolus organizers of one parental genome in interspecific hybrids is considered more common than generally appreciated....
Directory of Open Access Journals (Sweden)
Dongfa Sun
Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor
Francia-Martinez, J.R.; Duran Zuazo, V.H.; Martinez-Raya, A.
2006-01-01
Soil erosion, runoff and nutrient-loss patterns over a two-year period (1999¿2000) were monitored in erosion plots on a mountainside with olive (Olea europaea cv. Picual) trees under three different types of soil management: (1) non-tillage with barley (Hordeum vulgare) strips of 4 m width (BS); (2)
Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase
The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa
Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...
Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508
DEFF Research Database (Denmark)
Kreis, Michael
1978-01-01
At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...
DEFF Research Database (Denmark)
Hansen, Elly Møller; Munkholm, Lars Juhl; Olesen, Jørgen E
2015-01-01
retention did not significantly increase yields, nor did it reduce leaching, while fodder radish (Raphanus sativus L.) as a catch crop was capable of reducing nitrate leaching to a low level. Thus, YSL of winter wheat (Triticum aestivum L.) was higher than for spring barley (Hordeum vulgare L.) grown after...
Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves
Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan
2014-01-01
– The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)
Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus
Directory of Open Access Journals (Sweden)
P. E. Pensel
2014-01-01
Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.
DEFF Research Database (Denmark)
Zerbe, Philipp; Chiang, Angela; Dullat, Harpreet
2014-01-01
Marrubium vulgare (Lamiaceae) is a medicinal plant whose major bioactive compounds, marrubiin and other labdane-related furanoid diterpenoids, have potential applications as anti-diabetics, analgesics or vasorelaxants. Metabolite and transcriptome profiling of M. vulgare leaves identified five...... different candidate diterpene synthases (diTPSs) of the TPS-c and TPS-e/f clades. We describe the in vitro and in vivo functional characterization of the M. vulgare diTPS family. In addition to MvEKS ent-kaurene synthase of general metabolism, we identified three diTPSs of specialized metabolism: MvCPS3...
International Nuclear Information System (INIS)
Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya
2015-01-01
Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds
Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya
2015-08-01
Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.
Energy Technology Data Exchange (ETDEWEB)
Joshi, Anjali, E-mail: joshianjali1982@gmail.com; Sharma, Arti [Centre For Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Nayyar, Harsh [Department of Botany, Panjab University, Chandigarh (India); Verma, Gaurav [Dr. SS Bhatnagar University Institute of Chemical Engineering and Technology, Panjab University, Chandigarh (India); Dharamvir, Keya [Department of Physics, Panjab University, Chandigarh (India)
2015-08-28
Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.
DEFF Research Database (Denmark)
Krusell, L; Rasmussen, I; Gausing, K
1997-01-01
of knotted1 from maize was isolated from barley seedlings and expressed as a maltose binding protein fusion in E. coli. The purified HvH21-fusion protein selected DNA fragments with 1-3 copies of the sequence TGAC. Gel shift experiments showed that the TGAC element was required for binding and the results...
Directory of Open Access Journals (Sweden)
M. Vazirian
2015-12-01
Full Text Available Background and Objectives: Essential oils are very complex mixture of components and their composition may vary in different species or varieties or even within the same variety. Origanum vulgare L. subsp. vulgare is one of the most distributed subspecies within the genus Origanum and has been found to be a poor-oil, categorized in cymyl, bornane or sabinyl chemotypes with higher proportion of sesquiterpenes. In this experiment, the Iranian sample was studied for the chemical composition of the oil and evaluation of its antioxidant activity. Methods: Essential oil was obtained by hydro-distillation and analyzed by GC/MS for determination of components. Antioxidant activity was evaluated by radical scavenging ability (DPPH method and reducing power (FRAP assay. Results: The sample belonged to “thymol” chemotype with the main components as thymol (37.13%, gama-terpinene (9.67%, carvacrol (9.57%, carvacrol methyl ether (6.88, cis-alpha-bisabolene (6.80%, eucalyptol (3.82%, p-cymene (3.58% and elemol (2.04%. The oil of plant showed very strong antioxidant activity (IC50=2.5 µg/mL in DPPH method, which was stronger than the standard antioxidants (Vit E and BHA, p
Coté, Héloïse; Boucher, Marie-Anne; Pichette, André; Legault, Jean
2017-05-25
Background: Tanacetum vulgare L. (Asteraceae) is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean), Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Directory of Open Access Journals (Sweden)
Héloïse Coté
2017-05-01
Full Text Available Background: Tanacetum vulgare L. (Asteraceae is a perennial herb that has been used to treat multiple ailments. Regional variability of the chemical composition of T. vulgare essential oils is well-known. Despite these regional chemotypes, most relevant studies did not analyze the complete chemical composition of the T. vulgare essential oil and its constituents in relation to their biological activities. Here, we assess the anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities of T. vulgare collected from northern Quebec (Saguenay-Lac-St-Jean, Canada. Methods: Essential oil was extracted from plants by steam distillation and analyzed using GC-FID. Biological activities of essential oil and its main constituents were evaluated in vitro. Results: We identified the major compounds as camphor, borneol, and 1,8-cineole. The oil possesses anti-inflammatory activity inhibiting NO production. It also inhibits intracellular DCFH oxidation induced by tert-butylhydroperoxide. Anti-inflammatory activity of essential oil appears driven mainly by α-humulene while antioxidant activity is provided by α-pinene and caryophyllene oxide. Essential oil from T vulgare was active against both Escherichia coli and Staphylococcus aureus with camphor and caryophyllene oxide responsible for antibacterial activity. Finally, T. vulgare essential oil was slightly cytotoxic against the human healthy cell line WS1 while α-humulene and caryophyllene oxide were moderately cytotoxic against A-549, DLD-1, and WS1. Conclusion: We report, for the first time, links between the specific compounds found in T. vulgare essential oil and anti-inflammatory, antioxidant, antibacterial, and cytotoxic activities. T. vulgare essential oil possesses interesting biological properties.
Technetium-99 toxicity to plants and sorption by soils
International Nuclear Information System (INIS)
Gast, R.G.; Thorvig, L.H.; Landa, E.R.; Gallagher, K.J.
1978-01-01
The potential toxic effects of 99 Tc on germinating seeds and young seedlings of wheat (Triticum aestivum L.), barley (Hordeum vulgare L.), oats (Avena sativa L.), radishes (Raphanus sativus L.), soybeans (Glycine max L.), and corn (Zea mays L.) were studied by germinating and growing seedlings in 50 ml of one-third to one-half strength Hoagland solution containing increasing 99 Tc concentrations. All species showed shoot and root tissue yield reductions at low 99 Tc concentrations, with greatest yield reductions for the three small grains and radishes occurring below 2.5 μCi 99 Tc/50 ml solution or 3.0 μg Tc/ml. The greatest yield reductions for soybeans and corn occurred at higher 99 Tc concentrations in solution but at comparable concentrations in tissue. Significant yield reductions in wheat seedlings occurred after post-germination additions of 99 Tc. This indicates that seedlings are sensitive to 99 Tc toxicity at later stages of growth. Wheat plants grown to maturity in soils to which 99 Tc was added 7, 17, and 33 days after planting showed much greater 99 Tc concentrations in older than in newer leaves; concentrations in seeds were 40 to 80 times less than those in vegetative tissue. Results for 99 Tc sorption on four different samples of Nicollet (Aquic Hapludoll) and Bergland (Aeric Haplaquept) soils showed little sorption by the Nicollet soils. In contrast, all Bergland samples showed significant but variable sorption rates. Although there were some differences in the chemical and physical properties of the Bergland samples, it is difficult to correlate these differences with differences in their 99 Tc sorption properties
AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel
Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.
2003-01-01
The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible
Origanum vulgare (Lamiaceae OVICIDAL POTENTIAL ON GASTROINTESTINAL NEMATODES OF CATTLE
Directory of Open Access Journals (Sweden)
Luciana Laitano Dias de Castro
2013-12-01
Full Text Available Due to anthelmintic resistance in nematodes, several research studies have been developed seeking control alternatives to these parasites. This study evaluated the in vitro action of Origanum vulgare on gastrointestinal nematode eggs of cattle. In order to evaluate the ability to inhibit egg hatch, different dried leaves extracts of this plant were tested, such as dye, hydroalcoholic and aqueous extracts at concentrations varying from 0.62 to 80 mg/mL. Each assay was accompanied by control containing levamisole hydrochloride (0.2 mg/mL, distilled water and 70 ºGL grain alcohol at the same concentration of the extracts. Test results showed that the different O. vulgare extracts inhibited egg hatch of cattle gastrointestinal nematodes at a percentage that varied from 8.8 to 100%; dye and hydroalcoholic extract were the most promising inhibitors. In view of this ovicidal property, O. vulgare may be an important source of viable antiparasitic compounds for nematodiosis control in ruminants.
Directory of Open Access Journals (Sweden)
M. T. Tinoco
2007-01-01
Full Text Available O Foeniculum vulgare Mill. subsp. vulgare é uma planta espontânea da região mediterrânea, pertencente à família Apiaceae. O seu óleo essencial, principalmente o dos frutos secos, é amplamente utilizado nas indústrias alimentar, farmacêutica, cosmética e perfumaria. Neste trabalho, pretendeu-se avaliar a actividade antimicrobiana do óleo essencial dos frutos verdes e das folhas da variedade de funcho doce colhido no Alentejo, na região de Évora, e relacionar essa actividade com a respectiva composição química. A extracção dos óleos essenciais foi efectuada por hidrodestilação e a sua análise foi feita por GC-FID e GC-MS. No óleo das folhas foram identificados como componentes maioritários os fenilpropanóides anetol, fenchona e estragol e o monoterpeno a-felandreno, enquanto que o óleo dos frutos apresentou como constituintes predominantes anetol e fenchona. A actividade antimicrobiana dos óleos foi avaliada face às estirpes Staphylococcus aureus, Escherichia coli, Saccharomyces spp., Fusarium oxysporum e Penicillium sp.. Os óleos essenciais apresentaram actividade antimicrobiana contra S. aureus, Saccharomyces spp. e Fusarium oxysporum.Foeniculum vulgare Mill. ssp. vulgare is a spontaneous plant of Mediterranean region that belongs to the Apiaceae family. Its essential oil is used as additives in food, pharmaceutical, cosmetic and perfume industries mainly that one obtained from dried seeds. The main goal of this work were to evaluate the antimicrobial activity of essential oils obtained from fresh leaves and unripe seeds of sweet fennel, collected in Évora-Alentejo, in face of their chemical composition. The extraction of the essentials oils was made by hydrodistillation. Chemical analyses were carried out by GC-FID and GCMS. Phenylpropanoides anethole, fenchone, estragole and the monoterpene aphellandrene were the most abundant compounds of leaves essential oil. Seeds essential oil showed as main components
Registration of ‘Kardia’, a Two-Rowed Spring Food Barley
‘Kardia’ (Reg. No. XXXX, XXXX), a two-rowed spring food barley (Hordeum vulgare L.) developed by the USDA-ARS, Aberdeen, ID, in cooperation with the University of Idaho Agricultural Experiment Station, was released in 2015. Kardia is derived from the cross of ‘03AH3054 / 98Ab12019’ and was advanced...
Effects of Net Blotch ( Pyrenophora teres ) on Malt Barley Yield and ...
African Journals Online (AJOL)
Barley (Hordeum vulgare L.) production is constrained by diseases such as net blotch caused by Pyrenophora teres Drechsl. The objectives of this study were to assess the effects of net blotch disease on malt barley yield and grain quality under natural infection. Four malt barley varieties (Beka, HB 120, HB 52 and Holker), ...
Directory of Open Access Journals (Sweden)
Saeide Saeidi
2014-10-01
Full Text Available Background: Herbal medicines are the major remedy in traditional medical systems and made a great contribution in maintaining human health and in preventing many infectious diseases. The present study was carried out to determine the potential antibacterial effect of ethanol extracts and essential oil of Marrubium vulgare L. against Staphylococcus aureus which is antibiotic resistant. Materials and Methods: All 17 strains of S. aureus isolated from nose and throat sample from 160 healthy subjects, hospital staffs and inpatient in the city of Zabol (Amir Al-Momenin hospital, Zabol, south-eastern Iran were screened during years 2010-2011. In this study, the essential oil of Marrubium vulgare L. obtained by hydrodistillation was analyzed by gas chromatography coupled to mass spectrometry (GC-MS in order to determine their chemical composition. The minimum inhibitory concentrations were investigated to characterize the antimicrobial activities of this essential oil and extract. Results: Thirty-one components in the oil of Marrubium vulgare were identified. The results demonstrated that the major components of the essential oil were γ-Eudesmol (11%, Germacrene (10%, D-Citronelly formate (10%, β-Citronellol (8%, Geranyl tiglate (7.1%, Geranyl formate (6.02%. The least MIC value of extract M. vulgare was 2.5 mg/mL and the highest MIC value of essential oil M. vulgare was 2.5 mg/mL. Conclusion: This investigation showed that the M. vulgare essential oil and extract has a potent antimicrobial activity against S. aureus. The present studies confirm the use of this essential oil and extract as antibacterial agent. Further research is required to evaluate the practical values of therapeutic applications.
Directory of Open Access Journals (Sweden)
A. V. Toledo
Full Text Available Se investigó la ocurrencia natural del hongo entomopatógeno Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales en adultos de Delphacodes kuscheli Fennah y D. haywardi Muir (Hemiptera: Delphacidae, criados sobre Hordeum vulgare L. bajo condiciones de invernadero. Los insectos muertos, por una sospechada infección fúngica, fueron recolectados, esterilizados superficialmente, y examinados en el laboratorio. Conidiobolus coronatus fue aislado en cultivos puros, descrito morfológicamente y depositado en colecciones micológicas. Este trabajo presenta el primer registro de C. coronatus contra insectos perjudiciales en la Argentina.The natural occurrence of the entomopathogenic fungus Conidiobolus coronatus (Costantin Batko (Zygomycetes: Entomophthorales in adults of Delphacodes kuscheli Fennah and D. haywardi Muir (Hemiptera: Delphacidae, reared on Hordeum vulgare L. under greenhouse conditions, was investigated. Dead insects, suspected of fungal infection, were collected, surface sterilized, and examined in the laboratory. Conidiobolus coronatus was isolated in pure cultures, described morphologically, and deposited in mycological collections. This paper presents the first record of C. coronatus against harmful insects in Argentina.
DEFF Research Database (Denmark)
Thomsen, I.K.; Jensen, E.S.
1994-01-01
The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots re...... mineral fertilizer was in the second and third barley crop similar to the recovery of N from incorporated plant residues.......The recovery by spring barley (Hordeum vulgare L.) of nitrogen mineralized from N-15-labelled straw and ryegrass material was followed for 3 years in the field. The effects of separate and combined applications of straw and ryegrass were studied using cross-labelling with N-15. Reference plots...... receiving (NH4NO3)-N-15-N-15 were included. Plant samples were taken every second week until maturity during the first growing season and at maturity in the two following years. Incorporation of plant material had no significant influence on the above-ground dry matter yield of the barley. The barley...
Implementation of biochemical screening to improve baking quality of barley
DEFF Research Database (Denmark)
Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per
2011-01-01
Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the phys......Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... on the physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...
Energy Technology Data Exchange (ETDEWEB)
Zeiger, E; Rafalowsky, J [Chile Univ., Santiago. Departamento de Biologia y Genetica
1976-01-01
A bioassay for cell differentiation during stomatal development in barley (Hordeum vulgare L.) has been defined. It uses cell kinetics analysis to follow the temporal course of cell divisions in the developmental sequence. The rate of displacement of the divisions along the stomatal rows provides a measure of differentiation. Physical factors affecting differentiation may be tested with intact seedlings. The bioassay showed that X-ray irradiation inhibited the divisions leading to stomatal formation. The inhibition kinetics was similar to the one observed in root meristems. Chemical substances are tested by culturing excised shoots in a synthetic medium. Detached leaves responded to sucrose and light with increasing rates of stomatal divisions. Gibberellic acid (GA/sub 3/) was assayed for its effects on the growth of the leaf and the differentiation of stomata. GA/sub 3/ increased the overall length of the leaves without affecting the rates of cell division. The treated cells responded with increased elongation rates and a precocious initiation and completion of cell enlargement. GA/sub 3/ had no specific effect on stomatal differentiation.
Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)
DEFF Research Database (Denmark)
Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke
1986-01-01
The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...
Physiological effects and transport of 24-epibrassinolide in heat-stressed barley
Czech Academy of Sciences Publication Activity Database
Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.
2011-01-01
Roč. 33, č. 4 (2011), s. 1249-1259 ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011
DEFF Research Database (Denmark)
Thomsen, Ingrid K; Pedersen, Asger R; Nyord, Tavs
2010-01-01
, and losses via N2O. Two field experiments were carried out on a loamy sand. Pig slurry was applied to established crops, i.e., to spring barley (Hordeum vulgare L.) in May 2007, and to winter wheat (Triticum aestivum L.) in April 2008. In 2007 the slurry was applied by direct injection using either winged...
Ridging in autumn as an alternative to mouldboard ploughing in a humid-temperate region
DEFF Research Database (Denmark)
Henriksen, Jens Christian Martin Bugge; Rasmussen, Jesper; Søgaard, Carsten
2006-01-01
and ploughing. Residue treatments were stubble, stubble + straw and stubble + liquid manure in order to create a gradient of C/N ratios. From the time of harvest until planting of a subsequent barley crop (Hordeum vulgare L.), inorganic N was determined 11 times in 1998–1999 and 10 times in 1999–2000 in the 0...
International Nuclear Information System (INIS)
Ramulu, K.S.
1980-01-01
The M 2 and M 3 plants derived from both fast neutron and X-ray treatments have been studied to detect and analyse reciprocal translocations in Arabidopsis thaliana (L.) Heynh. cv. Landsberg erecta (2n=10), Hordeum vulgare L. cv. Aramir (2n=14) and Secale cereale L., summer inbred line ZF9 (2n=14). (Auth.)
Czech Academy of Sciences Publication Activity Database
Efimova, N.V.; Vaňková, Radomíra; Kusnetsov, V.; Litvinovskaya, R. P.; Zlobin, Y.L.; Dobrev, Petre; Vedenicheva, N.P.; Savchuk, A. L.; Karnachuk, R. A.; Kudryakova, N.V.; Kuznetsov, V. D.
2017-01-01
Roč. 120, APR (2017), s. 32-40 ISSN 0039-128X Institutional support: RVO:61389030 Keywords : lupinus-luteus cotyledons * arabidopsis-thaliana * de-etiolation * abscisic-acid * brassinosteroid biosynthesis * plant development * hormonal balance * mutant * expression * growth * Brassinosteroids * Cytokinin * Gene expression * Green light * Hordeum vulgare * Transcription Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.282, year: 2016
Directory of Open Access Journals (Sweden)
Manzoor A. Rather
2016-11-01
Full Text Available Foeniculum vulgare (Apiaceae commonly known as fennel is a well known and important medicinal and aromatic plant widely used as carminative, digestive, lactogogue and diuretic and in treating respiratory and gastrointestinal disorders. Its seeds are used as flavourings in baked goods, meat and fish dishes, ice cream, alcoholic beverages and herb mixtures. Phenols, phenolic glycosides and volatile aroma compounds such as trans-anethole, estragole and fenchone have been reported as the major phytoconstituents of this species. Different pharmacological experiments in a number of in vitro and in vivo models have convincingly demonstrated the ability of F. vulgare to exhibit antifungal, antibacterial, antioxidant, antithrombotic and hepatoprotective activities, lending support to the rationale behind several of its therapeutic uses. Phenolic compounds isolated from F. vulgare are considered to be responsible for its antioxidant activity while the volatile aroma compounds make it an excellent flavouring agent. The present review is an up-to-date and comprehensive analysis of the chemistry, pharmacology, traditional uses and safety of F. vulgare.
Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins
DEFF Research Database (Denmark)
Bagger Jørgensen, Rikke
1986-01-01
The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...
The genetics and mechanism of avoidance of rust infection in Hordeum chilense
Vaz Patto, M.C.
2001-01-01
Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae
Environmental adaptibility of tansy ( Tanacetum vulgare L ...
African Journals Online (AJOL)
Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for laboratory research ...
Environmental adaptibility of tansy (Tanacetum vulgare L.)
African Journals Online (AJOL)
STORAGESEVER
2009-11-16
Nov 16, 2009 ... Ecological role of essential oils is reflected in the interaction of plants with environmental factors. Environmental adaptability of the plants can be assumed from essential oil contents. Essential oils are agents, which communicate with the plant environment. Tansy (Tanacetum vulgare L.) was selected for.
Faleiro, Leonor; Miguel, Graça; Gomes, Sónia; Costa, Ludmila; Venâncio, Florencia; Teixeira, Adriano; Figueiredo, A Cristina; Barroso, José G; Pedro, Luis G
2005-10-19
Antilisterial activities of Thymbra capitata and Origanum vulgare essential oils were tested against 41 strains of Listeria monocytogenes. The oil of T. capitata was mainly constituted by one component, carvacrol (79%), whereas for O. vulgare three components constituted 70% of the oil, namely, thymol (33%), gamma-terpinene (26%), and p-cymene (11%). T. capitata essential oil had a significantly higher antilisterial activity in comparison to O. vulgare oil and chloramphenicol. No significant differences in L. monocytogenes susceptibilities to the essential oils tested were registered. The minimum inhibitory concentration values of T. capitata essential oil and of carvacrol were quite similar, ranging between 0.05 and 0.2 microL/mL. Antioxidant activity was also tested, the essential oil of T. capitata showing significantly higher antioxidant activity than that of O. vulgare. Use of T. capitata and O. vulgare essential oils can constitute a powerful tool in the control of L. monocytogenes in food and other industries.
DNA replication after mutagenic treatment in Hordeum vulgare.
Kwasniewska, Jolanta; Kus, Arita; Swoboda, Monika; Braszewska-Zalewska, Agnieszka
2016-12-01
The temporal and spatial properties of DNA replication in plants related to DNA damage and mutagenesis is poorly understood. Experiments were carried out to explore the relationships between DNA replication, chromatin structure and DNA damage in nuclei from barley root tips. We quantitavely analysed the topological organisation of replication foci using pulse EdU labelling during the S phase and its relationship with the DNA damage induced by mutagenic treatment with maleic hydrazide (MH), nitroso-N-methyl-urea (MNU) and gamma ray. Treatment with mutagens did not change the characteristic S-phase patterns in the nuclei; however, the frequencies of the S-phase-labelled cells after treatment differed from those observed in the control cells. The analyses of DNA replication in barley nuclei were extended to the micronuclei induced by mutagens. Replication in the chromatin of the micronuclei was rare. The results of simultanous TUNEL reaction to identify cells with DNA strand breaks and the labelling of the S-phase cells with EdU revealed the possibility of DNA replication occurring in damaged nuclei. For the first time, the intensity of EdU fluorescence to study the rate of DNA replication was analysed. Copyright © 2016 Elsevier B.V. All rights reserved.
Diversity in Indian barley (Hordeum vulgare) cultivars and ...
Indian Academy of Sciences (India)
tinguish varieties of crop plants and establish their purity as a prerequisite for any ... of genetic material in germplasm collection and as a general guide for the choice ... Sixty-nine barley cultivars were grown under field condi- tions in three ...
Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley
Czech Academy of Sciences Publication Activity Database
Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav
2008-01-01
Roč. 9, č. 294 (2008), s. 1-9 ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008
Czech Academy of Sciences Publication Activity Database
Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.
2011-01-01
Roč. 93, č. 3 (2011), s. 613-625 ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011 http://sipav.org/main/jpp/index.php/jpp/article/view/1229
Radiation induced early maturing mutants in barley
International Nuclear Information System (INIS)
Kumar, R.; Chauhan, S.V.S.; Sharma, R.P.
1978-01-01
In M 2 generation, two early maturing plants were screened from a single spike progeny of a plant obtained from 20 kR of gamma-ray irradiation of a six-rowed barley (Hordeum vulgare L. var. Jyoti). Their true breeding nature was confirmed in M 3 generation. These mutants flower and mature 38 and 22 days earlier than those of control. (auth.)
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Sorghum vulgare 名詞 一般 * * * * モロコ...シ モロコシ モロコシ Thesaurus2015 200906063836088318 C LS06/LS72 UNKNOWN_2 Sorghum vulgare
Omslaget - hvid okseøje (Leucanthemum vulgare)
DEFF Research Database (Denmark)
Friis, Ib
2010-01-01
Artiklen redergør for den historiske baggrund for den illustration (tavle 994 fra Flora Danica, udgivet i 1790) af hvid okseøje (Leucanthemum vulgare), der er anvendt som illustration på festskriftets omslag. De illustratorer, der blev anvendt af Martin Vahl, udgiver af Flora Danica da tavle 994...
Foderstater för ökad konsumtion av vallfoder
DEFF Research Database (Denmark)
Hetta, M.; Lund, Peter; Tahir, M.N.
2011-01-01
nedbrytningen från våmmen till tunntarmen. Nedbrytning av stärkelse i tunntarmen leder till högre energieffektivitet i ämnesomsättningen. Stärkelse hos korn (Hordeum Vulgare, L) anses i litteraturen ha en snabb omsättning i våmmen och stärkelse hos majs (Zea Mays, L) anses ha en långsam nedbrytning (Mills et al...
Toxicities of TNT and RDX to Terrestrial Plants in Five Soils with Contrasting Characteristics
2013-07-01
lettuce ( Lactuca sativa (L.)) and barley (Hordeum vulgare (L.)), respectively, at analytically determined soil concentrations up to and including 3320... sativa L.), Japanese millet (J. millet; Echinochloa crus-galli L. [Beauv.]), and perennial ryegrass (Lolium perenne L.) in five natural soils that...of the test. The test species in these studies were Medicago sativa (L.) var. Canada no. 1 (alfalfa), Echinochloa crus-galli (L.) P. Beauv. var
The Phytotoxicity of Designated Pollutants on Plant Species
1984-03-01
Only seeds collected from those flowers exposed during pollin 20. DISTRIBUTION/AVAILABILITY OF ABSTRACT 21. ABSTRACT SECURITY CLASSIFICATION...acid exposure during pollination lowered the germination rate of mature seeds. Plant injury was chiefly a function of acid concentration, but amount...TESTS Species Name Variety Barley Hordeum vulgare L. CM67 Bean Phaseolus vulgaris L. Pinto Citrus Citrus limon (L.) Lupe Lemon Lettuce Lactuca sativa
Radioprotective effects of ascorbic acid in barley seeds
Energy Technology Data Exchange (ETDEWEB)
Conger, B V
1975-01-01
Experiments were conducted to test the radioprotective effects of a naturally occurring reducing agent, ascorbic acid, on seeds (caryopses) of barley, Hordeum vulgare L. emend Lam. Seeds were soaked either before or after ..gamma.. or fission neutron irradiation in distilled water or ascorbic acid solutions ranging in concentration from 0.01 to 1.00 M. Results are reported as percentage germination, seedling height, seedling growth reduction, and (in one experiment) percent of cells with chromosome aberrations. As evidenced by both reduced germination and seedling growth, ascorbic acid was toxic when seeds were soaked for 1 hr at ambient temperature prior to irradiation and then planted immediately. When seeds were soaked in ascorbic acid before irradiation and soaked after irradiation in air-bubbled water at 0/sup 0/C for 18 hr, the toxicity disappeared, and a protective effect (which increased with increasing ascorbic acid concentration) was observed for ..gamma.. and, to a lesser extent, for neutron irradiation. Additional studies suggested that the protective effect was related to reduced hydration of the embryos of seeds soaked in ascorbic acid. Also, no radioprotective effect was observed when seeds were presoaked for 2 or 16 hr in 0.01 M ascorbic acid solutions buffered at pH 3 or pH 7. A protective effect was observed for seeds of 1.5 percent water content soaked after irradiation in an oxygen-bubbled ascorbic acid solution of 0.5 M but was not observed for seeds soaked in nitrogen-bubbled ascorbic acid. The protective effect against oxygen-dependent damage may be a result of interaction of ascorbic acid with radiation-induced free radicals.
Directory of Open Access Journals (Sweden)
Jonathan Brassac
Full Text Available Polyploidization is a major mechanism of speciation in plants. Within the barley genus Hordeum, approximately half of the taxa are polyploids. While for diploid species a good hypothesis of phylogenetic relationships exists, there is little information available for the polyploids (4×, 6× of Hordeum. Relationships among all 33 diploid and polyploid Hordeum species were analyzed with the low-copy nuclear marker region TOPO6 for 341 Hordeum individuals and eight outgroup species. PCR products were either directly sequenced or cloned and on average 12 clones per individual were included in phylogenetic analyses. In most diploid Hordeum species TOPO6 is probably a single-copy locus. Most sequences found in polyploid individuals phylogenetically cluster together with sequences derived from diploid species and thus allow the identification of parental taxa of polyploids. Four groups of sequences occurring only in polyploid taxa are interpreted as footprints of extinct diploid taxa, which contributed to allopolyploid evolution. Our analysis identifies three key species involved in the evolution of the American polyploids of the genus. (i All but one of the American tetraploids have a TOPO6 copy originating from the Central Asian diploid H. roshevitzii, the second copy clustering with different American diploid species. (ii All hexaploid species from the New World have a copy of an extinct close relative of H. californicum and (iii possess the TOPO6 sequence pattern of tetraploid H. jubatum, each with an additional copy derived from different American diploids. Tetraploid H. bulbosum is an autopolyploid, while the assumed autopolyploid H. brevisubulatum (4×, 6× was identified as allopolyploid throughout most of its distribution area. The use of a proof-reading DNA polymerase in PCR reduced the proportion of chimerical sequences in polyploids in comparison to Taq polymerase.
Antibacterial activity of whole plant extract of Marrubium vulgare
African Journals Online (AJOL)
SERVER
2007-11-26
Nov 26, 2007 ... Key words: Disc diffusion, antibacterial activity, Marrubium vulgare. INTRODUCTION .... Glossary of Indian Medicinal. Plants, CSIR, V ed. ... 22. E. coli MTCC 443. 0. 0. 0. 10. 15. 400. 25. P. vulgaris MTCC 426. 0. 0. 0. 11. 16.
Directory of Open Access Journals (Sweden)
Shamkant B. Badgujar
2014-01-01
Full Text Available Foeniculum vulgare Mill commonly called fennel has been used in traditional medicine for a wide range of ailments related to digestive, endocrine, reproductive, and respiratory systems. Additionally, it is also used as a galactagogue agent for lactating mothers. The review aims to gather the fragmented information available in the literature regarding morphology, ethnomedicinal applications, phytochemistry, pharmacology, and toxicology of Foeniculum vulgare. It also compiles available scientific evidence for the ethnobotanical claims and to identify gaps required to be filled by future research. Findings based on their traditional uses and scientific evaluation indicates that Foeniculum vulgare remains to be the most widely used herbal plant. It has been used for more than forty types of disorders. Phytochemical studies have shown the presence of numerous valuable compounds, such as volatile compounds, flavonoids, phenolic compounds, fatty acids, and amino acids. Compiled data indicate their efficacy in several in vitro and in vivo pharmacological properties such as antimicrobial, antiviral, anti-inflammatory, antimutagenic, antinociceptive, antipyretic, antispasmodic, antithrombotic, apoptotic, cardiovascular, chemomodulatory, antitumor, hepatoprotective, hypoglycemic, hypolipidemic, and memory enhancing property. Foeniculum vulgare has emerged as a good source of traditional medicine and it provides a noteworthy basis in pharmaceutical biology for the development/formulation of new drugs and future clinical uses.
Potassium-dependent changes in the expression of membrane-associated proteins in barley roots
International Nuclear Information System (INIS)
Fernando, M.; Kulpa, J.; Siddiqi, M.Y.; Glass, A.D.M.
1990-01-01
Barley (Hordeum vulgare L. cv Halcyon) seedlings which has been grown in full strength complete inorganic nutrient media (containing 6 millimolar K + ) had high internal K + concentrations and low values of K + ( 86 Rb + ) influx when influx was measured from solutions containing 100 micromolar K + . Transfer of these plants to solutions lacking K + resulted in significant reductions of root and shoot K + concentrations and values of K + ( 86 Rb + ) influx increased by greater than 10-fold within 3 days. When plants treated in this way were returned to complete solutions, containing K + , the changes induced by K + deprivation were reversed. Parallel studies of microsomal membranes by means of SDS-PAGE demonstrated that the expression of a group of polypeptides increased or decreased in parallel with changes of K + ( 86 Rb + ) influx. Most prominent of these were 45 and 34 kilodalton polypeptides which specifically responded to K + status of the barley plants; their expression was not enhanced by N or P deprivation. The 45 kilodalton polypeptide was susceptible to degradation by a membrane associated protease when microsomes were washing in buffer containing 0.2 millimolar PMSF. This loss was prevented by increasing PMSF concentration to 2 millimolar
Effect of inoculum density and soil tillage on the development and severity of rhizoctonia root rot.
Schroeder, K L; Paulitz, T C
2008-03-01
Rhizoctonia spp. cause substantial yield losses in direct-seeded cereal crops compared with conventional tillage. To investigate the mechanisms behind this increased disease, soils from tilled or direct-seeded fields were inoculated with Rhizoctonia spp. at population densities from 0.8 to 250 propagules per gram and planted with barley (Hordeum vulgare). The incidence and severity of disease did not differ between soils with different tillage histories. Both R. solani AG-8 and R. oryzae stunted plants at high inoculum densities, with the latter causing pre-emergence damping-off. High inoculum densities of both species stimulated early production of crown roots in barley seedlings. Intact soil cores from these same tilled and direct-seeded fields were used to evaluate the growth of Rhizoctonia spp. from colonized oat seeds. Growth of R. oryzae was not affected by previous tillage history. However, R. solani AG-8 grew more rapidly through soil from a long-term direct-seeded field compared to tilled soils. The differential response between these two experiments (mixed, homogenized soil versus intact soil) suggests that soil structure plays a major role in the proliferation of R. solani AG-8 through soils with different tillage histories.
Effect of dietary oregano ( Origanum vulgare L.) essential oil on ...
African Journals Online (AJOL)
Effect of dietary oregano ( Origanum vulgare L.) essential oil on growth performance, cecal microflora and serum antioxidant activity of broiler chickens. ... promoting effects and also displayed potent antibacterial effects against cecal E. coli.
Directory of Open Access Journals (Sweden)
Stefan Reuscher
Full Text Available The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs. In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum in the cultivated variety Hordeum vulgare ssp. vulgare cv. Scarlett. Plants were cultivated on an anthropogenically heavy metal-contaminated soil collected in an agricultural field, thus allowing simultaneous localization of quantitative trait loci (QTL for the accumulation of both essential nutrients and toxic trace elements in barley as a model cereal crop. For accumulation of the micronutrients Fe and Zn and the interfering toxin Cd, we identified 25, 16 and 5 QTL, respectively. By examining the gene content of the introgressions, we associated QTL with candidate genes based on homology to known metal homeostasis genes of Arabidopsis and rice. Global comparative analyses suggested the preferential remobilization of Cu and Fe, over Cd, from the flag leaf to developing grains. Our data identifies grain micronutrient filling as a regulated and nutrient-specific process, which operates differently from vegetative micronutrient homoeostasis. In summary, this study provides novel QTL for micronutrient accumulation in the presence of toxic analogues and supports a higher degree of metal specificity of trace element partitioning during grain filling in barley than previously reported for other cereals.
Czech Academy of Sciences Publication Activity Database
Štroch, Michal; Materová, Z.; Vrábl, D.; Karlický, Václav; Šigut, Ladislav; Nezval, J.; Špunda, Vladimír
2015-01-01
Roč. 96, nov (2015), s. 90-96 ISSN 0981-9428 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk(CZ) LM2010007 Grant - others:EHP(CZ) EHP-CZ02-OV-1-014-2014 Program:CZ02 Institutional support: RVO:67179843 Keywords : barley (Hordeum vulgare L.) * chlorophyll fluorescence * photosynthesis * photosynthetic pigments * UV-A radiation * UV-B radiation Subject RIV: BO - Biophysics Impact factor: 2.928, year: 2015
Variability of barley aleurone layer induced by X-rays
Directory of Open Access Journals (Sweden)
Romuald Kosina
2015-05-01
Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.
Green Fodder Production and Water Use Efficiency of Some Forage Crops under Hydroponic Conditions
Ghazi N. Al-Karaki; M. Al-Hashimi
2012-01-01
The objectives of this study were to evaluate five forage crops (alfalfa (Medicago sativa), barley (Hordeum vulgare), cowpea (Vigna unguiculata), sorghum (Sorghum bicolor), and wheat (Triticum aestivum)) for green fodder production and water use efficiency under hydroponic conditions. The experiment has been conducted under temperature-controlled conditions (24 ± 1°C) and natural window illumination at growth room of Soilless Culture Laboratory, Arabian Gulf University, Manama, Bahrain. The r...
Begnini, Karine Rech; Nedel, Fernanda; Lund, Rafael Guerra; Carvalho, Pedro Henrique de Azambuja; Rodrigues, Maria Regina Alves; Beira, Fátima Tereza Alves; Del-Pino, Francisco Augusto Burkert
2014-10-01
Cancer is a leading cause of death and is responsible for one in eight deaths worldwide. The use of herbs as complementary medicine for cancer, especially advanced cancer, has recently increased. The aim of this study was to evaluate in vitro, the antiproliferative effect of Origanum vulgare against human breast adenocarcinoma (MCF-7), and human colon adenocarcinoma (HT-29). The essential oil (EO) was extracted from a bought amount of O. vulgare dried leaves and analyzed in a gas chromatograph interfaced with a mass selective detector. The cytotoxicity test was performed by sulforhodamine B assay. The results show that the EO is composed mostly of 4-terpineol and induces a high cytotoxicity effect in HT-29. In the MCF-7 cell line the EO was less effective. In conclusion, this study showed that O. vulgare main component is 4-terpineol and was effective in inducing cancer cell growth inhibition.
Souza,Evandro Leite de; Stamford,Tânia Lúcia Montenegro; Lima,Edeltrudes de Oliveira
2006-01-01
Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...
108-110 Registration of Guta Barley (Hordeium vulgare L.)
African Journals Online (AJOL)
adoption potential by the local farmers. Keywords: Guta; Barley (Hordeium vulgare L); Yield ... evaluated along with Aruso and Shage as the local and standard variety, respectively at altitudinal range of 2400- ... 6. Farmers Evaluation of the Variety. To evaluate the perception and preferences of the local farmers, farmers' ...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
SDS-PAGE was performed to separate the extracted pro- teins by using 12% separating and 5% stacking gels with a. Mini Protean System from Bio-Rad according to Laemmli modified method (Laemmli 1970). In this study, we adopted constant current electrophoresis instead of constant voltage. The loading of sample was ...
Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...
African Journals Online (AJOL)
segregating progenies with maximum genetic variability for selection. .... cultivar Clipper applied in slots of the first two, the tenth, and the last ... solution (50 ml glacial acetic acid, 200 ml methanol and 250 ml distilled water) ...... Adelaide, South.
Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain
DEFF Research Database (Denmark)
Ingversen, J.; Køie, B.
1973-01-01
The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein gro...
Genetic diversity in barley landraces (Hordeum vulgare L. subsp ...
Indian Academy of Sciences (India)
its nutritional value and low glycemic index (Ullrich 2011). Lebanon belongs to the ... Rim Mzid and Farhat Chibani contributed equally to this work. biochemical accomplished ..... environment interaction of hordein content. J. Cereal Sci. 34,.
Latent manganese deficiency increases transpiration in barley (Hordeum vulgare).
Hebbern, Christopher A; Laursen, Kristian Holst; Ladegaard, Anne H; Schmidt, Sidsel B; Pedas, Pai; Bruhn, Dan; Schjoerring, Jan K; Wulfsohn, Dvoralai; Husted, Søren
2009-03-01
To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements revealed that the quantum yield efficiency of PSII (F(v)/F(m)) was reduced from 0.83 in Mn-sufficient control plants to below 0.5 in Mn-starved plants. Leaf Mn concentrations declined from 30 to 7 microg Mn g(-1) dry weight in control and Mn-starved plants, respectively. Mn-starved plants had up to four-fold higher transpiration than control plants. Stomatal closure and opening upon light/dark transitions took place at the same rate in both Mn treatments, but the nocturnal leaf conductance for water vapour was still twice as high in Mn-starved plants compared with the control. The observed increase in transpiration was substantiated by (13)C-isotope discrimination analysis and gravimetric measurement of the water consumption, showing significantly lower water use efficiency in Mn-starved plants. The extractable wax content of leaves of Mn-starved plants was approximately 40% lower than that in control plants, and it is concluded that the increased leaf conductance and higher transpirational water loss are correlated with a reduction in the epicuticular wax layer under Mn deficiency.
International Nuclear Information System (INIS)
Bansal, Y.K.; Sen, Sumitra
1987-01-01
Rate of replication and transcription between normal and giant endopolyploid nuclei of differentiated tissue of Hordeum vulgare L. (2n=14) roots and Phlox drummondii Hook. (2n=14) and Zea mays L. (2n=20) endosperms were studied by labelling experiments with tritiated thymidine and uridine. The incorporation of thymidine and uridine was identical in both diploid and giant endopolyploid nuclei of the roots of H. vulgare. The endosperm cells of P. drummondii and Z. mays, however, exhibit markedly different labelling pattern in normal (i.e. triploid) and endopolyploid nuclei where both replication and transcription were rather high. The nutritive function of the endosperm is probably responsible for this high degree of activity. (author). 14 refs., 10 figs., 3 tables
Genetic diversity among wild and cultivated barley as revealed by RFLP
DEFF Research Database (Denmark)
Petersen, L.; Østergård, H.; Giese, H.
1994-01-01
Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp. sponta...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....... was estimated and the barley lines clustered into five groups reflecting geographical origin. The geographical groups of land-race lines showed less intragroup variation than the geographical groups of spontaneum lines. The group of European varieties, representing large variation in agronomic traits, showed...
Koleva, Vanya; Dragoeva, Asya; Stoyanova, Zheni; Yordanova, Zhenia; Ali, Selime; Uzunov, Nikolay M.; Melendez-Alafort, Laura; Rosato, Antonio; Enchev, Dobromir D.
2018-03-01
Medicinal plants produce various secondary metabolites as a part of their chemical defence and survival in nature. These compounds have a wide range of biological activities. Nowadays, medicinal plants are used as source of allelochemicals and new effective anticancer agents. Our previous studies revealed allelopathic potential of water extracts of Adonis vernalis L. (Ranunculaceae), Origanum vulgare ssp. vulgare L. and Nepeta nuda subsp. nuda (Lamiaceae). Present study aimed to evaluate the effect of the same extracts in vitro on human hepatoma cell line SK-HEP-1. Cell proliferation/viability was assessed using Premixed WST-1 Cell Proliferation Reagent. Adonis water extract (1.83mg/ml) had notable negative influence on cancer cell line tested. Oregano (3.5 mg/ml) also exerted negative effect, but to a lesser degree. On the contrary, nepeta water extract (6.59 mg/ml) had an opposite effect, stimulating cell proliferation. One possible explanation could be the type of extraction: after treatment with nepeta methanol extract (6.59 mg/ml) cell viability was significantly reduced. In conclusion, Adonis vernalis and Nepeta nuda subsp. nuda possess metabolites with growth inhibitory effect on human hepatoma cell line SK-HEP-1. Further research is needed to clarify biological activity of lower concentrations which are appropriate to enable the design of new anticancer drugs.
Potential production of Aspidosperma cylindrocarpon seedlings viarescue seedlings
Directory of Open Access Journals (Sweden)
Nathália Ferreira e Silva
Full Text Available ABSTRACT: Translocation of rare populations is regarded as the last resort for the conservation of species whose habitat destruction is imminent. The objective of the present study was to evaluate the effect of two height classes and three leaf reduction intensities on growth and increases in height, stem diameter, survival, and new leaf production in seedlings of Aspidosperma cylindrocarpon (peroba obtained via rescue seedlings in a remnant of tropical semi deciduous forest. We recovered 240 individuals that were divided into two height classes (Class I-5 to 15cm and Class II-20 to 35cm and subjected to three leaf reduction intensities (0%, 50%, and 100%, which were then transported to a shade house with 50% light reduction. Measurements of height, stem diameter, and new leaf production were collected 8 times at 0, 15, 60, 75, 90, 105, 120, and 135 days, and survival rate was measured at day 135. The average survival rate was 82.9%; 77.5% for one Class I (5-15cm and 88.3% for Class II (20-35cm. Higher seedling growth was observed for the 0% leaf reduction treatment in both height classes. The leaves insertion were greater in the 100% cuts, with a decrease observed over time. It is advisable to restore A. cylindrocarpon seedlings in two height classes owing to the high survival rate, leaf appearance, and growth reported in the present study. The no-leaf reduction treatment (0% is the most viable alternative for the production of A. cylindrocarpon seedlings, via rescue seedlings.
DEFF Research Database (Denmark)
Giese, Nanna Henriette; Hejgaard, Jørn
1984-01-01
The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....
Diane L. Haase
2011-01-01
Roots are critical to seedling performance after outplanting. Although root quality is not as quick and simple to measure as shoot quality, target root characteristics should be included in any seedling quality assessment program. This paper provides a brief review of root characteristics most commonly targeted for operational seedling production. These are: root mass...
Vulgarization of popular music tradition in Serbia
Božilović, Nikola
2011-01-01
The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...
Use of hydroponics culture to assess nutrient supply by treated wastewater.
Adrover, Maria; Moyà, Gabriel; Vadell, Jaume
2013-09-30
The use of treated wastewater for irrigation is increasing, especially in those areas where water resources are limited. Treated wastewaters contain nutrients that are useful for plant growth and help to reduce fertilizers needs. Nutrient content of these waters depends on the treatment system. Nutrient supply by a treated wastewater from a conventional treatment plant (CWW) and a lagooned wastewater from the campus of the University of Balearic Islands (LWW) was tested in an experiment in hydroponics conditions. Half-strength Hoagland nutrient solution (HNS) was used as a control. Barley (Hordeum vulgare L.) seedlings were grown in 4 L containers filled with the three types of water. Four weeks after planting, barley was harvested and root and shoot biomass was measured. N, P, K, Ca, Mg, Na and Fe contents were determined in both tissues and heavy metal concentrations were analysed in shoots. N, P and K concentrations were lower in LWW than in CWW, while HNS had the highest nutrient concentration. Dry weight barley production was reduced in CWW and LWW treatments to 49% and 17%, respectively, comparing to HNS. However, to a lesser extent, reduction was found in shoot and root N content. Treated wastewater increased Na content in shoots and roots of barley and Ca and Cr content in shoots. However, heavy metals content was lower than toxic levels in all the cases. Although treated wastewater is an interesting water resource, additional fertilization is needed to maintain a high productivity in barley seedlings. Copyright © 2013 Elsevier Ltd. All rights reserved.
The effect of abandoned mining ponds on trace elements dynamics in the soil-plant system
Gabarrón, María; Faz, Ángel; Zornoza, Raúl; Acosta, Jose A.
2017-04-01
In semiarid climate regions lack of vegetation and dryer climate contribute to erosion of abandoned mining surface areas making them up important potential sources of metal pollution into the environment. The objectives of this study were to determine the influence of mine ponds in agriculture and forest soils, and identify the dynamic of metals in the soil-plant system for native plant species (Ballota hirsuta) and crop species (Hordeum vulgare) in two ancient mining districts: La Unión and Mazarrón. To achieve these objectives, wastes samples from mine ponds and soil samples (rhizosphere and non-rhizosphere soils) from natural and agricultural lands were collected. In addition, six plants (Ballota hirsuta) from natural area and 3 plants (Hordeum vulgare) from crops were collected. Physicochemical properties and total, water soluble and bioavailable metals (Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb, and Zn) and arsenic were measured in waste/soil samples. The chemical speciation of metals in soil was estimated by a sequential extraction procedure. For plants analyses, each plant were divided in roots, stem and leaves and metal content measured by ICP-MS. Results indicated that mine, natural and agricultural soils were contaminated by As, Cd, Cu, Pb, and Zn. Chemical partitioning revealed higher mobility of metals in mine ponds than natural and agriculture soils while only Fe and As are completely bound to the soil matrix due to the mineralogical compositions of soils. The accumulation of metals in Ballota hirsuta in La Union decrease as Fe>As>Cr>Ni>Cu>Zn>Cd>Mn>Co>Pb while in Mazarrón did as As>Fe>Cr>Pb>Cu>Ni>Co>Mn>Zn>Cd. Ballota hirsuta showed high ability to bio-accumulate Cu, Cr, Fe, Ni, and As, transferring a large amount to edible parts without exceeding the toxicity limits for animals. Results for barley plants (Hordeum vulgare) showed the ability to absorb and accumulate As, Fe, Mn, Pb and Zn, although the transfer ability of As, Cd and Pb was lower. Although the
Directory of Open Access Journals (Sweden)
ARIEL J FABERI
2011-09-01
Full Text Available The studies of Armadillidium vulgare as pest are virtually null worldwide. However under no-tillage systems this species has found an adequate environment for its development and it has become an important pest in some crops in Argentina. It has been shown that the composition of vegetables affects the isopods biology. Our hypothesis was that soybean leaf litter has high nutritive value which allows A. vulgare to grow faster, survive longer, and have higher fecundity favoring the population increase and turning it into a crop pest. Growth and survivorship of juveniles and adults, egg incubation period, offspring number per female and offspring mean body weight were determined in individuals fed with leaf litter of soybean, sunflower, wheat and pasture. The growth rate coefficient, k, in juveniles was higher for soybean, intermediate for pasture and lower for sunflower. Adult growth was faster under the soybean diet. Survivorship under soybean and pasture was longer than under sunflower and wheat in both juveniles and adults. The reproductive parameters were similar in all diets, food did not generate any change in the reproductive aspects of A. vulgare. Results of the present study represent a source of information about the A. vulgare biology under different diets of agricultural origin to establish the basis for Integrated Management of this species as pest. Under soybean litter provision A. vulgare found the best conditions for faster growth, longer survival and relatively higher fecundity. In fields with soybean as preceding crop or in systems with high frequency of soybean in the crop rotation a more abundant population of A. vulgare would be found as well as with larger individuals which could cause more damage to the following crop in the rotation.Los estudios sobre Armadillidium vulgare como plaga son virtualmente nulos a nivel mundial. Sin embargo, en los sistemas bajo siembra directa esta especie ha encontrado un ambiente adecuado para
Strip Tillage and Early-Season Broadleaf Weed Control in Seeded Onion (Allium cepa)
Sarah Gegner-Kazmierczak; Harlene Hatterman-Valenti
2016-01-01
Field experiments were conducted in 2007 and 2008 near Oakes, North Dakota (ND), USA, to evaluate if strip tillage could be incorporated into a production system of seeded onion (Allium cepa) to eliminate the standard use of a barley (Hordeum vulgare) companion crop with conventional, full width tillage, yet support common early-season weed control programs. A split-factor design was used with tillage (conventional and strip tillage) as the main plot and herbicide treatments (bromoxynil, DCPA...
Salo , Tapio J.; Palosuo , Taru; Kersebaum , Kurt Christian; Nendel , Claas; Angulo , Carlos; Ewert , Frank; Bindi , Marco; Calanca , Pierluigi; Klein , Tommy; Moriondo , Marco; Ferrise , Roberto; Olesen , Jørgen Eivind; Patil , Rasmi H.; Ruget , Francoise; Takac , Jozef
2016-01-01
Eleven widely used crop simulation models (APSIM, CERES, CROPSYST, COUP, DAISY, EPIC, FASSET, HERMES, MONICA, STICS and WOFOST) were tested using spring barley (Hordeum vulgare L.) data set under varying nitrogen (N) fertilizer rates from three experimental years in the boreal climate of Jokioinen, Finland. This is the largest standardized crop model inter-comparison under different levels of N supply to date. The models were calibrated using data from 2002 and 2008, of which 2008 included si...
Isozyme differences in barley mutants
International Nuclear Information System (INIS)
AI-Jibouri, A.A.M.; Dham, K.M.
1990-01-01
Full text: Thirty mutants (M 11 ) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
Irena Januskaitiene; Jūratė Žaltauskaitė; Austra Dikšaitytė; Gintarė Sujetovienė; Diana Miškelytė; Giedrė Kacienė; Sandra Sakalauskienė; Jurga Miliauskienė; Romualdas Juknys
2018-01-01
This work focuses on the investigation of competition interaction between C3 crop barley (Hordeum vulgare L.) and C4 weed barnyard grass (Echinochloa crus-galli L.) at 2 times higher than ambient [CO2] and +4 0C higher ambient temperature climate conditions. It was hypothesized that interspecific competition will change the response of the investigated plants to increased [CO2] and temperature. The obtained results showed that in the current climate conditions, a higher biomass and photosynth...
Directory of Open Access Journals (Sweden)
Somayyeh Sadrefozalayi
2014-02-01
Full Text Available Objective: Foeniculum vulgare seed (F. vulgare is a herbal plant which is used with phytoestrogene compounds for polycystic ovary syndrome (PCOS treatment. In this research, renoprotective effect of the aqueous extract of Foeniculum vulgare (AEF in experimental PCOS female rats is studied. Materials and Methods: Forty female rats were randomly divided into five groups. The first group served as control,was injected with an equivalent volume (0.2 ml of normal saline, and received normal diet. Animals in the second group were non poly cystic ovary syndrome (PCOS rats which were treated with intragastric administration of aqueous extract of F. vulgare (150 mg/kg b.w.. In the third group, the rats were treated with intraperitoneal injection of estradiolvalerate (EV (4 mg in 0.2 ml of sesame oil. The fourth groups were treated with EV and AEF (150mg/kg bw with the same route. The fifth groups were treated with EV and AEF (100mg/kg bw. After 4 weeks of study, all of the rats were sacrificed, their kidneys tissues were processed for light microscopy, and some biochemical parameters of serum were measured. Results: The mean values of blood urea nitrogen in PCOS rats treated with low dose of AEF and EV and non-treated, was significantly (p
Oreganum vulgare Linn. leaf: An Extensive Pharmacognostical and Phytochemical Quality Assessment
Directory of Open Access Journals (Sweden)
Veni Bharti
2013-08-01
Full Text Available Purpose: Standardization and detailed pharmacognostical studies of Oreganum vulgare Linn. leaf for authentication and commercial utilization. Methods: Oreganum vulgare Linn. leaf was with standardization according to standard procedures described in WHO, 2011 and I.P. 1996. Results: The physicochemical parameters total ash, acid insoluble ash, water soluble ash and sulphated ash were found to be 11.5%, 11%, 5, 10.5% w/w respectively. Foaming index was found be <100. The trace elements were found to be copper, lead, cadmium, zinc, cobalt, manganese, nickel and copper in ethanol extract and phytochemical screening of aqueous and ethanol extract showed the presence of carbohydrates, flavonoids, anthocyanins, phenolic compounds etc. Conclusion: The standardization parameters viz. physico-chemical parameters, macroscopy, microscopy, taxonomy, anatomy and preliminary phytochemical screening, microbial and aflatoxin count, HPTLC profile is being reported to help in authentication and development of monograph of this plant.
Directory of Open Access Journals (Sweden)
M.B. Cleff
2008-04-01
Full Text Available In vitro activity of the essential oil Origanum vulgare against Sporothrix schenckii was determined by the MIC (Minimum Inhibitory Concentration. For this, seven samples of S. schenckii were studied, two isolated from two cases of human sporotrichosis and five isolated from cats. Analysis of the essential oil was carried out in a gas chromatograph (GC/FID for the identification and quantification of thymol and carvacrol (antifungal agents. MIC was obtained based on the microdilution method according to the adapted document NCCLS-M 27A2 for fitopharmacy. All the isolates presented sensibility to the essential oil. S. schenckii was inhibited in a concentration of 0.25% (250m l/ml. Chromatographic analysis showed that thymol concentration was bigger than carvacrol. The antifungal activity demonstrated by the essential oil of O. vulgare against S. Schenckii stimulates the accomplishment of more studies, including in vivo studies.
Laurie, John D; Ali, Shawkat; Linning, Rob; Mannhaupt, Gertrud; Wong, Philip; Güldener, Ulrich; Münsterkötter, Martin; Moore, Richard; Kahmann, Regine; Bakkeren, Guus; Schirawski, Jan
2012-05-01
Ustilago hordei is a biotrophic parasite of barley (Hordeum vulgare). After seedling infection, the fungus persists in the plant until head emergence when fungal spores develop and are released from sori formed at kernel positions. The 26.1-Mb U. hordei genome contains 7113 protein encoding genes with high synteny to the smaller genomes of the related, maize-infecting smut fungi Ustilago maydis and Sporisorium reilianum but has a larger repeat content that affected genome evolution at important loci, including mating-type and effector loci. The U. hordei genome encodes components involved in RNA interference and heterochromatin formation, normally involved in genome defense, that are lacking in the U. maydis genome due to clean excision events. These excision events were possibly a result of former presence of repetitive DNA and of an efficient homologous recombination system in U. maydis. We found evidence of repeat-induced point mutations in the genome of U. hordei, indicating that smut fungi use different strategies to counteract the deleterious effects of repetitive DNA. The complement of U. hordei effector genes is comparable to the other two smuts but reveals differences in family expansion and clustering. The availability of the genome sequence will facilitate the identification of genes responsible for virulence and evolution of smut fungi on their respective hosts.
Directory of Open Access Journals (Sweden)
Sameh Dbira
2018-03-01
Full Text Available Due to its high tolerance to abiotic stress, barley (Hordeum vulgare is cultivated in many arid areas of the world. In the present study, we evaluate the tolerance to water stress (drought in nine accessions of “Ardhaoui” barley landraces from different regions of Tunisia. The genetic diversity of the accessions is evaluated with six SSR markers. Seedlings from the nine accessions are subjected to water stress by completely stopping irrigation for three weeks. A high genetic diversity is detected among the nine accessions, with no relationships between genetic distance and geographical or ecogeographical zone. The analysis of growth parameters and biochemical markers in the water stress-treated plants in comparison to their respective controls indicated great variability among the studied accessions. Accession 2, from El May Island, displayed high tolerance to drought. Increased amounts of proline in water-stressed plants could not be correlated with a better response to drought, as the most tolerant accessions contained lower levels of this osmolyte. A good correlation was established between the reduction of growth and degradation of chlorophylls and increased levels of malondialdehyde and total phenolics. These biochemical markers may be useful for identifying drought tolerant materials in barley.
Coskun, Devrim; Britto, Dev T.; Li, Mingyuan; Becker, Alexander; Kronzucker, Herbert J.
2013-01-01
Futile transmembrane NH3/NH4+ cycling in plant root cells, characterized by extremely rapid fluxes and high efflux to influx ratios, has been successfully linked to NH3/NH4+ toxicity. Surprisingly, the fundamental question of which species of the conjugate pair (NH3 or NH4+) participates in such fluxes is unresolved. Using flux analyses with the short-lived radioisotope 13N and electrophysiological, respiratory, and histochemical measurements, we show that futile cycling in roots of barley (Hordeum vulgare) seedlings is predominately of the gaseous NH3 species, rather than the NH4+ ion. Influx of 13NH3/13NH4+, which exceeded 200 µmol g–1 h–1, was not commensurate with membrane depolarization or increases in root respiration, suggesting electroneutral NH3 transport. Influx followed Michaelis-Menten kinetics for NH3 (but not NH4+), as a function of external concentration (Km = 152 µm, Vmax = 205 µmol g–1 h–1). Efflux of 13NH3/13NH4+ responded with a nearly identical Km. Pharmacological characterization of influx and efflux suggests mediation by aquaporins. Our study fundamentally revises the futile-cycling model by demonstrating that NH3 is the major permeating species across both plasmalemma and tonoplast of root cells under toxicity conditions. PMID:24134887
Coskun, Devrim; Britto, Dev T; Li, Mingyuan; Becker, Alexander; Kronzucker, Herbert J
2013-12-01
Futile transmembrane NH3/NH4(+) cycling in plant root cells, characterized by extremely rapid fluxes and high efflux to influx ratios, has been successfully linked to NH3/NH4(+) toxicity. Surprisingly, the fundamental question of which species of the conjugate pair (NH3 or NH4(+)) participates in such fluxes is unresolved. Using flux analyses with the short-lived radioisotope (13)N and electrophysiological, respiratory, and histochemical measurements, we show that futile cycling in roots of barley (Hordeum vulgare) seedlings is predominately of the gaseous NH3 species, rather than the NH4(+) ion. Influx of (13)NH3/(13)NH4(+), which exceeded 200 µmol g(-1) h(-1), was not commensurate with membrane depolarization or increases in root respiration, suggesting electroneutral NH3 transport. Influx followed Michaelis-Menten kinetics for NH3 (but not NH4(+)), as a function of external concentration (Km = 152 µm, Vmax = 205 µmol g(-1) h(-1)). Efflux of (13)NH3/(13)NH4(+) responded with a nearly identical Km. Pharmacological characterization of influx and efflux suggests mediation by aquaporins. Our study fundamentally revises the futile-cycling model by demonstrating that NH3 is the major permeating species across both plasmalemma and tonoplast of root cells under toxicity conditions.
Submergence tolerance in Hordeum marinum
DEFF Research Database (Denmark)
Pedersen, Ole; Malik, Al I.; Colmer, Timothy D.
2010-01-01
Floodwaters differ markedly in dissolved CO(2), yet the effects of CO(2) on submergence responses of terrestrial plants have rarely been examined. The influence of dissolved CO(2) on underwater photosynthesis and growth was evaluated for three accessions of the wetland plant Hordeum marinum Huds....... All three accessions tolerated complete submergence, but only when in CO(2) enriched floodwater. Plants submerged for 7 days in water at air equilibrium (18 mM CO(2)) suffered loss of biomass, whereas those with 200 mM CO(2) continued to grow. Higher underwater net photosynthesis at 200 mM CO(2......) increased by 2.7- to 3.2-fold sugar concentrations in roots of submerged plants, compared with at air equilibrium CO(2). Leaf gas films enhancing gas exchange with floodwater, lack of a shoot elongation response conserving tissue sugars and high tissue porosity (24-31% in roots) facilitating internal O(2...
Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.
2001-01-01
In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the
Isozyme differences in barley mutants
Energy Technology Data Exchange (ETDEWEB)
AI-Jibouri, A A.M.; Dham, K M [Department of Botany, Nuclear Research Centre, Baghdad (Iraq)
1990-01-01
Full text: Thirty mutants (M{sub 11}) of barley (Hordeum vulgare L.) induced by physical and chemical mutagens were analysed for isozyme composition using polyacrylamide gel electrophoresis. Results show that these mutants were different in the isozymes leucine aminopeptidase, esterase and peroxidase. The differences included the number of forms of each enzyme, relative mobility value and their intensity on the gel. Glutamate oxaloacetate transaminase isozyme was found in six molecular forms and these forms were similar in all mutants. (author)
Host genotype is an important determinant of the cereal phyllosphere mycobiome
DEFF Research Database (Denmark)
Sapkota, Rumakanta; Knorr, Kamilla; Jørgensen, Lise Nistrup
2015-01-01
The phyllosphere mycobiome in cereals is an important determinant of crop health. However, an understanding of the factors shaping this community is lacking. Fungal diversity in leaves from a range of cultivars of winter wheat (Triticum aestivum), winter and spring barley (Hordeum vulgare...... and location have minor effects. We found many host-specific fungal pathogens, but also a large diversity of fungi that were relatively insensitive to host genetic background, indicating that host-specific pathogens live in a 'sea' of nonspecific fungi....
DEFF Research Database (Denmark)
Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny
2012-01-01
The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe......-regimes caused significant differences in both quantity and quality of the storage proteins transcripts. Principal Component Analysis of the amino acid (AA) profiles also indicated dissimilarity in individual AA percentages, correlated to hordein content. The abundance values of proteins of interest confirmed...
Hernández Díaz-Ambrona, Carlos Gregorio
1999-01-01
Este trabajo profundiza en el estudio de los sistemas agrícolas de secano de la Meseta Central. Sobre la base de la alternativa tradicional ce^eal^arbecho, se han estudiado durante tres años de cultivo 1995/96, 1996/97 y 1997/98 seis rotaciones diferentes: monocultivo de cebada (Hordeum vulgare L.), cebada/barbecho, cebada/habas (Viciafaba L.), cebada/guisantes {Pisum sativum L.), cebada/habas/barbecho y cebada/guisantes/barbecho. Entre las rotaciones, se ha comparado la biomasa, el rendimien...
Resistance to Barley Leaf Stripe
DEFF Research Database (Denmark)
Nørgaard Knudsen, J. C.
1986-01-01
in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...
Directory of Open Access Journals (Sweden)
Nan Jia
Full Text Available Bacillus strains have been widely used as the companion strain of Ketogulonigenium vulgare in the process of vitamin C fermentation. Different Bacillus strains generate different effects on the growth of K. vulgare and ultimately influence the productivity. First, we identified that Bacillus endophyticus Hbe603 was an appropriate strain to cooperate with K. vulgare and the product conversion rate exceeded 90% in industrial vitamin C fermentation. Here, we report the genome sequencing of the B. endophyticus Hbe603 industrial companion strain and speculate its possible advantage in the consortium. The circular chromosome of B. endophyticus Hbe603 has a size of 4.87 Mb with GC content of 36.64% and has the highest similarity with that of Bacillus megaterium among all the bacteria with complete genomes. By comparing the distribution of COGs with that of Bacillus thuringiensis, Bacillus cereus and B. megaterium, B. endophyticus has less genes related to cell envelope biogenesis and signal transduction mechanisms, and more genes related to carbohydrate transport and metabolism, energy production and conversion, as well as lipid transport and metabolism. Genome-based functional studies revealed the specific capability of B. endophyticus in sporulation, transcription regulation, environmental resistance, membrane transportation, extracellular proteins and nutrients synthesis, which would be beneficial for K. vulgare. In particular, B. endophyticus lacks the Rap-Phr signal cascade system and, in part, spore coat related proteins. In addition, it has specific pathways for vitamin B12 synthesis and sorbitol metabolism. The genome analysis of the industrial B. endophyticus will help us understand its cooperative mechanism in the K. vulgare-Bacillus strain consortium to improve the fermentation of vitamin C.
Directory of Open Access Journals (Sweden)
Evandro Leite de Souza
2006-12-01
Full Text Available Origanum vulgare L. (oregano, Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growth inhibition zones (30-37 mm. MIC values were between 20-40 µL/mL for the most bacteria strains. Essential oil was able to cause significant (POriganum vulgare L. (orégano, Lamiaceae, tem sido reconhecida como uma espécie vegetal com destacáveis propriedades biológicas por um longo tempo. Este estudo objetivou avaliar a atividade antibacteriana do óleo essencial de Origanum vulgare L. sobre várias bactérias Gram positivas e Gram negativas deteriorantes e/ou patogênicas de interesse em alimentos, bem como observar sua efetividade antimicrobiana em um micromodelo de conservação de alimentos. Os resultados mostraram uma considerável atividade antibacteriana do óleo essencial ensaiado notada por grandes zonas de inibição do crescimento bacteriano (30-37 mm. Os valores de CIM encontrados oscilaram entre 20-40 µL/mL para a maioria das bactérias. A CIM do óleo essencial causou um significante (P<0.05 efeito inibitório sobre a viabilidade bacteriana, sendo caracterizado uma propriedade bacteriostática após 24 horas de exposição. Ainda, a CIM causou uma diminuição significante (P<0.05 da contagem da flora bacteriana autóctone em carne moída armazenada sob refrigeração. Estes dados suportam a possibilidade do uso do óleo essencial de Origanum vulgare L. como composto antimicrobiano alternativo em sistemas de conservação de alimentos.
A weed suppressive index for spring barley (Hordeum vulgare) varieties
DEFF Research Database (Denmark)
Hansen, P K; Kristensen, K; Willas, J
2008-01-01
A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...
Isolating Barley ( Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Promoters play the most important role in determining the temporal and spatial expression pattern and transcript level of a gene. Some strong constitutive promoters, such as cauliflower mosaic virus 35s promoter, are widely used in plant genetic engineering research. However, the expression levels of the foreign genes in ...
Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...
African Journals Online (AJOL)
Yomi
2012-04-10
Apr 10, 2012 ... proline and glutamine (Piston et al., 2004). The four main groups of ... account for approximately 50% of the total protein in the. *Corresponding author. ..... inheritance, chromosomal location, and population dynamics. PNAS,.
Identification of a Phytase Gene in Barley (Hordeum vulgare L.)
Dai, Fei; Qiu, Long; Ye, Lingzhen; Wu, Dezhi; Zhou, Meixue; Zhang, Guoping
2011-01-01
Background Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. Methodology/Principal Findings Quantitative trait loci (QTL) analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP) gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. Conclusions/Significance It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains. PMID:21533044
Identification of a phytase gene in barley (Hordeum vulgare L..
Directory of Open Access Journals (Sweden)
Fei Dai
Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.
Comparison of stability statistics for yield in barley (Hordeum vulgare ...
African Journals Online (AJOL)
STORAGESEVER
2010-03-15
Mar 15, 2010 ... statistics and yield indicated that only TOP method would be useful for simultaneously selecting for high yield and ... metric stability methods; i) they reduce the bias caused by outliers, ii) ...... Biometrics, 43: 45-53. Sabaghnia N ...
Registration of Food Barley (Hordeum vulgare L.) Variety HB 1307 ...
African Journals Online (AJOL)
Six-rowed food type barley, HB 1307, was developed by Holetta Agricultural Research Center (HARC) from a cross between a landrace line and exotic germplasm (Awra gebs-1 x IBON93/91) and released in 2006 for mid and high altitude areas. The three consecutive years\\' (2002-2004) tests proved its superiority in grain ...
Directory of Open Access Journals (Sweden)
Wiesław Nowakowski
2015-06-01
Full Text Available L'action de I'AIA sur la teneur en azote total et en azote protéinique des graines du Triticum vulgare, d'Hordeum vulgare et d'Avena sativa cultivés a 30%, 60% et 90% de la capacité capillaire en eau du sable a tété étudiée au cours de trois ans (1969, 1970, 1971. La teneur en g-protéines totales liée au rendement des graines de céréales examinees a été plus élevée dans les conditions de sécheresse (30% de la capacite capillaire en eau à la suite d'un traitement auxinique. La teneur (% en azote total et proteinique ne semble pas etre tellement modifiee dans les graines de cereales à la suite d'un traitement auxinique.
Directory of Open Access Journals (Sweden)
Faride BEHBOUDI
2017-06-01
Full Text Available Plants such as wheat and barley that are strategically important crops need to be considered to develop a comprehensive toxicity profile for nanoparticles (NPs. The present study was aimed to investigate the effects of chitosan and SiO2 NPs on wheat and barley plants. Two factorial experiments (seeds priming and direct exposure were performed based on a completely randomized design in four replications. Results showed that the seeds priming with the NPs had not significant effect on germination parameters such as Germination Percentage (GP, Germination Rate (GR, Germination Value (GV, Mean Germination Time (MGT, Pick Value (PV and Mean Daily Germination (MDG. In contrast, exposure of the seeds to the NPs had significant effects on these parameters. In both experiments, treatments had significant effects on shoot, seedling, root length, fresh and dry weight, as well as vigor indexes as compared to the control. In most traits, the best concentration of NPs was 30 ppm, whereas applications of the NPs with 90 ppm displayed adverse effects on majority of the studied traits. According to these results, selectivity in applications of NPs with suitable concentration and method is essential for different plant species.
Chromosomal organization of repetitive DNAs in Hordeum bogdanii and H. brevisubulatum (Poaceae
Directory of Open Access Journals (Sweden)
Quanwen Dou
2016-10-01
Full Text Available Molecular karyotypes of H. bogdanii Wilensky, 1918 (2n = 14, and H. brevisubulatum Link, 1844 ssp. brevisubulatum (2n = 28, were characterized by physical mapping of several repetitive sequences. A total of 18 repeats, including all possible di- or trinucleotide SSR (simple sequence repeat motifs and satellite DNAs, such as pAs1, 5S rDNA, 45S rDNA, and pSc119.2, were used as probes for fluorescence in situ hybridization on root-tip metaphase chromosomes. Except for the SSR motifs AG, AT and GC, all the repeats we examined produced detectable hybridization signals on chromosomes of both species. A detailed molecular karyotype of the I genome of H. bogdanii is described for the first time, and each repetitive sequence is physically mapped. A high degree of chromosome variation, including aneuploidy and structural changes, was observed in H. brevisubulatum. Although the distribution of repeats in the chromosomes of H. brevisubulatum is different from that of H. bogdanii, similar patterns between the two species imply that the autopolyploid origin of H. brevisubulatum is from a Hordeum species with an I genome. A comparison of the I genome and the other Hordeum genomes, H, Xa and Xu, shows that colocalization of motifs AAC, ACT and CAT and colocalization of motifs AAG and AGG are characteristic of the I genome. In addition, we discuss the evolutionary significance of repeats in the genome during genome differentiation.
Study on tissue culture for Gelidium seedling
Pei, Lu-Qing; Luo, Qi-Jun; Fei, Zhi-Qing; Ma, Bin
1996-06-01
As seedling culture is a crucial factor for successful cultivation of Gelidium, the authors researched tissue culture technology for producing seedlings. The morphogeny and experimental ecology were observed and studied fully in 2 5 mm isolated tissue fragments. Regeneration, appearance of branching creepers and attaching structure and new erect seedlings production and development were studied. Fragments were sown on bamboo slice and vinylon rope. The seedlings were cultured 20 30 days indoor, then cultured in the sea, where the density of erect seedlings was 3 19 seedlings/cm2, growth rate was 3.84% day. The frond arising from seedlings directly was up to 10 cm per year. The ecological conditions for regenerated seedlings are similar to the natural ones. The regenerated seedlings are suitable for raft culture in various sea areas.
Foeniculum vulgare essential oils: chemical composition, antioxidant and antimicrobial activities.
Miguel, Maria Graça; Cruz, Cláudia; Faleiro, Leonor; Simões, Mariana T F; Figueiredo, Ana Cristina; Barroso, José G; Pedro, Luis G
2010-02-01
The essential oils from Foeniculum vulgare commercial aerial parts and fruits were isolated by hydrodistillation, with different distillation times (30 min, 1 h, 2 h and 3 h), and analyzed by GC and GC-MS. The antioxidant ability was estimated using four distinct methods. Antibacterial activity was determined by the agar diffusion method. Remarkable differences, and worrying from the quality and safety point of view, were detected in the essential oils. trans-Anethole (31-36%), alpha-pinene (14-20%) and limonene (11-13%) were the main components of the essentials oil isolated from F. vulgare dried aerial parts, whereas methyl chavicol (= estragole) (79-88%) was dominant in the fruit oils. With the DPPH method the plant oils showed better antioxidant activity than the fruits oils. With the TBARS method and at higher concentrations, fennel essential oils showed a pro-oxidant activity. None of the oils showed a hydroxyl radical scavenging capacity > 50%, but they showed an ability to inhibit 5-lipoxygenase. The essential oils showed a very low antimicrobial activity. In general, the essential oils isolated during 2 h were as effective, from the biological activity point of view, as those isolated during 3 h.
Roles of Hydroxynitrile Glucosides in Barley
DEFF Research Database (Denmark)
Roelsgaard, Pernille Sølvhøj
on barley (Hordeum vulgare). Barley accumulates five hydroxynitrile glucosides, including one cyanogenic glucoside, in the epidermal cell layer. Cyanogenic glucosides are classically known as hydrogen cyanide-releasing defense compounds which act against generalist insects and herbivores. However...... is proposed. The results obtained in this Ph.D. study provide a unique insight demonstrating that hydroxynitrile glucosides play a far more complex role in barley defense against and susceptibility to Bgh than previously described. Future studies can build on the platforms established in this study to provide...
Studies on /sup 32/P transport and yellow rust resistance in barley
Energy Technology Data Exchange (ETDEWEB)
Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)
1982-01-01
Several cultivars of barley (Hordeum vulgare L.) differing in their resistance to yellow rust were used to study the influence of the infection with Puccinia striiformis West. (strain 24) on /sup 32/P transport in intact plants and isolated leaves. Close correlations exist between transport processes and resistance. For example, resistant plants seem to have a more intensive matter transport than susceptible ones. The importance of the rate of transport to the effectiveness of hypothetic inducers of resistance reactions and defence substances is discussed.
Inter-simple sequence repeat (ISSR) loci mapping in the genome of perennial ryegrass
DEFF Research Database (Denmark)
Pivorienė, O; Pašakinskienė, I; Brazauskas, G
2008-01-01
The aim of this study was to identify and characterize new ISSR markers and their loci in the genome of perennial ryegrass. A subsample of the VrnA F2 mapping family of perennial ryegrass comprising 92 individuals was used to develop a linkage map including inter-simple sequence repeat markers...... demonstrated a 70% similarity to the Hordeum vulgare germin gene GerA. Inter-SSR mapping will provide useful information for gene targeting, quantitative trait loci mapping and marker-assisted selection in perennial ryegrass....
In vitro activity of Origanum vulgare essential oil against Candida species
Directory of Open Access Journals (Sweden)
Marlete Brum Cleff
2010-03-01
Full Text Available The aim of this study was to evaluate the in vitro activity of the essential oil extracted from Origanum vulgare against sixteen Candida species isolates. Standard strains tested comprised C. albicans (ATCC strains 44858, 4053, 18804 and 3691, C. parapsilosis (ATCC 22019, C. krusei (ATCC 34135, C. lusitaniae (ATCC 34449 and C. dubliniensis (ATCC MY646. Six Candida albicans isolates from the vaginal mucous membrane of female dogs, one isolate from the cutaneous tegument of a dog and one isolate of a capuchin monkey were tested in parallel. A broth microdilution technique (CLSI was used, and the inoculum concentration was adjusted to 5 x 10(6 CFU mL-1. The essential oil was obtained by hydrodistillation in a Clevenger apparatus and analyzed by gas chromatography. Susceptibility was expressed as Minimal Inhibitory Concentration (MIC and Minimal Fungicidal Concentration (MFC. All isolates tested in vitro were sensitive to O. vulgare essential oil. The chromatographic analysis revealed that the main compounds present in the essential oil were 4-terpineol (47.95%, carvacrol (9.42%, thymol (8.42% and □-terpineol (7.57%. C. albicans isolates obtained from animal mucous membranes exhibited MIC and MFC values of 2.72 µL mL-1 and 5 µL mL-1, respectively. MIC and MFC values for C. albicans standard strains were 2.97 µL mL-1 and 3.54 µL mL-1, respectively. The MIC and MFC for non-albicans species were 2.10 µL mL-1 and 2.97 µL mL-1, respectively. The antifungal activity of O. vulgare essential oil against Candida spp. observed in vitro suggests its administration may represent an alternative treatment for candidiasis.
Directory of Open Access Journals (Sweden)
Chevalier Frédéric
2012-01-01
Full Text Available Abstract Background Wolbachia are vertically transmitted bacteria known to be the most widespread endosymbiont in arthropods. They induce various alterations of the reproduction of their host, including feminization of genetic males in isopod crustaceans. In the pill bug Armadillidium vulgare, the presence of Wolbachia is also associated with detrimental effects on host fertility and lifespan. Deleterious effects have been demonstrated on hemocyte density, phenoloxidase activity, and natural hemolymph septicemia, suggesting that infected individuals could have defective immune capacities. Since nothing is known about the molecular mechanisms involved in Wolbachia-A. vulgare interactions and its secondary immunocompetence modulation, we developed a transcriptomics strategy and compared A. vulgare gene expression between Wolbachia-infected animals (i.e., “symbiotic” animals and uninfected ones (i.e., “asymbiotic” animals as well as between animals challenged or not challenged by a pathogenic bacteria. Results Since very little genetic data is available on A. vulgare, we produced several EST libraries and generated a total of 28 606 ESTs. Analyses of these ESTs revealed that immune processes were over-represented in most experimental conditions (responses to a symbiont and to a pathogen. Considering canonical crustacean immune pathways, these genes encode antimicrobial peptides or are involved in pathogen recognition, detoxification, and autophagy. By RT-qPCR, we demonstrated a general trend towards gene under-expression in symbiotic whole animals and ovaries whereas the same gene set tends to be over-expressed in symbiotic immune tissues. Conclusion This study allowed us to generate the first reference transcriptome ever obtained in the Isopoda group and to identify genes involved in the major known crustacean immune pathways encompassing cellular and humoral responses. Expression of immune-related genes revealed a modulation of host
Jasion, Mateusz; Samecka-Cymerman, Aleksandra; Kolon, Krzysztof; Kempers, Alexander J
2013-10-01
We investigated the possibility of use of Tanacetum vulgare (tansy) as an ecological indicator of metal concentration in a naturally colonized open-pit lignite mine in Bełchatów (Poland). Tanacetum vulgare is the only species growing abundantly and spontaneously in the lignite mine waste dumps. Metal concentrations in roots, stems, leaves, flowers, and soil were measured in dump sites differing in type and time of reclamation and therefore differing in pollution levels. Tanacetum vulgare appeared to be an accumulator of chromium and iron in roots, whereas highest concentrations of manganese and zinc were found in leaves. A high bioaccumulation factor for cadmium (Cd) was observed in dumps and control sites, indicating that even small amounts of Cd in the environment may result in significant uptake by the plant. The lowest concentrations of metals were found in plants from sites situated on dumps reclaimed with argillaceous limestone.
Seedling vigor and genetic variability for rice seed, seedling emergence and seedling traits
International Nuclear Information System (INIS)
Ali, S.S.; Jafri, S.J.H.; Jamil, M.; Ijaz, M.
1994-01-01
Eleven local rice cultivars including Basmati 370 were evaluated for seedling vigor. Three groups of traits were evaluated viz; seed traits (Seed density, seed volume see weight, paddy length and grain length), seed emergence traits (emergence %, emergence index and emergence rate index), and seedling traits (fresh root length, dry root weight, emergence percentage, root length, dry root weight, seed weight and relative root weight were observed significant, respectively. Seed density, relative root weight, emergence rate index and root to shoot ratio were relatively more amenable to improvement. Relative expected genetic advance was the function of heritability and coefficient of phenotypic variability, latter being more important. (author)
Directory of Open Access Journals (Sweden)
Nisha Makkar
2017-01-01
Full Text Available Introduction: Oropharyngeal candidiasis is an opportunistic mucosal infection caused by Candida albicans. It usually responds to topical treatments such as clotrimazole troches, topical fluconazole, chlorhexidine mouthwash and nystatin suspension. Piper betel leaf oil and Origanum vulgare essential oil have shown some topical antifungal activity. Aim: To determine and compare the antifungal efficacy of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension against C. albicans. Materials and Methods: The zone of inhibition was measured by the cup–plate diffusion method using 100 μl volume of piper betel leaf oil, O. vulgare essential oil and fluconazole suspension, which were pipetted into the wells of the inoculated Sabouraud’s dextrose agar plates. The zone of inhibition was measured in millimetres using Vernier calliper. Minimum inhibitory concentration (MIC was determined by the broth macro-dilution test by pouring 1 ml of the respective concentrations of the test material to the individual test tubes along with 10 μl of the diluted test organism inoculum. Finally, MIC was calculated using a reflective viewer. Results: The zone of inhibition for O. vulgare essential oil (>40 mm was more than fluconazole suspension (>35 mm. MIC of O. vulgare essential oil, piper betel leaf oil and fluconazole suspension was 1.6%, 0.4% and 0.8%, respectively. Conclusion: O. vulgare essential oil was found to be a more effective antifungal agent than piper betel leaf oil and fluconazole suspension.
Morphological differentiation of non-glandular and glandular trichomes on Marrubium vulgare L.
Directory of Open Access Journals (Sweden)
Marta Dmitruk
2014-04-01
Full Text Available Marrubium vulgare L., commonly known as a white horehound or common horehound, belongs to the plant family Lamiaceae. It is a perennial aromatic herb which grows naturally in Europe, Asia, and America. Since ancient Egypt, this species has been known as a remedy for upper respiratory tract ailments. Nowadays, horehound is used in herbal medicine for treatment of liver diseases, biliary tract disorders, and for increasing the appetite and supporting the function of the stomach. The main biologically active substances in M. vulgare organs are: marrubiin, tannins, essential oils, and ursolic acid. The paper presents micromorphological analyses of non-glandular and glandular trichomes of M. vulgare. The research material was sampled from the plant collection in the Botanical Garden of the Maria Curie-Sklodowska University in Lublin (51°14′ N, 22°34′ E. The above-ground parts of horehound were collected during the flowering period in July 2013. Using light microscopy (LM and scanning electron microscopy (SEM, the types and sizes of trichomes from the stem, leaf, calyx, and corolla were investigated. The results of the microscopic observations show that the surfaces of M. vulgare vegetative and reproductive organs are densely clothed with glandular and non-glandular trichomes. The glandular trichomes are of two main types: peltate and capitate. Peltate trichomes consist of a short stalk cell and a large head with secretory cells arranged in a circle. The height of a mature trichome is about 31.33 μm and the diameter of the head is 31.47 μm. The substance produced by secretory cells passes through the apical walls and accumulates within a space between the cuticle and the cell wall layer. Capitate long trichomes with a basal cell, long stalk, neck cell, and a unicellular head are 36.65 μm long and the diameter of the head is about 15.6 μm. There are two types of short capitate trichomes: with a bicellular head and a unicellular stalk and with
Directory of Open Access Journals (Sweden)
Abd El-Moneim Mohamed Radwan AFIFY
2011-03-01
Full Text Available In the present study, seeds from local cultivar of fennel were germinated on Murashige and Skoog medium (MS without plant growth regulators. Different types of explants from the growing seedling such as cotyledonal leaves, hypocotyls, epicotyls and roots were cultured on MS medium, contained different concentrations of 2,4-dichlorophenoxyacetic acid (2,4-D either alone or with kinetin. Differential responses in the essential oil constituents were observed in the induction and development of callus. The major components of essential oils includes estragole, trans-anethole, limonene and fenchone were studied under different conditions to find out the best methods which could be used to reduce the amount of estragole (not favorite for human consumption and increase the amount of trans-anethole.
The chemical defoliation of Ligitstrum vulgare L. and Spiraea x arguta Zab. shrubs in nursery
Directory of Open Access Journals (Sweden)
Szczepan Marczyński
2015-06-01
Full Text Available To defoliate Ligustrum vulgare and Spiraea x arguta – ethephon, KJ, Mg(ClO32•6H2O, CuSO4•5H2O and (NH42SO4 in various concentrations were used alone or in mixtures. Treating plants with potassium iodide gave the best results. KJ concentrations of 0.05-0,1% and 0.1-0.% were sufficient to defoliate Spiraea and Ligusturm respectively. Magnesium chlorate at concentration of 0.24 and 2% CuSO4 were also effective, the latter however, proved slight harmful to the plants. Spraying with defoliants on Sept. 26 gave better results than treating plants on Sept. 16. Chemical defoliation decreased negligibly the frost resistance of Ligusturm vulgare shrubs.
Directory of Open Access Journals (Sweden)
Budianto Budianto
2015-10-01
Pada penelitian ini menggunakan ekstrak air dari buah adas untuk mengetahui aktivitas antibakteri terhadap Vibrio harveyi dan Vibrio alginolyticus dengan menggunakan metode uji Minimum Inhibitory Concentration (MIC dan difusi cakram kertas. Hasil yang diperoleh pada uji MIC, konsentrasi terkecil untuk menghambat pertumbuhan adalah 0,060 g/ml, untuk kedua spesies bakteri. Variasi perlakuan pada uji cakram kertas yaitu konsentrasi A (0,065 g/ml, B (0,070 g/ml, C (0,075 g/ml, D (0,080 g/ml, E (0,085 g/ml, F (0,090 g/ml dan kontrol (0,000 g/ml, hasil yang diperoleh adalah konsentrasi 0,090 g/ml memiliki diameter zona hambat tertinggi sebesar 11,17 ± 0,5 mm (V. harveyi dan 12,53 ± 1,14 mm (V. alginolyticus, sehingga dapat disimpulkan bahwa buah adas (F. vulgare Mill memiliki peranan ekologi yang sangat penting sebagai bahan pengobatan alternatif dalam pengendalian penyebaran penyakit Vibriosis yang disebabkan oleh V. harveyi dan V. alginolyticus. Kata kunci: Foeniculum vulgare Mill, Vibrio harveyi, Vibrio alginolyticus, uji MIC dan difusi cakram kertas
The 'Big bang' in the Early Iron Age
Directory of Open Access Journals (Sweden)
Medović Aleksandar
2010-01-01
Full Text Available The Early Iron Age granaries of Tell Gradina upon Bosut exploded in a fire inferno in the 8th century B.C. The result of this catastrophe is 2-5 cm thick layer with mixed carbonized seeds and fruits. Recently, eight samples were taken from Gradina's profile for archaeobotanical analysis. The goal was to obtain basic information on land use and on major crops and weeds of that period. The most abundant were cereals, followed by millets, pulses and oil/fibre plants. The dominant cereals were einkorn (Triticum monococcum and hulled barley (Hordeum vulgare vulgare. Broomcorn millet (Panicum miliaceum was also very important. Pulses were represented with six and oil/fibre plants with three species. Among weeds and ruderals, most common are rye brome (Bromus secalinus, fat hen (Chenopodium album, darnel ryegrass (Lolium temulentum, hairy crabgrass (Digitaria sanguinalis and corncockle (Agrostemma githago.
DEFF Research Database (Denmark)
Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena
2001-01-01
developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L.......) varieties. For barley, 95% of the mass spectra were correctly classified. This is an encouraging result, since in earlier experiments only a grouping into subsets of varieties was possible. However, the method was not useful in the classification of rye, due to the strong similarity between mass spectra...
DEFF Research Database (Denmark)
Gallagher, M.W.; Clayborough, R.; Beswick, K.M.
2000-01-01
A relaxed eddy accumulation (REA) system, based on the design by Beverland et al. (Journal of Geophysics Research 101 (D17) 22, 807-22, 815), for the measurement of biogenic VOC species was evaluated by intercomparison with an eddy correlation CO2 flux system over a mature deciduous beech canopy...... (Fagus Sylvatica) during the FOREXNOX program. Measurements from a site where winter wheat and barley (Hordeum Vulgare ann Triticum Aestivum) were being harvested are also presented. The system was inter-compared with two different eddy correlation systems for measuring CO2 fluxes. Good results were...
UCE: A uracil excision (USERTM)-based toolbox for transformation of cereals
DEFF Research Database (Denmark)
Hebelstrup, Kim H; Christiansen, Michael W; Carciofi, Massimiliano
2010-01-01
Background Cloning of gene casettes and other DNA sequences into the conventional vectors for biolistic or Agrobacterium-mediated transformation is hampered by a limited amount of unique restriction sites and by the difficulties often encountered when ligating small single strand DNA overhangs...... (USER cereal), ready for use in cloning of complex constructs into the T-DNA. A series of the vectors were tested and shown to perform successfully in Agrobacterium-mediated transformation of barley (Hordeum vulgare L.) as well as in biolistic transformation of endosperm cells conferring transient...
Effect of sterilization on mineralization of straw and black carbon
Bobul'ská, Lenka; Bruun, Sander; Fazekašová, Danica
2013-01-01
The study was aimed at investigating the role of microorganisms in the degradation of BC (black carbon). CO evolution was measured under sterilized and non-sterilized soil using BC and straw amendments. Black carbon and straw were produced from homogenously C labelled roots of barley (Hordeum vulgare) with a specific activity 2.9 MBq g C. Production of BC was implemented at 300 °C for 24 h in a muffle oven, incubated in soil and C in the evolved CO was measured after 0.5, 1, 2, 4, 8, 16, 26 a...
High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris
DEFF Research Database (Denmark)
Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene
2008-01-01
An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion transformants...
Starch bioengineering in Brachypodium distachyon
DEFF Research Database (Denmark)
Tanackovic, Vanja; Svensson, Jan Tommy; Buleon, A
2011-01-01
Brachypodium distachyon was recently introduced as a model plant for temperate cereals (Opanowicz et al., 2008). We aim to establish Brachypodium as a model for cereal starch metabolism. Grain starch from two lines: Bd21 and Bd21-3 are being characterized. Microscopic, chemical and structural data...... including amylopectin chain length distribution, phosphate content and amylose content provided further evidence for the close relationship to temperate cereals even though starch content and starch granule size were considerably lower than that for barley (Hordeum vulgare). Bioinformatics analyses...... in temperate cereals....
GeneCAT--novel webtools that combine BLAST and co-expression analyses
DEFF Research Database (Denmark)
Mutwil, Marek; Obro, Jens; Willats, William G T
2008-01-01
The gene co-expression analysis toolbox (GeneCAT) introduces several novel microarray data analyzing tools. First, the multigene co-expression analysis, combined with co-expressed gene networks, provides a more powerful data mining technique than standard, single-gene co-expression analysis. Second...... orthologs in the plant model organisms Arabidopsis thaliana and Hordeum vulgare (Barley). GeneCAT is equipped with expression data for the model plant A. thaliana, and first to introduce co-expression mining tools for the monocot Barley. GeneCAT is available at http://genecat.mpg.de....
Identification and characterization of barley RNA-directed RNA polymerases
DEFF Research Database (Denmark)
Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba
2009-01-01
in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...
DEFF Research Database (Denmark)
Vinther, F.P.; Jensen, E.S.
2000-01-01
The input of Nitrogen (N) through symbiotic N-2 fixation (SNF) in grass-clover mixtures was determined in an organic cropping. system for grazing during 3 years. The mixture of perennial ryegrass (Lolium perenne L.) and white clover (Trifolium repens L.) was established by undersowing in spring...... barley (Hordeum vulgare L.) and maintained subsequently for two production years. Dinitrogen fixation was determined using the N-15 isotope dilution techniques and two labelling procedures. Using either pre-labelling of the soil with immobilisation of the N-15 by addition of a carbon source before...
Koldaş, Serkan; Demirtas, Ibrahim; Ozen, Tevfik; Demirci, Mehmet Ali; Behçet, Lütfi
2015-03-15
A detailed phytochemical analysis of Origanum vulgare L. ssp. viride (Boiss.) Hayek was carried out and the antioxidant activities of five different crude extracts were determined. The antiproliferative activities of the extracts were determined using the xCELLigence system (Real Time Cell Analyzer). Differences between the essential oil and volatile organic compound profiles of the plant were shown. The main component of the essential oil was caryophyllene oxide, while the main volatile organic compounds were sabinene and eucalyptol as determined by HS-GC/MS. Phenolic contents of the extracts were determined qualitatively and quantitatively by HPLC/TOF-MS. Ten phenolic compounds were found in the extracts from O. vulgare and Origanum acutidens: rosmarinic acid (in highest abundance), chicoric acid, caffeic acid, p-coumaric acid, gallic acid, quercetin, apigenin-7-glucoside, kaempferol, naringenin and 4-hydroxybenzaldehyde. This study provides first results on the antiproliferative and antioxidant properties and detailed phytochemical screening of O. vulgare ssp. viride (Boiss.) Hayek. © 2014 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Janaína Endres Georg-Kraemer
2011-05-01
Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.Doubled haploid populations offer special advantages in genetic analyses, since the information they provide may be maximized due to the fact that all loci are homozygous. The aim of this study was to develop two barley (Hordeum vulgare ssp.vulgare L. doubled-haploid (DHs populations segregating to (1-3, 1-4-β-glucanases activity, utilizing the anther
Nitrite uptake by nitrogen-depleted wheat seedlings
Energy Technology Data Exchange (ETDEWEB)
Jackson, W A; Johnson, R E; Volk, R J
1974-01-01
Intact, 14-day-old nitrogen-depleted wheat (Triticum vulgare cv. Blueboy) seedlings were exposed to solutions of 0.5 mM KNO/sub 2/, 0.05 mM CaSO/sub 4/ and 1 mM sodium 2-(N-morpholino)-ethanesulfonate, pH 6.1. Nitrite uptake was determined from depletion of the ambient solution or from incorporation of /sup 15/N in the tissue. An initial nitrite uptake shoulder was followed by a relatively slow uptake rate which subsequently increased to a substantially greater rate. This accelerated phase was maintained through 24 h. Nitrite accumulated to a slight extent in the root tissues during the first few hours but declined to low values when the accelerated rate was fully developed, indicating an increase in nitrite reductase activity paralleling the increase in nitrite uptake capacity. About 50% of the nitrogen absorbed as nitrite was translocated to the shoots by 9 to 12 h. Development of the accelerated nitrite uptake rate was restricted in excised roots, in intact plants kept in darkness, by 400 ..mu..g puromycin ml/sup -1/ and by 1 mM L-ethionine. When puromycin and L-ethionine were added after the accelerated phase had been initiated, their effects were not as detrimental as when they were added at first exposure to KNO/sub 2/. The two inhibitors restricted translocation more than uptake. The data indicate an involvement of protein synthesis and a requirement for movement of a substance from shoots to roots for maximal development of the accelerated nitrite uptake phase. A requirement for protein synthesis in the transport of soluble organic nitrogen from roots to shoots is also suggested.
Honey Antibacterial Effect Boosting Using Origanum vulgare L. Essential Oil
Imtara, Hamada; Elamine, Youssef; Lyoussi, Badiâa
2018-01-01
The appearance of new bacterial strains which cause pathogenic diseases and which are resistant to the most used antibiotics requires probing new antibacterial agents sources. Therefore, the main aim of the present work was to follow the antibacterial activity of honey samples from Palestine and Morocco, after the combination with Origanum vulgare L. essential oil, and figure out whether the honey physicochemical parameters and geographic origin influence the final activity. The results of th...
Aprotosoaie, Ana Clara; Hăncianu, Monica; Poiată, Antonia; Tuchiluş, Cristina; Spac, A; Cioană, Oana; Gille, Elvira; Stănescu, Ursula
2008-01-01
In our study, four samples of volatile oil from Foeniculum vulgare, cultivated in different pedoclimatic conditions, were investigated for their antimicrobial activity and chemical composition. Organisms. Staphylococcus aureus ATCC 25923, Bacillus cereus, Pseudomonas aeruginosa, Escherichia coli ATCC 25922, Candida albicans were included in the report. Antimicrobial susceptibility tests. The comparative inhibitory activity of volatile oil samples with other antimicrobial agents was quantitative determined by minimum inhibitory concentration (MIC). Oil samples are the volatile oils extracted by steam distillation, from two ecological vegetative populations of Foeniculum vulgare. Gas chromatography coupled to mass spectrometry (GC-MS) was used to determine the chemical composition of the essential oils. All oil samples have a good activity against E. coli and S. aureus at low concentrations. Against B. cereus and P. aeruginosa these oil samples are less active. The oil samples were generally bactericidal at a concentration up to twofold or fourfold higher than the MIC value. Significantly synergic activity with amoxicillin or tetracycline showed all fennel samples against E. coli, Sarcina lutea and B. subtilis strains. Fennel oil samples have shown high activity against Candida albicans. No significant antimicrobial activity variations were observed for Foeniculum vulgare volatile oil samples obtained after two or three years cultivation period. The most important identified compounds in all samples of fennel volatile oils were trans-anethole, estragole, fenchone, limonene, alpha-pinene and gamma-terpinene.
Directory of Open Access Journals (Sweden)
Wojciech Zalewski
Full Text Available Cytokinin oxidase/dehydrogenase proteins (CKX are encoded by a multigene family of CKX genes with a varying number of members depending on species. For some of the genes, spectacular effects on grain production in selected cereals have been observed. Despite the fact that partial or full length sequences of most HvCKX genes in barley (Hordeum vulgare have already been published, in most cases their specific biological functions have not been reported. Detailed expression patterns for five HvCKX genes in different organs/tissues of developing barley plants coupled with analysis of RNAi silent for two genes are presented to test the hypothesis that these expression profiles might indicate their function. Elevated expression for four of them - HvCKX1, HvCKX9, HvCKX4, and HvCKX11 - was found in developing kernels of wild-type plants compared to other tissues. HvCKX5 was mainly expressed in leaf tissue. Lower expression was noted for HvCKX1 in seedling roots and for HvCKX9 in leaves. The documented effect of RNAi silencing of HvCKX1 and a trend for HvCKX9 was higher plant productivity, and the trait was inherited through four generations. Higher plant yield was determined by higher numbers of seeds and spikes. Increased productivity was significantly greater in HvCKX1 silenced plants showing higher relative expression of HvCKX1 in developing kernels of wild-type plants compared to the expression of HvCKX9. Both HvCKX1 silenced T1 seedlings of cv. Golden Promise and the newly transformed breeding line STH7308 showed greater root mass, but this trait was not inherited in the next generation. Similarly HvCKX9 silenced T1 seedlings exhibited greater plant height without inheritance in the next generation. It is suggested that these effects were not inherited because of compensation by other genes co-ordinately regulating reproductive development. One line with untypically changed, inherited phenotype, which was selected from several dozen silenced lines
Directory of Open Access Journals (Sweden)
Juárez-Cisneros Gladys
2014-11-01
Full Text Available Soil pollution by waste motor oil (WMO caused soil´s lost fertility. The aims of this research where a bioremediation of soil polluted by 10000 ppm of WMO for biostimulation with vermicompost (VC at 3 and 6 % (w/w follow by b phytoremediation (PR of the same soil to eliminate remaining WMO with Sorghum vulgare inoculated with Bacillus cereus and/or Rhizobium etli or Promoting Growth Plant Bacteria (PGPB. At the first step of assay WMO concentration was measured before and after bioremediation. At the second step the same soil phytoremediation was applied for remaining WHO sowing S. vulgare inoculated with PGPB, then at flowering stage its biomass and WHO final concentration was determined. Results showed that soil impacted by WMO biostimulated with VC at 3% was eliminated 8630 ppm of WMO. At the second phase in the same soil PR applied for remaining WMO which was reduced until 210 ppm. Soil polluted by remaining WMO applied PR using S. vulgare plus R. etli WMO was decreased at 260 ppm. While S. vulgare´s biomass inoculated with PGPB was higher compared to S. vulgare grown in soil not polluted by WMO according by ANOVA - Tukey (p > 0.05. These results suggested that soil polluted by WMO could be recovering by applying integrated BR and PR better than just using one type.
Laurie, John D.; Ali, Shawkat; Linning, Rob; Mannhaupt, Gertrud; Wong, Philip; Güldener, Ulrich; Münsterkötter, Martin; Moore, Richard; Kahmann, Regine; Bakkeren, Guus; Schirawski, Jan
2012-01-01
Ustilago hordei is a biotrophic parasite of barley (Hordeum vulgare). After seedling infection, the fungus persists in the plant until head emergence when fungal spores develop and are released from sori formed at kernel positions. The 26.1-Mb U. hordei genome contains 7113 protein encoding genes with high synteny to the smaller genomes of the related, maize-infecting smut fungi Ustilago maydis and Sporisorium reilianum but has a larger repeat content that affected genome evolution at important loci, including mating-type and effector loci. The U. hordei genome encodes components involved in RNA interference and heterochromatin formation, normally involved in genome defense, that are lacking in the U. maydis genome due to clean excision events. These excision events were possibly a result of former presence of repetitive DNA and of an efficient homologous recombination system in U. maydis. We found evidence of repeat-induced point mutations in the genome of U. hordei, indicating that smut fungi use different strategies to counteract the deleterious effects of repetitive DNA. The complement of U. hordei effector genes is comparable to the other two smuts but reveals differences in family expansion and clustering. The availability of the genome sequence will facilitate the identification of genes responsible for virulence and evolution of smut fungi on their respective hosts. PMID:22623492
Submergence sensitivity of durum wheat, bread wheat and barley at the germination stage
Directory of Open Access Journals (Sweden)
Iduna Arduini
2016-06-01
Full Text Available Soil waterlogging at initial growth stages can cause heavy yield losses of winter cereals. Therefore, the screening for submergence tolerance traits in seeds of commercial varieties is of high concern worldwide. Ten Italian varieties of durum wheat (Triticum durum Desf., bread wheat (T. aestivum L. and barley (Hordeum vulgare L. were investigated for their ability to germinate in submerged conditions and to recover after submergence periods of three to 15 days. Submergence prevented germination and decreased germinability, at rates that increased with duration of submergence. Sensitivity ranked in the order: barley >durum wheat >bread wheat. We related the higher sensitivity of barley to its slower germination and slightly higher leakage of electrolytes, whereas the percentage of abnormal seedlings was lower than in other species. It was less than 4%, compared to less than 15 and 8% in durum wheat and bread wheat, respectively. Wide varietal differences were found in all species. According to variety, after 6-day submergence, germinability ranged from 2 to 42% in barley, from 5 to 80% in durum wheat, and from 30 to 77% in bread wheat. Varieties with more than 40% seed survival were three, six and seven per species, in the same order. The differential submergence sensitivity of varieties indicates a potential to select for waterlogging tolerance within Italian genotypes of winter cereal crops.
'Galega Vulgar' - yield indices and quality of elementary olive oil
International Nuclear Information System (INIS)
Almeida, F.; Vitorino, M.C.; Henriques, L.R.; Peres, M.F.
1998-01-01
This paper shows the evolution of two olive yield indexes (humidity and fat) and three olive oil quality parameters (acidity, peroxid value and UV absorbances) for cv. Galega vulgar from the olive grove Quinta Senhora de Mercules, Castelo Branco, during the 1995/96 harvest. It shows also the evolution of fatty acid composition of the same olive oil [pt
Directory of Open Access Journals (Sweden)
Mejdoub Hafedh
2011-09-01
Full Text Available Abstract Background In order to validate its antiseptic and anticancer properties with respect to traditional uses, we have screened for the first time the antimicrobial activity of aerial parts of M. vulgare L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. Methods The agar disk diffusion method was used to study the antibacterial activity of M. vulgare essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD, the minimum inhibitory concentrations (MIC and the concentration inhibiting 50% (IC50 were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of M. vulgare essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. Results The antimicrobial activity of the essential oil was investigated in order to evaluate its efficacy against the different tested microorganisms. The present results results showed a significant activity against microorganisms especially Gram (+ bacteria with inhibition zones and minimal inhibitory concentration values in the range of 6.6-25.2 mm and 1120-2600 μg/ml, respectively, whereas Gram (- bacteria exhibited a higher resistance. As far as the antifungal activity, among four strains tested, Botrytis cinerea exhibited the strongest activity with inhibition zones of 12.6 mm. However, Fusarium solani, Penicillium digitatum and Aspergillus niger were less sensitive to M. vulgare essential oil. About the citotoxicity assay, this finding indicate the capability of this essential oil to inhibited the proliferation of HeLa cell lines under some conditions with IC50 value of 0.258 μg/ml. Conclusion This investigation showed that the M. vulgare essential oil has a potent antimicrobial activity against some Gram (+ pathogenic bacteria and Botrytis cinerea fungi. The present studies confirm the use of this
Directory of Open Access Journals (Sweden)
Kornelia Gudys
2018-06-01
Full Text Available Drought is one of the most adverse abiotic factors limiting growth and productivity of crops. Among them is barley, ranked fourth cereal worldwide in terms of harvested acreage and production. Plants have evolved various mechanisms to cope with water deficit at different biological levels, but there is an enormous challenge to decipher genes responsible for particular complex phenotypic traits, in order to develop drought tolerant crops. This work presents a comprehensive approach for elucidation of molecular mechanisms of drought tolerance in barley at the seedling stage of development. The study includes mapping of QTLs for physiological and biochemical traits associated with drought tolerance on a high-density function map, projection of QTL confidence intervals on barley physical map, and the retrievement of positional candidate genes (CGs, followed by their prioritization based on Gene Ontology (GO enrichment analysis. A total of 64 QTLs for 25 physiological and biochemical traits that describe plant water status, photosynthetic efficiency, osmoprotectant and hormone content, as well as antioxidant activity, were positioned on a consensus map, constructed using RIL populations developed from the crosses between European and Syrian genotypes. The map contained a total of 875 SNP, SSR and CGs, spanning 941.86 cM with resolution of 1.1 cM. For the first time, QTLs for ethylene, glucose, sucrose, maltose, raffinose, α-tocopherol, γ-tocotrienol content, and catalase activity, have been mapped in barley. Based on overlapping confidence intervals of QTLs, 11 hotspots were identified that enclosed more than 60% of mapped QTLs. Genetic and physical map integration allowed the identification of 1,101 positional CGs within the confidence intervals of drought response-specific QTLs. Prioritization resulted in the designation of 143 CGs, among them were genes encoding antioxidants, carboxylic acid biosynthesis enzymes, heat shock proteins, small auxin
Rezayat, Seyed Mahdi; Dehpour, Ahmad-Reza; Motamed, Saeed Mohammadi; Yazdanparast, Maryam; Chamanara, Mohsen; Sahebgharani, Mousa; Rashidian, Amir
2017-10-24
The aim of the present study is to investigate the protective effects of Foeniculum vulgare essential oil on intestinal inflammation through the inhibition of NF-kB pathway in acetic acid-induced rat colitis. Acute colitis was induced by intra-rectal administration of 2 mL of diluted acetic acid (4%) solution. Two hours after the induction of colitis, 0.2% tween 80 in normal saline, dexamethasone (2 mg/kg) and F. vulgare essential oil (100, 200, 400 mg/kg) were administered to the animals by oral gavage and continued for 5 consecutive days. Assessment of macroscopic and microscopic lesions was done. MPO activity was evaluated by biochemical method. Furthermore, TNF-α activity was detected by immunohistochemistry (IHC) and the expression level of p-NF-kB p65 protein was measured by western blot analysis. Dexamethasone and F. vulgare essential oil (200, 400 mg/kg) reduced the macroscopic and microscopic lesions compared to the acetic acid group (p kB p65 protein (p kB pathway.
Directory of Open Access Journals (Sweden)
Meysam Foroozandeh
2015-10-01
Full Text Available Background and Aim: Stroke is one of the most important factors of mortality and disability in the world. Free radicals are produced following ischemic stroke and they play a central role in breaking the blood-brain barrier and causing brain edema formation. The aim of the current study was to evaluate the effect of hydro- alcoholic extract of Origanum vulgare on brain edema and neurologic deficit in a rat stroke model. Materials and Methods: In thisexperimental study, 35 male Wistar rats were randomly divided into 5 equal groups. The first two groups (control and Sham received distilled water, while three treatment groups received oral Origanum vulgare extract for 30days (50,75and 100 mg/kgdaily, respectively. Two hours after the last dose of Origanum vulgare extract,each main group underwent a 60 min middle cerebral artery occlusion. Then, the assessment of blood brain edema, and neurologic deficits analysis were done . Brain edema (brain water content was analyzed by One-Way ANOVA using LSD method and neurologic deficits analysis by means of Mann-Whitney U, and P<0.05 was taken as the significant level. Results: Origanum vulgare extract reduced brain edema in the experimental groups of 50 (82.49±0.47, 75 (80.89±0.63 and 100 mg/kg/day (80.80±0.66 compared to the control group (84.46±0.67. The neurologic deficit scores in the experimental groups of 75and 100mg/kg/day, compared with control group, but neurologic deficit scores did not affect the group receiving the dose 50 mg/kg. Conclusion: The obtained data indicate that Origanum vulgar extract via reduction of brain edema and neurologic deficits scorescan have a protective effect on the stroke model.
Vaz Patto, M.C.; Rubiales, D.; Martin, A.; Hernandez, P.; Lindhout, W.H.; Niks, R.E.; Stam, P.
2003-01-01
In cereals, rust fungi are among the most harmful pathogens. Breeders usually rely on short-lived hypersensitivity resistance. As an alternative, "avoidance" may be a more durable defence mechanism to protect plants to rust fungi. In Hordeum chilense avoidance is based on extensive wax covering of
Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
user
2011-01-31
Jan 31, 2011 ... Grain flour starch pasting and malt qualities were analyzed. .... bags and stored in a cool place (ca. ... Pasting properties of four malting barely varieties grain flour starches and the effect of three fungicide (propiconazole) spray.
DEFF Research Database (Denmark)
Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach
2011-01-01
During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...
Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)
DEFF Research Database (Denmark)
Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald
2009-01-01
To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...
Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L
DEFF Research Database (Denmark)
Sandfær, J.
1979-01-01
Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...
Malt quality of 4 barley (Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
user
2011-01-31
Jan 31, 2011 ... 76.6 to 79.7%). The varieties had a pasting- time and -temperature (Ti) of 4.7 to 5.0 min and 64.7 to .... 16°C) (Termaks chamber KBP 6395F, Bergen, Norway). Each .... varieties in the peak viscosity is in part attributed to the.
Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare
Scheu, Arne Hagen August
2017-01-01
Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.
Phosphorus acquisition by barley (Hordeum vulgare L. at suboptimal soil temperature
Directory of Open Access Journals (Sweden)
Kari Ylivainio
2012-12-01
Full Text Available We studied the effects of soil temperature (8 ºC and 15 ºC on barley growth, barley phosphorus (P uptake and soil P solubility. Barley was grown in a pot experiment in two soils with different P fertilization histories for 22 years. The availability of P was estimated by using 33P-labeled fertilizer and calculating L-values. After cultivation for 22 years at ambient soil temperature without P fertilization (-P, soil L-value had decreased compared to soil that received annual P fertilization (P+. Low soil temperature further reduced the L-values, more in the -P soil than in the +P soil. Our results demonstrated that P fertilization can only partially ameliorate poor growth at low soil temperatures. Thus, applying ample fertilization to compensate for poor growth at low soil temperatures would increase the P content and solubility in the soil, but plant uptake would remain inhibited by cold.
Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...
African Journals Online (AJOL)
propiconazole) spray intervals (7, 14, 21 day) and no spray control were arranged in a RCBD in 4 replications to assess net blotch (Pyrenophora teres) effect on malt quality. The varieties were grown at Holetta agricultural research center in 2005, ...
BIOCHEMICAL COMPOSITION AND NUTRITIONAL EVALUATION OF BARLEY RIHANE (HORDEUM VULGARE L.).
Lahouar, Lamia; Ghrairi, Fatma; El Arem, Amira; Medimagh, Sana; El Felah, Mouledi; Salem, Hichem Ben; Achour, Lotfi
2017-01-01
Many experimental studies have suggested an important role for barley Rihane(BR)in the prevention of colon cancer and cardiovascular diseases. The objective of this study was to evaluate the physico-chemical properties and nutritional characterizations of BR compared to other varieties grown in Tunisia (Manel, Roho and Tej). Total, insoluble and soluble dietary fiber(β-glucan), total protein, ash and some minerals of BR and Tunisian barley varieties were determined. The results revealed that BR is good source of dietary fiber mainly β-glucan compared to the other varieties. This variety is a relatively rich source of phosphorous and potassium and it contains many important unsaturated fatty acids. BR has higher nutritional value than other varieties. Barley Rihane has significant nutritional characterizations compared to others Tunisian barleys varieties. Abbreviations: BR, Barley Rihane; LDL, low density lipoprotein; HDL, high density lipoprotein; AOM, azoxymethane; TBV, Tunisian barley varieties; TGW, thousand grain weight; SW, weight specific; TDF, total dietary fiber; IDF, insoluble dietary fiber; SDF, soluble dietary fiber; DM, Dry Matter.
Growth and yield of barley (Hordeum vulgare L.) as affected by ...
African Journals Online (AJOL)
Bheema
(2003) reported that about 65% of grain yield variability in barley was attributed to ... of those of the respective non-stressed environments (Cantero-Martínez et ... production stability of barley (Fekadu and Skjelvåg, 2002) and nitrogen and phosphorus are .... of SAS version 9.1 for analysis of variance of non-orthogonal data.
Containers of Attalea funifera fibers to produce eucalyptus seedlings
Directory of Open Access Journals (Sweden)
Andrea Vita Reis Mendonça
2016-09-01
Full Text Available The aim of this study was to assess the technical feasibility of using biodegradable containers made of fiber waste of Attalea funifera Martius to produce seedling of Eucalyptus camaldulensis Dehnh. The work was carried out in three stages: manufacture of piassava fiber containers, seedling production and field simulation. The experiment of seedling production was in completely randomized design, with two treatments (polyethylene tube and biodegradable container and 10 repetitions, with 64 seedlings per repetition. After 93 days, seedlings were evaluated based on quality variables. The simuation of initial growth of seedlings in the field consisted in planting seedlings in containers of 11L, in completely randomized design, with three treatments: seedlings produced in polyethylene tubes; seedlings produced in biodegradable containers, without removal of the container during planting; and seedlings produced in biodegradable containers, with removal of the container at planting, with ten repetitions, with one seedling by repetition. The biodegradable container withstood the production cycle and resulted in seedlings within acceptable standards quality. The use of biodegradable container, made of palm fibers, waived the removal of this vessel in the final planting.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Souza, Evandro Leite de; Stamford, Tânia Lúcia Montenegro; Lima, Edeltrudes de Oliveira
2006-01-01
Origanum vulgare L. (oregano), Lamiaceae, has been known as plant specie with prominent biological properties for a long time. This study aimed to evaluate the antibacterial activity of Origanum vulgare essential oil on various Gram-positive and Gram-negative spoiling and/or pathogen food-related bacteria, as well as to observe its antimicrobial effectiveness in a food conservation micromodel. The results showed a strong antibacterial activity of the assayed essential oil noted by large growt...
Line-scan inspection of conifer seedlings
Rigney, Michael P.; Kranzler, Glenn A.
1993-05-01
Almost two billion conifer seedlings are produced in the U.S. each year to support reforestation efforts. Seedlings are graded manually to improve viability after transplanting. Manual grading is labor-intensive and subject to human variability. Our previous research demonstrated the feasibility of automated tree seedling inspection with machine vision. Here we describe a system based on line-scan imaging, providing a three-fold increase in resolution and inspection rate. A key aspect of the system is automatic recognition of the seedling root collar. Root collar diameter, shoot height, and projected shoot and root areas are measured. Sturdiness ratio and shoot/root ratio are computed. Grade is determined by comparing measured features with pre-defined set points. Seedlings are automatically sorted. The precision of machine vision and manual measurements was determined in tests at a commercial forest nursery. Manual measurements of stem diameter, shoot height, and sturdiness ratio had standard deviations three times those of machine vision measurements. Projected shoot area was highly correlated (r2 equals 0.90) with shoot volume. Projected root area had good correlation (r2 equals 0.80) with root volume. Seedlings were inspected at rates as high as ten per second.
Teixeira, Bárbara; Marques, António; Ramos, Cristina; Serrano, Carmo; Matos, Olívia; Neng, Nuno R; Nogueira, José M F; Saraiva, Jorge Alexandre; Nunes, Maria Leonor
2013-08-30
There is a growing interest in industry to replace synthetic chemicals by natural products with bioactive properties. Aromatic plants are excellent sources of bioactive compounds that can be extracted using several processes. As far as oregano is concerned, studies are lacking addressing the effect of extraction processes in bioactivity of extracts. This study aimed to characterise the in vitro antioxidant and antibacterial properties of oregano (Origanum vulgare) essential oil and extracts (in hot and cold water, and ethanol), and the chemical composition of its essential oil. The major components of oregano essential oil were carvacrol, β-fenchyl alcohol, thymol, and γ-terpinene. Hot water extract had the strongest antioxidant properties and the highest phenolic content. All extracts were ineffective in inhibiting the growth of the seven tested bacteria. In contrast, the essential oil inhibited the growth of all bacteria, causing greater reductions on both Listeria strains (L. monocytogenes and L. innocua). O. vulgare extracts and essential oil from Portuguese origin are strong candidates to replace synthetic chemicals used by the industry. © 2013 Society of Chemical Industry.
Mercury in mercury(II)-spiked soils is highly susceptible to plant bioaccumulation.
Hlodák, Michal; Urík, Martin; Matúš, Peter; Kořenková, Lucia
2016-01-01
Heavy metal phytotoxicity assessments usually use soluble metal compounds in spiked soils to evaluate metal bioaccumulation, growth inhibition and adverse effects on physiological parameters. However, exampling mercury phytotoxicity for barley (Hordeum vulgare) this paper highlights unsuitability of this experimental approach. Mercury(II) in spiked soils is extremely bioavailable, and there experimentally determined bioaccumulation is significantly higher compared to reported mercury bioaccumulation efficiency from soils collected from mercury-polluted areas. Our results indicate this is not affected by soil sorption capacity, thus soil ageing and formation of more stable mercuric complexes with soil fractions is necessary for reasonable metal phytotoxicity assessments.
Does heavy traffic have long term implications for crop yields?
DEFF Research Database (Denmark)
Nielsen, J. Aa.; Munkholm, Lars Juhl; Schjønning, Per
Danish soils are subject to increasingly heavier traffic. Today, wheel loads of 6-12 tons are common on e.g. slurry tankers, combines and sugar beet harvesters. Field trials were started in Denmark in spring 2010 to answer the question: "does heavy traffic have long term implications for crop...... by the contractors delivering the machinery for the experimentation. Each year, spring barley (Hordeum vulgare L.) was established after the compaction treatments. s.ince 2013, investigations on biological tillage (root growth by pioneering crops) have been added to the trials. Significant yield losses up to 12.5 dt...
Directory of Open Access Journals (Sweden)
Evandro Leite de Souza
2008-06-01
Full Text Available Origanum vulgare L. (oregano, Lamiaceae, essential oil has a variety of biological properties and its antimicrobial activity has received a renewed interest for use in food conservation. The aim of this study was to evaluate the interference of heating on the antimicrobial activity and chemical composition of O. vulgare essential oil. The antimicrobial activity of the essential oil kept at room temperature and exposed to different heating temperatures (60, 80, 100 and 120 °C during 1 hour was evaluated by observing antimicrobial effectiveness at absolute concentration and determining MIC values by the solid medium diffusion procedure. The essential oil chemical composition analysis was performed by GC-MS. O. vulgare essential oil showed interesting antimicrobial activity on all assayed microbial strains (Candida albicans, C.krusei, C. tropicalis, Bacillus cereus, Escherichia coli, Staphylococcus aureus, Yersinia enterocolitica, Salmonella enterica, Serratia marcencens, noted by large growth inhibition zones (30-42 mm. Heating treatment showed no significant interference (p O óleo essencial de Origanum vulgare L. Lamiaceae (orégano apresenta variadas propriedades biológicas, de modo que seu potencial antimicrobiano tem despertado interesse para uso na conservação de alimentos. Este estudo objetivou avaliar a interferência de diferentes tratamentos térmicos (60, 80, 100 e 120 °C/1 hora sobre a efetividade antimicrobiana e composição química do óleo essencial de O. vulgare. A efetividade antimicrobiana do óleo essencial exposto aos diferentes tratamentos térmicos foi avaliada através da observação de sua atividade antimicrobiana em concentração absoluta e através da determinação da sua CIM utilizando-se a técnica de difusão em meio sólido. O estudo da composição do óleo essencial foi realizado através de GC-MS. O óleo essencial apresentou intensa atividade antimicrobiana sobre todas as amostras microbianas ensaiadas
International Nuclear Information System (INIS)
Wu Huibin; Tang Shirong; Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai; Smith, Donald L.
2009-01-01
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO 2 (860 μL L -1 ) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg -1 ). The results showed that elevated CO 2 not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO 2 treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO 2 could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO 2 , increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
Brassac, Jonathan; Blattner, Frank R
2015-09-01
Polyploidization is an important speciation mechanism in the barley genus Hordeum. To analyze evolutionary changes after allopolyploidization, knowledge of parental relationships is essential. One chloroplast and 12 nuclear single-copy loci were amplified by polymerase chain reaction (PCR) in all Hordeum plus six out-group species. Amplicons from each of 96 individuals were pooled, sheared, labeled with individual-specific barcodes and sequenced in a single run on a 454 platform. Reference sequences were obtained by cloning and Sanger sequencing of all loci for nine supplementary individuals. The 454 reads were assembled into contigs representing the 13 loci and, for polyploids, also homoeologues. Phylogenetic analyses were conducted for all loci separately and for a concatenated data matrix of all loci. For diploid taxa, a Bayesian concordance analysis and a coalescent-based dated species tree was inferred from all gene trees. Chloroplast matK was used to determine the maternal parent in allopolyploid taxa. The relative performance of different multilocus analyses in the presence of incomplete lineage sorting and hybridization was also assessed. The resulting multilocus phylogeny reveals for the first time species phylogeny and progenitor-derivative relationships of all di- and polyploid Hordeum taxa within a single analysis. Our study proves that it is possible to obtain a multilocus species-level phylogeny for di- and polyploid taxa by combining PCR with next-generation sequencing, without cloning and without creating a heavy load of sequence data. © The Author(s) 2015. Published by Oxford University Press, on behalf of the Society of Systematic Biologists.
Seedling recruitment of Colophospermum mopane on the Highveld ...
African Journals Online (AJOL)
Seedling recruitment of Colophospermum mopane on the Highveld of Zimbabwe: research note. ... Open areas with bare ground or sparse grass cover were favourable sites for seedling recruitment. Seedlings ... AJOL African Journals Online.
Directory of Open Access Journals (Sweden)
LÓPEZ, A.N.
2012-04-01
Full Text Available ResumenLa colza (Brassica napus, B. campestris en siembra directa (SD representa una alternativa en los sistemas de rotación actuales. Armadillidium vulgare es una de las plagas principales de los cultivos en SD. El objetivo de este trabajo fue evaluar cebos de acción combinada como estrategia alternativa de control de dicha especie.Se realizaron ensayos de laboratorio y de campo con los siguientes tratamientos: testigo sin tratamiento químico; testigo químico (4 kg/ha de Carbaryl 8%, MataBiBos Acay; 3, 4 y 5 kg/ha de cebo de acción combinada (Carbaryl 8% + Metaldehído 4%, Dual Acay. Se evaluó el número de individuos de A. vulgare muertos, de plantas dañadas y de plantas sanas. En el laboratorio, a los 2, 3, 7 y 9 días después de la aplicación de los cebos, los tratamientos químicos se diferenciaron del testigo y no mostraron diferencias significativas entre ellos. Los tratamientos con aplicaciones de cebos presentaron un número de plantas sanas y totales mayorcon respecto al testigo. En el campo, se detectaron diferencias en el número de individuos muertos entre los tratamientos químicos y el testigo. No se observaron diferencias en la proporción de individuos muertos ni de plantas dañadas entre los tratamiento químicos, sí respecto al testigo. La presencia del molusquicida en el cebo de acción combinada no interfirió en el control de A. vulgare. Se concluye que el cebo de acción combinada representa una alternativa de control de A. vulgare eficaz, que permite la protección del cultivo de colza. AbstractOilseed rape (Brassica napus, B. campestris under No-Tillage (NT represents an alternative in the current crop rotation systems. Armadillidium vulgare is a principal pest in crops under NT. The aim of this study was to evaluate combined action baits as alternative strategy in the control of that species. Laboratory and fields traits were carried out with five treatments: control treatment without chemicals, positive
Directory of Open Access Journals (Sweden)
Lucía Delgadillo Ruíz
2017-01-01
Full Text Available Introducción . Los extractos de algunas plantas han demostrado tener propiedades antimicr o bianas relacionadas a ciertos compuestos químicos como son el timol, carvacrol, limoneno, linalol y terpineno. El objetivo del presente trabajo fue determinar la concentración de estos compue s tos en los extractos de Larrea tridentata , Origanum vulgare , Artemisa ludoviciana y Ruta graveolens ; así como evaluar su efecto antimicrobiano en Escherichia coli , Acinetoba c ter baumanii , Pseudomona sp y Staphyloc o ccus aureus . Método . Los extractos se obtuvieron por destilación simple empleando alcohol etílico como solvente, la composición química se evaluó mediante cromatografía de gases. La actividad antimicrobia na de cada uno de los extractos de plantas se realizó por los métodos difusión en pozo y difusión en disco. Resultados . Las bacterias mostraron diferentes grados de sensibilidad a los extractos, prese n tando inhibición de crecimiento S. aureus con el extra cto de O. vulgare y R. graveolens , mientras que la bacteria Pseudomona sp. , con los extracto s de A. ludoviciana, L. tridentata y O. vulgare . Discusión . La mayor concentración de timol y carvacrol se encontró en los extractos de O. vulgare y L. tridentata . El compuesto linalol se encontró en una proporción mayor en O. vulgare y en menor proporción en A. ludoviciana . Limoneno se encontró en los extractos de O. vulgare y R. graveolens . De las cuatro plantas evaluadas, el extracto de L. tridentata fue mejor , de bido a que presenta la mayor inhibición en comparación con los otros extractos; y con un efecto similar a los aceites empleados como control. La técnica de dif u sión en disco, permitió observar mejor los efectos inhibitorios de los extra c tos y los aceites s obre cada una de las bacterias empleadas en comparación con el método de difusión en pozo.
Pukalskas, A.; Venskutonis, P.R.; Salido, S.; Waard, de P.; Beek, van T.A.
2012-01-01
In an earlier screening of Lithuanian plants, horehound (Marrubium vulgare) showed good antioxidant activity and as this species is used in herbal teas and cough pastilles it was selected for further investigation. Some fractions of the aerial parts were strong scavengers of the model free radicals
Pyrrolizidine Alkaloids from Echium vulgare in Honey Originate Primarily from Floral Nectar.
Lucchetti, Matteo A; Glauser, Gaetan; Kilchenmann, Verena; Dübecke, Arne; Beckh, Gudrun; Praz, Christophe; Kast, Christina
2016-06-29
Pyrrolizidine alkaloids (PAs) in honey can be a potential human health risk. So far, it has remained unclear whether PAs in honey originate from pollen or floral nectar. We obtained honey, nectar, and plant pollen from two observation sites where Echium vulgare L. was naturally abundant. The PA concentration of honey was determined by targeted analysis using a high pressure liquid chromatography-mass spectrometry system (HPLC-MS/MS), allowing the quantification of six different PAs and PA-N-oxides present in E. vulgare. Echium-type PAs were detected up to 0.153 μg/g in honey. Nectar and plant pollen were analyzed by nontargeted analysis using ultrahigh pressure liquid chromatography-high resolution-mass spectrometry (UHPLC-HR-MS), allowing the detection of 10 alkaloids in small size samples. Echium-type PAs were detected between 0.3-95.1 μg/g in nectar and 500-35000 μg/g in plant pollen. The PA composition in nectar and plant pollen was compared to the composition in honey. Echimidine (+N-oxide) was the main alkaloid detected in honey and nectar samples, while echivulgarine (+N-oxide) was the main PA found in plant pollen. These results suggest that nectar contributes more significantly to PA contamination in honey than plant pollen.
Directory of Open Access Journals (Sweden)
Suhartati Djarkasi1
2008-12-01
Full Text Available The aims of this research were to study the effect of temperature and storage on the oxidative stability of crude and refined canarium nut oil extracted from the seeds of Canarium indicum and Canarium vulgare. The experiment was designed to include storage of two type of canarium nut oil at two different temperatures for up to 35 days. The oils (crude and refined used had the similar condition. Parameter used for oxidative deterioration indicators were two peroxide value, TBARS (thiobarbituric acid reactive substances, and free fatty acid value. The result showed that refining oil can decrease component natural antioxidant of canarium oil cause more sensitive to the oxidation. Increased storage temperature can raise oxidation of crude and refined oils from both species Canarium. The peroxide values of crude and refined oils both Canarium indicum and Canarium vulgare stored at 30 °C were 2.17, 4.35, 3.36 and 3.77 meq O2/kg oil, respectively. When they were stored at 4C the similar results were 6.21, 19.09, 8.12 and 17.23 meq O2/kg oil. Furthermore, TBARS value of crude and refined oils both for Canarium indicum and Canarium vulgare stored 30C were 4.55, 7.78, 5.70 and 6.58 µmol MDA/kg oil. When they were stored at 40 °C the similar results were 9.99, 55.46, 12.46 and 43.62 µmol MDA/kg oil.
The fungi causin damping-off of carrot seedlings
Directory of Open Access Journals (Sweden)
Bogdan Nowicki
2013-12-01
Full Text Available When 136 samples of dying carrot seedlings from several fields were analyzed Alternaria rudicina proved to be the most common seedling pathogen (41%, followed by some Fusarium species (27%, mostly F. avenaceum.The less common seedling pathogens were Pythium spp. (13%, Phoma spp.(2,5% and Botrytis cinerea (1,4%. Some other fungi (Bipolaris sorokiniana, Sclerotinia sclerotiorum, Stemphylium botryosym and Ulocladium consortiale were found in less than 1% of seedlings examined.
Cotyledon persistence and seedling growth in fluted Pumpkin ...
African Journals Online (AJOL)
Photosynthetic activity of exposed cotyledons of Telfairia occidentalis during seed germination and the growth of seedlings with removed or attached cotyledons were investigated. The experiment investigated how early cotyledon removal affects seedling growth. Seedlings from seeds germinated in light and those ...
Seed-vectored endophytic bacteria modulate development of rice seedlings.
Verma, S K; Kingsley, K; Irizarry, I; Bergen, M; Kharwar, R N; White, J F
2017-06-01
The aim of the present study was to evaluate the effects of the removal of indigenous bacteria from rice seeds on seedling growth and development. Here we report the presence of three indigenous endophytic bacteria in rice seeds that play important roles in modulating seedling development (shoot and root lengths, and formation of root hairs and secondary roots) and defence against pathogens. Seed-associated bacteria were removed using surface sterilization with NaOCl (bleach) followed by antibiotic treatment. When bacteria were absent, growth of seedlings in terms of root hair development and overall seedling size was less than that of seedlings that contained bacteria. Reactive oxygen staining of seedlings showed that endophytic bacteria became intracellular in root parenchyma cells and root hairs. Roots containing endophytic bacteria were seen to stain densely for reactive oxygen, while roots free of bacteria stained lightly for reactive oxygen. Bacteria were isolated and identified as Enterobacter asburiae (VWB1), Pantoea dispersa (VWB2) and Pseudomonas putida (VWB3) by 16S rDNA sequencing. Bacteria were found to produce indole acetic acid (auxins), inhibited the pathogen Fusarium oxysporum and solubilized phosphate. Reinoculation of bacteria onto seedlings derived from surface-disinfected rice and Bermuda grass seeds significantly restored seedling growth and development. Rice seeds harbour indigenous bacterial endophytes that greatly influence seedling growth and development, including root and shoot lengths, root hair formation and disease susceptibility of rice seedlings. This study shows that seeds of rice naturally harbour bacterial endophytes that play key roles in modulation of seedling development. © 2017 The Society for Applied Microbiology.
Cassiano Busatta; Altemir José Mossi; Maria Regina Alves Rodrigues; Rogério Luis Cansian; José Vladimir de Oliveira
2007-01-01
This work reports antimicrobial activity of oregano (Origanum vulgare) essential oil against several bacteria in sausage. The in vitro minimum inhibitory concentration (MIC) was determined for 9 selected aerobic heterotrofic bacteria. The antimicrobial activity of distinct concentrations of the essential oil on the basis of the highest MIC found was tested in a food system comprised of fresh sausage. Batch food samples were also inoculated with Escherichia coli with a fixed concentration and ...
Directory of Open Access Journals (Sweden)
Loyana Silva Godinho
2014-01-01
Full Text Available Schistosomiasis, a parasitic disease caused by trematode flatworms of the genus Schistosoma, affects more than 200 million people worldwide, and its control is dependent on a single drug, praziquantel. Tanacetum vulgare (Asteraceae is used in folk medicine as a vermifuge. This study aimed to investigate the in vitro schistosomicidal activity of the crude extract (TV and the essential oil (TV-EO from the aerial parts of T. vulgare. TV-EO was obtained by hydrodistillation and analyzed by GC/MS, which allowed the identification of β-thujone (84.13% as the major constituent. TV and TV-EO, at 200 μg/mL, decreased motor activity and caused 100% mortality of all adult worms. At 100 and 50 μg/mL, only TV caused death of all adult worms, while TV-EO was inactive. TV (200 μg/mL was also able to reduce viability and decrease production of developed eggs. Confocal laser scanning microscopy showed morphological alterations in the tegument of the S. mansoni surface after incubation with TV (50 and 100 μg/mL. Quantitative analysis on the schistosomes tegument showed that TV caused changes in the numbers of tubercles of S. mansoni male worms in a dose-dependent manner. The findings suggest that T. vulgare is a potential source of schistosomicidal compounds.
[Effect of ectomycorrhizae on the growth of Picea koraiensis seedlings].
Song, Rui-Qing; Wu, Ke
2005-12-01
Basidioscarps of Agaricales in different Picea koraiensis forest plantations were collected during August-October, 2000. 36 isolaters of species of Agaricales were obtained by isolating and culturing to the basidioscarps. Through indoor inoculation test on seedlings of Picea koraiensis, 6 ectomycorrhizae fungi cultures were obtained from 36 isolaters. The inoculation results show that the period for ectomycorrhizae inoculation to 1-year seedlings of Picea koraiensis should be about 30 days after seedlings emerging, the suitable temperature for ectomycorrhizae forming is about 20 degrees C. 6 ectomycorrhizae strains all have growth-promoting effect to the seedlings of Picea koraiensis. The contents of chlorophyll a of the seedlings inoculated strains of Agaricus silvaticus, 031 and L15 were significantly higher than other strains and control. The contents of chlorophyll b in the seedlings inoculated strains 009, 004, Agaricus silvaticus and L15 were significantly higher than other strains and control. The weights of seedlings which inoculated strains 009, 025, 031, Agaricus silvaticus and L15 were significantly different to control, the weight of seedlings inoculated strains of Agaricus silvaticus and L15 are 19.23% and 23.08% more than control; The heights of the seedlings inoculated 6 strains all have significant difference to control, the weight of seedlings inoculated strains of Agaricus silvaticus and L15 are 17.83% and 16.37% more than control. The results of outdoor inoculation show that the seedlings inoculated Agaricus silvaticus grow best on height, 9.25% more than control after inoculated 70 days; the seedlings inoculated strain L15 grow best on collar diameter, 9.92% more than control after inoculated 70 days; the lateral root numbers of seedlings inoculated strain 009 is largest, 51.91% more than control after inoculated 70 days; the main roots of seedlings inoculated strain 009 are longest, 3.36% more than control after inoculated 70 days; the
Rice Seedling Substrate Produced by Coal Gangue
Directory of Open Access Journals (Sweden)
SHAO Yu-fei
2017-10-01
Full Text Available Peats are the mostly used material in making rice seedling substrate. However, mining peats could cause environmental problems. In order to reduce or replace peats in rice seedling substrate industry, this paper studied suitable way to configure rice seedling. The coal gangue was used to experiment cultivating rice. Four rice seeding experiments were carried out based on physical and chemical properties of materials attributes. The results showed:(1 Coal gangue was feasible for rice seedling; (2 The maximum adding amount of coal gangue was 80%(volume ratio though the coal gangue need to be activated; (3 In the case of no activated treatment only 38%(volume ratio of coal gangue could be added to the substrate.
International Nuclear Information System (INIS)
Wang, T.T.; Chu, G.M.; Jiang, P.; Wang, M.
2017-01-01
Two greenhouse experiments were conducted to test the effects of sand burial (0-2 cm) and seed size (small, medium and large) on seed germination and seedling growth of Anabasis aphylla, which is typically used as a windbreak and for the fixation of sand in the Gurbantunggut desert of Xinjiang, region of northwest China. The results showed that sand burial significantly affected seed germination, seedling emergence, survival and biomass of A. aphylla. The seed germination rate, seedling emergence rate, seedling survival rate and biomass were highest at the 0.2 and 0.5 cm sand burial depths. At different burial depths, different sizes of A. aphylla seed showed a significant difference in the germination and emergence rate. At the same sand burial depth, the seedling emergence rate of the large seeds was significantly higher than that of medium and small seeds. At sand burial depth of 0.2-2 cm, germination of large seeds and seedling survival rates were significantly higher than those at the same sand burial depth for medium seed germination, and the latter was significantly higher than for small seed. We speculate that tolerance to sand burial and diversity of seed size increased the adaption of A. aphylla to this environment, contributing to its dominance in the windy and sandy area of Gurbantunggut desert. (author)
Grazing on Regeneration Sites Encourages Pine Seedling Growth
Raymond D. Ratliff; Renee G. Denton
1995-01-01
Effects of season-long, deferred-rotation, and rest-rotation grazing, on ponderosa pine (Pinus ponderosa Dougl. ex Laws.) seedling growth and herbaceous vegetation control were studied in regeneration sites at Boyd Hill, Modoc National Forest, California. Seedlings were planted in 1989. Pine seedling survival and damage did not differ, but the...
Labelling of rice seedlings and rice plants with 32P
International Nuclear Information System (INIS)
Achmad Nasroh, K.
1989-01-01
Labelling of rice seedlings and rice plants with 32 P. Labelled rice seedlings can be used to tag insect pests that feed on. Radioactivity counting of 32 P in the endosperm and in the shoot of rice seeds that soaked for 72 hours in KH 2 32 PO 4 solution of 1 μCi/ml were 29,300 and 9,500 cpm respectively. When these labelled seedlings were grown in unlabelled medium the radioactivity in the shoot increased. It was due to the 32 P that was translocated to the shoot from the endosperm. The 32 P translocation reached maximum about one week after the seedling were grown in the unlabelled medium. Labelled seedlings could also be produced by growing 5, 10 and 15 days old seedlings hydroponically in Kimura B solution containing 32 P. Ten days after growing, the radioactivity concentration of the seedlings stem reached about 115,000; 85,000 and 170,000 cpm/mg dry weight for the 5, 10 and 15 days old seedlings respectively. For the implementation of this method, 20 ml labelled Kimura B was needed for labelling of one seedling. The seedlings should be prepared in tap water. During the growth the 32 P in the labelled seedlings was distributed throughout the plant, so that new leaves and tillers became also radioactive. (author). 5 refs
Choudhary, Manoj Kumar; Kataria, Jyoti; Sharma, Shweta
2017-10-01
A facile biomimetic approach for the synthesis of gold nanoparticles (AuNPs) using aqueous extract of fennel ( Foeniculum vulgare) seeds have been reported in this article. The seeds of F. vulgare are rich in various plant secondary metabolites (phytochemicals) such as polyphenolic acids, flavonoids, and saponins. The phytochemicals of F. vulgare seeds play dual role of reducing and stabilizing agents. The formation of gold nanoparticles was evidenced from the appearance of intense purple color at room temperature with λ max around 550 nm in the UV-Vis absorption spectra. The stable AuNPs were further characterized by X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy and transmission electron microscopy (TEM) analysis. The synthesized nanoparticles were observed to be polydispersed, spherical and ranged from 10 to 30 nm with an average size of 20 ± 2 nm, as obtained from TEM images. The catalytic activity of gold nanoparticles was investigated by studying the reduction of anthropogenic dyes such as methylene blue (MB) and rhodamine B (Rh-B) with sodium borohydride. Results showed the possible applications of biogenic AuNPs in environment related problems.
Cell size and cell number in dwarf mutants of barley (Hordeum vulgare)
International Nuclear Information System (INIS)
Blonstein, A.D.; Gale, M.D.
1984-01-01
Sixteen height mutants, induced by sodium azide treatment of the two-rowed barley variety Proctor, have been used to investigate the relationship between the extent and nature of stem shortening with alterations in cell size and cell number, and the pleiotropic effects of dwarfing genes on vegetative development and agronomic performance. The studies on epidermal cell number and cell length in the developmentally earliest and latest elongated vegetative tissues - the coleoptile and peduncle resprectively - suggest that cell number may be the primary determinant of plant height. One semi-prostrate and one erectoides mutant are used to illustrate different cell number/cell size strategies and their relationships with gibberellin sensitivity, growth rate and lodging resistance are discussed. (author)
Effects of aerial pollutants on cereal growth. [Hordeum vulgare var. Maris Otter
Energy Technology Data Exchange (ETDEWEB)
1975-01-01
Winter barley, var. Maris Otter, was grown at Woburn Experimental Farm in three closed plastic chambers with either filtered, ambient or sulfur dioxide-polluted air. The mean sulfur dioxide levels were 7.2 ..mu..g m/sup -3/, 37 ..mu..g m/sup -3/ for the filtered and ambient chambers respectively. In the field the mean value was 51.5 ..mu..g m/sup -3/ . Temperature and relative humidity in these closed houses differed from the outside. No visible damage occurred on any of the plants grown in the filtered or ambient air. In the fumigated chamber a high dose of sulfur dioxide was given for one week (19-25 April 1975), producing a mean concentration of 951 ..mu..g m/sup -3/, at the four-leaf stage. It caused severe necrosis of the leaves. The plants subsequently recovered and no further fumigations were given. At final harvest these plants were not significantly lower in total dry weight and grain weight from the ambient plants. The dry matter yield of the plants grown in filtered air was higher than that of plants in ambient air.
Diversity in boron toxicity tolerance of Australian barley (Hordeum vulgare L.) genotypes.
Hayes, Julie E; Pallotta, Margaret; Garcia, Melissa; Öz, Mehmet Tufan; Rongala, Jay; Sutton, Tim
2015-09-26
Boron (B) is an important micronutrient for plant growth, but is toxic when levels are too high. This commonly occurs in environments with alkaline soils and relatively low rainfall, including many of the cereal growing regions of southern Australia. Four major genetic loci controlling tolerance to high soil B have been identified in the landrace barley, Sahara 3771. Genes underlying two of the loci encode the B transporters HvBot1 and HvNIP2;1. We investigated sequence and expression level diversity in HvBot1 and HvNIP2;1 across barley germplasm, and identified five novel coding sequence alleles for HvBot1. Lines were identified containing either single or multiple copies of the Sahara HvBot1 allele. We established that only the tandemly duplicated Sahara allele conferred B tolerance, and this duplicated allele was found only in a set of nine lines accessioned in Australian collections as Sahara 3763-3771. HvNIP2;1 coding sequences were highly conserved across barley germplasm. We identified the likely causative SNP in the 5'UTR of Sahara HvNIP2;1, and propose that the creation of a small upstream open reading frame interferes with HvNIP2;1 translation in Sahara 3771. Similar to HvBot1, the tolerant HvNIP2;1 allele was unique to the Sahara barley accessions. We identified a new source of the 2H B tolerance allele controlling leaf symptom development, in the landrace Ethiopia 756. Ethiopia 756, as well as the cultivar Sloop Vic which carries both the 2H and HvBot1 B tolerance alleles derived from Sahara 3771, may be valuable as alternative parents in breeding programs targeted to high soil B environments. There is significant diversity in B toxicity tolerance among contemporary Australian barley varieties but this is not related to variation at any of the four known B tolerance loci, indicating that novel, as yet undiscovered, sources of tolerance exist.
Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review
Directory of Open Access Journals (Sweden)
Jamar, C.
2011-01-01
Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.
Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.
Directory of Open Access Journals (Sweden)
Perović Dragan
2009-01-01
Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.
Influence of yellow rust infection on /sup 32/P transport in detached barley leaves
Energy Technology Data Exchange (ETDEWEB)
Schubert, J. (Akademie der Landwirtschaftswissenschaften der DDR, Aschersleben. Inst. fuer Phytopathologie)
1982-01-01
Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of /sup 32/P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general.
DEFF Research Database (Denmark)
Frandsen, T P; Lok, F; Mirgorodskaya, E
2000-01-01
in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...
Influence of yellow rust infextion on 32P transport in detached barley leaves
International Nuclear Information System (INIS)
Schubert, J.
1982-01-01
Several barley cultivars (Hordeum vulgare L.) differing in their resistance to yellow rust (Puccinia striiformis West.) were tested for relationships between changes of 32 P transport in detached leaves and resistance to yellow rust disease. Investigation carried out with detached second leaves from plants infected at their first leaf revealed a matter transport in these leaves changed by the infection. Transport was also influenced by inoculation with yellow rust uredospores. In that case rust infection influenced the basipetal transport less strongly in resistent plants than in susceptible ones. Connected with the findings the influence of fungal substances on transport processes is discussed in general. (author)
DEFF Research Database (Denmark)
Jensen, E.S.
1996-01-01
Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated....... The dry matter production and total N uptake of a spring barley crop following pea or barley, with a period of unplanted soil in the autumn/winter, were significantly higher after pea than after barley. The barley crop following pea and barley recovered 11% of the pea and 8% of the barley residue N...
Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish
2010-07-01
Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.
Energy Technology Data Exchange (ETDEWEB)
Wu Huibin [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); College of Resources and Environment, Huazhong Agricultural University, 430070 Wuhan, Hubei Province (China); Tang Shirong, E-mail: tangshir@hotmail.com [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, The Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Zhang Ximei; Guo Junkang; Song, Zhengguo; Tian Shuai [Centre for Research in Ecotoxicology and Environmental Remediation, Institute of Agro-Environmental Protection, Ministry of Agriculture, Tianjin 300191 (China); Open Key Laboratory of Agro-environment and Agro-product Safety of the Ministry of Agriculture, Tianjin (China); Smith, Donald L. [Plant Science Department, McGill University, Macdonald Campus, 21111 Lakeshore Road, Ste. Anne de Bellevue, Quebec, H9X 3V9 (Canada)
2009-10-30
The most important challenge to use phytoremediation is how to improve its efficiency by increasing the accumulation of metals in plants, or by improving key plant biological traits that should enhance metal uptake. In this paper, we used open-top chambers to investigate the effects of elevated CO{sub 2} (860 {mu}L L{sup -1}) on biomass and Cs uptake by a Sorghum vulgare x Sorghum vulgare var. sudanense hybrid and Trifolium pratense L. growing on soils spiked with various levels of cesium (0, 300, 1500 and 3000 mg Cs kg{sup -1}). The results showed that elevated CO{sub 2} not only increased aboveground biomass of the Sorghum and Trifolium species by 32-111%, and by 8-11%, respectively, compared to the ambient CO{sub 2} treatment, but also caused more accumulation of Cs by Sorghum species (up to 73%) than Trifolium species (up to 43%). It was speculated that the increase in biomass and the improvement in Cs accumulation ability at elevated CO{sub 2} could be related to lowered soil pH values, and changes in number and kind of microorganisms in the rhizospheres of the two tested species. This is the first report of a link among elevated CO{sub 2}, increased biomass and hyperaccumulation of Cs by Sorghum and Trifolium species.
Synthesis of Pisolithus Ectomycorrhizae on Pecan Seedlings in Fumigated Soil
Donald H. Marx
1979-01-01
Curtis variety of pecan (Carya illinoensis) seedlings were grown for 8 months in fumigated soil infested at sowing with mycelial inoculum of Pisolithus tinctorius. Pisolithus ectomycorrhizae were formed on all inoculated seedlings and significantly improved their growth over control seedlings. Inoculated and control seedlings also formed ectomycorrhizae with naturally...
Composición química y actividad antibacteriana del aceite esencial del Origanum vulgare (orégano
Directory of Open Access Journals (Sweden)
Emilia Albado Plaus
2001-01-01
Full Text Available Objetivo: Determinar la actividad antimicrobiano en el aceite esencial (Carvacrol del Origanum vulgare. Material y métodos: El aceite esencial se obtuvo por destilación por arrastre con vapor de agua, a partir de las hojas y flores desecadas de O. vulgare; se determinó la gravedad especifica con un pinnómetro y el índice de refracción con refractómetro de Abbc; la composición química se evaluó mediante cromatografía de gas con detector de masa (GL-SM. La actividad antimicrobiana del aceite de O. vulgare se realizó por el método semicuantitativo de incorporación y de disco difusión en agar. Resultados: La densidad especifica del producto resultó 0.9234 a 20°C y el índice de refracción 1.4774; el cromatograma mostró un contenido de 9% de Carvacrol, 12.19% de Terpineol, 6.86% de P-cimeno y la presencia de otros compuesto relacionados metabolicamente con los tres antes citados. Las bacterias gram-negativas: Escherichia coli, Pseudomona aeruginosa, Salmonella tiphymurium, Salmonella cholerae suis y Vibrio cholerae y las bacterias gram-positivas: Staphylococcus aureus y Bacillus cereus, mostraron diferentes grados de sensibilidad. De los microorganismos evaluados solo pseudomonas aeruginosa mostró resistencia. Conclusión: El aceite esencial posee actividad microbiana contra todas las bacterias evaluadas, excepto antes para P. aeruginosa.(Rev Med Hered 2001; 12: 16-19 .
Directory of Open Access Journals (Sweden)
Saghi
2015-02-01
Full Text Available Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Escherichia coli. Objectives The present study aimed to investigate the inhibitory effects O. vulgare essence against multidrug-resistant (MDR strains of A. baumannii from selected hospitals in Tehran, Iran. Materials and Methods This oil was obtained using the hydrodistillation method and analyzed by gas chromatography mass spectrography (GC/MS. The antimicrobial activity against MDR isolates was achieved using disc diffusion method and macro-broth dilution assay. Results Analysis of the essential oil revealed the presence of pulegone (68.59% piperitone (7.8%, piperitenone (7.8%, 1, 8-cineole (1.3%, and carvacrol (1.6% as the major components. The results showed a significant activity against MDR A. baumannii with inhibition zones and minimal inhibitory concentration values in the ranges of 7-15 mm and 20-35 µL/mL respectively. Conclusions This investigation showed that the essence oil of O. vulgare had a potent antimicrobial activity against MDR A. baumannii. Further research is required to evaluate the practical values of therapeutic applications.
Diversity of seedling responses to drought
Slot, M.; Poorter, L.
2007-01-01
Drought is an important seedling mortality agent in dry and moist tropical forests, and more severe and frequent droughts are predicted in the future. The effect of drought on leaf gas exchange and seedling survival was tested in a dry-down experiment with four tree species from dry and moist
Longleaf pine bud development: influence of seedling nutrition
J. P. Barnett; D. P. Jackson; R. K. Dumroese
2010-01-01
A subset of seedlings from a larger study (Jackson and others 2006, 2007) were selected and evaluated for two growing seasons to relate bud development, and root-collar diameter (RCD), and height growth with three nursery fertilization rates. We chose seedlings in the 0.5 (lowest), 2.0 (mid-range), and 4.0 (highest) mg of nitrogen per seedling treatments. Buds moved...
Effect of ethephon on hardening of Pachystroma longifolium seedlings
Directory of Open Access Journals (Sweden)
João Alexandre Lopes Dranski
2013-06-01
Full Text Available Immediately after planting, tree seedlings face adverse environmental and biotic stresses that must be overcome to ensure survival and to yield a desirable growth. Hardening practices in the nursery may help improve seedling stress resistance through reduction of aboveground plant tissues and increased root volume and biomass. We conducted an assay to quantify changes in the morphogenesis following application of ethephon on seedlings of Pachystroma longifolium (Ness I. M. Johnst.during hardening. The results showed no effect of the ethephon treatments on the number of leaves but a reduction of up to 50% in seedling height increment, and an increase in stem diameter increment of up to 44% with the 600 mg L-1 ethephon treatment, which consequently altered seedling Dickson Quality Index. Our results indicate that ethephon may help to promote desired morphological changes that occur during seedling hardening in nurseries.
Directory of Open Access Journals (Sweden)
Jana Luíza Toscano Mendes de Oliveira
2009-02-01
Full Text Available This study aimed to evaluate the antibacterial activity of Origanum vulgare L. and O. majorana L. essential oils on Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isolated from the patients with conjunctivitis. The results showed a prominent inhibitory effect of both the essential oils on all the bacterial strains, noted by the large bacterial growth inhibition zones (15-32mm. The Minimum Inhibitory Concentrations (MIC values were between 5-20µL/mL and 2.5-10 µL/mL for O. vulgare and O. majorana essential oil, respectively. The MIC were able to cause significant (PEste estudo objetivou analisar a atividade antibacteriana do óleo essencial de O. vulgare L. and O. majorana L. sobre cepas bacterianas (Staphylococcus aureus, S. coagulase negative, Enterobacter spp., Proteus spp., Acinetobacter spp., Klebsiella spp. isoladas de pacientes com conjuntivite. Os resultados mostraram um destacável efeito inibitório de ambos os óleos essenciais ensaiadossobre todas as cepas bacterianas, notado pela formação de amplas zonas de inibição do crescimento bacteriano (15-32 mm. Os valores de Concentração Inibitória Mínima - CIM encontradas estiveram entre 5-20µL/mL e 2.5-10 µL/mL para o óleo essencial de O. vulgare e O. majorana, respectivamente. Os valores de CIM foram capazes de causar significante efeito inibitório sobre a viabilidade celular de Klebisiella spp., Proteus spp. e S. aureus causando uma total eliminação do inóculo microbiano em um tempo máximo de 24 h de exposição. Estes resultados mostraram a efetividade antibacteriana dos óleos essenciais de O. vulgare e O. majorana, bem como suporta a possibilidade do uso de tais produtos como fontes de compostos antimicrobianos.
Understanding rhizosphere processes to enhance phytoextraction of germanium and rare earth elements
Wiche, Oliver
2017-04-01
Germanium (Ge) and rare earth elements (REEs) are economically valuable raw materials that are not actually rare in terms of concentrations in soils but they are hardly available for plant uptake due to interactions with organic matter (SOM), secondary soil constituents such as Fe/Mn oxides and P bearing soil fractions. Processes in the rhizosphere might influence availability of Ge and REEs in the soil-plant system, since lowering of the pH and presence of carboxylates and siderophores (small molecules that strongly chelate Fe and other elements) strongly influences the chemical speciation of Ge and REEs in soil and consequently this comprehensive knowledge helps us to improve phytomining. In a series of field and greenhouse experiments 16 plant species from the functional groups of grasses, herbs and legumes were tested with regard to their accumulation efficiency of Ge and REEs in shoots. Subsequently, we conducted mixed culture experiments in which inefficient species (e.g. cereals like Avena sativa, Hordeum vulgare, Panicum miliaceum) were cultivated in mixed cultures with efficient species (Lupinus albus, Lupinus angustifolius). Based on the plant concentrations a principal component analysis (PCA) was performed to identify significant factors that explain the accumulation behavior of different plant species with regard to Ge, REEs, Si, Fe and Mn. In this analysis Mn was used to identify plant species with efficient mechanisms to access sparingly available P-resources in soils. Particularly in nonmycorrhizal species concentrations of Mn in leaves often indicate a carboxylate based P-mobilising strategy. Herbaceous plant species accumulated significantly higher amounts of REEs while grasses accumulated significantly higher amounts of Ge. Concentrations of Ge in shoots of grasses correlated significantly positive with Si, but negatively with concentrations of Mn. Indeed, the results of the PCA clearly show that plants with high Mn concentrations tend to have
Luxury as the opposite of vulgarity:a trio of perspectives on luxury brands
Reyneke, Mignon
2011-01-01
This thesis, entitled “Luxury as the opposite of vulgarity: A trio of perspectives on luxury brands” considers luxury brands in a trio of contemporary contexts. Despite the academic research surrounding luxury brands being limited, the existent research most often studies luxury brands in a traditional retail context. That is, luxury is viewed from a perspective where the products are sold in luxury retail stores. However, the landscape that these brands function within has changed significan...
Hadjer Kadri; Salah Eddine Djilani; Abdelouaheb Djilani
2013-01-01
Background.Arisarum vulgare is screened and its total phenolic compounds and total flavonoid contents were measured. In addition, the antioxidant capacity of the methanol-water (7:3) extract of this plant is evalu- ated by DPPH (2,2-diphenyl-1 picrylhydrazyl) and ABTS (2,2’-azino-bis(3-ethylbenzothiazoline-6-sulfon- ic)) tests expressed by Vitamin C Equivalent Antioxidant Capacity (VCEAC). HPLC analyses are carried out to identify some polyphenols. The aim of this study is to identify, ...
Analysis on Factors Affecting Seedling Establishment in Rice
Directory of Open Access Journals (Sweden)
Ju LUO
2007-03-01
Full Text Available Elongations of coleoptile and mesocotyl are related directly to rice seedling establishment in soil and height of plant is related to lodging in rice production. Twelve typical rice cultivars with different lengths of coleoptile and mesocotyl (long, medium and short were selected by screening the lengths of coleoptile and mesocotyl in 1500 accessions. The seedling establishments of these typical cultivars were compared under the combinations of different sowing depths and flooding durations, and two semi-dwarf varieties (G140, Zhong 96–21 with good seedling establishments and optimum mesocotyl lengths were found. The length of mesocotyl was completely fitted negative binomial distribution and the length of coleoptile was nearly fitted lognormal distribution. Analysis of the relationships among mesocotyl, coleoptile, seeding depth, flooding duration, and their interactions to seedling establishment percentage showed that there existed significant relations among mesocotyl, coleoptile, mesocotyl × coleoptile, seeding depth, flooding duration and mesocotyl × sowing depth in the experiment for seedling establishment.
Instrumental neutron activities analysis of Marrubium vulgare L., a valuable medicinal herb
Energy Technology Data Exchange (ETDEWEB)
Nedjimi, Bouzid [Djelfa Univ. (Algeria). Lab. of Exploration and Valorization of Steppe Ecosystem; Beladel, Brahim [Djelfa Univ. (Algeria). Dept. of Physics
2016-08-01
Twenty two chemical elements were identified by Instrumental neutron activation analysis in Marrubium vulgare (Lamiaceae) a traditional medicine plant, used indigenously in Mediterranean basin to cure several diseases. The precision of the results was assessed by analyzing the certified reference material GBW 07605 (GSV-4) Tea leaves. Results showed that K was the dominant chemical element in studied plant (4.40%). The Ca and Fe mass fractions were also relatively high. However potential toxic elements in this Lamiaceae plant were within the safety limits suggested by WHO/FAO.
Seedling recruitment of forb species under experimental microhabitats in alpine grassland
International Nuclear Information System (INIS)
Li, S. S.; Yu, L.; Lin, W. G.; Pingi, T. F.
2015-01-01
Which factors limit plant seedling recruitment in alpine meadow of the Qinghai-Tibetan Plateau (QTP), China? This study examined the relative influence of seed mass and microsites (resulted from grazing disturbance) on field seedling emergence and survival of nineteen alpine herbaceous species with a range of traits in QTP. Seed mass had significant effects on seedling emergence and survival eliminating influence of light and nutrient variances among these species. The larger-seed species had more advantageous than the smaller-seed species in seedling survival, but it was disadvatage for seedling emergence, especially under high nutrient availability and low light intensity conditions. Light had obvious effects on seedling survival, but less effects on seedling emergence for these species. Moreover, nutrient and light treatments altered the regression relationships of seed mass and seedling emergence and survival and the order of significances was L25>L50>L100>L10>L4. These results suggested that seed mass may restrict seedling recruitment processes, however, light and nutrient availability all have significant effects on seedling emergence and survival for these alpine species. Moderate light intensity was propitious to seedling emergence and survival in alpine grassland. This suggests that ecological factors in alpine grassland provide a stochastic influence on different seed-mass species. These trends may help to explain why many small-seeded species of Asteraceae and Gramineae tend to be more abundant in disturbed habitats. (author)
Reinhardt, K.; Germino, M. J.; Kueppers, L. M.; Mitton, J.; Castanha, C.
2012-12-01
BACKGROUND Recent ecophysiological studies aimed at explaining adult tree mortality during drought have examined the carbon (C)-exhaustion compared to the hydraulic-failure hypotheses for death. Prolonged drought leads to durations of stomatal closure (and thus limited C gain), which could result in long periods of negative C balance and fatal reductions in whole-plant C reserves (i.e., available non-structural carbohydrates ["NSC"]). Alternatively, C reserves may not decrease much but could become increasingly inaccessible to sink tissues in long dry-periods due to impediments to translocation of photosynthate (e.g., through disruption of hydrostatic pressure flow in phloem). As C reserves decline or become inaccessible, continued maintenance respiration has been hypothesized to lead to exhaustion of NSC after extended durations of drought, especially in isohydric plant species. On the other hand, hydraulic failure (e.g., catastrophic xylem embolisms) during drought may be the proximate cause of death, occurring before true C starvation occurs. Few studies have investigated specifically the mechanism(s) of tree death, and no published studies that we know of have quantified changes in NSC during mortality. EXPERIMENTAL DESIGN AND HYPOTHESES We conducted two studies that investigated whole-tree and tissue-specific C relations (photosynthetic C gain, respiration, dry-mass gain, and NSC pools) in Pinus flexilis seedlings during the initial establishment phase, which is characterized by progressive drought during summer. We measured survival, growth and biomass allocation, and C-balance physiology (photosynthetic C-gain and chlorophyll fluorescence, respiration C-use, and NSC concentrations) from germination to mortality. We hypothesized that 1) stomatal and biochemical limitations to C gain would constrain seedling survival (through inadequate seasonal C-balance), as has been shown for conifer seedlings near alpine treeline; 2) hydraulic constraints (embolisms and
Silvicultural Attempts to Induce Browse Resistance in Conifer Seedlings
Directory of Open Access Journals (Sweden)
Bruce A. Kimball
2011-01-01
Full Text Available A multiyear study was conducted to determine if soil amendment combined with topical application of elemental sulfur could be employed to reduce deer browse damage to four conifer species. Fertilizer and sulfur were applied to conifer seedlings at seven sites near Corvallis, OR. Growth and browse damage data were collected for all seedlings over a period of 17 months. Additionally, foliar concentrations of monoterpenes and simple carbohydrates were assessed in western redcedar (Thuja plicata seedlings over a period of three years. Fertilization and sulfur treatments had a moderate impact on growth and no influence on browse damage or the chemical responses. Over the course of the study, browse damage diminished while foliar monoterpene concentrations increased in redcedar. It appears that silvicultural manipulation via sulfur application and/or soil amendment cannot accelerate or alter the ontogenetical changes that may naturally defend seedlings against mammalian herbivores. In a brief trial with captive deer, redcedar browse resistance was influenced by seedling maturation, but not monoterpene content. Other maturation effects may yield significant browse protection to young seedlings.
Image seedling analysis to evaluate tomato seed physiological potential
Directory of Open Access Journals (Sweden)
Vanessa Neumann Silva
Full Text Available Computerized seedling image analysis are one of the most recently techniques to detect differences of vigor between seed lots. The aim of this study was verify the hability of computerized seedling image analysis by SVIS® to detect differences of vigor between tomato seed lots as information provided by traditionally vigor tests. Ten lots of tomato seeds, cultivar Santa Clara, were stored for 12 months in controlled environment at 20 ± 1 ºC and 45-50% of relative humidity of the air. The moisture content of the seeds was monitored and the physiological potential tested at 0, 6 and 12 months after storage, with germination test, first count of germination, traditional accelerated ageing and with saturated salt solution, electrical conductivity, seedling emergence and with seed vigor imaging system (SVIS®. A completely randomized experimental design was used with four replications. The parameters obtained by the computerized seedling analysis (seedling length and indexes of vigor and seedling growth with software SVIS® are efficient to detect differences between tomato seed lots of high and low vigor.
Urban solid waste in the production of Lafoensia pacari seedlings
Directory of Open Access Journals (Sweden)
Alan H. M. de Abreu
Full Text Available ABSTRACT This study aimed to verify the potential of urban solid wastes as substrate for production of seedlings of Lafoensia pacari. Five treatments were tested, four with solid wastes and one standard substrate, namely: sewage sludge from Alegria Wastewater Treatment Plant (WTP; sewage sludge from Ilha do Governador WTP; sewage sludge from Sarapuí WTP; domestic garbage compost (Fertlurb; and a commercial substrate made of biostabilized pine bark (standard substrate. The wastes received 20% (in volume of shredded coconut fiber. At 105 days after sowing, the seedlings were evaluated for different quality parameters. Seedlings produced with Sarapuí WTP sewage sludge showed the best results in all the parameters, followed by seedlings produced with sewage sludge from Alegria and Ilha do Governador WTPs, which did not differ. Seedlings produced with domestic garbage compost showed satisfactory results, higher than the ones observed for seedlings produced with commercial substrate. The urban solid wastes with 20% of coconut fiber showed high potential and can be recommended for the composition of substrate in the production of Lafoensia pacari seedlings.
Spiridon, Iuliana; Colceru, Svetlana; Anghel, Narcis; Teaca, Carmen Alice; Bodirlau, Ruxanda; Armatu, Alice
2011-10-01
The study reported here presents a comparative screening of three medicinal plants including oregano (Origanum vulgare L.), lavender (Lavandula angustifolia) and lemon balm (Melissa officinalis) having the same geographical origin, the Southeast region of Romania, and growing in the same natural conditions. The contents of total phenolics and total flavonoids for the extracts of these were determined. Furthermore, the total antioxidant capacity was also evaluated. It was found that Origanum vulgare and Melissa officinalis extracts present the most effective antioxidant capacity in scavenging DPPH radicals, while Lavandula angustifolia is less active. High performance liquid chromatography-mass spectrometry analysis was used to identify the components of extracts. Major phenolic acids identified in the analysed species were ferulic, rosmarinic, p-coumaric and caffeic, while predominant flavonoids were quercetin, apigenin kaempherol, which were present as glucosides.
Effects of Seedbed Density on Seedling Morphological Characteristics of four Broadleaved Species
Energy Technology Data Exchange (ETDEWEB)
Yucedag, C.; Gailing, O.
2012-11-01
The aim of this study was to investigate the effects of seedling spacing on morphological characteristics of one year-old Amygdalus communis L., Prunus avium L., Pyrus elaeagnifolia Pall. and Eriolobus trilobatus (Poiret) Roemer seedlings under nursery conditions. Seedlings were grown in completely randomized blocks with four replications. Seedbeds were 1.2 m wide with 5 rows each 20 cm apart. Within-row spacings were chosen as 4, 8 and 12 cm to analyze the effect of seedlings density on growth performance. Seedling spacing significantly affected root collar diameter, shoot height, tap root length and number of fine roots in A. communis and P. avium, but not in P. elaeagnifolia and E. tribolatus. Additionally wider seedling spacings resulted in larger seedlings in A. communis and P. avium. In conclusion, it would be beneficial to use wider seedling spacing in order to obtain better seedling growth in A. communis and P. avium. Larger seedlings could also provide significant advantages because of reduced cultural activities and an expected higher growth and survival rate. (Author) 27 refs.
Maryam Mohajerani (PhD); Afsaneh Aghae i ( MSc )
2016-01-01
Background and objective: Peroxidases catalyze protein oxidation and lipid peroxidation. The activity of these enzymes in nerve cells is involved in causing disorders such as Alzheimer's and Parkinson's disease. This study investigated the effect of Citrus aurantium, Foeniculum vulgare and Rosmarinus officinalis essential oils on activity of peroxidase enzyme. Methods: All three medicinal plants were dried at room temperature. Their essential oil was extracted by steam distillation ...
Effects of graphene on seed germination and seedling growth
Energy Technology Data Exchange (ETDEWEB)
Zhang, Ming; Gao, Bin, E-mail: bg55@ufl.edu [University of Florida, Department of Agricultural and Biological Engineering (United States); Chen, Jianjun [University of Florida, Department of Environmental Horticulture and Mid-Florida Research & Education Center (United States); Li, Yuncong [University of Florida, Soil and Water Science Department Tropical Research & Education Center (United States)
2015-02-15
The environmental impact of graphene has recently attracted great attention. In this work, we show that graphene at a low concentration affected tomato seed germination and seedling growth. Graphene-treated seeds germinated much faster than control seeds. Analytical results indicated that graphene penetrated seed husks. The penetration might break the husks to facilitate water uptake, resulting in faster germination and higher germination rates. At the stage of seedling growth, graphene was also able to penetrate root tip cells. Seedlings germinated from graphene-treated seeds had slightly lower biomass accumulation than the control, but exhibited significantly longer stems and roots than the control, which suggests that graphene, in contrast with other nanoparticles, had different effects on seedling growth. Taken together, our results imply that graphene played complicated roles in affecting the initial stage of seed germination and subsequent seedling growth.
Production of desert rose seedlings in different potting media
Directory of Open Access Journals (Sweden)
Ronan Carlos Colombo
2017-09-01
Full Text Available Over the past decade the desert rose received fame in the flower market due to its striking and sculptural forms; however, the commercial production of these species is quite recent and little is known about its crop management, including substrates recommendation. The objectives of this study were to investigate the effect of different substrates on desert rose seed germination and production of its seedlings. Experiment I: freshly harvested seeds of desert rose were sown in different substrates e.g. sand, coconut fiber, semi-composted pine bark, sand + coconut fiber, semi-composted pine bark + sand and coconut fiber + semicomposted pine bark. These substrates were evaluated to study the emergence percentage of seeds, initial growth of seedlings and seedling emergence speed index (ESI. Experiment II: desert rose from the experiment I were transferred to plastic pots filled with the same substrates as in experiment I. The pH and electrical conductivity (EC of the substrates were noted every 30 days while the growth parameters of seedlings were recorded after 240 days. Results from experiment I showed higher germination rate and seedling growth in substrates containing semi-composted pine bark. Similarly, in experiment II, better quality seedlings were observed in substrates containing semi-composted pine bark. Thus, for desert rose seed germination and seedling growth, it is recommended to use substrates containing semi-composted pine bark.
Biodegradable bags for the production of plant seedlings
Bilck,Ana Paula; Olivato,Juliana Bonametti; Yamashita,Fabio; Souza,José Roberto Pinto de
2014-01-01
The production of plant seedlings has traditionally used polyethylene bags, which are thrown out in the soil or burned after transplant because the large amount of organic material attached to the bags makes recycling difficult. Additionally, when a seedling is taken from the bag for transplant, there is the risk of root damage, which compromises the plant’s development. In this study, we developed biodegradable bags to be used in seedling production, and we verify their influence on the deve...
Photomodulation of strigolactone biosynthesis and accumulation during sunflower seedling growth
Bharti, Niharika; Tripathi, Smita; Bhatla, Satish Chander
2015-01-01
Present investigations report the presence of strigolactones (SLs) and photomodulation of their biosynthesis in sunflower seedlings (roots, cotyledons and first pair of leaves) during early phase of seedling development. Qualitative analyses and characterization by HPLC, ESI-MS and FT-IR revealed the presence of more than one type of SLs. Orobanchyl acetate was detected both in roots and leaves. Five-deoxystrigol, sorgolactone and orobanchol were exclusively detected in seedling roots. Sorgomol was detectable only in leaves. HPLC eluted fraction from seedling roots and leaves co-chromatographing with GR24 (a synthetic SL) could also bring about germination in Orobanche cernua (a weed) seeds, which are established to exhibit SL – mediated germination, thereby indicating the SL identity of the eluates using this bioassay. SLs accumulation was always more in the roots of light-grown seedlings, it being maximum at 4 d stage. Although significant activity of carotenoid cleavage dioxygenase (CCD, the enzyme critical for SL biosynthesis) was detected in 2 d old seedling roots, SLs remained undetectable in cotyledons at all stages of development and also in the roots of 2 d old light and dark-grown seedlings. Roots of light-grown seedlings showed maximum CCD activity during early (2 d) stage of development, thereby confirming photomodulation of enzyme activity. These observations indicate the migration of a probable light-sensitized signaling molecule (yet to be identified) or a SL precursor from light exposed aerial parts to the seedling roots maintained in dark. Thus, a photomodulation and migration of SL precursor/s is evident from the present work. PMID:26252191
Detection of alien genetic introgressions in bread wheat using dot-blot genomic hybridisation.
Rey, María-Dolores; Prieto, Pilar
2017-01-01
Simple, reliable methods for the identification of alien genetic introgressions are required in plant breeding programmes. The use of genomic dot-blot hybridisation allows the detection of small Hordeum chilense genomic introgressions in the descendants of genetic crosses between wheat and H. chilense addition or substitution lines in wheat when molecular markers are difficult to use. Based on genomic in situ hybridisation, DNA samples from wheat lines carrying putatively H. chilense introgressions were immobilised on a membrane, blocked with wheat genomic DNA and hybridised with biotin-labelled H. chilense genomic DNA as a probe. This dot-blot screening reduced the number of plants necessary to be analysed by molecular markers or in situ hybridisation, saving time and money. The technique was sensitive enough to detect a minimum of 5 ng of total genomic DNA immobilised on the membrane or about 1/420 dilution of H. chilense genomic DNA in the wheat background. The robustness of the technique was verified by in situ hybridisation. In addition, the detection of other wheat relative species such as Hordeum vulgare , Secale cereale and Agropyron cristatum in the wheat background was also reported .
Strong microsite control of seedling recruitment in tundra
DEFF Research Database (Denmark)
Graae, Bente J; Ejrnæs, Rasmus; Lang, Simone I
2011-01-01
The inclusion of environmental variation in studies of recruitment is a prerequisite for realistic predictions of the responses of vegetation to a changing environment. We investigated how seedling recruitment is affected by seed availability and microsite quality along a steep environmental......, the experimental seed addition showed that the microsite environment was even more important. For all species, seedling emergence peaked at the productive end of the gradient, irrespective of the adult niches realized. Disturbance promoted recruitment at all positions along the environmental gradient, not just...... at high productivity. Early seedling emergence constituted the main temporal bottleneck in recruitment for all species. Surprisingly, winter mortality was highest at what appeared to be the most benign end of the gradient. The results highlight that seedling recruitment patterns are largely determined...
Production of cell wall enzymes in pepper seedlings, inoculated with ...
African Journals Online (AJOL)
Pepper seedlings inoculated with arbuscular mycorrhizal AM fungus, Glomus etunicatum, produced cellulase, polygal-acturonase and pectin methylestrase enzymes. The activities of the enzymes increased as the pepper seedlings matured in age, showing that the activity of the enzymes in the seedlings was age mediated.
Long-term rotation and tillage effects on soil structure and crop yield
DEFF Research Database (Denmark)
Munkholm, Lars Juhl; Heck, R; Deen, B
2013-01-01
long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C......–C–S–S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard ploughing, MP. Topsoil structural quality...
DEFF Research Database (Denmark)
Munkholm, Lars Juhl; Heck, Richard; Deen, Bill
year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...... L.) and R8, (C-C-S-S) corn, corn, soybean (Glycine max L.), soybean. A red clover (Trifolium pretense L.) cover crop was under seeded in oats and spring barley in R6. In 2010, first year corn was grown in R6 and R8. The tillage treatments included no tillage, NT and mouldboard plowing, MP. Topsoil...
Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase
DEFF Research Database (Denmark)
Leah, R.; Kigel, J.; Svendsen, I.
1995-01-01
blot analysis with the cDNA as probe indicated that BGQ60 is encoded by a single gene, and that BGQ60 mRNA only accumulates in the starchy endosperm tissue of late developing seeds. The bgq60 structural gene of approximately 5 kilobases contains an open reading frame encoding 485 amino acids...... during barley seed development and germination are discussed.......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units...
Santos, Adrian Richard Schenberger; Etto, Rafael Mazer; Furmam, Rafaela Wiegand; Freitas, Denis Leandro de; Santos, Karina Freire d'Eça Nogueira; Souza, Emanuel Maltempi de; Pedrosa, Fábio de Oliveira; Ayub, Ricardo Antônio; Steffens, Maria Berenice Reynaud; Galvão, Carolina Weigert
2017-09-01
Soil bacteria colonization in plants is a complex process, which involves interaction between many bacterial characters and plant responses. In this work, we labeled Azospirillum brasilense FP2 (wild type) and HM053 (excretion-ammonium) strains by insertion of the reporter gene gusA-kanamycin into the dinitrogenase reductase coding gene, nifH, and evaluated bacteria colonization in barley (Hordeum vulgare). In addition, we determined inoculation effect based on growth promotion parameters. We report an uncommon endophytic behavior of A. brasilense Sp7 derivative inside the root hair cells of barley and highlight the promising use of A. brasilense HM053 as plant growth-promoting bacterium. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
International Nuclear Information System (INIS)
Mohammed, M.M.A.
2010-01-01
This study was conducted to evaluate the modulating efficacy of prolonged oral administration of Foeniculum vulgare Mill. essential oil (FEO) against gamma irradiation-induced biochemical changes in male rats. Essential oil of Foeniculum vulgare Mill. was orally administrated at dose level of 250 mg/kg body wt/day for 21 days before irradiation and 7 days post exposure (6.5 Gy single dose). Rats exposed to ionizing radiation exhibited a potential elevation of serum aspartate aminotransferase (AST) and alkaline phosphatase (ALP) activities, bilirubin, urea and creatinine levels, lipid abnormalities, and an increase in tissue lipid peroxidation (LPO) and metallothioneins (MTs). On the other hand, noticeable drop in liver and kidney glutathione content and serum total protein, albumin and testosterone levels were recorded. Tissue organs displayed some changes in trace element concentrations, which may be due to the radiation ability to induce oxidative stress. The data obtained from rats treated with fennel oil before and after whole body gamma irradiation revealed significant modulation in the biochemical tested parameters and profound improvement in the activity of antioxidant status, glutathione and metallothioneins. The treatment of irradiated rats with fennel oil also appeared to be effective in minimizing the radiation-induced increase in lipid peroxidation as well as changes in essential trace elements in some tissue organs. In addition to its containing many chemical antioxidant constituents such as polyphenols, fennel was found to contain detectable concentrations of essential trace elements (Zn, Cu, Fe, Se, Mg, Mn and Ca) which may be involved in multiple biological processes as constituents of enzymes system including superoxide dismutase (Cu, Zn, Mn, SODs), oxide reductase, glutathione (GSP, GSH, GST), metallothionein MTs, etc. Overall, it could be concluded that Foeniculum vulgare Mill. essential oil exerts beneficial protective role against radiation
Molecular biology of Ganoderma pathogenicity and diagnosis in coconut seedlings.
Kandan, A; Radjacommare, R; Ramanathan, A; Raguchander, T; Balasubramanian, P; Samiyappan, R
2009-01-01
The pathogenicity of Ganoderma boninense was tested on coconut seedlings under greenhouse conditions and infection confirmed by using immunological and molecular diagnostic tools. Desiccation of older leaves and the emergence of sporophores were observed from pathogen-inoculated seedlings, whereas a control seedling does not show any pathogenic symptoms. Mature sporophores were formed within 10-13 weeks after inoculation. Polyclonal antibodies raised against mycelial proteins of Ganoderma were used for detection of Ganoderma in infected field palm and seedlings through indirect enzyme-linked immunosorbent assay technique. We adopted dot-immunobinding assay for the detection of Ganoderma from greenhouse and field samples. Under nucleic-acid-based diagnosis, G. boninense (167 bp) was detected from artificially inoculated seedlings and infected field palms by polymerase chain reaction. Apart from these, histopathological studies also support the Ganoderma pathogenicity in coconut seedlings. The pathogenicity test and combination of all the three diagnostic methods for Ganoderma could be highly reliable, rapid, sensitive and effective screening of resistance in planting material in the future.
Gene expression in plant lipid metabolism in Arabidopsis seedlings.
Directory of Open Access Journals (Sweden)
An-Shan Hsiao
Full Text Available Events in plant lipid metabolism are important during seedling establishment. As it has not been experimentally verified whether lipid metabolism in 2- and 5-day-old Arabidopsis thaliana seedlings is diurnally-controlled, quantitative real-time PCR analysis was used to investigate the expression of target genes in acyl-lipid transfer, β-oxidation and triacylglycerol (TAG synthesis and hydrolysis in wild-type Arabidopsis WS and Col-0. In both WS and Col-0, ACYL-COA-BINDING PROTEIN3 (ACBP3, DIACYLGLYCEROL ACYLTRANSFERASE1 (DGAT1 and DGAT3 showed diurnal control in 2- and 5-day-old seedlings. Also, COMATOSE (CTS was diurnally regulated in 2-day-old seedlings and LONG-CHAIN ACYL-COA SYNTHETASE6 (LACS6 in 5-day-old seedlings in both WS and Col-0. Subsequently, the effect of CIRCADIAN CLOCK ASSOCIATED1 (CCA1 and LATE ELONGATED HYPOCOTYL (LHY from the core clock system was examined using the cca1lhy mutant and CCA1-overexpressing (CCA1-OX lines versus wild-type WS and Col-0, respectively. Results revealed differential gene expression in lipid metabolism between 2- and 5-day-old mutant and wild-type WS seedlings, as well as between CCA1-OX and wild-type Col-0. Of the ACBPs, ACBP3 displayed the most significant changes between cca1lhy and WS and between CCA1-OX and Col-0, consistent with previous reports that ACBP3 is greatly affected by light/dark cycling. Evidence of oil body retention in 4- and 5-day-old seedlings of the cca1lhy mutant in comparison to WS indicated the effect of cca1lhy on storage lipid reserve mobilization. Lipid profiling revealed differences in primary lipid metabolism, namely in TAG, fatty acid methyl ester and acyl-CoA contents amongst cca1lhy, CCA1-OX, and wild-type seedlings. Taken together, this study demonstrates that lipid metabolism is subject to diurnal regulation in the early stages of seedling development in Arabidopsis.
Eastern Redcedar Seedling Assessment
U.S. Environmental Protection Agency — Eastern redcedar tree seedling growth in response to various soil, nitrogen, and photosynthetic radiation characteristics. This dataset is associated with the...
Energy Technology Data Exchange (ETDEWEB)
Stenstroem, Elna [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology; Arvidsson, Bernt [Svenska Skogsplantor AB, Joenkoeping (Sweden)
2001-07-01
During the 1990s, there were serious outbreaks of the pathogen Lophodermium seditiosum on pine seedlings in Swedish forest nurseries, even though the seedlings had been treated with the fungicide propiconazole. The present experiment was carried out to evaluate two other fungicides, fluazinam and azoxystrobin, as possible alternatives to propiconazole. In the tests, which were all carried out in the same forest nursery, seedlings were treated with either propiconazole, fluazinam. or azoxystrobin, and the proportion of needles with ascocarps of L. seditiosum and the number of ascocarps per needle were recorded over the following 2 yrs. Seedlings treated with azoxystrobin already appeared healthier than control seedlings in September of the first year, and by November all azoxystrobin-treated seedlings had fewer ascocarps per needle compared with control seedlings. In autumn of the second year, there were no ascocarps on seedlings treated with fluazinam or azoxystrobin, whereas seedlings treated with propiconazole had similar numbers of ascocarps to non-treated control seedlings.
Germination and initial development of aroeira (Myracrodruon urundeuva seedlings
Directory of Open Access Journals (Sweden)
Silvana de Paula Quintão Scalon
2012-12-01
Full Text Available Aroeira has great economic importance due to its wood useful, tannins extraction and use in the pharmacology. The aim of this work was to evaluate the germination aspects and initial seedlings development of aroeira, under gibberellins, substrata and shading effects, and for that two experiments were led out. In the first one, seeds were previously soaked for 24 hours in water and in 100 mg.L-1 gibberellin solution and were sowed directly in cells trays in the following substrata: land and sand (1:1 and 1:2 and Plantmax . In the second experiment, 15 cm length seedlings were transplanted to polyethylene sacks filled out land+sand+poultry manure (1:1:1 partly decomposed and they were maintained at greenhouse for 15 days. Soon after, seedlings were transferred for the following conditions: shading (50% and full sun and they were 50 mg.L-1 and 150 mg.L-1 gibberellins solutions pulverized, as control seedlings water pulverized. Aroeira seeds should not be previously water or gibberellins imbibed before being sowed. The best substrata for aroeira seeds germination was Plantmax without germinative treatments to reach higher than 80% of seedlings survival. The seedlings developed better at full sun light and the gibberellin. It was observed increment in height, diameter, foliar area and fresh and dry mass from aerial and root part when compared to shading situation. The gibberellins applications did not influence the aroeira seedlings initial growth characteristics.
SOURCES OF MYCORRHIZAL INFECTION OF SHOREA ACUMINATA SEEDLINGS UNDER LABORATORY CONDITIONS
Directory of Open Access Journals (Sweden)
LEE Su SEE
1995-01-01
Full Text Available Uninoculated dipterocarp seedlings raised in normal field soil in nurseries were always found to have mycorrhizas after a few months. This study set out to determine whether dipterocarp seedlings could continue to grow and develop in the absence of mycorrhizas and also to determine possible sources of mycorrhizal infection of dipterocarp seedlings raised under laboratory conditions using Shorea acuminata as a typical example. Seedlings were planted in capped or uncapped perspex boxes containing sterile or non-sterile field soil and watered daily with sterile water or tap water. Seedling growth and development of mycorrhizas were monitored at monthly intervals for up to seven months. Seedlings grown in sterile soil remained uninfected after seven months while infection was found in some of the seedlings grown in normal soil regardless of whether they had been watered with tap water or sterile water. This showed that field soil (i.e. under grass far from the forest contained suitable inoculum for forest tree seedlings. Tap water and the air were not important sources of infection. However, mycorrhizal infection was very uneven indicating that the inoculum was probably very unevenly distributed in the soil or that the inoculum density was rather low. Seedlings grown in sterile soil showed better growth than those grown in normal soil and infection of roots by parasitic fungi in the latter was also observed.
Energy Technology Data Exchange (ETDEWEB)
Langvall, Ola (Swedish Univ. of Agricultural Sciences, Unit for Field-based Forest Research, Asa Forest Research Station, Lammhult (Sweden))
2011-04-15
A model including site-specific microclimate-affecting properties of a forest regeneration area together with seedling characteristics was used to evaluate the accumulated risk of frost damage to Norway spruce (Picea abies (L.) Karst.) seedlings. Climate change in Sweden was simulated on the basis of the regional climate model RCA3. The daily average temperature, the driving factor for bud burst in the model, was adjusted using the difference between the mean of the climate model data for the years 1961-1990 and 2036-2065. The model was run for a highly frost prone, clear-cut site in which bare-rooted Norway spruce seedlings of mid-Swedish provenance were planted. Alternate runs were conducted with data for containerized seedlings and seedlings of Belarusian origin. The study showed that bud burst will occur at earlier dates throughout Sweden in the period 2036-2065 if the climate changes according to either of the climate scenarios examined, compared to the reference period 1961-1990. Furthermore, the risk of damage to Norway spruce seedlings as a result of frost events during summer will increase in southern Sweden and be unaffected or decrease in northern Sweden. The risk of frost damage was exacerbated in containerized seedlings, while the risk was lower for the seedlings of Belarusian provenance when compared with bare-rooted seedlings or seedlings of mid-Swedish origin
An Acylated Kaempferol Glycoside from Flowers of Foeniculum vulgare and F. Dulce
Soliman, Fathy M.; Shehata, Afaf H.; Khaleel, Amal E.; Ezzat, Shahera M.
2002-01-01
An acylated kaempferol glycoside, namely kaempferol-3-O-α-L-(2”,3”-di-E-pcoumaroyl)-rhamnoside (1) was isolated from the flowers of Foeniculum vulgare Mill. and F. dulce DC. It is thus isolated for the first time from family Apiaceae. In addition, the different organs of both plants afforded six flavonoid glycosides - namely afzelin (kaempferol-3-O-α-L-rhamnoside) (2), quercitrin (3), isorhamnetin-3-O-β-D-glucoside (4), isoquercitrin (5), rutin (6), and miquelianin (quercetin-3...
Effects of benzoic acid and cadmium toxicity on wheat seedlings
Directory of Open Access Journals (Sweden)
Kavita Yadav
2013-06-01
Full Text Available Benzoic acid (BA and Cd exhibit cumulative effects on plants due to their accumulation in the soil. The present study reports the effects of BA an allelochemical, Cd and their combinations on seed germination, seedling growth, biochemical parameters, and response of antioxidant enzymes in Triticum aestivum L. The experiment was conducted in sand supplemented with Hoagland nutrient solution. Benzoic acid was applied at concentrations of 0.5, 1.0, and 1.5 mM with or without Cd (7 mg L-1 to observe effects of allelochemical and Cd alone and in combination on wheat. Both stresses exhibited inhibitory effect on growth and metabolism of wheat seedlings. The allelochemical in single and combined treatments with Cd decreased seedling growth as compared to Cd stress. The two stresses significantly enhanced malondialdehyde content of wheat seedlings. The activity of other antioxidant enzymes, viz. superoxide dismutase (SOD, catalase (CAT, ascorbate peroxidase (APX, and guaiacol peroxidase (POX were also recorded. SOD increased in seedlings under the two stresses. CAT more prominently ameliorates the toxic effects of H2O2 as compared with APX and POX and protected wheat seedlings from oxidative stress. Allelochemical buttressed the toxic effect of Cd on wheat seedlings.
Shakuntala Sharma; Joshua P. Adams; Jamie L. Schuler; Robert L. Ficklin; Don C. Bragg
2016-01-01
This study assessed the effects of spacing and genotype on the growth and physiology of improved loblolly pine (Pinus taeda L.) seedlings from three distinct genotypes planted in Drew County, Arkansas (USA). Genotype had a significant effect on survival and height. Clone CF Var 1 showed greater height and survival compared to other seedlings....
Winter survival of Scots pine seedlings under different snow conditions.
Domisch, Timo; Martz, Françoise; Repo, Tapani; Rautio, Pasi
2018-04-01
Future climate scenarios predict increased air temperatures and precipitation, particularly at high latitudes, and especially so during winter. Soil temperatures, however, are more difficult to predict, since they depend strongly on the fate of the insulating snow cover. 'Rain-on-snow' events and warm spells during winter can lead to thaw-freeze cycles, compacted snow and ice encasement, as well as local flooding. These adverse conditions could counteract the otherwise positive effects of climatic changes on forest seedling growth. In order to study the effects of different winter and snow conditions on young Scots pine (Pinus sylvestris L.) seedlings, we conducted a laboratory experiment in which 80 1-year-old Scots pine seedlings were distributed between four winter treatments in dasotrons: ambient snow cover (SNOW), compressed snow and ice encasement (ICE), flooded and frozen soil (FLOOD) and no snow (NO SNOW). During the winter treatment period and a 1.5-month simulated spring/early summer phase, we monitored the needle, stem and root biomass of the seedlings, and determined their starch and soluble sugar concentrations. In addition, we assessed the stress experienced by the seedlings by measuring chlorophyll fluorescence, electric impedance and photosynthesis of the previous-year needles. Compared with the SNOW treatment, carbohydrate concentrations were lower in the FLOOD and NO SNOW treatments where the seedlings had almost died before the end of the experiment, presumably due to frost desiccation of aboveground parts during the winter treatments. The seedlings of the ICE treatment showed dead needles and stems only above the snow and ice cover. The results emphasize the importance of an insulating and protecting snow cover for small forest tree seedlings, and that future winters with changed snow patterns might affect the survival of tree seedlings and thus forest productivity.
Tree seedling response to LED spectra: Implications for forest restoration
Antonio Montagnoli; R. Kasten Dumroese; Mattia Terzaghi; Jeremiah R. Pinto; Nicoletta Fulgaro; Gabriella Stefania Scippa; Donato Chiatante
2018-01-01
We found that different spectra, provided by light-emitting diodes or a fluorescent lamp, caused different photomorphological responses depending on tree seedling type (coniferous or broad-leaved), species, seedling development stage, and seedling fraction (shoot or root). For two conifers (Picea abies and Pinus sylvestris) soon after germination (â¤40 days), more...
Xia, Keke; Wang, Bo; Zhang, Jiewei; Li, Yuan; Yang, Hailian; Ren, Dongtao
2017-08-01
Previous physiological and pharmacological studies have suggested that the activity of phosphoinositide-specific phospholipase C (PI-PLC) plays an important role in regulating plant salt stress responses by altering the intracellular Ca 2+ concentration. However, the individual members of plant PLCs involved in this process need to be identified. Here, the function of AtPLC4 in the salt stress response of Arabidopsis seedlings was analysed. plc4 mutant seedlings showed hyposensitivity to salt stress compared with Col-0 wild-type seedlings, and the salt hyposensitive phenotype could be complemented by the expression of native promoter-controlled AtPLC4. Transgenic seedlings with AtPLC4 overexpression (AtPLC4 OE) exhibited a salt-hypersensitive phenotype, while transgenic seedlings with its inactive mutant expression (AtPLC4m OE) did not exhibit this phenotype. Using aequorin as a Ca 2+ indicator in plc4 mutant and AtPLC4 OE seedlings, AtPLC4 was shown to positively regulate the salt-induced Ca 2+ increase. The salt-hypersensitive phenotype of AtPLC4 OE seedlings was partially rescued by EGTA. An analysis of salt-responsive genes revealed that the transcription of RD29B, MYB15 and ZAT10 was inversely regulated in plc4 mutant and AtPLC4 OE seedlings. Our findings suggest that AtPLC4 negatively regulates the salt tolerance of Arabidopsis seedlings, and Ca 2+ may be involved in regulating this process. © 2017 John Wiley & Sons Ltd.
Marrão, Ana Rita Galante de Abreu
2016-01-01
The Internet became an inherent part of people’s daily life and the major source of transformation in the relation between consumers and brands. However, in the luxury branding context, the introduction of prestige brands into a mass channel such as the Internet might bring the risk of vulgarization, loss of control over the brand, loss of the high-luxury appeal, jeopardizing brand equity. Hence, the present thesis paper proposes to answer the dilemma between the imperative of going online an...
Differential radiosensitivity of seeds, seedlings and callus cultures of Petunia inflata
International Nuclear Information System (INIS)
Bapat, V.A.; Rao, P.S.
1976-01-01
A comparative study of the effects of γ-irradiation on seeds, seedlings and callus cultures of Petunia inflata showed striking differences in radiosensitivity as reflected in differences in mean fresh and dry weights, seedling height and morphology. Seeds subjected to low doses (4-6 kR) of irradiation showed stimulation of seedling height. Direct exposure of seedlings to high doses (10 kR) of irradiation caused inhibition in their development. Callus cultures, however, were more radioresistant compared to seeds and seedlings. Tissues grown on either an irradiated nutrient medium or on a medium in which sucrose alone had been irradiated, showed a marked inhibition in their growth potential
Machine vision system for measuring conifer seedling morphology
Rigney, Michael P.; Kranzler, Glenn A.
1995-01-01
A PC-based machine vision system providing rapid measurement of bare-root tree seedling morphological features has been designed. The system uses backlighting and a 2048-pixel line- scan camera to acquire images with transverse resolutions as high as 0.05 mm for precise measurement of stem diameter. Individual seedlings are manually loaded on a conveyor belt and inspected by the vision system in less than 0.25 seconds. Designed for quality control and morphological data acquisition by nursery personnel, the system provides a user-friendly, menu-driven graphical interface. The system automatically locates the seedling root collar and measures stem diameter, shoot height, sturdiness ratio, root mass length, projected shoot and root area, shoot-root area ratio, and percent fine roots. Sample statistics are computed for each measured feature. Measurements for each seedling may be stored for later analysis. Feature measurements may be compared with multi-class quality criteria to determine sample quality or to perform multi-class sorting. Statistical summary and classification reports may be printed to facilitate the communication of quality concerns with grading personnel. Tests were conducted at a commercial forest nursery to evaluate measurement precision. Four quality control personnel measured root collar diameter, stem height, and root mass length on each of 200 conifer seedlings. The same seedlings were inspected four times by the machine vision system. Machine stem diameter measurement precision was four times greater than that of manual measurements. Machine and manual measurements had comparable precision for shoot height and root mass length.
Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach
DEFF Research Database (Denmark)
Kichey, Thomas Michel René; Holme, Inger; Møller, Inge Skrumsager
2009-01-01
into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...
Construction of a map-based reference genome sequence for barley, Hordeum vulgare L.
Czech Academy of Sciences Publication Activity Database
Beier, S.; Himmelbach, A.; Colmsee, C.; Zhang, X. Q.; Barrero, R. A.; Hastie, A.; Šimková, Hana; Staňková, Helena; Vrána, Jan; Chan, S.; Zhou, G.; Poland, J.; Bellgard, M. I.; Houben, A.; Doležel, Jaroslav; Ayling, S.; Lonardi, S.; Scholz, U.; Stein, N.; Mascher, M.
2017-01-01
Roč. 4, APR 27 (2017), č. článku 170044. ISSN 2052-4463 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : BACTERIAL ARTIFICIAL CHROMOSOMES * PHYSICAL MAP * LIBRARIES Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Plant sciences, botany Impact factor: 4.836, year: 2016
Directory of Open Access Journals (Sweden)
Я. М. Мукан
2014-04-01
Full Text Available In 2011 to 2013 a study was completed for the impact of varying rates of fertilizing onto the indices of productivity for barley agrophytocenosis of Helios and Commandor, in particular, such its components as a number of productive stems, number of seeds per ear, potential biological activity of ear and photosynthetic apparatus. It is found that the level of spring barley agrophytocenosis productivity is subject both to varietal peculiarities and the rate of mineral fertilizer application. When applying N 60P 60K 60 і N 90P 90K 90 the highest potential and biological productivity of Helios and Commandor was recorder as compared against the control. Impact of varying application rates for fertilizers onto the components of ear biological productivity has been scrutinized. The qualitative composition of ear is a clear expression of variety phenotype and identifies the level of biological yield for spring barley. Application of N 60 P 60 K 60 і N 90 P 90 K 90 mineral fertilizers fairly increased the average leaf surface, photosynthetic lead capacity of varieties in 2 to 2.5 times, as well as FAR efficiency coefficient in 1.5 to 2.0 times as against control that thus contributed to the development of highest biological yield of Helios variety phytomass at the level of 14.9 to 15.0, grain – 7.8 to 8.0 ton per ha and, respectively, 12.7 and 7.5 tons per ha for Comandor variety.
Effect of gamma irradiation (60CO) on quatitative characters of barley (Hordeum vulgare)
International Nuclear Information System (INIS)
Santana, T.C.; Gonzalez, F.C.
1984-01-01
Seeds od f a barley line were irradiated with doses ranging from O to 64 Kr of gamma radiation for three consecutive generations (R1,R2 and R3). From these, several mutant generations were obtained in the field, planting at a commercial density and without selection. (M.A.C.) [pt
AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.
Directory of Open Access Journals (Sweden)
A. Altinkut
2003-01-01
Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.
Development and characterization of polymorphic EST based SSR markers in barley (Hordeum vulgare).
Jo, Won-Sam; Kim, Hye-Yeong; Kim, Kyung-Min
2017-08-01
In barley, breeding using good genetic characteristics can improve the quality or quantity of crop characters from one generation to the next generation. The development of effective molecular markers in barley is crucial for understanding and analyzing the diversity of useful alleles. In this study, we conducted genetic relationship analysis using expressed sequence tag-simple sequence repeat (EST-SSR) markers for barley identification and assessment of barley cultivar similarity. Seeds from 82 cultivars, including 31 each of naked and hulled barley from the Korea Seed and Variety Service and 20 of malting barley from the RDA-Genebank Information Center, were analyzed in this study. A cDNA library of the cultivar Gwanbori was constructed for use in analysis of genetic relationships, and 58 EST-SSR markers were developed and characterized. In total, 47 SSR markers were employed to analyze polymorphisms. A relationship dendrogram based on the polymorphism data was constructed to compare genetic diversity. We found that the polymorphism information content among the examined cultivars was 0.519, which indicates that there is low genetic diversity among Korean barley cultivars. The results obtained in this study may be useful in preventing redundant investment in new cultivars and in resolving disputes over seed patents. Our approach can be used by companies and government groups to develop different cultivars with distinguishable markers. In addition, the developed markers can be used for quantitative trait locus analysis to improve both the quantity and the quality of cultivated barley.
Directory of Open Access Journals (Sweden)
Lilian R Descamps
2011-09-01
Full Text Available The bird cherry-oat aphid Rhopalosiphum padi L. (Homoptera: Aphididae is one of the main pests in a number of crops in the semiarid Pampas of Argentina. In the present study, the effect of different host plants, including Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L., and Secale cereale L. on biological parameters of R. padi L. was studied in the laboratory at 24 ± 1 °C, 65 ± 10% RH and a 14:10 photoperiod. Longevity, intrinsic rate of natural increase (r m, net reproductive rate (R0, mean generation time (T, doubling time (DT, and finite rate of increase (λ of the bird cherry-oat aphid on the different cereal crops were estimated. Differences in fertility life table parameters of R. padi among host plants were analyzed using pseudo-values, which were produced by Jackknife re-sampling. Results indicated that beer barley might be the most suitable food for R. padi due to greater adult longevity (20.88 d, higher fecundity (41 nymphs female-1, higher intrinsic rate of natural increase (0.309 females female-1 d-1, lower doubling time (2.24, and lower nymphal mortality (22.2%. Therefore, it can be concluded from the present study that R. padi prefers beer barley for fast and healthy development over other cereal crops.El áfido Rhopalosiphum padi L. (Homoptera: Aphididae es una de las principales plagas de numerosos cultivos de la región semiárida pampeana de Argentina. En el presente trabajo se estudió el efecto de diferentes cereales incluidos Triticum aestivum L., ×Triticosecale Wittm., Hordeum vulgare L., Hordeum distichum L., Avena sativa L. and Secale cereale L. sobre los parámetros biológicos de R. padi en laboratorio. Se estimaron longevidad, tasa intrínseca de crecimiento natural (r m, tasa neta de reproducción (R0, tiempo generacional medio (T, tiempo de duplicación (TD, y tasa finita de incremento (λ del pulgón de la avena en diferentes cereales. Las diferencias de
[Effects of gap size on seedling natural regeneration in artificial Pinus tabulaeformis plantation].
Han, Wen-Juan; Yuan, Xiao-Qing; Zhang, Wen-Hui
2012-11-01
To clarify the effects of gap size created by thinning on the seedling natural regeneration in artificial Pinus tabulaeformis plantation, a plot investigation was conducted to study the ecological factors and the age structure, height, diameter, length of needles, and dry biomass of roots, stems, and needles of 1-10 year-old seedlings in different habitats, and a path analysis was made on the environmental factors affecting the seedling regeneration. Obvious differences were observed in the ecological factors in different size gaps and slope aspects. There lacked of above 3 year-old seedlings in understory and of above 7 year-old seedlings in small gap, and the seedlings of 5 and 6 year-old were lesser in big gap. The 1-10 year-old seedlings could be divided into 3 development phases, i. e. , 1-3 year-old, 4-7 year-old, and 8-10 year-old seedlings, among which, 1-3 year-old seedlings were critical for the establishment and growth of the population. The growth situation of the seedlings in different habitats was in order of big gap in shady slope > big gap in sunny slope > small gap in sunny slope > small gap in shady slope > understory in sunny slope > understory in shady slope. Path analysis showed light intensity had decisive positive effects on the seedling number of different development phases, shrub coverage had decisive negative effects on the seedling number of 4-7 year-old and 8-10 year-old phases, whereas humus dry mass had negative effects on the seedling number of 4-7 year-old but positive effects on the seedling number of 8-10 year-old. It was suggested that in the management of artificial P. tabulaeformis plantation, relatively high intensity thinning combined with shrub clearing should be adopted to provide favorable conditions for the sustainable development of P. tabulaeformis population.
Responses of endogenous proline in rice seedlings under chromium exposure
Directory of Open Access Journals (Sweden)
X.Z. Yu
2016-12-01
Full Text Available Hydroponic experiments were performed to exam the dynamic change of endogenous proline in rice seedlings exposed to potassium chromate chromium (VI or chromium nitrate chromium (III. Although accumulation of both chromium species in rice seedlings was obvious, more chromium was detected in plant tissues of rice seedlings exposed to chromium (III than those in chromium (VI, majority being in roots rather than shoots. Results also showed that the accumulation capacity of chromium by rice seedlings was positively correlated to chromium concentrations supplied in both chromium variants and the accumulation curve depicted an exponential trend in both chromium treatments over the entire period of exposure. Proline assays showed that both chromium variants induced the change of endogenous proline in shoots and roots of rice seedlings. Chromium (VI of 12.8 mg/L increased proline content significantly (p
Response of Pinus ponderosa Seedlings to Stylet-Bearing Nematodes
Viglierchio, D. R.
1979-01-01
Of 12 stylet-bearing nematodes used for inoculations, Pratylenchus penetrans, P. brachyurus, P. vulnus, Ditylenchus destructor, Meloidogyne incognita, M. javanica, and M. hapla reproduced on Pinus ponderosa, while Xiphinema index, Aphelenchus avenae, Paratylenehus neoamblycephalus, Tylenchulus semipenetrans, and Macroposthonia xenoplax did not. P. vulnus, P. brachyurus, P. penetrans, A. avenae, D. destructor, T. semipenetrans, and P. neoamblycephalus significantly suppressed both the shoot and root wet weights of ponderosa pine seedlings obtained from stands in five different locations. X. index significantly suppressed root wet weights, M. xenoplax siguificantly suppressed shoot wet weight, and M. incognita, M. javanica, and M. hapla suppressed neither at the inoculation levels used. Injurious nematodes tended to suppress root growth more than shoot growth. Seedlings from two locations produced greater shoot growth wet weight than did seedlings from the other three locations. The more injurious nematodes tended to cause an increase in the water content of shoots. Frequency analyses of seedling population shoot-root ratios indicated that ponderosa pine seedlings could be selected for better shoot-root ratios as well as for resistance to several pathogenic nematodes. PMID:19300659
[Effects of different endophytic fungi on seedling growth of Dendrobium devonianum].
Huang, Hui; Shao, Shi-Cheng; Gao, Jiang-Yun
2016-06-01
To obtain seedling growth-promoting fungi is a key step in restoration-friendly cultivation of medicinal Dendrobium species, since there are a large number of functionally-unknown endophytic fungi in the roots of Dendrobium plants.In this study, six functionally-unknown endophytic fungal strains were isolated from roots of D.devonianum using single peleton isolation technology, and used in inoculation experiments to test their effectiveness for seedling growth in D.devonianum.After 90 days of inoculation, comparing with the control treatment, FDdS-1, FDdS-2 and FDdS-4 showed strong pathogenic or fatal effects on seedlings; while, FDdS-12, FDdS-9 and FDdS-5 had different effects on seedling growth.FDdS-5 had significant promoting effects on height, fresh and dry weight, stem diameter and root numbers, while FDdS-9 only had significant promoting effect on seedling height, and FDdS-12 had a negative effect on seedling growth.According to the anatomical features of the inoculated roots, FDdS-5 fungi could infect the velamina of seedlings and the existence of symbiosis pelotons in the cortex cells, suggesting that FDdS-5 is a mycorrhiza fungi of D.devonianum.FDdS-5 and FDdS-9 were identified as Sebacina vermifera and Sebacina sp.by molecular technologies.By using FDdS-5 in the restoration-friendly cultivation of D.devonianum, it could effectively promote seedling growth and shorten the seedling growth periods.The results will aid in reintroduction and cultivation of D.devonianum. Copyright© by the Chinese Pharmaceutical Association.
When GIS zooms in: spatio-genetic maps of multipaternity in Armadillidium vulgare.
Bech, Nicolas; Depeux, Charlotte; Durand, Sylvine; Debenest, Catherine; Lafitte, Alexandra; Beltran-Bech, Sophie
2017-12-01
Geographic information system (GIS) tools are designed to illustrate, analyse and integrate geographic or spatial data, usually on a macroscopic scale. By contrast, genetic tools focus on a microscopic scale. Because in reality, landscapes have no predefined scale, our original study aims to develop a new approach, combining both cartographic and genetic approaches to explore microscopic landscapes. For this, we focused on Armadillidium vulgare, a terrestrial isopod model in which evolutionary pressures imposed by terrestrial life have led to the development of internal fertilisation and, consequently, to associated physiological changes. Among these, the emergence of internal receptacles, found in many taxa ranging from mammals to arthropods, allowed females to store sperm from several partners, enabling multipaternity. Among arthropods, terrestrial isopods like the polygynandrous A. vulgare present a female structure, the marsupium, in which fertilised eggs migrate and develop into mancae (larval stage). To test our innovative combined approach, we proposed different males to four independent females, and at the end of incubation in the marsupium, we mapped (using GIS methods) and genotyped (using 12 microsatellite markers) all the incubated mancae. This methodology permitted to obtain spatio-genetic maps describing heterozygosity and spatial distribution of mancae and of multipaternity within the marsupial landscape. We discussed the interest of this kind of multidisciplinary approach which could improve in this case our understanding of sexual selection mechanisms in this terrestrial crustacean. Beyond the interesting model-focused insights, the main challenge of this study was the transfer of GIS techniques to a microscopic scale and our results appear so as pioneers rendering GIS tools available for studies involving imagery whatever their study scale.
Carlos Jansen and the literary vulgarization for the youth
Directory of Open Access Journals (Sweden)
Lia Araujo Miranda Lima
2015-12-01
Full Text Available In this article we study the translations of Carlos Jansen for the youth, age group corresponding approximately to the contemporary concepts of preadolescence and adolescence, made at the end of the 19th century. Jansen was a pioneer in translating into Brazilian Portuguese works for the youth among which novels by Swift, Defoe, and Cervantes. His widely adapted versions had a pedagogical goal, serving as a reading material for children and adolescents attending schools. For this reason he was called a "vulgarizer" by critics of that period. The research encompassed the analysis of newspapers published between 1880 and 1899, available at the National Library's Hemeroteca Digital Brasileira, which provide data on the advertising and reception of his works. We intend to enrich historical research on children's literature in Brazil and analyse to what degree Jansen's pedagogical project has governed his translation practice.
Use of aquatic macrophytes in substrate composition to produce moringa seedlings
Directory of Open Access Journals (Sweden)
Walda Monteiro Farias
2016-03-01
Full Text Available The use of aquatic macrophytes in substrate composition to produce seedlings of moringa is a sustainable alternative. Therefore, the objective of this research was to evaluate the development of moringa seedlings using substrates composed with aquatic macrophytes, and to determine concentrations of N, P and K in the seedlings. We used different combinations of weeds (M, manure (E and topsoil (TV to compose the substrates. The experiment was conducted in a 3 × 4 factorial in randomized arrangement with four replications. We evaluated plant height, crown diameter and stem, relative growth rate in height, canopy diameter and in stem, dry matter of aerial part and of roots, root length and root/shoot ratio, besides the content of N, P and K in seedlings. Moringa seedlings showed reduced growth when produced in substrates composed only with cattail. Water lettuce and substrates composed of 60% M + 30%E + 10 % TV and 70% M + 30% E, promoted greater nutrition and growth of moringa seedlings. The substrate 60M +30E +10TV composed by water hyacinth and cattail resulted in greater amount of P in moringa seedlings.
Contribution of nitrogen derived from mineral supplementation for soybean seedlings
Directory of Open Access Journals (Sweden)
Gerusa Massuquini Conceição
Full Text Available ABSTRACT Seeds can absorb N from mineral supplementation, thus stimulating seedling development in soybeans (Glycine max (L. Merrill. This study aimed to evaluate the contribution to soybean seedlings of N derived from mineral supplementation in seeds with different nutritional contents. Seeds of the cultivar BMX Potência RR received mineral supplementation enriched with 2.5% excess 15N. The treatments were performed in seeds in two lots, one with high and one with low nutritional content. At 2, 6 and 10 days after sowing on paper towels, the seedlings were collected and separated into cotyledons, roots and shoots. Dry matter production, root length and root volume were assessed. Total N and 15N values were analyzed in the seedling organ tissues. The seeds from the lot with lower nutritional content absorbed more N from the mineral supplement, which was accumulated in the cotyledons and redistributed to the root systems and cotyledons. At 10 days after sowing, most of the N in the organs of soybean seedlings was derived from the seed reserves, regardless of nutritional content. Thus, application of N through mineral supplementation is of low importance for the development and nutrition of seedlings.
Directory of Open Access Journals (Sweden)
Balderas-León Iván
2015-02-01
Full Text Available Waste motor oil (WMO pollutes soil and causing lost soil fertility. An alternative to solve this problem its bioremediation (BR by double and following biostimulation (BS with mineral solution (MS and a legume as green manure (GM then using phytoremediation (PR with growth promoting vegetal bacteria (GPVB like Bacillus cereus and Burkholderia cepacia to minimize remaining WMO. The aims of this research were: a bioremediation of polluted soil by 75000 ppm of WMO by biostimulation and then b Its phytoremediation for remaining WMO by Sorghum vulgare inoculated with B. cereus and B. cepacia. Soil polluted by high concentration WMO was biostimulated with MS, and then Phaseolus vulgaris treated by GPVB was incorporated as GM, finally to apply PR to eliminate WMO with S. vulgare with GPVB. Results indicate that soil bioremediated by biostimulation with MS, WMO decreased at 32500 ppm/30 days, and then with GM, WMO was reduced at 10100 ppm after/90 days. Finally, to apply phytoremediation using S. vulgare and GPVB at flowering, WMO was reduced from 2500 ppm to 800 ppm. For recovering soil impacted by high concentration WMO to apply both techniques double and following BS and PR are the best option than each technique separately.
Response of fenugreek ( Trigonella foenum-graecum L.) seedlings ...
African Journals Online (AJOL)
In the present investigation, the impact of drought and heavy metal in fenugreek was critically monitored. Fenugreek seedlings were exposed to 1- bar polyethylene glycol (PEG) solution (osmotic stress) and 10 ppm solution of HgCl2 (heavy metal). Within 3 days of seedling growth, mercury exposure induced relatively high ...
Efectividad de la crema de Aloe vera en pacientes con psoriasis vulgar de la Parroquia San Fernando
Directory of Open Access Journals (Sweden)
Yoisel Belen Ruiz
2014-10-01
Full Text Available Se realizó un estudio de intervención terapéutica en 20 pacientes con psoriasis vulgar, pertenecientes a la Parroquia San Fernando, en Montes, Estado Sucre (Venezuela, de mayo a diciembre del 2013, quienes fueron seleccionados aleatoriamente y asignados en 2 grupos de idéntica cantidad de integrantes: el de control, que utilizó medicación convencional con triamcinolona, y el de estudio, que recibió tratamiento tópico con crema de Aloe vera (sábila de base inerte; a fin de determinar la efectividad de esta última. Para establecer la comparación entre ambos grupos, se emplearon técnicas no paramétricas debido al número reducido de pacientes, y siempre se consideró un nivel de significación de 0,05. Se obtuvo que la modalidad terapéutica con crema de sábila fuera tan efectiva como la aplicación de la triamcinolona, pero a diferencia de esta última, no presentó reacciones adversas. Así, pudo concluirse que la terapia con Aloe vera es efectiva para tratar pacientes con psoriasis vulgar
Biodegradable bags for the production of plant seedlings
Directory of Open Access Journals (Sweden)
Ana Paula Bilck
2014-10-01
Full Text Available The production of plant seedlings has traditionally used polyethylene bags, which are thrown out in the soil or burned after transplant because the large amount of organic material attached to the bags makes recycling difficult. Additionally, when a seedling is taken from the bag for transplant, there is the risk of root damage, which compromises the plant’s development. In this study, we developed biodegradable bags to be used in seedling production, and we verify their influence on the development of Brazilian ginseng (Pfaffia glomerata (Spreng Pedersen, when the plant is planted without being removed from the bag. Both black and white biodegradable bags remained intact throughout the seedling production period (60 days. After being transplanted into containers (240 days, they were completely biodegraded, and there was no significant difference between the dry mass of these plants and that of plants that were transplanted without the bags. The plants that were cultivated without being removed from the polyethylene bags had root development difficulties, and the wrapping showed no signs of degradation. The use of biodegradable films is an alternative for the production of bags for seedlings, as these can then be transplanted directly into the soil without removing the bag, reducing the risk of damage to the roots during the moment of transplant.
Directory of Open Access Journals (Sweden)
Mohanty, Monalisa
2013-04-01
Full Text Available The effect of Cr+6 with and without chelating agents were assessed in mung bean seedlings grown hydroponically. It was noted that the growth parameters showed a declining trend with increasing Cr+6 concentrations without chelate application. Among the seedlings grown with chelated chromium complexes, Cr+6–DTPA (10µM showed highest growth rate of roots as well as shoots. At higher concentration of Chromium i.e. Cr+6 (100µM, there exhibited high chlorophyll content in mung bean leaves where the seedlings showed stunted growth. The seedlings treated without and with chelated chromium complexes showed increased proline content as compared to control. The enzymatic study showed that, the catalase activity was maximum in shoots as compared to roots and the reverse is true in the case of peroxidase activity i.e. the roots showed higher value than that of the shoots.
Wang, Yi; Ding, Gui-jie
2013-03-01
A greenhouse pot experiment was conducted to study the effects of inoculating Pisolithus tinctorius, Cenococcum geophilum, Cantharellus cibarius, and Suillus luteus on the physiological characteristics of Pinus massoniana seedlings under the conditions of drought stress and re-watering, with the drought resistance of the mycorrhizal seedlings evaluated. Under drought stress, the MDA content and membrane' s relative permeability of P. massoniana seedlings increased, but these two indices in the inoculated (mycorrhizal) seedlings were significantly lower than these in the un-inoculated (control) seedlings. After re-watering, the MDA content and membrane's relative permeability of mycorrhizal seedlings had a rapid decrease, as compared with the control. In the first 21 days of drought stress, the production rate of superoxide radical of the seedlings increased, and the SOD, POD and NR activities of mycorrhizal seedlings increased significantly. With the extending of drought stress, the seedlings after re-watering had different recovery ability. Under the re-watering after 14 days drought stress, the SOD, POD and NR activities recovered. The drought resistance of the mycorrhizal seedlings was in the order of Suillus luteus 1 > Suillus luteus 7 > Cantharellus cibarius > Cenococcum geophilum > Pisolithus tinctorius. The SOD and MDA activities had a greater correlation with the mycorrhizal seedlings drought resistance, being able to be used as the indicators to evaluate the drought resistance of mycorrhizal seedlings.
Seedling characters at different temperatures in pearl millet ...
African Journals Online (AJOL)
The effect of six temperatures ranging from 20 to 45°C on the germination and seedling length of six grain pearl millet genotypes (KS, AM, HG, EC, ZZ and D) was determined. There was significant variation in germination and seedling length across temperatures and among genotypes. As a result, significant temperature ...
Growth and ABA responses of maple seedlings to aluminum
Energy Technology Data Exchange (ETDEWEB)
Bertrand, A.; Robitaille, G.; Boutin, R. [Canadian Forestry Service, Sainte Foy, PQ (Canada); Nadeau, P. [Agriculture and Agri-Food Canada Research Station, Sainte-Foy, PQ (Canada)
1995-12-01
The impacts of low pH and 2.0 mM aluminum (Al) on the growth of sugar maple seedlings was assessed over a 13-week period. The hypothesis was that low pH and high aluminum concentration would lower the vigor of sugar maple seedlings and were contributing factors to sugar maple stand decline. The effects of the stresses were measured in roots and shoots. The concentration of abscisis acid (ABA) in xylem sap in response to Al over time was measured to determine whether it could be used as an indicator of Al stress in sugar maple seedlings. At week 9, total leaf area of Al-treated seedlings was reduced by 27%, but by week 13 leaf area was similar for seedlings in all treatments. None of the other growth parameters examined were negatively affected by the treatments at either week 9 or week 13. ABA concentration in the xylem sap was not affected by any of the treatments. The duration of exposure to Al was found critical when assessing a threshold concentration for Al toxicity because plants can acclimate to an Al concentration previously considered toxic. 36 refs., 1 tab., 6 figs.
Pesavento, Giovanna; Maggini, Valentina; Maida, Isabel; Lo Nostro, Antonella; Calonico, Carmela; Sassoli, Chiara; Perrin, Elena; Fondi, Marco; Mengoni, Alessio; Chiellini, Carolina; Vannacci, Alfredo; Gallo, Eugenia; Gori, Luigi; Bogani, Patrizia; Bilia, Anna Rita; Campana, Silvia; Ravenni, Novella; Dolce, Daniela; Firenzuoli, Fabio; Fani, Renato
2016-06-01
Essential oils (EOs) are known to inhibit the growth of a wide range of microorganisms. Particularly interesting is the possible use of EOs to treat multidrug-resistant cystic fibrosis (CF) pathogens. We tested the essential oil (EO) from Origanum vulgare for in vitro antimicrobial activity, against three of the major human opportunistic pathogens responsible for respiratory infections in CF patients; these are methicillin-resistant Staphylococcus aureus, Stenotrophomonas maltophilia and Achromobacter xylosoxidans. Antibiotic susceptibility of each strain was previously tested by the standard disk diffusion method. Most strains were resistant to multiple antibiotics and could be defined as multi-drug-resistant (MDR). The antibacterial activity of O. vulgare EO (OEO) against a panel of 59 bacterial strains was evaluated, with MIC and MBC determined at 24, 48 and 72 hours by a microdilution method. The OEO was effective against all tested strains, although to a different extent. The MBC and MIC of OEO for S. aureus strains were either lower or equal to 0.50%, v/v, for A. xylosoxidans strains were lower or equal to 1% and 0.50%, v/v, respectively; and for S. maltophilia strains were lower or equal to 0.25%, v/v. The results from this study suggest that OEO might exert a role as an antimicrobial in the treatment of CF infections.
IMPROVED METHODS OF OBTAINING PEPPER SEEDLINGS
Florina Uleanu
2012-01-01
This paper refers to the effect of different types of pots on the level of growth and development of the pepper seedlings in order to clarify the influences caused by use of different recipes transplanters pots. Different biocomposites from renewable resources biodegradable nutritive support were studied. Seedlings were grown in 4 variants of pots M1 (V1), M2 (V2), M3 (V3) and jiffy- pots (V4). The height of the aerial part varied from 14.5 (V1) to 17.4 cm (V4), whereas the root length varied...
Tree fern trunks facilitate seedling regeneration in a productive lowland temperate rain forest.
Gaxiola, Aurora; Burrows, Larry E; Coomes, David A
2008-03-01
Seedling regeneration on forest floors is often impaired by competition with established plants. In some lowland temperate rain forests, tree fern trunks provide safe sites on which tree species establish, and grow large enough to take root in the ground and persist. Here we explore the competitive and facilitative effects of two tree fern species, Cyathea smithii and Dicksonia squarrosa, on the epiphytic regeneration of tree species in nutrient-rich alluvial forests in New Zealand. The difficulties that seedlings have in establishing on vertical tree fern trunks were indicated by the following observations. First, seedling abundance was greatest on the oldest sections of tree fern trunks, near the base, suggesting that trunks gradually recruited more and more seedlings over time, but many sections of trunk were devoid of seedlings, indicating the difficulty of establishment on a vertical surface. Second, most seedlings were from small-seeded species, presumably because smaller seeds can easily lodge on tree fern trunks. Deer browsing damage was observed on 73% of epiphytic seedlings growing within 2 m of the ground, whereas few seedlings above that height were browsed. This suggests that tree ferns provide refugia from introduced deer, and may slow the decline in population size of deer-preferred species. We reasoned that tree ferns would compete with epiphytic seedlings for light, because below the tree fern canopy photosynthetically active radiation (PAR) was about 1% of above-canopy PAR. Frond removal almost tripled %PAR on the forest floor, leading to a significant increase in the height growth rate (HGR) of seedlings planted on the forest floor, but having no effects on the HGRs of epiphytic seedlings. Our study shows evidence of direct facilitative interactions by tree ferns during seedling establishment in plant communities associated with nutrient-rich soils.
Directory of Open Access Journals (Sweden)
Domizia Donnini
2014-08-01
Full Text Available Aim of study: the main aims of this study were to evaluate the quality of truffle-inoculated seedlings produced by commercial nurseries in Italy and to identify their minimum requisites in terms of plant age, health, homogeneity, and cut-off percentage of inoculated Tuber and non-Tuber ectomycorrhizae, based on the analysis of an extensive sample of seedlings subjected to quality control and certification.Area of study: truffle-inoculated seedlings produced by Italian commercial nurseries.Material and Methods: analysis of truffle-inoculated seedlings for health and quality standards; recording of presence of inoculated Tuber spp. and other concurrent fungi according to the official Italian method for certification; selective amplification of ectomycorrhizal DNA by PCR species-specific primers.Main results: We showed that mycorrhization levels in truffle-inoculated seedlings increased with time after truffle-spore inoculation. The highest mean percentage of the inoculated Tuber spp., but also the highest presence of contaminants, were recorded after three years. The mycorrhization level of Tuber melanosporum and T. aestivum was higher in Corylus and Ostrya seedlings than in Q. ilex and Q. pubescens, but the latter two host species showed the lowest presence of other ectomycorrhizal fungi. Mycorrhization level distribution in truffle-inoculated seedlings of suitable batches differed very little from the distribution in only all suitable seedlings. Truffle seedlings with other Tuber spp. were very few and even absent after three years. The general quality of Italian truffle-inoculated seedlings is high but can be improved even further by revising the parameters used for their certification.Research highlights: Mycorrhization assessment in truffle-inoculated seedlings produced by commercial nurseries and a revision of the parameters of quality standards following several years of certification in Italy.Keywords: Truffle cultivation; truffle
Root plasma membrane transporters controlling K+/Na+ homeostasis in salt-stressed bBarley1[C][W
DEFF Research Database (Denmark)
Chen, Zhonghua; Pottosin, Igor I.; Cuin, Tracey A.
2007-01-01
are well combined to withstand saline conditions. These mechanisms include: (1) better control of membrane voltage so retaining a more negative membrane potential; (2) intrinsically higher H1 pump activity; (3) better ability of root cells to pump Na1 from the cytosol to the external medium; and (4) higher......Plant salinity tolerance is a polygenic trait with contributions from genetic, developmental, and physiological interactions, in addition to interactions between the plant and its environment. In this study, we show that in salt-tolerant genotypes of barley (Hordeum vulgare), multiple mechanisms...... of the cytosolic K1-to-Na1 ratio being a key determinant of plant salinity tolerance, and suggest multiple pathways of controlling that important feature in salt-tolerant plants....
A laser ablation ICP-MS based method for multiplexed immunoblot analysis
DEFF Research Database (Denmark)
de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager
2015-01-01
developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...... by more than one technique. The developed method enables a higher number of proteins to be multiplexed in comparison to existing immunoassays. Furthermore, multiplexed protein analysis by LA-ICP-MS provides an analytical platform with high throughput appropriate for screening large collections of plants....
DEFF Research Database (Denmark)
Vigeland, Magnus D; Spannagl, Manuel; Asp, Torben
2013-01-01
Adaptation to temperate environments is common in the grass subfamily Pooideae, suggesting an ancestral origin of cold climate adaptation. Here, we investigated substitution rates of genes involved in low-temperature-induced (LTI) stress responses to test the hypothesis that adaptive molecular...... evolution of LTI pathway genes was important for Pooideae evolution. Substitution rates and signatures of positive selection were analyzed using 4330 gene trees including three warm climate-adapted species (maize (Zea mays), sorghum (Sorghum bicolor), and rice (Oryza sativa)) and five temperate Pooideae...... species (Brachypodium distachyon, wheat (Triticum aestivum), barley (Hordeum vulgare), Lolium perenne and Festuca pratensis). Nonsynonymous substitution rate differences between Pooideae and warm habitat-adapted species were elevated in LTI trees compared with all trees. Furthermore, signatures...
The effects of Vexar® seedling protectors on the growth and development of lodgepole pine roots
Engeman, Richard M.; Anthony, R. Michael; Krupa, Heather W.; Evans, James
1997-01-01
The effects on the growth and development of lodgepole pine roots from the Vexar® tubes used to protect seedlings from pocket gopher damage were studied in the Targhee National Forest, Idaho and the Deschutes National Forest, Oregon. At each site, Vexar-protected and unprotected seedlings, with and without above-ground gopher damage were examined after six growing seasons for root deformities and growth. Undamaged seedlings exhibited greater growth, reflecting the importance of non-lethal gopher damage as a deterrent to tree growth. Protected seedlings with similar damage history as unprotected seedlings had greater root depth than unprotected seedlings, although unprotected seedlings with no above-ground damage generally had the greatest root weight. In general, the percent of seedlings with root deformities was greater for the unprotected seedlings than for the Vexar-protectd seedlings, although this could be largely due to the greater care required to plant protected seedlings. Acute deformities were more common for unprotected seedlings, whereas root deformities with less severe bending were more common for protected seedlings. The incidence of crossed roots was similar for protected and unprotected seedlings on the Deschutes site, where enough occurrences of this deformity permitted analyses. Protected seedlings were similar in root abundance, root distribution, root size and vigor to the unprotected seedlings, with some indication from the Deshutes study site that root distribution was improved with Vexar protection.
Air lateral root pruning affects longleaf pine seedling root system morphology
Shi-Jean Susana Sung; Dave Haywood
2016-01-01
Longleaf pine (Pinus palustris) seedlings were cultured with air lateral root pruning (side-vented containers, VT) or without (solid-walled containers, SW). Seedling root system morphology and growth were assessed before planting and 8 and 14 months after planting. Although VT seedlings had greater root collar diameter than the SW before planting,...
[Effects of sowing depth on seedling traits and root characteristics of summer maize].
Cao, Hui-ying; Wang, Ding-bo; Shi, Jian-guo; Zhu, Kun-lun; Dong, Shu-ting; Liu, Peng; Zhao, Bin; Zhang, Ji-wang
2015-08-01
Two summer maize hybrids, Zhengdan 958 (ZD958) and Xianyu 335 (XY335), were used as experimental materials. 4 sowing depths (3, 5, 7 and 9 cm) and uneven sowing depth (CK) were designed under sand culture and field experiments to investigate the effects of sowing depth on seedling traits and root characteristics of summer maize. The results showed that the seedling emergence rate gradually decreased and seedling emergence time gradually lengthened as the sowing depth increased. Compared with the sowing depth of 3 cm, the seedling emergence rates of ZD958 and XY335 sown at the depth of 9 cm were reduced by 9.4% and 11.8%, respectively, and the seedling emergence duration was prolonged 1.5 d. With the increasing sowing depth, the seedling length and uniformity decreased significantly, the mesocotyl length increased significantly, while the coleoptile length had no significant difference; the primary radicle length gradually decreased, the total length of secondary radicle gradually increased, and the total root length had no significant difference; the total dry mass of seedling and mesocotyl increased significantly, and the total root dry mass had no significant difference. With the increasing sowing depth, the soluble sugar content in each part of seedling increased and the amount of nutritional consumption of germinating seeds increased, the seedling root growth rate increased, but the root activity decreased, and the number of total nodal root and nodal layers increased. With the increasing sowing depth, harvested ears per unit area were reduced by decreased seedling emergence rate and seedling vigor, thus influenced the yield. In addition, uniform sowing depth could improve the canopy uniformity and relative characteristics, then increase the yield.
Rubiales, Diego; Moral, Ana
2011-01-01
Hordeum chilense is wild barley with high potential for cereal breeding purposes given its high crossability with other members of the Triticeae tribe. It is resistant to loose smuts of wheat (Ustilago tritici). The resistance is expressed in xTritordeum amphipoids, offering perspectives for its utilization both in tritordeum breeding and for its transfer to wheat. H. chilense and tritordeums are also resistant to barley loose smut (U. nuda). © 2010 Blackwell Verlag GmbH.
DEFF Research Database (Denmark)
Merrild, Marie Porret; Ambus, Per; Rosendahl, Søren
2013-01-01
) seedlings grew into established networks of Rhizophagus irregularis and cucumber (Cucumis sativus) in two experiments. One experiment studied seedling uptake of 32P in the network in response to cutting of cucumber shoots; the other analysed seedling uptake of P and nitrogen (N) in the presence of intact...... or severed arbuscular mycorrhizal fungus networks and at two soil P concentrations. Pre‐established and intact networks suppressed growth of tomato seedlings. Cutting of cucumber shoots mitigated P deficiency symptoms of seedlings, which obtained access to P in the extraradical mycelium and thereby showed...
Mangrove microclimates alter seedling dynamics at the range edge.
Devaney, John L; Lehmann, Michael; Feller, Ilka C; Parker, John D
2017-10-01
Recent climate warming has led to asynchronous species migrations, with major consequences for ecosystems worldwide. In woody communities, localized microclimates have the potential to create feedback mechanisms that can alter the rate of species range shifts attributed to macroclimate drivers alone. Mangrove encroachment into saltmarsh in many areas is driven by a reduction in freeze events, and this encroachment can further modify local climate, but the subsequent impacts on mangrove seedling dynamics are unknown. We monitored microclimate conditions beneath mangrove canopies and adjacent open saltmarsh at a freeze-sensitive mangrove-saltmarsh ecotone and assessed survival of experimentally transplanted mangrove seedlings. Mangrove canopies buffered night time cooling during the winter, leading to interspecific differences in freeze damage on mangrove seedlings. However, mangrove canopies also altered biotic interactions. Herbivore damage was higher under canopies, leading to greater mangrove seedling mortality beneath canopies relative to saltmarsh. While warming-induced expansion of mangroves can lead to positive microclimate feedbacks, simultaneous fluctuations in biotic drivers can also alter seedling dynamics. Thus, climate change can drive divergent feedback mechanisms through both abiotic and biotic channels, highlighting the importance of vegetation-microclimate interactions as important moderators of climate driven range shifts. © 2017 by the Ecological Society of America.
BIOACTIVE COMPOUNDS AND ANTIOXIDANT CAPACITY FROM FIVE TYPES OF SEEDLINGS
Directory of Open Access Journals (Sweden)
Florina Maria Copaciu
2016-10-01
Full Text Available After germination process, the green seedlings accumulate important quantities of bioactive compounds such as: enzymes, vitamins, minerals, chlorophylls and nutrients. The current study presents a comparison between different bioactive compounds and their antioxidant capacity, after the seedling germination and growth of five seeds (arugula, lentil, wheat, beans and mustard both on soil, in a pot (natural system, and directly on cotton wool soaked, in water (artificial system. In this study the carotenoids content and the antioxidant capacity were analysed. The data of the present study showed that the highest amount of zeaxanthin and β - carotene was found in cultivars of wheat grown in natural system, while the highest antioxidant activity was found in cultivars of wheat, lentils and beans, though in this case with no statistical differences between the systems. The results show statistical differences between the values of bioactive compounds in the five types of seedlings but also in the values obtained for the same seedlings in different systems. The best cultivars for improving the nutritional quality for human consumption are wheat seedlings followed by lentil ones.
Naturally seeded versus planted ponderosa pine seedlings in group-selection openings
Philip M. McDonald; Gary Fiddler; Martin Ritchie; Paula Anderson
2009-01-01
The purpose of this article was to determine whether natural regeneration or planted seedlings should be used in group-selection openings. The answer dependson the survival and growth rate of both types of seedlings, and that could depend on the size of the openings and the effect of trees on their edge. In thisside-by-side study, the natural pine seedlings originated...
Bowers, Janice E.; Pierson, E.A.
2001-01-01
Larger seeds have been shown to convey benefits for seedling survival but the mechanisms of this process are not well understood. In this study, seed size and seedling survival were compared for 2 sympatric cactus species, Carnegiea gigantea (Engelm.) Britt. & Rose and Ferocactus wislizeni (Engelm.) Britt. & Rose, in laboratory and field experiments in the northern Sonoran Desert. Both species have small seeds, but Ferocactus seeds are nearly twice as long and 3 times as heavy as those of Carnegiea. The difference in size is perpetuated after germination: new Ferocactus seedlings have 4 times the estimated volume of new Carnegiea seedlings. In an outdoor experiment, annual survivorship of both species was low but was 6 times higher for Ferocactus (6 seedlings, 8.1%) than Carnegiea (1 seedling, 1.4%). The pattern of seedling mortality in relation to temperature and rain suggests that, after the initial flush of seed and seedling predation, drought and heat took a greater toll on Carnegiea than Ferocactus seedlings, probably because the larger seedling volume of Ferocactus conferred greater drought tolerance. In addition, F. wislizeni could become established without benefit of nurse plants whereas C. gigantea could not; this might reflect differential tolerance to high soil temperatures.
Merrild, Marie P; Ambus, Per; Rosendahl, Søren; Jakobsen, Iver
2013-10-01
Common mycorrhizal networks (CMNs) influence competition between plants, but reports regarding their precise effect are conflicting. We studied CMN effects on phosphorus (P) uptake and growth of seedlings as influenced by various disruptions of network components. Tomato (Solanum lycopersicon) seedlings grew into established networks of Rhizophagus irregularis and cucumber (Cucumis sativus) in two experiments. One experiment studied seedling uptake of (32)P in the network in response to cutting of cucumber shoots; the other analysed seedling uptake of P and nitrogen (N) in the presence of intact or severed arbuscular mycorrhizal fungus networks and at two soil P concentrations. Pre-established and intact networks suppressed growth of tomato seedlings. Cutting of cucumber shoots mitigated P deficiency symptoms of seedlings, which obtained access to P in the extraradical mycelium and thereby showed improved growth. Solitary seedlings growing in a network patch that had been severed from the CMN also grew much better than seedlings of the corresponding CMN. Interspecific and size-asymmetric competition between plants may be amplified rather than relaxed by CMNs that transfer P to large plants providing most carbon and render small plants P deficient. It is likely that grazing or senescence of the large plants will alleviate the network-induced suppression of seedling growth. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.
Effect of organic media on growth of vegetable seedlings
International Nuclear Information System (INIS)
Unal, M.
2013-01-01
Organic media physical and chemical properties are suitable for growing seedling. It is not is low cost for additional chemical substances. In NP/sub 2/O/sub 5/K/sub 2/ O additional media M5 compared to organic media. The purpose of this study was to determine; the use of different growing media for organic production of tomatoes and peppers seedling quality characterictics. The trial was conducted the year 2010 in the greenhouse of Organic Agriculture Program of Arslanbey Vocational School of Kocaeli University. In this research M4 containing peat-stable manure-perlite, M5 containing peat-sand-NPK, M6 containing peat-stable manure and M8 containing peat gave positive results in tomato and pepper seedling cultivation. The quality of tomato and pepper seedling measured values and there were a difference between different growing media statistically at p<0.05 level. However, the width of cotyledons of pepper with different growing medium did not differ statistically. (author)
Shen, Yu; Lansky, Ephraim; Traber, Maret; Nevo, Eviatar
2013-09-01
Biosynthesis of tocols (vitamin E isoforms) is linked to response to temperature in plants. 'Evolution Canyon', an ecogeographical microcosm extending over an average of 200 meters (range 100-400) wide area in the Carmel Mountains of northern Israel, has been suggested as a model for studying global warming. Both domestic (Hordeum vulgare) and wild (Hordeum spontaneum) barley compared with wheat, oat, corn, rice, and rye show high tocotrienol/tocopherol ratios. Therefore, we hypothesized that tocol distribution might change in response to global warming. α-, β-, γ-, and δ-tocopherol, and α-, β-, γ-, and δ-tocotrienol concentrations were measured in wild barley (H. spontaneum) seeds harvested from the xeric (African) and mesic (European) slopes of Evolution Canyon over a six-year period from 2005-2011. Additionally, we examined seeds from areas contiguous to and distant from the part of the Canyon severely burned during the Carmel Fire of December 2010. Increased α-tocotrienol (pslope in contrast to the cooler 'European' slope, and 3) to propinquity to the fire. The study illustrates the role of α-tocotrienol in both chronic and acute temperature adaptation in wild barley and suggests future research into thermoregulatory mechanisms in plants. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.
The influence of seedling density in containers on morphological characteristics of European beech
Directory of Open Access Journals (Sweden)
Wrzesiński Piotr
2015-09-01
Full Text Available This study examines the influence on growth parameters, in particular the morphological features of the root system, of 1-year-old European beech seedlings cultivated in containers with two different densities. The experiment was conducted in the container nursery in Skierdy (Forest District of Jabłonna in spring 2011. After 10 months of cultivation in Hiko polyethylene containers, above- and below-ground parts of the seedlings were measured. The measurements of the root system were conducted with a scanner and the WinRHIZO software. No influence due to the seedling density on either shoot height or thickness was observed, but instead the research showed that different seedling densities affected the development of root systems. The mean root thickness and dry mass of the European beech seedlings were significantly higher at the lower density. The influence of seedling density on the development of root mass deserves special attention as it is the most important factor affecting future growth of the seedlings during cultivation. This tendency also suggests that the amount of nutrients allocated to shoot development may be higher in order to improve the efficiency of photosynthesis. At both densities, differences in biomass accumulation affected the root-toshoot ratio. In seedlings cultivated at the lower density, the increased dry root matter of the seedlings resulted in a significant increase in the root-to-shoot ratio. This may cause a potential growth advantage of these seedlings after they are planted and may thus result in a more productive cultivation.
Bioaccumulation of hexachlorobutadiene in pumpkin seedlings after waterborne exposure.
Hou, Xingwang; Zhang, Haiyan; Li, Yanlin; Yu, Miao; Liu, Jiyan; Jiang, Guibin
2017-10-18
Hexachlorobutadiene (HCBD) has been listed as a persistent organic pollutant (POP) in the Stockholm Convention, and is now drawing more and more research interest. However, the understanding of its bioaccumulation, especially in plants, is still very limited. In this work, the behavior of HCBD in aqueous solution and pumpkin seedlings was studied through in-lab hydroponic exposure experiments. It was found that 69% of HCBD volatilized from water to the atmosphere after one day of exposure, and only 1% remained in the solution after four days. This high volatility might be the main cause of the low HCBD levels in aqueous environments. Although a great amount of HCBD volatilized into the atmosphere, only a small proportion of airborne HCBD was captured by the leaves and stems of the blank pumpkin seedling controls. The translocation of HCBD from the leaves to the bottom roots, as well as its release from the roots into the water, was detected. For the exposure groups, the pumpkin seedlings absorbed HCBD from both the hydroponic solution and the air via the roots and leaves, respectively. The concentration of HCBD in the exposed pumpkin roots linearly increased with the continuous addition of HCBD into the exposure system. Upward translocation from the roots to the leaves and downward translocation from the leaves to the roots existed simultaneously in the exposed pumpkin seedlings. However, the concentrations of HCBD in the leaves, stems and roots in the exposure group were much higher than those of the blank plant controls, suggesting little contribution from the airborne HCBD in the hydroponically exposed pumpkin seedlings. The lipid content did not show obvious effects on the bioaccumulation and biodistribution of HCBD in the pumpkin seedlings, indicating that the translocation of HCBD within the pumpkin seedlings might be an active process. This study provided new findings on the environmental behavior of HCBD, which will be helpful for understanding the exposure
Effects of seed and seedling predation by small mammals on ...
African Journals Online (AJOL)
Seed predation reduced seedling recruitment from seeds planted in March 1986 in mature fynbos, but ... Seed predation did not significantly reduce seedling recruitment from seed planted in July, August and ... AJOL African Journals Online.
Physiological response of wheat, maize and cotton to gamma irradiation
International Nuclear Information System (INIS)
Sharabash, M.T.M.; Gaweesh, S.S.M.; Orabi, I.O.A.; Hammad, A.H.A.
1988-01-01
Grains of wheat triticum aestivum vulgare cv. Giza 155, maize Zea mays cv. double hybrid strain 17 S and cotton seeds Gossypium barbadence cv. Giza 67 were irradiated with successive doses of gamma rays from 0 to 64 Krad. Irradiating wheat grains with 1 Krad, maize grains with 0.5 Krad and cotton seeds with 4 Krad stimulated their germination and enhanced the growth of seedlings and their chlorophyll content. Also, these doses activated Alpha- and Beta-Amylase in the seeds. Higher doses had suppression effects. Peroxidase value in the seedlings of the three species was accelerated progressively in concomitant with the increase in the dosage
Directory of Open Access Journals (Sweden)
Tkaczyk Miłosz
2016-09-01
Full Text Available To investigate susceptibility of young Scots pine seedlings to four Phytophthora species: Phytophthora cactorum, Phytophthora cambivora, Phytophthora plurivora and Phytophthora pini; seven-day-old seedlings of Scots pine (15 seedlings per experiment were infected using agar plugs of the respective species. Control group also consisted of 15 seedlings and was inoculated with sterile agar plugs. Results unambiguously show that after 4.5 days, all seedlings show clear signs of infection and display severe symptoms of tissue damage and necrosis. Moreover, three and two seedlings in the P. cactorum and P. cambivora infected seedlings groups, respectively, collapsed. The length of largest necrosis measured 13.4±3.90 mm and was caused by P. cactorum. To rule out any putative contamination or infection by secondary pathogens, re-isolations of pathogens from infection sites were performed and were positive in 100% of plated pieces of infected seedlings. All re-isolations were, however, negative in the case of the control group. Detailed microscopic analyses of infected tissues of young seedlings confirmed the presence of numerous Phytophthora species inside and on the surface of infected seedlings. Therefore, our results suggest Phytophthora spp. and mainly P. cactorum and P. cambivora as aggressive pathogens of Scots pine seedlings and highlight a putative involvement of these species in the damping off of young Scots pine seedlings frequently observed in forest nurseries.
Survival of planted tupelo seedlings in F- and H-Area tree-kill zones
International Nuclear Information System (INIS)
Nelson, E.A.; Rogers, V.A.
1995-01-01
Swamp tupelo seedlings were planted in four areas which experienced previous tree mortality at the seeplines of the F- and H-Area Seepage Basins. The sites represented a range in severity of impact and stage of recovery. Seedlings were planted in February of 1994 and followed through the first growing season in the field. Survival on all sites through the first growing season was excellent, with greater than 92% of the seedlings still alive. Most seedlings appeared healthy with few external signs of stress. The performance of the seedlings will be followed in subsequent years to determine the physical state of the soil environment on seedling growth. Hopefully, the results will indicate that artificial reforestation can begin on similarly impacted sites prior to the beginning of natural revegetation of the site
DETERMINATION OF THE SEEDLINGS QUALITY CLASSES OF BLACK LOCUST (Robinia pseudoacacia L. ORIGINS
Directory of Open Access Journals (Sweden)
İbrahim Turna
2000-04-01
Full Text Available classification criteria is the assesment of height and root-colar diameter together. newly seedling quality classification (YS have highly first grade seedlings. The most important According to the results of this study, all the origins determined with respect to either TSE or determined by using factor analysis. Furthermore the morphological characteristics that affect the seedling quality classification were diameter. The resulting seedling quality classification were controlled by using discriminant analysis. determined according to height, root-colar diameter and combination of both height and root-colar provenances were soved in KTÜ Nursery. One year later, these seedlings were lifted. Quality norms in KTÜ Nursery were used. Eighteen different origin seeds of Black locust of which eleven are egzotic In this present study, 1+0 Black Locust ( Robinia pseudoacacia L. seedlings grown
Effects of Mulching, Fertilizer, Seeding and Seedling Treatments on ...
African Journals Online (AJOL)
Effects of Mulching, Fertilizer, Seeding and Seedling Treatments on Plant Species Recovery in Kondoa Irangi Hills, Tanzania. ... There were high significant correlations of 0.85 and 0.87 between seedling recruitment and mortality in both sites, indicating that other factors, probably aridity, rather than prevailing site conditions ...
Effect of chromium toxicity on germination and early seedling growth ...
African Journals Online (AJOL)
USER
2010-07-19
Jul 19, 2010 ... germination and early seedling growth of melon (Cucumis melo L.). Chromium ... chromium on seed germination and seedling growth- biomass in early ..... such critical regulatory mechanisms are likely to operate in seeds at ...
Grass defoliation affecting survival and growth of seedlings of ...
African Journals Online (AJOL)
Two experiments were conducted, one in the field and the other in the greenhouse, to investigate the effects of the intensity and frequency of grass defoliation on the survival and growth of Acacia karroo seedlings. In the greenhouse, seedlings growing with heavily clipped grasses had higher biomass production than those ...
The growth of Balanites aegyptiaca (L.) seedlings under varied ...
African Journals Online (AJOL)
Drought and soil fertility are the major factors that influence seedling survival and growth in arid areas, thus it is of paramount importance to establish optimum water requirements for ... Two weeks old seedlings in polythene bag (2kg) containing the standard potting mixture as growing media were used for the experiments.
Melatonin Has the Potential to Alleviate Cinnamic Acid Stress in Cucumber Seedlings
Directory of Open Access Journals (Sweden)
Juanqi Li
2017-07-01
Full Text Available Cinnamic acid (CA, which is a well-known major autotoxin secreted by the roots in cucumber continuous cropping, has been proven to exhibit inhibitory regulation of plant morphogenesis and development. Melatonin (MT has been recently demonstrated to play important roles in alleviating plant abiotic stresses. To investigate whether MT supplementation could improve cucumber seedling growth under CA stress, we treated cucumber seeds and seedlings with/without MT under CA- or non-stress conditions, and then tested their effects on cucumber seedling growth, morphology, nutrient element content, and plant hormone. Overall, 10 μM MT best rescued cucumber seedling growth under 0.4 mM CA stress. MT was found to alleviate CA-stressed seedling growth by increasing the growth rates of cotyledons and leaves and by stimulating lateral root growth. Additionally, MT increased the allocation of newly gained dry weight in roots and improved the tolerance of cucumber seedlings to CA stress by altering the nutrient elements and hormone contents of the whole plant. These results strongly suggest that the application of MT can effectively improve cucumber seedling tolerance to CA stress through the perception and integration of morphology, nutrient element content and plant hormone signaling crosstalk.
METHYL JASMONATE AND STEM BENDING HARDENING AND INITIAL GROWTH OF Cordia trichotoma SEEDLINGS
Directory of Open Access Journals (Sweden)
Danielle Acco Cadorin
2015-12-01
Full Text Available The submission of seedlings to mechanical stimuli and plant growth regulator promote their hardening and can be included in the routine of nurseries, favoring the survival and initial growth in the field. The study aimed to evaluate the effects of applying methyl jasmonate and stem bending in hardening and initial growth of Cordia trichotoma seedlings. Seedlings were subjected to 20 stem bending daily for 4 weeks; 20 stem bending daily for 8 weeks; 50 µmol.L-1 of methyl jasmonate applied weekly for 4 weeks; 50 µmol.L-1 of methyl jasmonate applied weekly for 8 weeks and the control treatment. The design was a completely randomized, with five repetitions of the fourteen seedlings. Seedlings submitted to hardening treatments showed less increment in height, greater increment in stem diameter and less value for strength index. Seedlings of control treatment had greater loss of root tissue electrolytes and less potential for root regeneration. In the field, 180 days after planting, seedlings submitted to eight weeks of stem bending and eight methyl jasmonate applications showed greater increment in height and stem diameter. The results indicate that both stem bending such as methyl jasmonate application for eight weeks are effective in promoting hardening and improve the starting performance in field of Cordia trichotoma seedlings.
Directory of Open Access Journals (Sweden)
Gray John C
2006-11-01
Full Text Available Abstract Background The floral dip method of transformation by immersion of inflorescences in a suspension of Agrobacterium is the method of choice for Arabidopsis transformation. The presence of a marker, usually antibiotic- or herbicide-resistance, allows identification of transformed seedlings from untransformed seedlings. Seedling selection is a lengthy process which does not always lead to easily identifiable transformants. Selection for kanamycin-, phosphinothricin- and hygromycin B-resistance commonly takes 7–10 d and high seedling density and fungal contamination may result in failure to recover transformants. Results A method for identifying transformed seedlings in as little as 3.25 d has been developed. Arabidopsis T1 seeds obtained after floral dip transformation are plated on 1% agar containing MS medium and kanamycin, phosphinothricin or hygromycin B, as appropriate. After a 2-d stratification period, seeds are subjected to a regime of 4–6 h light, 48 h dark and 24 h light (3.25 d. Kanamycin-resistant and phosphinothricin-resistant seedlings are easily distinguished from non-resistant seedlings by green expanded cotyledons whereas non-resistant seedlings have pale unexpanded cotyledons. Seedlings grown on hygromycin B differ from those grown on kanamycin and phosphinothricin as both resistant and non-resistant seedlings are green. However, hygromycin B-resistant seedlings are easily identified as they have long hypocotyls (0.8–1.0 cm whereas non-resistant seedlings have short hypocotyls (0.2–0.4 cm. Conclusion The method presented here is an improvement on current selection methods as it allows quicker identification of transformed seedlings: transformed seedlings are easily discernable from non-transformants in as little as 3.25 d in comparison to the 7–10 d required for selection using current protocols.
Allelopathic Responses of Rice Seedlings under Some Different Stresses
Directory of Open Access Journals (Sweden)
Tran Dang Khanh
2018-05-01
Full Text Available The objective of this study was to evaluate the allelopathic responses of rice seedlings under submergence stress at different temperatures (10, 25, 32, and 37 °C. The results showed that a wide range of allelopathic responses of rice seedlings depended on varieties and stress conditions, with temperature was being a key factor. It showed that the extracts of rice seedlings induced significant suppression on lettuce and radish seedling germination, but had negligible allelopathic effects on growth of barnyardgrass, whilst the emergence and growth of natural weeds was stimulated. In contrast, the root exudates of Koshihikari rice seedlings (K32 at 32 °C reduced the number of total weeds by ≈60.0% and the total dry weight of weeds by 93.0%; i.e., to a greater extent than other root exudates. Among the 13 identified phenolic acids, p-hydroxybenzoic, vanillic, syringic, sinapic and benzoic acids—at concentrations of 0.360, 0.045, 3.052, 1.309 and 5.543 μg/mL might be involved in allelopathic responses of K32, inhibiting the growth of barnyardgrass and natural weeds. Findings of the present study may provide useful information on allelopathic responses of rice under environmental stresses and thus further understand of the competitive relationships between rice and weeds under natural conditions.
Devrnja, Nina; Anđelković, Boban; Aranđelović, Sandra; Radulović, Siniša; Soković, Marina; Krstić Milošević, Dijana; Ristić, Mihailo; Ćalić, Dušica
2017-01-01
Chemical composition of essential oil (EO) and methanol extracts (MEs) from different parts of Tanacetum vulgare L. plant was analyzed and investigated for potential biological activities and correlated with the main constituents detected in EO and MEs. The EO was characterized by a high content of oxygenated monoterpenes with trans-chrysanthenyl acetate as major compound. All MEs were characterized by neochlorogenic, 3,5-O-dicaffeoylquinic and caffeoylquinic acids. High phenolic content in M...
Czech Academy of Sciences Publication Activity Database
Pavela, R.; Žabka, M.; Bednář, Jan; Tříska, Jan; Vrchotová, Naděžda
2016-01-01
Roč. 83, may (2016), s. 275-282 ISSN 0926-6690 R&D Projects: GA MZe(CZ) QJ1510160 Institutional support: RVO:67179843 Keywords : foeniculum vulgare * botanical insecticides * essential oils * medicinal plants * aromatic plants Subject RIV: EH - Ecology, Behaviour Impact factor: 3.181, year: 2016
Acclimatization and growth of ornamental pineapple seedlings under organic substrates
Directory of Open Access Journals (Sweden)
Ronan Carlos Colombo
2017-09-01
Full Text Available The in vitro propagation techniques are commonly used to produce ornamental pineapple seedlings in commercial scale, aiming to attend the growers with genetic and sanitary quality seedlings. However, the choice of the ideal substrate is essential for the acclimatization and growth stage of the seedlings propagated by this technique, since some substrates can increase the seedling mortality and/or limit the seedling growth due to its physical and chemical characteristics. Thus, the aim of this study was to evaluate the acclimatization of ornamental pineapple [Ananas comosus (L. Merr. var. ananassoides (Baker Coppens & Leal] on different substrates. Seedlings with approximately seven centimeters, obtained from in vitro culture, were transplanted into styrofoam trays filled with the following substrates: sphagnum; semi-composed pine bark; carbonized rice husk; sphagnum + semicomposed pine bark; sphagnum + carbonized rice husk; and semi-composed pine bark + carbonized rice husk. Each treatment was replicated five times using 10 plants. At 180 days, there were evaluated the following variables: survival percentage, plant height, number of leaves, leaf area, largest root length, and shoot and root dry matter. The substrate semi-composed pine bark + carbonized rice husk presented the lowest mean (62% for survival percentage. The semi-composed pine bark and semi-composed pine bark + carbonized rice husk treatments presented significant increments in some evaluated biometric characteristics. The semi-composed pine bark is the most favorable substrate for the A. comosus var. ananassoids acclimatization.
Mimica-Dukić, N; Kujundzić, S; Soković, M; Couladis, M
2003-04-01
The influence of different hydrodistillation conditions was evaluated from the standpoint of essential oil yield, chemical composition and antifungal activity from seeds of Foeniculum vulgare Mill. Three hydrodistillation conditions were considered. The main constituents of the oils were: (E)-anethole (72.27%-74.18%), fenchone (11.32%-16.35%) and methyl chavicol (3.78%-5.29%). The method of distillation significantly effected the essential oil yield and quantitative composition, although the antifungal activity of the oils against some fungi was only slightly altered. Copyright 2003 John Wiley & Sons, Ltd.
Béjaoui, Afef; Chaabane, Hédia; Jemli, Maroua; Boulila, Abdennacer; Boussaid, Mohamed
2013-01-01
Variation in the quantity and quality of the essential oil (EO) of wild population of Origanum vulgare at different phenological stages, including vegetative, late vegetative, and flowering set, is reported. The oils of air-dried samples were obtained by hydrodistillation. The yield of oils (w/w%) at different stages were in the order of late vegetative (2.0%), early vegetative (1.7%), and flowering (0.6%) set. The oils were analyzed by gas chromatography (GC) and GC–mass spectrometry (GC-MS)...
Akhbari, Maryam; Kord, Reza; Jafari Nodooshan, Saeedeh; Hamedi, Sepideh
2018-01-07
In this study, biological properties of the essential oil isolated from seeds of Foeniculum vulgare (F. vulgare) were evaluated. GC-MS analysis revealed Trans-Anethole (80.63%), L-Fenchone (11.57%), Estragole (3.67%) and Limonene (2.68%) were the major compounds of the essential oil. Antibacterial activity of the essential oil against nine Gram-positive and Gram-negative strains was studied using disc diffusion and micro-well dilution assays. Essential oil exhibited the antibacterial activity against three Gram-negative strains of Pseudomonas aeruginosa, Escherichia coli, and Shigella dysenteriae. The preliminary study on toxicity of seed oil was performed using Brine Shrimp lethality test (BSLT). Results indicated the high toxicity effect of essential oil (LC50 = 10 μg/mL). In vitro anticancer activity of seed oil was investigated against human breast cancer (MDA-Mb) and cervical epithelioid carcinoma (Hela) cell lines by MTT assay. Results showed the seed oil behave as a very potent anticancer agent with IC50 of lower than 10 μg/mL in both cases.
Production and development of eucalyptus seedlings in function of doses of phosphorus
Directory of Open Access Journals (Sweden)
José Henrique Tertulino Rocha
2013-12-01
Full Text Available This study evaluated the effect of phosphorus (P on the survival in the nursery and early development in the field of clonal Eucalyptus urophylla x Eucalyptus grandis seedlings. The experimental design was completely randomized with four treatments and five replicates of 30 plants per replicate. At the end of the cycle (90 days, 15 seedlings were used for determining the dry matter accumulation and nutrient concentration in the shoot. The rest was planted in the field to determine the percentage of survival and early development. The treatments consisted of four doses of P fertilization (0.0, 1.3, 2.6 and 5.2 mg plant-1. To obtain high quality seedlings in conditions similar to this experiment it is required doses of P in the range from 3.6 to 3.8 mg plant-1. Doses greater than 4 mg plant-1 affect the development and quality of eucalyptus seedlings. An adequate phosphorus fertilization of eucalyptus seedlings increase, by about 30%, the percentage of surviving seedlings in the field.
Planting and care of fine hardwood seedlings: Nursery production of hardwood seedlings
Douglass F. Jacobs
2003-01-01
Access to quality tree seedlings is an essential component of a successful hardwood reforestation project. Hardwood plantations may be established by sowing seed directly to a field site, but the success of direct seeding operations has been inconsistent for many species, which indicates that more research is needed before this practice can be recommended. For...
Directory of Open Access Journals (Sweden)
Kwan-Soo Woo
2011-08-01
Full Text Available Four-year-old seedlings of Pinus thunbergii, Pinus densiflora and Pinus rigida were inoculated with Fusarium circinatum isolate (FT-7, the pitch canker fungus, from P. thunbergii, to evaluate the effects of the pathogen on disease development and gas exchange rate. Needle dehydration was evident on 2 of 10 seedlings of P. thunbergii and P. rigida at 18 and 21 days after inoculation, respectively, while no symptoms were observed in P. densiflora seedlings throughout the experiment. Gas exchange stopped completely in 4 of 5 measured seedlings of P. thunbergii and 2 of 5 measured seedlings of P. rigida at 25 days after inoculation, and in the remaining 3 seedlings of P. rigida at 39 days after inoculation. Disease development in P. thunbergii seedlings was faster than that in P. rigida seedlings. By the time, the experiment was ended at 78 days after inoculation, 9 of 10 seedlings of P. rigida and 8 of 10 seedlings of P. thunbergii seedlings treated with FT-7 was almost dead, but all seedlings of P. densiflora were still healthy. We suggest that P. densiflora is resistant to F. circinatum in the current study, and gas exchange rate of the species after inoculation does not differ significantly compared to that of untreated control.
phenoSeeder - A Robot System for Automated Handling and Phenotyping of Individual Seeds.
Jahnke, Siegfried; Roussel, Johanna; Hombach, Thomas; Kochs, Johannes; Fischbach, Andreas; Huber, Gregor; Scharr, Hanno
2016-11-01
The enormous diversity of seed traits is an intriguing feature and critical for the overwhelming success of higher plants. In particular, seed mass is generally regarded to be key for seedling development but is mostly approximated by using scanning methods delivering only two-dimensional data, often termed seed size. However, three-dimensional traits, such as the volume or mass of single seeds, are very rarely determined in routine measurements. Here, we introduce a device named phenoSeeder, which enables the handling and phenotyping of individual seeds of very different sizes. The system consists of a pick-and-place robot and a modular setup of sensors that can be versatilely extended. Basic biometric traits detected for individual seeds are two-dimensional data from projections, three-dimensional data from volumetric measures, and mass, from which seed density is also calculated. Each seed is tracked by an identifier and, after phenotyping, can be planted, sorted, or individually stored for further evaluation or processing (e.g. in routine seed-to-plant tracking pipelines). By investigating seeds of Arabidopsis (Arabidopsis thaliana), rapeseed (Brassica napus), and barley (Hordeum vulgare), we observed that, even for apparently round-shaped seeds of rapeseed, correlations between the projected area and the mass of seeds were much weaker than between volume and mass. This indicates that simple projections may not deliver good proxies for seed mass. Although throughput is limited, we expect that automated seed phenotyping on a single-seed basis can contribute valuable information for applications in a wide range of wild or crop species, including seed classification, seed sorting, and assessment of seed quality. © 2016 American Society of Plant Biologists. All Rights Reserved.
Szczerba, Mark W; Britto, Dev T; Balkos, Konstantine D; Kronzucker, Herbert J
2008-01-01
Futile plasma membrane cycling of ammonium (NH4+) is characteristic of low-affinity NH4+ transport, and has been proposed to be a critical factor in NH4+ toxicity. Using unidirectional flux analysis with the positron-emitting tracer 13N in intact seedlings of barley (Hordeum vulgare L.), it is shown that rapid, futile NH4+ cycling is alleviated by elevated K+ supply, and that low-affinity NH4+ transport is mediated by a K+-sensitive component, and by a second component that is independent of K+. At low external [K+] (0.1 mM), NH4+ influx (at an external [NH4+] of 10 mM) of 92 micromol g(-1) h(-1) was observed, with an efflux:influx ratio of 0.75, indicative of rapid, futile NH4+ cycling. Elevating K+ supply into the low-affinity K+ transport range (1.5-40 mM) reduced both influx and efflux of NH4+ by as much as 75%, and substantially reduced the efflux:influx ratio. The reduction of NH4+ fluxes was achieved rapidly upon exposure to elevated K+, within 1 min for influx and within 5 min for efflux. The channel inhibitor La3+ decreased high-capacity NH4+ influx only at low K+ concentrations, suggesting that the K+-sensitive component of NH4+ influx may be mediated by non-selective cation channels. Using respiratory measurements and current models of ion flux energetics, the energy cost of concomitant NH4+ and K+ transport at the root plasma membrane, and its consequences for plant growth are discussed. The study presents the first demonstration of the parallel operation of K+-sensitive and -insensitive NH4+ flux mechanisms in plants.
Asymbiotic seed germination and in vitro seedling development of ...
African Journals Online (AJOL)
Within two weeks of culture, spherules emerged out due to cracking of the seed coat. The spherules developed into protocorms with a leaf primordium at apical portion after 3 to 4 weeks and gradually produced complete seedlings. Strong and stout root system was induced in in vitro seedlings on transferring in half strength ...
(GPx) activity in young barley seedlings enriched with selenium
African Journals Online (AJOL)
AJB_YOMI
2011-09-21
Sep 21, 2011 ... E-mail: guzx@njau.edu.cn. Tel/Fax: +86. 25 84396293. have been used for animal feeds and beer malts. Recently, young barley seedlings have been used as food material for people in Asian countries such as China,. Japan, and Korea. Young barley seedlings are rich in dietary fiber, chlorophyll, carotene ...
Linking carbon and water limitations to drought-induced mortality of Pinus flexilis seedlings
Reinhardt, Keith; Germino, Matthew J.; Kueppers, Lara M.; Domec, Jean-Christophe; Mitton, Jeffry
2015-01-01
Survival of tree seedlings at high elevations has been shown to be limited by thermal constraints on carbon balance, but it is unknown if carbon relations also limit seedling survival at lower elevations, where water relations may be more important. We measured and modeled carbon fluxes and water relations in first-year Pinus flexilis seedlings in garden plots just beyond the warm edge of their natural range, and compared these with dry-mass gain and survival across two summers. We hypothesized that mortality in these seedlings would be associated with declines in water relations, more so than with carbon-balance limitations. Rather than gradual declines in survivorship across growing seasons, we observed sharp, large-scale mortality episodes that occurred once volumetric soil-moisture content dropped below 10%. By this point, seedling water potentials had decreased below −5 MPa, seedling hydraulic conductivity had decreased by 90% and seedling hydraulic resistance had increased by >900%. Additionally, non-structural carbohydrates accumulated in aboveground tissues at the end of both summers, suggesting impairments in phloem-transport from needles to roots. This resulted in low carbohydrate concentrations in roots, which likely impaired root growth and water uptake at the time of critically low soil moisture. While photosynthesis and respiration on a leaf area basis remained high until critical hydraulic thresholds were exceeded, modeled seedling gross primary productivity declined steadily throughout the summers. At the time of mortality, modeled productivity was insufficient to support seedling biomass-gain rates, metabolism and secondary costs. Thus the large-scale mortality events that we observed near the end of each summer were most directly linked with acute, episodic declines in plant hydraulic function that were linked with important changes in whole-seedling carbon relations.
Linking carbon and water relations to drought-induced mortality in Pinus flexilis seedlings.
Reinhardt, Keith; Germino, Matthew J; Kueppers, Lara M; Domec, Jean-Christophe; Mitton, Jeffry
2015-07-01
Survival of tree seedlings at high elevations has been shown to be limited by thermal constraints on carbon balance, but it is unknown if carbon relations also limit seedling survival at lower elevations, where water relations may be more important. We measured and modeled carbon fluxes and water relations in first-year Pinus flexilis seedlings in garden plots just beyond the warm edge of their natural range, and compared these with dry-mass gain and survival across two summers. We hypothesized that mortality in these seedlings would be associated with declines in water relations, more so than with carbon-balance limitations. Rather than gradual declines in survivorship across growing seasons, we observed sharp, large-scale mortality episodes that occurred once volumetric soil-moisture content dropped below 10%. By this point, seedling water potentials had decreased below -5 MPa, seedling hydraulic conductivity had decreased by 90% and seedling hydraulic resistance had increased by >900%. Additionally, non-structural carbohydrates accumulated in aboveground tissues at the end of both summers, suggesting impairments in phloem-transport from needles to roots. This resulted in low carbohydrate concentrations in roots, which likely impaired root growth and water uptake at the time of critically low soil moisture. While photosynthesis and respiration on a leaf area basis remained high until critical hydraulic thresholds were exceeded, modeled seedling gross primary productivity declined steadily throughout the summers. At the time of mortality, modeled productivity was insufficient to support seedling biomass-gain rates, metabolism and secondary costs. Thus the large-scale mortality events that we observed near the end of each summer were most directly linked with acute, episodic declines in plant hydraulic function that were linked with important changes in whole-seedling carbon relations. © The Author 2015. Published by Oxford University Press. All rights reserved
Caglar, S; Akgun, A
2006-07-01
The experiment was undertaken to test the efficiency of inoculation of vesicular-arbuscular mycorrhizal (VAM) fungi on the seedling growth of three Pistacia species used as rootstocks. The stratified Pistacia seeds were inoculated with VAM fungi. The highest rate of inoculated roots was 96.7% in P. khinjuck seedlings with G. clarum and G. etunicatum, 83.3% in P. vera seedlings with G. caledonium and 73.3% in P. terebinthus seedlings with G. caledonium. Mycorrhizal inoculations improved seedling height only in P. terebinthus. Certain mycorrhizal inoculations increased the leaf N, but not P and K contents. Seedlings inoculated with G. caledonium had higher reducing sugar contents. It was concluded that pre-inoculated Pistacia seedlings could have a better growth in the harsh field conditions.
[Comparison of development condition of different Liriope spicata seedlings].
Wang, Yue; Su, He; Zhan, Yan-Ting; Yang, Yang; Dong, Xue-Hui
2017-04-01
The study identified the main morphological index of the seedlings classification including seedling age,the root width and number of newborn buds and coarse roots, according to the local agricultural production techniques and assessment of Liriope spicata's growth and development condition. After carrying on K cluster analysis of the morphological, we separated the seedlings into two levels. The first level (Ⅰ): the new talent with the root width exceeding two point five millimeters, the new born buds exceeding three, and with the coarse root exceeding one. The second level (Ⅱ): the old talent with the root width below one millimeters, the newborn buds below two and without coarse root. The study surveyed the plants' growth index dynamics, as well as the yield and quality of the tuberous root. The experimental results suggested that the growth condition of seedling Ⅰwas better, the yield of earthnut higher, the quality of earthnut more excellent. The study lied the foundation of L. spicata's grading standards and standardized production. Copyright© by the Chinese Pharmaceutical Association.
Identification of 'Ubá' mango tree zygotic and nucellar seedlings using ISSR markers
Directory of Open Access Journals (Sweden)
Aline Rocha
2014-10-01
Full Text Available Polyembryonic seeds are characterized by the development of over one embryo in the same seed, which can be zygotic and nucellar. The objective of this work was to identify the genetic origin, whether zygotic or nucellar, of seedlings of polyembryonic seeds of 'Ubá' mango tree using ISSR markers, and relating them with the vigor of the seedlings. Thus, mangos were harvested in Visconde do Rio Branco (accession 102 and Ubá (accessions 112, 138, 152 and 159, whose seeds were germinated in plastic trays filled with washed sand. Fifty days after sowing, seedlings from five seeds of each one of the accessions 102, 112, 138, 159 and from 10 seeds of the accession 152, were analyzed. These sseedlings were characterized and evaluated for plant height, stem circumference and mass of fresh aerial part and the most vigorous seedling was the one displaying at least two of these traits higher than the other seedlings from seed. Leaves were collected for genomic DNA extraction, which was amplified using seven ISSR primers previously selected based on the amplification profile and considering the number and resolution of fragments. Zygotic seedlings were found in 18 seeds, which were the most vigorous in six seeds. The results evidenced the existence of genetic variability in orchards using seedlings grown from seeds, because the farmer usually uses the most vigorous ones, assuming that this is of nucellar origin. These results also indicate that the most vigorous seedling are not always nucellar, inasmuch as of 20% of the total seeds evaluated, the zygotic seedling was the most vigorous.
DEFF Research Database (Denmark)
Dupont, Yoko Luise; Strandberg, Beate; Damgaard, Christian Frølund
2018-01-01
and nitrogen fertilizer on reproductive features of Tanacetum vulgare (Asteraceae). The study was carried out in an experimental set-up, in which plots of 7x7 m were treated with one of six treatments: four levels of the herbicide glyphosate (0%, 1%, 5%, and 25% of label rate of 1440 g a.i. ha-1) without...
Saghi; Bahador; Khaledi; Ataee Kachoei; Amiri Dastjerdi; Esmaeili
2015-01-01
Background Infection due to Acinetobacter baumannii has become a significant challenge to modern healthcare systems. The rapid emergence and global dissemination of A. baumannii as a major nosocomial pathogen is remarkable and it demonstrates its successful adaptation to the 21st century hospital environment. Recent studies have discussed about essential oil of Origanum vulgare against a range of bacteria, including various species of Staphylococcus, Pseudomonas, Bacillus and Esc...