WorldWideScience

Sample records for sechium edule swartz

  1. [The chayote, Sechium edule Swartz (Cucurbitaceae)].

    Science.gov (United States)

    Flores, E M

    1989-06-01

    Sechium edule (chayote) is a cucurbitaceus species. A fast transition from domestic crop to exportation product, made evident the lack of adequate information about the plant and the cultivation techniques. This work summarizes, reinterprets or describes comprehensively several aspects related to the taxonomy, origin, morphology, physiology, ecology and culture of the species.

  2. Study of flavonoids of Sechium edule (Jacq) Swartz (Cucurbitaceae) different edible organs by liquid chromatography photodiode array mass spectrometry.

    Science.gov (United States)

    Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra

    2004-10-20

    A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society

  3. Sechium edule (Jacq. Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line

    Directory of Open Access Journals (Sweden)

    Sandra Salazar-Aguilar

    2017-07-01

    Full Text Available The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC and column chromatography (CC, identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions. Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC50 1.85 µg·mL−1, but the lymphocytes were affected by the extract (IC50 30.04 µg·mL−1. Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL−1. Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

  4. Sechium edule (Jacq.) Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line.

    Science.gov (United States)

    Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero Del Mar; Cadena-Iñiguez, Jorge; Soto-Hernández, Marcos; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco

    2017-07-25

    The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC 50 1.85 µg·mL -1 ), but the lymphocytes were affected by the extract (IC 50 30.04 µg·mL -1 ). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL -1 . Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

  5. Conservación in vitro de chayote (Sechium edule)

    OpenAIRE

    Alvarenga-Venutolo, Silvana; Abdelnour-Esquivel, Ana; Villalobos-Aránbula, Víctor

    2007-01-01

    Conservación in vitro de chayote (Sechium edule). La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l) y ácido acetil salicílico (10-9, 10-6 y 10-3 M) al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC) y combinaciones de estos factores, en Costa Rica, en 1997. Se e...

  6. Nutraceutic Characteristics of the Extracts and Juice of Chayote (Sechium edule (Jacq. Sw. Fruits

    Directory of Open Access Journals (Sweden)

    María de la Luz Riviello-Flores

    2018-05-01

    Full Text Available Fruits of chayote [Sechium edule (Jacq. Swartz] are a non-traditional vegetable widely consumed in Latin America, with the state of Veracruz, México being the world’s main producer, but little is known about the nutraceutical potential. This study aimed to determine the chemical compositions and antioxidant activities from the juice fruits from two commercial varieties of chayote cultivated in Mexico, as well as a proposal for the elaboration of chayote juices with stevia leaves and pineapple juice. The physicochemical properties of juice from virens levis (VL and nigrum spinosum (NS varieties were determined using standard methods. The juice of the two varieties differ significantly regarding the concentrations of total soluble solids and total sugars, but not vitamin C. The total concentration of phenolics in NS extracts was slightly higher than in VL (1005 and 856 mg 100 g−1 dry-weight, respectively, but the total flavonoid contents were similar (27 and 26 mg 100 g−1 dry-weight, respectively. Cucurbitacin D was predominant in both varieties. The radical scavenging capacities of VL and NS extracts varied slightly (IC50 = 0.45 to 0.65 mg mL−1, while the antioxidant activities were similar (~80%. The NS variety is particularly promising regarding nutraceutical application. The chayote juice combined with stevia and pineapple maintained the original nutraceutical characteristics of the fruit, but enhanced the organoleptic characteristics like density and sugar/acidity balance.

  7. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    Science.gov (United States)

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

  8. Conservación in vitro de chayote (Sechium edule

    Directory of Open Access Journals (Sweden)

    Silvana Alvarenga-Venutolo

    2007-01-01

    Full Text Available Conservación in vitro de chayote (Sechium edule. La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l y ácido acetil salicílico (10-9, 10-6 y 10-3 M al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC y combinaciones de estos factores, en Costa Rica, en 1997. Se encontró que los brotes mantuvieron altos porcentajes de viabilidad después de ser conservados durante seis meses en los tratamientos evaluados. Debido a la apariencia más vigorosa y a la coloración más verde que presentaron las plántulas, se consideró que el mejor tratamiento fue la adición de 60 g/l de sacarosa al medio de cultivo combinado con la incubación a 16ºC.

  9. Properties of cast films made of chayote (Sechium edule Sw.) tuber starch reinforced with cellulose nanocrystals

    Science.gov (United States)

    In this study, cellulose (C) and cellulose nanocrystals (CN) were blended with chayote tuber (Sechium edule Sw.) starch (CS) in formulations cast into films. The films were conditioned at different storage temperatures and relative humidity (RH), and analyzed by mechanical tests, X-ray diffraction, ...

  10. Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram

    OpenAIRE

    Lalthansanga, James; Samanta, A. K.

    2015-01-01

    Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves...

  11. Cryopreservation of chayote (Sechium edule JACQ.SW.) zygotic embryos and shoot-tips from in vitroplantlets

    OpenAIRE

    Abdelnour-Esquivel, Ana; Engelmann, Florent

    2002-01-01

    This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM we...

  12. Micropropagación de chayote (sechium edule jacq. Sw. a partir de brotes vegetativos

    Directory of Open Access Journals (Sweden)

    Ana Abdelnour

    2002-01-01

    Full Text Available El chayote (Sechium edule es una importante fuente de divisas para los países exportadores, entre los que Costa Rica mantiene el liderazgo mundial. Entre los factores más limitantes para su producci ón se encuentra el material de siembra, tradicionalmente la semilla, que por su naturaleza no permite la obtención de una producción morfológicamente homogénea de frutos (color, forma y textura de la epidermis motivo de los altos porcentajes de rechazo en las plantas empacadoras. El establecimiento de una metodología de propagación vegetativa de la especie ayudaría a resolver los problemas de heterogeneidad. Por lo anterior, la presente investigación se dirigió a desarrollar un método de micropropagación a partir de brotes vegetativos. Se evaluó el efecto de varios desinfectantes y concentraciones de reguladores de crecimiento en las etapas de establecimiento, multiplicación y enraizamiento de dos cultivares comerciales. Se observó que una desinfección con hipoclorito de calcio al 4% permitió el mayor porcentaje de explantes establecidos asépticamente bajo condiciones in vitro (49%. También se observó que durante las etapas posteriores de la micropropagación, los requerimientos de reguladores de crecimiento fueron muy bajos (0,1 mgL-1 de BA en la etapa de brotación de yemas y de 0,1 a 0,2 mgL-1 de AIB durante el enraizamiento o no se requirieron (etapa de multiplicaci ón de microestacas.

  13. Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule

    Directory of Open Access Journals (Sweden)

    Sergio Espíndola Mateos

    2015-10-01

    Full Text Available β-Glucosidase (EC 3.2.1.21 is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1, in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results. One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min−1. The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

  14. Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).

    Science.gov (United States)

    Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria Del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito

    2015-10-23

    β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

  15. Chemical analyses and in vitro and in vivo toxicity of fruit methanol extract of Sechium edule var. nigrum spinosum.

    Science.gov (United States)

    Aguiñiga-Sánchez, Itzen; Cadena-Íñiguez, Jorge; Santiago-Osorio, Edelmiro; Gómez-García, Guadalupe; Mendoza-Núñez, Víctor Manuel; Rosado-Pérez, Juana; Ruíz-Ramos, Mirna; Cisneros-Solano, Víctor Manuel; Ledesma-Martínez, Edgar; Delgado-Bordonave, Angel de Jesus; Soto-Hernández, Ramón Marcos

    2017-12-01

    Sechium edule (Jacq.) Sw. (Cucurbitaceae) is used in ethnomedicine, but the diversity of the varietal groups of this species has not often been considered. This is important because we previously reported that different variety of species exhibit different activities across different tumor cell lines. This study investigates the chemical composition and biological activities of extracts obtained from S. edule var. nigrum spinosum. The leukemia P388 cell line and mononuclear bone marrow cells (MNCBMs) were treated with the extract at a concentration ranging from 40 to 2370 μg/mL for cytotoxicity and viability assays. CD-1 mice were treated with 8-5000 mg/kg extract and monitored every hour for the first 24 h and subsequently for seven days for signs of toxicity (LD 50 ). In addition, the chromatographic profile of the extract was determined by HPLC. The extract inhibits the proliferation of both P388 cells and MNCBMs, with IC 50 values of 927 and 1911 μg/mL, respectively, but reduced the viability and induced the apoptosis of only leukemia cells. The LD 50 was higher than 5000 mg/kg, and this concentration did not alter the blood chemistry or cell count but doubled the mitotic index in the bone marrow. The HPLC showed the presence of cucurbitacins, phloridzin, naringenin, phloretin, apigenin, and gallic, chlorogenic, vanillic, p-hydroxybenzoic, caffeic, and p-coumaric acids. Sechium edule var. nigrum spinosum contains bioactive compounds that explain the antiproliferative and nutraceutical activities, and its lack of physiological side effects constitutes an added value to a widely consumed vegetable.

  16. HONGOS CAUSANTES DE ENFERMEDADES POSTCOSECHA EN CHAYOTE (Sechium edule (Jacq. SW. Y SU CONTROL IN VITRO

    Directory of Open Access Journals (Sweden)

    Siul D. Romero-Velazquez

    2015-01-01

    Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusarium sp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

  17. Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram.

    Science.gov (United States)

    Lalthansanga, James; Samanta, A K

    2015-07-01

    This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (pChayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

  18. Effect of feeding chayote (Sechium edule meal on growth performance and nutrient utilization in indigenous pig (Zovawk of Mizoram

    Directory of Open Access Journals (Sweden)

    James Lalthansanga

    2015-07-01

    Full Text Available Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule meal by replacing standard concentrate mixture (CM on the growth parameters such as feed intake, body weight gain, average daily gain (ADG and feed conversion ratio (FCR, and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk were used to study the effect of feeding chayote (Sechium edule meal (fruits and leaves at the ratio 4:1 on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4. Chayote meal was used to replace standard CM (pig grower ration at 0% (G1, 20% (G2, 30% (G3, and 40% (G4. Results: During the feeding trial of 90 days, it was found that the dry matter (DM intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05 among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05, although the ether extract digestibility in G1 was significantly low (p<0.01 as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

  19. Cryopreservation of chayote (Sechium edule JACQ. SW.) zygotic embryos and shoot-tips from in vitro plantlets.

    Science.gov (United States)

    Abdelnour-Esquivel, Ana; Engelmann, Florent

    2002-01-01

    This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.

  20. Hongos causantes de enfermedades postcosecha en chayote (Sechium edule(Jacq. SW. y su control in vitro

    Directory of Open Access Journals (Sweden)

    Siul D. Romero Velazquez

    2015-11-01

    Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusariumsp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

  1. Genetic characterization of chayote [Sechium edule (Jacq.) Swartz.] landraces of North Eastern Hills of India and conservation measure.

    Science.gov (United States)

    Verma, Veerendra Kumar; Pandey, Avinash; Jha, Anjani Kumar; Ngachan, S V

    2017-10-01

    Chayote or chow-chow is an underutilized cucurbit vegetable crop, widely cultivated by farmers in the backyards and Jhum lands for its tender leaves, fruits and tuberous root. In order to initiate crop improvement program in this crop, the present study was undertaken to assess the genetic variations in the 74 chow-chow landraces collected from the North Eastern Hill region of India. Wide variations for fruit colors, fruit length (6.5-21.5 cm), fruit width (4.2-10.7 cm), fruit weight (60-560 g), vitamin-C (2.6-13.8 mg/100 g), reducing sugar (0.18-2.77%), total sugar (1.09-2.94%) and phenol content (0.17-3.85 mg/100 g FW) were recorded among the landraces. All the landraces were also characterized using random amplified polymorphic DNA (RAPD) and inter simple sequence repeat (ISSR) markers. In RAPD analyses, out of 28 primers a total of 198 reproducible amplicons were formed at an average of 7.01 per primer and an overall polymorphism of 88.38%. Eight fragments were specific to landraces with light green fruits. Four fragments were observed to be specific to RCSC-22 (dark green fruits) and another four specific to a RCSC-30 (pale yellow fruits). Out of 30 ISSR, only 5 primers generated a total of 32 reproducible amplicons with an average of 6.4 per primer and overall polymorphism of 62.5%. The pair wise similarity coefficient values ranged from 0.55 to 0.96. The grouping of landraces in cluster analysis was found to be independent of their respective geographic locations. The cuttings of suckers and shoot top (2 months old) treated with indole-3-butyric acid (200 mg l -1 ) provide an alternative for the conservation of the diverse genetic materials to the researchers.

  2. Criterios locales para selección de semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de Chiapas, México

    Directory of Open Access Journals (Sweden)

    Francisco Guevara Hernández

    2015-04-01

    Full Text Available En el estudio se identificaron y analizaron los criterios socio-antropológicos fundamentados en etnoagronomía y etnobotánica de los productores para seleccionar semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de los municipios Villa Corzo y Villaflores (Chiapas, México. En entrevistas semi-estructuradas realizadas a 60 productores se describieron los criterios locales para seleccionar las semillas de esta hortaliza, considerando características de color, tamaño y presencia de espinas en los frutos, así como la obtención de variedades y recomendaciones para la siembra. Sin considerar la procedencia de los productores, el cultivo del chayote se realiza independientemente del tamaño, el color o la presencia de espinas en los frutos. Más de 60% de los productores entrevistados compra las semillas y prefieren aquellas variedades que posean frutos con espinas debido a su sabor agradable. Se confirmó la validez de los estudios socio-antropológicos en sistemas agrícolas tradicionales en la zona, particularmente en etnobotánica, para entender las relaciones sociales y productivas a nivel local, y para definir sistemas productivos sostenibles a partir de los criterios propios de las familias campesinas, lo que permite documentar, analizar, validar y entender multi-criterios relacionados con la producción familiar de chayote y su posible mejoramiento.

  3. VALORACIÓN DE LA CIDRA PAPA (Sechium edule COMO ALTERNATIVA DE ALIMENTACIÓN Y RECUPERACIÓN DE VÍNCULOS CON EL CAMPO VALORAÇÃO DA Sechium edule COMO ALTERNATIVA DE ALIMENTAÇÃO E RECUPERAÇÃO DOS VINCULOS COM O CAMPO VALUATION OF Sechium edule AS AN ALIMENTARY ALTERNATIVE AND RECUPERATION OF BONDS TO THE COUNTRY

    Directory of Open Access Journals (Sweden)

    CONSUELO MONTES R

    2011-12-01

    Full Text Available El objetivo de la investigación, fue valorar la cidra papa (Sechium edule como alternativa de alimentación para familias en desplazamiento que viven en asentamientos urbano marginales de Popayán, con el fin de contribuir a la recuperación del conocimiento tradicional asociado al uso y manejo, identificar ecotipos, identificar el significado sociocultural como alternativa para mantener los vínculos con el campo, evaluar productividad y posibilidades de manejo en espacios urbano marginales. El proceso se desarrolló mediante 'investigación participativa', donde los actores participaron en dinámicas recreativas, talleres de sensibilización y socialización, giras de intercambio de saberes, de semillas y generación de conocimientos, lo que permitió obtener información, y la apropiación del proceso. Se definieron como áreas de estudio 3 comunas de Popayán, se seleccionaron 4 asentamientos, se aplicaron 116 encuestas, se realizaron visitas mensuales por asentamiento, entablando diálogos informales con las familias participantes. Se conocieron las posibilidades de manejo de la planta, se incentivó la siembra de la misma aplicando el concepto de agricultura urbana donde se asoció la planta con otras hortalizas. Se pudo constatar que plantas como la cidra se adaptan a las condiciones que ofrecen los asentamientos y que son fuente alternativa para la alimentación de estas poblaciones, se fomentó el consumo de especies sub utilizadas, se hizo intercambio de saberes y se generaron espacios para motivar la conservación de ecotipos y especies de plantas como la cidra, que pueden resistir a las condiciones de marginalidad.0 objetivo da pesquisa, foi avaliar a cidra papa (Sechium edule como alternativa de alimentação para familias deslocadas que moram nos perímetros da cidade de Popayán, com o proposito de contribuir na recuperação do conhecimento tradicional relacionado com a utilização e manejo, identificação de ecotipos e o

  4. Effects of IAA and IBA on the in vitro rooting of stem cuttings of Sechium edule (Jacq. Sw

    Directory of Open Access Journals (Sweden)

    José García García

    2015-01-01

    Full Text Available This investigation was carried out with the objective of evaluating the response of shoots of chayote [S. edule (Jacq. Sw.] to the application of indole-3-butyric acid (IBA and indole-3-acetic acid (IAA on the in vitro rooting phase. The effect of three culture media, modified from the proposed of Murashige and Skoog (MS was studied: 1- 65% MS salt base, 2- 65% MS salt base + 0.05 mg l-1 of indolebutyric acid (AIB and 3- 65% MS salt base + 3.0 mg l-1-3-indole acetic acid (IAA. The variables evaluated were: number of roots, length and number of shoots per in vitro seedling. The best result were obtained when using 65% MS salt base with 3.0 mg l-1 of IAA. Significant differences (P<0.05 among treatments containing growth regulators was obtained for the variables number of roots and length of in vitro plantlets. In the UNA-730 accession root induction was obtained in a 65% MS salt base culture medium without growth regulators; however, when IAA and IBA was added the induction was 100%. The differences identified in this work with regards to the root induction were probably the combined result of genotype and specific culture conditions. Key words: auxins, chayote, growth regulators, in vitro culture

  5. Chayote (Sechium edule) causing hypokalemia in pregnancy.

    Science.gov (United States)

    Jensen, L P; Lai, A R

    1986-11-01

    A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.

  6. EFEKTIFITAS PEMBERIAN JUS LABU SIAM (Sechium edule TERHADAP PROFIL LIPID TIKUS (Rattus novergicus MODEL HIPERLIPIDEMIA

    Directory of Open Access Journals (Sweden)

    Yanita Listianasari

    2017-10-01

    Full Text Available Hyperlipidemia is a lipid profile (TC, TG, HDL, LDL metabolism disorder becoming the leading cause of cardiovascular disease. Flavonoid, phenol, vitamin C contained in squash have strong cardioprotective effect but its optimal dose has not been known yet. The objective of this research was to analyze the effectiveness of squash juice administration with varying doses on the lipid profile of hyperlipidemia model-rat with High Fat Diet induced. This research was done in laboratory experimental research with pre and posttest control group design.The experimental animals were consisted of 36 rats and divided into negative control, positive control, treatment I (drug, treatment II, III, IV (squash juice dose 1 ml, 2 ml, 4 ml/ 100 g BW rat/day with treatment for 38 days. The rat’s blood was taken before and after treatment for lipid profile. TC, HDL, LDL levels were measured using spectrophotometer Microlab 300 with CHOD-PAP. TG level was measured using Microlab 300 with GPO-PAP. Considering the statistic analysis, squash juice at doses 1 ml, 2 ml and 4 ml / 100 g BW rat/day, could reduce significantly (p < 0.05 TC, TG, LDL levels of rats. HDL level of rat could increase significantly (p < 0.05 with squash juice at dose 1 ml/100 g BW rat/day. There was no significant difference between the three doses of squash juice, so that squash juice at dose 1 ml/100 g BW rat/day is the best dose to reduce the lipid profile of hyperlipidemia model-rat. Hiperlipidemia merupakan gangguan metabolisme profil lipid (kolesterol total, trigliserida, HDL, LDL yang menjadi penyebab utama timbulnya penyakit kardiovaskular. Flavonoid, fenol, vitamin C yang terkandung dalam buah labu siam mempunyai efek kardioprotektif yang kuat akan tetapi belum diketahui dosis optimal. Tujuan penelitian ini adalah untuk menganalisis efektifitas pemberian jus labu siam dengan variasi dosis terhadap profil lipid tikus model hiperlipidemia. Metode yang digunakan adalah eksperimental laboratorik dengan rancangan pre and posttest control group design. Sebanyak 36 tikus putih Strain Wistar jantan dibagi menjadi 6 kelompok dengan 6 ekor tiap kelompok, yaitu kontrol negatif, kontrol positif (diinduksi High Fat Diet, perlakuan 1 (diinduksi High Fat Diet dan obat, perlakuan 2, 3, 4 (diinduksi High Fat Diet dan jus labu siam dosis 1 ml, 2 ml, 4 ml/100 g BB tikus/hari dengan perlakuan selama 38 hari. Pengambilan darah tikus dilakukan sebelum dan sesudah perlakuan untuk analisis profil lipid. Kadar kolesterol total, HDL, LDL diukur menggunakan spektrofotometer Microlab 300 dengan metode CHOD-PAP. Kadar trigliserida diukur menggunakan spektrofotometer Microlab 300 dengan metode GPO-PAP. Data dianalisis menggunakan uji Paired T-Test dan menunjukkan jus labu siam ketiga dosis dapat menurunkan secara bermakna (p<0,05 kadar kolesterol total, trigliserida dan LDL tikus. Kadar HDL tikus dapat naik secara bermakna (p<0,05 dengan jus labu siam dosis 1 ml/100 g BB tikus/hari. Pemberian jus labu siam dosis 1 ml/100 g BB tikus/hari merupakan dosis yang paling efektif dalam menurunkan kadar kolesterol total, trigliserida dan LDL serta menaikkan kadar HDL.

  7. Assessment of a fruit extract ( Sechium edule ) on the labeling of ...

    African Journals Online (AJOL)

    The blood was centrifuged and plasma (P) and RBC were isolated, also precipitated with trichloroacetic acid (TCA, 5%) and soluble (S) and insoluble (I) fractions (F) of plasma and cells (C) were determined. The radioactivity (ATI%) was rated in RBC, IF-P and IF-C. The results have showed that extract was able to reduce ...

  8. Polysaccharide composition of raw and cooked chayote (Sechium edule Sw.) fruits and tuberous roots.

    Science.gov (United States)

    Shiga, Tânia M; Peroni-Okita, Fernanda Helena Gonçalves; Carpita, Nicholas C; Lajolo, Franco Maria; Cordenunsi, Beatriz Rosana

    2015-10-05

    Chayote is a multipurpose table vegetable widely consumed in Latin America countries. Chayote fruits, leaves and tuberous roots contain complex carbohydrates as dietary fiber and starch, vitamins and minerals. The complex polysaccharides (cell walls and starch) were analyzed in the black and green varieties of chayote fruits as well as in green chayote tuberous root before and after a controlled cooking process to assess changes in their composition and structure. The monosaccharide composition and linkage analysis indicated pectins homogalacturonans and rhamnogalacturonan I backbones constitute about 15-20% of the wall mass, but are heavily substituted with, up to 60% neutral arabinans, galactans, arabinogalactans. The remainder is composed of xyloglucan, glucomannans and galactoglucomannans. Chayote cell-wall polysaccharides are highly stable under normal cooking conditions, as confirmed by the optical microscopy of wall structure. We found also that tuberous roots constitute a valuable additional source of quality starch and fiber. Published by Elsevier Ltd.

  9. Molecular evidence for the occurrence of tomato leaf curl New Delhi virus on chayote (Sechium edule) in southern India.

    Science.gov (United States)

    Nagendran, K; Mohankumar, S; Mohammed Faisal, P; Bagewadi, B; Karthikeyan, G

    2017-12-01

    During 2012-2014, mosaic disease on chayote in the farmers field of Kodaikanal region (high altitude zone) of Tamil Nadu was observed. The disease was characterized with severe mosaic, cupping and enation on leaves with reduced fruit size. Disease was found to causes an yield loss of more than 60% with the maximum disease incidence of 100% for the past 5 years consecutively. Preliminary serological and molecular screening indicated the association of begomovirus with the disease. Complete nucleotide sequence and phylogenetic analysis of DNA A revealed the identity of the virus as tomato leaf curl New Delhi virus (ToLCNDV). In recombination analysis study, the major parent was identified as ToLCNDV from Pakistan infecting tomato. Thus the present finding confirms expansion of new geographical region and host for ToLCNDV causing mosaic disease on chayote from Tamil Nadu. To our knowledge this is the first confirmed report for the occurrence of ToLCNDV on chayote in southern India.

  10. Traditional knowledge on integrated pest and weed management in chayote (Sechium edule (Jacq. Sw. crops from localities of Chiapas, Mexico

    Directory of Open Access Journals (Sweden)

    Luis Alfredo Rodríguez-Larramendi

    2017-10-01

    Full Text Available This research was carried out in Villaflores and Villa Corzo, located in Chiapas State of Mexico. Specifically, throughout an ethno-agronomical approach, semi-structured interviews were designed and applied to the chayote producers who were selected by random routes. The results indicate the 57.89% of chayote producers in both municipalities, have allowed to control weeds in their crops, and being a higher proportion represented by Villaflores. Given these concerns, they prefer to control weeds throughout traditional methods, basically using mattocks with frequencies of 15 to 30 days after sowing or two to four times per cycle of crop production. Both pest and diseases are mainly controlled throughout chemical methods application. A preference to perform control among periods of higher rainfall or drought is not distinguished. A considerable percentage, which reaches 44% of the interviewed population among both municipalities, report they do not need to control pests and crop diseases.

  11. Fruit extract from a Sechium edule hybrid induce apoptosis in leukaemic cell lines but not in normal cells.

    Science.gov (United States)

    Aguiñiga-Sánchez, Itzen; Soto-Hernández, Marcos; Cadena-Iñiguez, Jorge; Ruíz-Posadas, Lucero del Mar; Cadena-Zamudio, Jorge David; González-Ugarte, Ana Karen; Steider, Benny Weiss; Santiago-Osorio, Edelmiro

    2015-01-01

    The antiproliferative potential of a crude extract from the chayote hybrid H-837-07-GISeM® and its potential for apoptosis induction were assessed in leukaemic cell lines and normal mouse bone marrow mononuclear cells (BM-MNCs). The extract strongly inhibited the proliferation of the P388, J774, and WEHI-3 cell lines (with an IC50 below 1.3 μg·mL(-1)), reduced cell viability, and induced apoptotic body production, phosphatidylserine translocation, and DNA fragmentation. However, the extract had no effect on BM-MNCs. We postulate that these properties make the extract a good candidate for an anti-tumour agent for clinical use.

  12. Antioxidant and antibacterial activity of Rhoeo spathacea (Swartz) Stearn leaves

    OpenAIRE

    Tan, Joash Ban Lee; Lim, Yau Yan; Lee, Sui Mae

    2013-01-01

    The decoction and infusion of Rhoeo spathacea (Swartz) Stearn leaves have been recognized as a functional food particularly in South America, but has not yet gained international popularity as a beverage. The primary aim of this study was to establish the viability of R. spathacea aqueous leaf extracts as a beverage, in terms of its antioxidant activity and antibacterial activity. The antioxidant contents of aqueous and methanol leaf extracts were evaluated by the total phenolic content (TPC)...

  13. Aaron Swartz's the programmable web an unfinished work

    CERN Document Server

    Swartz, Aaron

    2013-01-01

    This short work is the first draft of a book manuscript by Aaron Swartz written for the series ""Synthesis Lectures on the Semantic Web"" at the invitation of its editor, James Hendler. Unfortunately, the book wasn't completed before Aaron's death in January 2013. As a tribute, the editor and publisher are publishing the work digitally without cost.From the author's introduction:"" . . . we will begin by trying to understand the architecture of the Web -- what it got right and, occasionally, what it got wrong, but most importantly why it is the way it is. We will learn how it allows both users

  14. A survey for potential biological control agents of Pereskia aculeata Miller (Cactaceae) in Brazil reveals two new species of Horismenus Walker (Hymenoptera: Eulophidae).

    Science.gov (United States)

    Pikart, Tiago G; Costa, Valmir A; Hansson, Christer; Cristo, Sandra C DE; Vitorino, Marcelo D

    2017-05-30

    This paper deals with the description of two new species of Horismenus Walker (Hymenoptera: Eulophidae) from Brazil, parasitoids of larvae of Adetus analis (Haldeman) (Coleoptera: Cerambycidae). Both species are similar to Horismenus steirastomae (Girault), a species that also parasitizes cerambycids. Adetus analis is a pest of Sechium edule (Jacq.) Swartz (Cucurbitaceae), a minor crop in Brazil, Argentina and U.S.A., but also feeds in stems of Pereskia aculeata Miller (Cactaceae), an ornamental plant that has become a problematic weed species in Africa, where it was introduced. The two new Horismenus species are described, diagnosed, and compared to H. steirastomae.

  15. Pengaruh Penambahan Karagenan Terhadap Karakteristik Fisik, Kimia Dan Sensoris Fruit and Vegetable Leather Berbasis Albedo Semangka (Citrullus Vulgaris Schard.) Dan Labu Siam (Sechium Edule)

    OpenAIRE

    Haryu, Adinda Safira Puspa; Parnanto, Nur Her Riyadi; Nursiwi, Asri

    2016-01-01

    Penelitian ini bertujuan untuk mengetahui pengaruh penambahan karagenan terhadap karakteristik fisik, kimia dan sensorisdari fruit and vegetable leather berbasis albedo semangka dan labu siam. Pengolahan fruit leather yang ada di Indonesia saat inihanya berbahan dasar buah buahan, perlu adanya penganekaragaman olahan dari fruit leather ini dengan menambahkan sayuranuntuk meningkatkan kandungan serat dan gizi, yang selanjutnya dikenal sebagai fruit and vegetable leather. Penelitian inimengguna...

  16. Cultivo de meristemas, termo y quimioterapia en chayote (Sechium edule Jacq. Sw.) para la erradicación del virus del mosaico del chayote (ChMV)

    OpenAIRE

    Abdelnour-Esquivel, Ana; Bermudez, L.C.; Rivera, C; Alvarenga-Venutolo, Silvana

    2006-01-01

    Recientemente se identificó en Costa Rica una nueva enfermedad viral en chayote, denominada "virus del mosaico del chayote" (ChMV, Chayote mosaic virus). Además de disminuir los rendimientos, esta enfermedad causa reducciones y malformación de los frutos, lo que eventualmente podría incidir en el incremento de frutos rechazados para la exportación. La enfermedad puede ser transmitida durante la propagación vegetativa y por la semilla. El cultivo de meristemas se utiliza en muchas ...

  17. DINÁMICA DE LA FORMACIÓN DE LA RAÍZ TUBERIZADA DEL CHAYOTE (Sechium edule Sw. EN SU PRIMER AÑO DE CULTIVO

    Directory of Open Access Journals (Sweden)

    A. Cruz-León

    2005-01-01

    Full Text Available El chayote es una planta perenne de crecimiento anual y su posesión de órganos de reserva le permite el rebrote e iniciar las primeras fases de crecimiento en un nuevo ciclo. Estas cualidades naturales, añadidas al consumo y aprovechamiento de todas sus partes vegetativas, lo hacen un cultivo muy apreciado por indígenas y campesinos, cuyos frutos también son vendidos en el mercado. El conocimiento empírico de sus productores le adjudica un gran valor nutricional a la raíz tuberizada de la planta, la que ha sido poco estudiada. Con el objetivo de contribuir al conocimiento de las características y proceso de formación de esa raíz tuberizada, se estableció una plantación que fue estudiada durante un año; así se determinó la dinámica de la formación de la raíz tuberizada para ese mismo lapso. Se describieron las características del chayotextle, que es el nombre popular que se da a esa raíz. Los resultados contribuyeron a establecer bases para un mayor conocimiento de su formación, sus características y las relaciones que se establecieron con el fotoperiodo en el comportamiento de los órganos externos de la planta. El estudio permitió aportar referencias de longitud, grosor, color, forma, textura y distribución en el suelo, así como la época de aparición, aumentó en volumen y la etapa de descomposición de la raíz engrosada de la especie en estudio. También se anotaron contribuciones sobre el conocimiento empírico que poseen los campesinos que aprovechan la raíz tuberizada de la planta de chayote.

  18. Antioxidant and antibacterial activity of Rhoeo spathacea (Swartz) Stearn leaves.

    Science.gov (United States)

    Tan, Joash Ban Lee; Lim, Yau Yan; Lee, Sui Mae

    2015-04-01

    The decoction and infusion of Rhoeo spathacea (Swartz) Stearn leaves have been recognized as a functional food particularly in South America, but has not yet gained international popularity as a beverage. The primary aim of this study was to establish the viability of R. spathacea aqueous leaf extracts as a beverage, in terms of its antioxidant activity and antibacterial activity. The antioxidant contents of aqueous and methanol leaf extracts were evaluated by the total phenolic content (TPC) and total flavonoid content (TFC) assays. The antioxidant activities measured were DPPH radical scavenging activity (FRS), ferric reducing power (FRP) and ferrous ion chelating (FIC) activity. The aqueous leaf extracts in the forms of decoction and infusion, were found to have comparable TPC and antioxidant activity with other herbal teas previously reported by our research group. Both decoction and infusion also exhibited antibacterial activity against six species of Gram positive and four species of Gram negative bacteria, notably methicillin-resistant Staphylococcus aureus and Neisseria gonorrhoeae. A total of four different known phenolic compounds were identified by HPLC and MS, three of which have not been previously reported to be found in this plant. Both the decoction and infusion of the leaves R. spathacea have potential to be popularized into a common beverage.

  19. The effects of industrial soil pollution on prosopis juliflora swartz growth around karachi

    International Nuclear Information System (INIS)

    Rehman, S.A.U.; Iqbal, M.Z.

    2009-01-01

    Study of the effect of soils of towel, garment, rubber and ply-wood factories of Korangi and Landhi industrial estates of Karachi and that of the University of Karachi on the growth of Prosopis juliflora Swartz plants growing in these areas demonstrated detrimental effect of industrial soils on the growth of plants of all the areas particularly on the plants growing at the University site. (author)

  20. Factors involved in the (near) anoxic survival time of Cerastoderma edule: associated bacteria vs. endogenous fuel

    NARCIS (Netherlands)

    Babarro, J.M.F.; De Zwaan, A.

    2001-01-01

    The effect of several antibiotics, molybdate and hydrogen sulfide was tested on anoxic tolerance of the cockle Cerastoderma edule, as well as utilisation of glycogen. The aim was to evaluate the role of fuel depletion and growth of bacteria as a cause of mortality. The exponential increase of

  1. Isolasi Dan Identifikasi Terpenoid dari Fraksi n-Butanol Herba Lampasau (Diplazium esculentum Swartz

    Directory of Open Access Journals (Sweden)

    Maria Dewi Astuti

    2017-03-01

    Full Text Available Abstrak Telah dilakukan penelitian yang bertujuan untuk mengidentifikasi senyawa kimia yang diisolasi dari fraksi n-butanol ekstrak metanol herba lampasau (Diplazium esculentum Swartz. Ekstrak metanol diperoleh secara maserasi dan difraksinasi berturut-turut denganpetroleum eter, etil asetat, dan n-butanol. Fraksi n­-butanol difraksinasidengan kromatografi kolom dengan fase diam silika gel dihasilkan fraksi A, B, C, dan D. Fraksi B dimurnikan dengan kromatografi lapis tipis preparatif pada silika geldihasilkan isolat B1. Isolat B1 berupa padatan tidak berwarna danberfluoresensi putih di bawah lampu UV 366 nm. Panjang gelombang maksimum pada spektra UV  isolat B1 adalah 225 nm dan 272.5 nm yang menunjukkan adanya ikatan rangkap tak terkonjugasi. Spektra IR isolat B1 menunjukkan adanya gugus C=C, –OH, C=O lakton, –CO, C–H ulur, dan C–H tekuk. Spektra 1H-NMR isolat B1 menunjukkan sinyal proton pada ikatan rangkap, proton –OH, proton pada –CH2 yang terikat atom oksigen, serta proton gugus metil –CH3. Berdasarkan data spektra UV, IR, dan 1H-NMR maka isolat B1 disarankan sebagai turunan senyawa triterpenoid hopan-lakton. Kata kunci : diplazium esculentum Swartz, fraksi n-butanol, triterpenoid hopan-lakton  Abstract The research  aims to identify chemical compounds isolated fromn-butanol fraction methanol extract of lampasau herbs (Diplazium esculentum Swartz. The methanol extract was obtained by maceration and fractioned by petroleum ether, ethyl acetate, andn-butanol. N-butanol fraction was fractionated using column chromatography on silica gel produced fractions A, B, C, and D. Fraction B was purified by preparative thin layer chromatography on silica gel produced isolate B1. Isolate B1was colorless solid and has white fluorescent under UV lamp 366 nm. The maximum wavelength on UV spectra of B1 are 225 nm and 272,5 nm indicates the unconjugated double bond. IR spectra of B1 showed the vibration of C=C, –OH, C=O lactone, –CO, C

  2. Erodibility of a mixed mudflat dominated by microphytobenthos and Cerastoderma edule, East Frisian Wadden Sea, Germany

    DEFF Research Database (Denmark)

    Andersen, Thorbjørn Joest; Lanuru, Mahatma; van Bernem, Carlo

    2010-01-01

    Sediment erodibility and a range of physical and biological parameters were measured at an intertidal site in the German Wadden Sea area in June, September and November 2002 and February and April 2003 in order to examine the influence of macrozoobenthos and microphytobenthos on sediment erodibil......Sediment erodibility and a range of physical and biological parameters were measured at an intertidal site in the German Wadden Sea area in June, September and November 2002 and February and April 2003 in order to examine the influence of macrozoobenthos and microphytobenthos on sediment...... erodibility and the temporal variation. The study site was a mixed mudflat situated in the mesotidal Baltrum-Langeoog tidal basin at the East Frisian barrier coast. The mud content at the site was about 35% and the filter-feeding cockle Cerastoderma edule was the dominating macrozoobenthic species (by biomass...... of C. edule will therefore probably increase the content of fine-grained sediments at the surface compared to an abiotic situation. Increasing the amount of fine-grained material in mixed sediments has previously been shown to reduce the erodibility of the sediments and C. edule will therefore...

  3. Contribution of Harold M. Swartz to In Vivo EPR and EPR Dosimetry.

    Science.gov (United States)

    Gallez, Bernard

    2016-12-01

    In 2015, we are celebrating half a century of research in the application of Electron Paramagnetic Resonance (EPR) as a biodosimetry tool to evaluate the dose received by irradiated people. During the EPR Biodose 2015 meeting, a special session was organized to acknowledge the pioneering contribution of Harold M. (Hal) Swartz in the field. The article summarizes his main contribution in physiology and medicine. Four emerging themes have been pursued continuously along his career since its beginning: (1) radiation biology; (2) oxygen and oxidation; (3) measuring physiology in vivo; and (4) application of these measurements in clinical medicine. The common feature among all these different subjects has been the use of magnetic resonance techniques, especially EPR. In this article, you will find an impressionist portrait of Hal Swartz with the description of the 'making of' this pioneer, a time-line perspective on his career with the creation of three National Institutes of Health-funded EPR centers, a topic-oriented perspective on his career with a description of his major contributions to Science, his role as a mentor and his influence on his academic children, his active role as founder of scientific societies and organizer of scientific meetings, and the well-deserved international recognition received so far. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. Contribution of Harold M. Swartz to In Vivo EPR and EPR Dosimetry

    International Nuclear Information System (INIS)

    Gallez, Bernard

    2016-01-01

    In 2015, we are celebrating half a century of research in the application of Electron Paramagnetic Resonance (EPR) as a biodosimetry tool to evaluate the dose received by irradiated people. During the EPR Biodose 2015 meeting, a special session was organized to acknowledge the pioneering contribution of Harold M. (Hal) Swartz in the field. The article summarizes his main contribution in physiology and medicine. Four emerging themes have been pursued continuously along his career since its beginning: (1) radiation biology; (2) oxygen and oxidation; (3) measuring physiology in vivo; and (4) application of these measurements in clinical medicine. The common feature among all these different subjects has been the use of magnetic resonance techniques, especially EPR. In this article, you will find an impressionist portrait of Hal Swartz with the description of the 'making of' this pioneer, a time-line perspective on his career with the creation of three National Institutes of Health-funded EPR centers, a topic-oriented perspective on his career with a description of his major contributions to Science, his role as a mentor and his influence on his academic children, his active role as founder of scientific societies and organizer of scientific meetings, and the well-deserved international recognition received so far. (author)

  5. Effects of metal contamination on the gene expression profile of two benthic species: Cerastoderma edule and Ruditapes philippinarum

    KAUST Repository

    Rodrigues, Raquel

    2017-08-14

    This study aimed to identify new biomarkers for metal exposure in two bivalve species. Suppressive Subtractive Hybridization (SSH) was employed to evaluate the transcriptomic response of Cerastoderma edule and Ruditapes philippinarum to metal pollution. Protein synthesis and catalytic activity were the most affected metabolic processes in C. edule and R. philippinarum, respectively. Also, different genes responded to the effect of contamination in each species. The different response observed in both species reinforces the importance of including more than one bioindicator species in risk assessment studies. These results provide the basis for new studies, which are necessary for further validation of the use of the identified genes as molecular biomarkers for metal exposure.

  6. Effects of metal contamination on the gene expression profile of two benthic species: Cerastoderma edule and Ruditapes philippinarum

    KAUST Repository

    Rodrigues, Raquel; Lourenç o, Joana; Pereira, Patrí cia; Carvalho, Susana; Mendo, Sonia

    2017-01-01

    This study aimed to identify new biomarkers for metal exposure in two bivalve species. Suppressive Subtractive Hybridization (SSH) was employed to evaluate the transcriptomic response of Cerastoderma edule and Ruditapes philippinarum to metal pollution. Protein synthesis and catalytic activity were the most affected metabolic processes in C. edule and R. philippinarum, respectively. Also, different genes responded to the effect of contamination in each species. The different response observed in both species reinforces the importance of including more than one bioindicator species in risk assessment studies. These results provide the basis for new studies, which are necessary for further validation of the use of the identified genes as molecular biomarkers for metal exposure.

  7. The inhibitory effect of Mesembryanthemum edule (L.) bolus essential oil on some pathogenic fungal isolates

    Science.gov (United States)

    2014-01-01

    Background Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. Methods The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005 - 5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. Result GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Conclusion Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative. PMID:24885234

  8. Refinement of the karyological aspects of Psidium guineense (Swartz, 1788): a comparison with Psidium guajava (Linnaeus, 1753)

    OpenAIRE

    Marques, Anelise Machado; Tuler, Am?lia Carlos; Carvalho, Carlos Roberto; Carrijo, Tatiana Tavares; Ferreira, Marcia Flores da Silva; Clarindo, Wellington Ronildo

    2016-01-01

    Abstract Euploidy plays an important role in the evolution and diversification of Psidium Linnaeus, 1753. However, few data about the nuclear DNA content, chromosome characterization (morphometry and class) and molecular markers have been reported for this genus. In this context, the present study aims to shed light on the genome of Psidium guineense Swartz, 1788, comparing it with Psidium guajava Linnaeus, 1753. Using flow cytometry, the nuclear 2C value of Psidium guineense was 2C = 1.85 pi...

  9. Actividad antiinflamatoria de flores y hojas de Caesalpinia pulcherrima L. (Swartz Anti-inflammatory activity of flowers and leaves of Caesalpinia pulcherrima L. (Swartz

    Directory of Open Access Journals (Sweden)

    Germán Eduardo Matiz

    2011-12-01

    Full Text Available Introducción: Partes aéreas de la planta Caesalpinia pulcherrima L. (Swartz han sido usadas en medicina tradicional al sur del Departamento de Cundinamarca para el tratamiento de afecciones inflamatorias. Objetivo: Evaluar la actividad antiinflamatoria de flores, hojas y frutos verdes de Caesalpinia pulcherrima para cuantificar su actividad antiinflamatoria en modelos murinos de inflamación aguda y subcrónica. Metodología: Este estudio cuantificó la actividad antiinflamatoria de diferentes extractos de tejidos aéreos de esta especie encontrada en Colombia por dos modelos de inflamación aguda, el edema auricular inducido por TPA (acetato de 12-O-tetradecanoil-forbol y el edema plantar inducido por carragenina; así como el modelo de inflamación sub-crónico de granuloma inducido por pellet de algodón. Resultados: Los extractos de flores mostraron la mayor actividad antiinflamatoria en el modelo del TPA, en tanto que las hojas fueron más efectivas en disminuir el granuloma, en el modelo del pellet de algodón. No se observó ninguna actividad antiinflamatoria de ningún extracto en el modelo de carragenina. Los frutos verdes no mostraron actividad en ningún modelo. Conclusión: Los resultados demostraron la efectividad que el uso etnobotánico le atribuye a esta planta. Los extractos activos obtenidos mostraron el potencial uso de esta planta en la fabricación fitoterapéuticos efectivos. Salud UIS 2011; 43 (3: 281-287Introduction: Aerial parts of Caesalpinia pulcherrima L. (Swartz have been used in traditional medicine in southern Cundinamarca Department for the treatment of inflammatory diseases. Objective: Evaluate the antiinflammatory activity of flowers, leaves and green fruits of the plant to quantify inflammatory activity of acute and subchronic murine inflammation models. Methodology: This study quantified the anti-inflammatory activity of different extracts of aerial tissues of this species for two models of acute

  10. Propensity to metal accumulation and oxidative stress responses of two benthic species (Cerastoderma edule and Nephtys hombergii): are tolerance processes limiting their responsiveness?

    KAUST Repository

    Marques, Ana; Piló , David; Araú jo, Olinda; Pereira, Fá bio; Guilherme, Sofia; Carvalho, Susana; Santos, Maria Ana; Pacheco, Má rio; Pereira, Patrí cia

    2016-01-01

    and antioxidant system responses of two benthic organisms (Cerastoderma edule, Bivalvia; Nephtys hombergii, Polychaeta). This approach will provide clarifications about the ability of each species to signalise metal contamination. Organisms of both species were

  11. Vaccinium meridionale Swartz Supercritical CO2 Extraction: Effect of Process Conditions and Scaling Up

    Directory of Open Access Journals (Sweden)

    Alexis López-Padilla

    2016-06-01

    Full Text Available Vaccinium meridionale Swartz (Mortiño or Colombian blueberry is one of the Vaccinium species abundantly found across the Colombian mountains, which are characterized by high contents of polyphenolic compounds (anthocyanins and flavonoids. The supercritical fluid extraction (SFE of Vaccinium species has mainly focused on the study of V. myrtillus L. (blueberry. In this work, the SFE of Mortiño fruit from Colombia was studied in a small-scale extraction cell (273 cm3 and different extraction pressures (20 and 30 MPa and temperatures (313 and 343 K were investigated. Then, process scaling-up to a larger extraction cell (1350 cm3 was analyzed using well-known semi-empirical engineering approaches. The Broken and Intact Cell (BIC model was adjusted to represent the kinetic behavior of the low-scale extraction and to simulate the large-scale conditions. Extraction yields obtained were in the range 0.1%–3.2%. Most of the Mortiño solutes are readily accessible and, thus, 92% of the extractable material was recovered in around 30 min. The constant CO2 residence time criterion produced excellent results regarding the small-scale kinetic curve according to the BIC model, and this conclusion was experimentally validated in large-scale kinetic experiments.

  12. Propagation of the neotropical fruit Vaccinium meridionale Swartz by air layering

    Directory of Open Access Journals (Sweden)

    Gustavo Adolfo Ligarreto-Moreno

    2013-08-01

    Full Text Available Vaccinium meridionale Swartz has its natural distribution in the tropics of the New World, from 2,100 to 4,000 m a.s.l.; and is a keystone species in habitat conservation, with 3 m high shrubs when pruned. The aim of this study was to evaluate stem rooting using naphthaleneacetic acid (NAA and Aloe vera as rooting promoters with a farm propagation system. For this purpose, a natural population of plants was selected in San Miguel de Sema (Boyaca, Colombia, 5°31'15'' N and 73°43'39'' W, at 2,615 m a.s.l., with an average temperature of 13°C and an average annual precipitation of 1,000-1,300 mm. The results showed that the studied rooting promoters stimulated the appearance and development of roots; however, the NAA treatments had greater root growth over time. Developing air layers allowed for their separation from the mother plants and transplant 6 months after the application of the rooting promoters started

  13. Vaccinium meridionale Swartz Supercritical CO2 Extraction: Effect of Process Conditions and Scaling Up

    Science.gov (United States)

    López-Padilla, Alexis; Ruiz-Rodriguez, Alejandro; Restrepo Flórez, Claudia Estela; Rivero Barrios, Diana Marsela; Reglero, Guillermo; Fornari, Tiziana

    2016-01-01

    Vaccinium meridionale Swartz (Mortiño or Colombian blueberry) is one of the Vaccinium species abundantly found across the Colombian mountains, which are characterized by high contents of polyphenolic compounds (anthocyanins and flavonoids). The supercritical fluid extraction (SFE) of Vaccinium species has mainly focused on the study of V. myrtillus L. (blueberry). In this work, the SFE of Mortiño fruit from Colombia was studied in a small-scale extraction cell (273 cm3) and different extraction pressures (20 and 30 MPa) and temperatures (313 and 343 K) were investigated. Then, process scaling-up to a larger extraction cell (1350 cm3) was analyzed using well-known semi-empirical engineering approaches. The Broken and Intact Cell (BIC) model was adjusted to represent the kinetic behavior of the low-scale extraction and to simulate the large-scale conditions. Extraction yields obtained were in the range 0.1%–3.2%. Most of the Mortiño solutes are readily accessible and, thus, 92% of the extractable material was recovered in around 30 min. The constant CO2 residence time criterion produced excellent results regarding the small-scale kinetic curve according to the BIC model, and this conclusion was experimentally validated in large-scale kinetic experiments. PMID:28773640

  14. Growth and fatty acid composition of juvenile Cerastoderma edule (L.) fed live microalgae diets with different fatty acid profiles

    NARCIS (Netherlands)

    Reis Batista, dos I.C.; Kamermans, P.; Verdegem, M.C.J.; Smaal, A.C.

    2014-01-01

    The importance of dietary 20:5n-3 (EPA), 22:6n-3 (DHA) and 20:4n-6 (ARA) for growth, survival and fatty acid composition of juvenile cockles (Cerastoderma edule) was investigated. Cockles of 6.24 ± 0.04 mm and 66.14 ± 0.34 mg (live weight) were distributed into three treatments where live microalgae

  15. Effect of picung (Pangium edule plant extracts as a botanical pesticide on mortality of coffee berry borer (Hypothenemus hampei

    Directory of Open Access Journals (Sweden)

    soekadar wiryadiputra

    2014-12-01

    Full Text Available Coffee pests known as coffe berry borer (CBB, Hypothenemus hampei were main pests which decreasing the productivity of Indonesian coffee. One of pests controlling was done by insecticides. Generally, plant uses for insecticide show high security level, because the breaking molecule was easy as not dangerous compound. Pangium edule contains of flavanoide, cyanide acid and saponin had potential as an botanical insecticide. The purpose of this research was to prove the potential extract of seed and leaves of picung (Pangium edule as an botanical insecticide for CBB. This research used a complete random design. There were 8 treatments with the concentration of the extract from leaves and seed of picung, one positive control treatment (Carbaril 0,02% formulation and one negative control treatment (aquades. The treatment was repeated four times and carried out observation on every day until six days. The concentrations leaf and seed extracts were 1.0%, 2.5% and 5.0%. The result of the research show that between concentration applied the were no significant different and at observation six days after application the mortality of CBB only around 35 -40% on both extracts (ewater and methanol. The result of the research also show that there were no real differentiation between leaves and seed of picung. LT-50 values were 1.25% and 0.96%, for leaves and seed extract in water for six day observation. From this observation could be concluded that picung tree (Pangium edule is not effective in the controlling CBB in the interval concentration applied and extraction method used. Key words: Botanical pesticide, picung tree, Pangium edule, mortality, Hypothenemus hampei, water extraction, methanol extraction.

  16. Biological activity of Ruta chalepensis (Rutaceae and Sechium pittieri (Cucurbitaceae extracts on Hypsipyla grandella (Lepidoptera: Pyralidae larvae

    Directory of Open Access Journals (Sweden)

    Fernando Mancebo

    2001-06-01

    Full Text Available Biological activity of a plant extract (common rue, Ruta chalepensis and a semi purifíed fraction (from "tacaco cimarrón", Sechium pittieri on mahogany shootborer larvas (Hypsipyla grandella was studied. A randomized complete block design, with four replications, was used. H. grandella third instar larvas were exposed for 24 h to Cedrela odorata leaf discs dipped in several treatment dissolutions of each extract (0.1, 0.32, 1.0, 3.20, and 10%; afterwards, each larva was transferred to a flask containing an artificial diet and was allowed to complete its development. Variables measured included food consumption (foliar area eaten in 24 h, mortality, and developmental effects (developmental time for each larval instar and the pupa, and pupal weight. The common rue extract showed a clear antifeedant activity at a concentration as low as 0.32%, whereas the "tacaco cimarrón" fraction caused toxicity, especially at the two highest concentrations (3.20 and 10%.Se estudió la actividad biológica de un extracto de follaje de ruda (Ruta chalepensis y de una fracción semipurificada de "tacaco cimarrón" (Sechium pittieri sobre las larvas del gusano barrenador de las meliáceas (Hypsipyla grandella. Se utilizó un diseño de bloques completos al azar, con cuatro repeticiones. Durante 24 h se expusieron larvas de tercer estadio de H. grandella a discos de follaje de Cedrela odorata impregnados con cada tratamiento. Estos consistieron en disoluciones de cada extracto (0.1, 0.32, 1.0, 3.20 y 10%; posteriormente cada larva se transfirió a un frasco que contenía dieta artificial, donde se le permitió completar su desarrollo. Las variables de respuesta fueron el consumo de alimento (área foliar comida en 24 h, la mortalidad y efectos sobre el desarrollo (tiempo de desarrollo de cada estadio larval y de la pupa, y el peso de la pupa. El extracto de ruda causó fagodisuasión a una concentración de apenas 0.32%, mientras que la fracción de "tacaco cimarr

  17. Antifeedant activity of botanical crude extracts and their fractions on Bemisia tabaci (Homoptera: Aleyrodidae adults: II. Sechium pittieri (Cucurbitaceae

    Directory of Open Access Journals (Sweden)

    Guillermo Flores

    2008-12-01

    Full Text Available Bemisia tabaci is a key pest of vegetables and other crops worldwide, but it is a particularly serious problem in the tropics, due to its ability to transmit several types of viruses, especially begomoviruses (Geminiviridae. Therefore, a preventive approach to deal with viral epidemics may be the deployment of repellents or phagodeterrents at earlier stages of plant development (critical period. Thus, the crude extract and four fractions thereof (water, water: methanol, methanol, and diethyl ether of wild "tacaco" (Sechium pittieri, Cucurbitaceae, were tested for phagodeterrence to B. tabaci adults under greenhouse conditions, on tomato plants, in Costa Rica. Both restricted-choice and unrestricted-choice experiments showed that the crude extract as well as some fractions exert such effect on the insect. In the former (in sleeve cages, fractions caused deterrence at doses as low as 0.1% (ether and 0.5% (water and water: methanol, with the methanol fraction showing no activity. However, in the latter (plants exposed in a greenhouse no one of the fractions performed well, suggesting that the deterrent principles somehow decomposed under the experimental conditions. Rev. Biol. Trop. 56 (4: 2115-2129. Epub 2008 December 12.Bemisia tabaci es una plaga clave de hortalizas y otros cultivos, mundialmente, y representa un problema particularmente serio en los trópicos, debido a su habilidad para transmitir varios tipos de virus, especialmente begomovirus (Geminiviridae. Por tanto, un enfoque preventivo para enfrentar las epidemias virales podría consistir en la utilización de sustancias repelentes o disuasivas en las eta-pas tempranas del desarrollo de la planta (período crítico. Así, el extracto crudo y cuatro fracciones (agua, agua: metanol, metanol, y éter dietílico de tacaco cimarrón (Sechium pittieri, Cucurbitaceae, fueron evaluadas por su posible actividad fagodisuasiva sobre B. tabaci en un invernadero, utilizando plantas de tomate, en

  18. Propensity to metal accumulation and oxidative stress responses of two benthic species (Cerastoderma edule and Nephtys hombergii): are tolerance processes limiting their responsiveness?

    KAUST Repository

    Marques, Ana

    2016-02-24

    The chronic exposure of benthic organisms to metals in sediments can lead to the development of tolerance mechanisms, thus diminishing their responsiveness. This study aims to evaluate the accumulation profiles of V, Cr, Co, Ni, As, Cd, Pb and Hg and antioxidant system responses of two benthic organisms (Cerastoderma edule, Bivalvia; Nephtys hombergii, Polychaeta). This approach will provide clarifications about the ability of each species to signalise metal contamination. Organisms of both species were collected at the Tagus estuary, in two sites with distinct contamination degrees (ALC, slightly contaminated; BAR, highly contaminated). Accordingly, C. edule accumulated higher concentrations of As, Pb and Hg at BAR compared to ALC. However, antioxidant responses of C. edule were almost unaltered at BAR and no peroxidative damage occurred, suggesting adjustment mechanisms to the presence of metals. In contrast, N. hombergii showed a minor propensity to metal accumulation, only signalising spatial differences for As and Pb and accumulating lower concentrations of metals than C. edule. The differences in metal accumulation observed between species might be due to their distinctive foraging behaviour and/or the ability of N. hombergii to minimise the metal uptake. Despite that, the accumulation of As and Pb was on the basis of the polychaete antioxidant defences inhibition at BAR, including CAT, SOD, GR and GPx. The integrated biomarker response index (IBRv2) confirmed that N. hombergii was more affected by metal exposure than C. edule. In the light of current findings, in field-based studies, the information of C. edule as a bioindicator should be complemented by that provided by another benthic species, since tolerance mechanisms to metals can hinder a correct diagnosis of sediment contamination and of the system’s health. Overall, the present study contributed to improve the lack of fundamental knowledge of two widespread and common estuarine species, providing

  19. Physiological responses to ocean acidification and warming synergistically reduce condition of the common cockle Cerastoderma edule.

    Science.gov (United States)

    Ong, E Z; Briffa, M; Moens, T; Van Colen, C

    2017-09-01

    The combined effect of ocean acidification and warming on the common cockle Cerastoderma edule was investigated in a fully crossed laboratory experiment. Survival of the examined adult organisms remained high and was not affected by elevated temperature (+3 °C) or lowered pH (-0.3 units). However, the morphometric condition index of the cockles incubated under high pCO 2 conditions (i.e. combined warming and acidification) was significantly reduced after six weeks of incubation. Respiration rates increased significantly under low pH, with highest rates measured under combined warm and low pH conditions. Calcification decreased significantly under low pH while clearance rates increased significantly under warm conditions and were generally lower in low pH treatments. The observed physiological responses suggest that the reduced food intake under hypercapnia is insufficient to support the higher energy requirements to compensate for the higher costs for basal maintenance and growth in future high pCO 2 waters. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Seasonal changes in size selection and intake rate of Oystercatchers Haematopus ostralegus feeding on the bivalves Mytilus edulis and Cerastoderma edule

    NARCIS (Netherlands)

    Ens, B.J.; Dirksen, S; Smit, CJ; Bunskoeke, AJ

    1996-01-01

    During the course of spring, Cockles Cerastoderma edule and Mussels Mytilus edulis grow in size, while the condition, as measured by the biomass content of shells of a given size, also increases. Condition temporarily drops when the larger individuals spawn. This study investigates the effects of

  1. De herba lunatica (London, Wellcome Library, 573, f. 149v): edition and translation of a medieval opuscule on the magical properties of common moonwort (Botrychium lunaria Swartz)

    OpenAIRE

    Ferraces Rodríguez, Arsenio

    2014-01-01

    This article provides the first edition of a medieval text on the properties of a plant named herba lunatica. From the description of the plant found in this text as well as in other medieval sources, together with its iconographic representation on the lower margin of the manuscript, we propose its identification with the ‘Botrychium lunaria’ Swartz. The edition of the Latin text includes its translation into Spanish.

  2. ANDEAN BLUEBERRY (Vaccinium Meridionale Swartz SEED STORAGE BEHAVIOUR CHARACTERIZATION UNDER LOW TEMPERATURE CONSERVATION CATEGORIZACIÓN DEL COMPORTAMIENTO DE LAS SEMILLAS DE MORTIÑO (Vaccinium Meridionale Swartz EN ALMACENAMIENTO A BAJA TEMPERATURA

    Directory of Open Access Journals (Sweden)

    María Isabel Hernández Pérez

    2012-06-01

    Full Text Available Abstract. A study was conducted to categorize harvest stage, maximun dry weigth and tolerance to desiccation at low temperature storage of seeds of the promising species "andean blueberry", Vaccinium meridionale Swartz. The aim was to determine the long term conservation possibility of a duplicate of the current Colombian Andean Highland field collection in cool storage rooms, as well as that of newly collected local populations from the mentioned highland region, which are in danger of genetic erosion due to human intervention and the ongoing global climate change. Both maximum dry weight and the highest germination percentages were observed to be associated in seeds extracted from deep purple (fully ripe berries. The seeds exhibited orthodox storage behavior, which indicates the possibility for long-term cold storage of a duplicate of the current metapopulation of the species in the country.Resumen. Se realizó un estudio para categorizar el estado de cosecha, máximo peso seco de la semilla y la tolerancia de ésta a la desecación y almacenamiento a bajas temperaturas, en la especie promisoria mortiño, Vaccinium meridionale Swartz. El objetivo fue establecer el potencial de conservar un duplicado de la colección de campo y rescatar y almacenar poblaciones espontáneas de la zona alto andina colombiana, en peligro de pérdida por intervención humana y el cambio climático, que pueden causar erosión de la diversidad genética de la especie. El máximo peso seco se logró a partir de semillas extraídas de bayas de color morado oscuro, con obtención de germinación superior en éstas y una relación directa entre el peso seco y el porcentaje de germinación. La semilla exhibió comportamiento ortodoxo, lo cual indica la posibilidad de almacenamiento a largo plazo de un duplicado de la metapoblación de la especie, existente en el país.

  3. Considerações taxonômicas e novas combinações em Ardisia Swartz (Myrsinaceae do sudeste do Brasil Taxonomic considerations and new combinations in Ardisia Swartz (Myrsinaceae from Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Luís Carlos Bernacci

    2000-12-01

    Full Text Available Os tipos de placentação e de pré-floração têm sido utilizados para a distinção dos gêneros Ardisia Swartz, ao qual tem sido atribuído placentação plurisseriada e pré-floração imbricada ou quincuncial, e Stylogyne A.DC., ao qual tem sido atribuído placentação unisseriada e pré-floração contorta. Entretanto, a análise de dez espécies destes gêneros revelou a inconsistência destes caracteres. Também foi constatada a impossibilidade de observar diferenças no tipo de placentação em espécimes com poucos óvulos. Propõe-se, portanto, o restabelecimento da circunscrição de Ardisia, incluindo o gênero Stylogyne, conforme adotado por Miquel, em 1856 e Handro, em 1969. Desta forma, Ardisia ambigua Mart. é o nome válido para S. ambigua (Mart. Mez e Ardisia martiana Miq. o é para S. laevigata (Mart. Mez. Duas novas combinações são necessárias: Ardisia depauperata (Mez Bernacci & Jung-Mendaçolli e Ardisia warmingii (Mez Bernacci & Jung-Mendaçolli.Placentation and aestivation have traditionally been used as diagnostic features to separate the genera Ardisia Swartz and Stylogyne A.DC. While Ardisia has pluriseriate placentation and imbricate or quincuncial aestivation, Stylogyne has uniseriate placentation and contorted aestivation. However, careful examination of ten species of these genera revealed the inconsistency of these characters in the distinction of the two genera. Also, we noticed the impossibility of observation of placentation types in few-ovuled specimens. Therefore, we propose the re-establishment of the circumscription of Ardisia adopted by Miquel, in 1856, and Handro, in 1969 which includes the genus Stylogyne. In this way Ardisia ambigua Mart. is the valid name for S. ambigua (Mart. Mez as Ardisia martiana Miq. is for S. laevigata (Mart. Mez. Two new combinations are necessary: Ardisia depauperata (Mez Bernacci & Jung-Mendaçolli and Ardisia warmingii (Mez Bernacci & Jung-Mendaçolli.

  4. Traça Tuta absoluta (Meyrick em cultivares de tomateiro tratadas com extratos aquosos de Trichilia pallida Swartz Tuta absoluta (Meyrick on tomato cultivars treated with aqueous extracts of Trichilia pallida Swartz

    Directory of Open Access Journals (Sweden)

    José Djair Vendramim

    2001-09-01

    Full Text Available A traça Tuta absoluta (Meyrick é atualmente uma das principais pragas do tomateiro no Brasil. Com o objetivo de obter um método de controle eficiente e não poluente, avaliou-se a atividade dos extratos aquosos de folhas e ramos de Trichilia pallida Swartz associados a duas cultivares de tomateiro (Santa Clara e IPA-5 sobre essa praga. Acompanhou-se o desenvolvimento do inseto em folhas de cada uma das cultivares previamente submersas nos extratos a 1% de concentração, avaliando-se a duração e viabilidade das fases larval e pupal e o peso de pupas. A cultivar IPA-5 provocou alongamento da fase larval e, quando associada aos extratos de folhas e de ramos, reduziu a viabilidade pupal do inseto. Os extratos de folhas e de ramos também alongaram o período larval de T. absoluta, na cultivar Santa Clara. O extrato de folhas foi mais prejudicial ao desenvolvimento da traça do que o extrato de ramos dessa planta, reduzindo a viabilidade larval em ambas as cultivares.The tomato pinworm Tuta absoluta (Meyrick is one of the main tomato pests in Brazil. With the objective of obtaining an efficient and not pollutant method of control, the activity of aqueous extracts of Trichilia pallida Swartz leaves and twigs on this pest was studied associated to the tomato cultivars Santa Clara and IPA-5. The development of the insect was observed on leaves of each cultivar, previously treated with extracts at 1% of concentration. Length and viability of larval and pupal stages and pupal weight were evaluated. The larval period of the insect was more prolonged on 'IPA-5' and, when associated with leaf and twig extracts, reduced pupal viability. Leaf and twig extracts also prolonged the larval stage in 'Santa Clara'. The leaf extract affected more negatively the insect development than the twig extract, reducing larval viability on both cultivars.

  5. Chemical composition profiling and antifungal activity of the essential oil and plant extracts of Mesembryanthemum edule (L.) bolus leaves.

    Science.gov (United States)

    Omoruyi, Beauty Etinosa; Afolayan, Anthony Jide; Bradley, Graeme

    2014-01-01

    Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could help to verify the efficacy of the plant in the management or treatment of these illnesses. Various concentrations of the hydro-distilled essential oil, ranging from 0.005-5 mg/ml, were tested against some fungal strains, using the micro-dilution method. Minimum inhibitory activity was compared with four other different crude extracts of hexane, acetone, ethanol and aqueous samples from the same plant. The chemical composition of the essential oil, hexane, acetone and ethanol extracts was determined using GC-MS. GC/MS analysis of the essential oil resulted in the identification of 28 compounds, representing 99.99% of the total oil. Phytoconstituents of hexane, acetone and ethanol extracts yielded a total peak chromatogram of fifty nine compounds. A total amount of 10.6% and 36.61% of the constituents were obtained as monoterpenes and oxygenated monoterpenes. Sesquiterpene hydrocarbons (3.58%) were relatively low compared to the oxygenated sesquiterpenes (9.28%), while the major concentrated diterpenes and oxygenated diterpenes were 1.43% and 19.24 %, respectively and phytol 12.41%. Total amount of fatty acids and their methyl esters content, present in the oil extract, were found to be 19.25 %. Antifungal activity of the oil extract and four solvent extracts were tested against five pathogenic fungal strains. The oil extract showed antifungal activity against Candida albican, Candida krusei, Candida rugosa, Candida glabrata and Cryptococcus neoformans with MIC ranges of 0.02 0.31 mg/ml. Hexane extract was active against the five fungal strains with MICs ranging between 0.02-1.25 mg/ml. Acetone extracts were active against C. krusei only at 0.04mg/ml. No

  6. Bioactivity of Trichilia pallida Swartz (Meliaceae) derived molecules on Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae); Bioatividade de moleculas isoladas de Trichilia pallida Swartz (Meliaceae) sobre Tuta absoluta (Meyrick) (Lepidoptera: Gelechiidae)

    Energy Technology Data Exchange (ETDEWEB)

    Cunha, Uemerson S. da [Universidade Federal de Pelotas (UFPel), RS (Brazil). Dept. de Fitossanidade]. E-mail: uscunha@ufpel.edu.br; Vendramim, Jose D. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Entomologia, Fitopatologia e Zoologia Agricola; Rocha, Waldireny C.; Vieira, Paulo C. [Universidade de Sao Carlos (UFSCar), SP (Brazil). Dept. de Quimica

    2008-11-15

    Dichloromethane (DIC) leaf and fruit extracts of Trichiliapallida Swartz were obtained for the isolation and identification of molecules with insecticide activity against the tomato leafminer, Tuta absoluta (Meyrick). DIC leaf extracts of T. pallida yielded six compounds, the triterpenes 24-methylenecycloarta-3{beta}-ol (TRIT-1), 24-methylenecycloarta-3{beta}-26-diol (TRIT-2) and cycloarta-23-eno-3{beta},25-diol (TRIT-3), the sterols 24-methylene-3,22-dihydroxycholesterol (EST-1), 24-methylenecholesterol (EST-2) and 24-methylene-3{beta},4{beta},22-trihydroxycholesterol (EST-3), while the fruit extract yielded the limonoid gedunine (LIM). These molecules were dissolved in acetone and sprayed at 0.1% on tomato leaflets infested with newly-hatched larvae. Larval mortality at day 5 and 9 after infestation, larval and pupal developmental time and survival, pupal weight and adult malformation were evaluated. TRIT-1, EST-1 and LIM were the most effective against T. absoluta due to larval development arrestment and reduced larval survivorship. (author)

  7. Refinement of the karyological aspects of Psidium guineense (Swartz, 1788): a comparison with Psidium guajava (Linnaeus, 1753).

    Science.gov (United States)

    Marques, Anelise Machado; Tuler, Amélia Carlos; Carvalho, Carlos Roberto; Carrijo, Tatiana Tavares; Ferreira, Marcia Flores da Silva; Clarindo, Wellington Ronildo

    2016-01-01

    Euploidy plays an important role in the evolution and diversification of Psidium Linnaeus, 1753. However, few data about the nuclear DNA content, chromosome characterization (morphometry and class) and molecular markers have been reported for this genus. In this context, the present study aims to shed light on the genome of Psidium guineense Swartz, 1788, comparing it with Psidium guajava Linnaeus, 1753. Using flow cytometry, the nuclear 2C value of Psidium guineense was 2C = 1.85 picograms (pg), and the karyotype showed 2n = 4x = 44 chromosomes. Thus, Psidium guineense has four chromosome sets, in accordance with the basic chromosome number of Psidium (x = 11). In addition, karyomorphometric analysis revealed morphologically identical chromosome groups in the karyotype of Psidium guineense. The high transferability of microsatellites (98.6%) further corroborates with phylogenetic relationship between Psidium guajava and Psidium guineense. Based on the data regarding nuclear genome size, karyotype morphometry and molecular markers of Psidium guineense and Psidium guajava (2C = 0.95 pg, 2n = 2x = 22 chromosomes), Psidium guineense is a tetraploid species. These data reveal the role of euploidy in the diversification of the genus Psidium.

  8. Solanum torvum Swartz. fruit attenuates cadmium-induced liver and kidney damage through modulation of oxidative stress and glycosylation.

    Science.gov (United States)

    Ramamurthy, C H; Subastri, A; Suyavaran, A; Subbaiah, K C V; Valluru, L; Thirunavukkarasu, C

    2016-04-01

    Increased levels of environmental pollutants are linked to almost all human disorders; the efficient method to manage the human health is through naturally available dietary molecule. Solanum torvum (ST) Swartz (Solanaceae) commonly called Turkey Berry is found in Africa, Asia, and South America. Its fruit, part of traditional Indian cuisine, is a widely consumed nutritious herb, acclaimed for its medicinal value. ST aqueous extract (STAe) (250, 500, and 1000 mg/kg b.w., 6 days; oral) against acute Cadmium (Cd) (6.3 mg/kg b.w., single dose; oral) toxicity was evaluated in rats. Protective effect was assessed using serum markers, tissue antioxidants, oxidant derivatives, glycoprotein, and histopathological studies. The activities of serum marker enzymes were increased (40-60 %); antioxidant enzymes such as SOD and CAT, GSH, and its metabolic enzyme activities were decreased (50-80 %) in the liver and kidney upon Cd intoxication. During STAe pre-treatment, at doses of 250 and 500 mg/kg b.w., the above changes were brought to near normal (25-63 %). Tissue 4-hydroxynonenal, 3-nitrotyrosine, and protein carbonyls were increased (8-15 fold) in Cd-alone-treated rats, whereas pre-supplementation of STAe significantly decreased their levels and inhibited the protein glycosylation effectively. The pharmacological effect of STAe was confirmed by histopathological observations. Based on previous literature and present investigation, we conclude that ST may serve as a potential functional food against environmental contaminant such as heavy metal-induced oxidative stress.

  9. Feasibility of constructed wetland planted with Leersia hexandra Swartz for removing Cr, Cu and Ni from electroplating wastewater.

    Science.gov (United States)

    You, Shao-Hong; Zhang, Xue-Hong; Liu, Jie; Zhu, Yi-Nian; Gu, Chen

    2014-01-01

    As a low-cost treatment technology for effluent, the constructed wetlands can be applied to remove the heavy metals from wastewater. Leersia hexandra Swartz is a metal-accumulating hygrophyte with great potential to remove heavy metal from water. In this study, two pilot-scale constructed wetlands planted with L. hexandra (CWL) were set up in greenhouse to treat electroplating wastewater containing Cr, Cu and Ni. The treatment performance of CWL under different hydraulic loading rates (HLR) and initial metal concentrations were also evaluated. The results showed that CWL significantly reduced the concentrations of Cr, Cu and Ni in wastewater by 84.4%, 97.1% and 94.3%, respectively. High HLR decreased the removal efficiencies of Cr, Cu and Ni; however, the heavy metal concentrations in effluent met Emission Standard of Pollutants for Electroplating in China (ESPE) at HLR less than 0.3 m3/m2 d. For the influent of 5 mg/L Cr, 10 mg/L Cu and 8 mg/L Ni, effluent concentrations were below maximum allowable concentrations in ESPE, indicating that the removal of Cr, Cu and Ni by CWL was feasible at considerably high influent metal concentrations. Mass balance showed that the primary sink for the retention of contaminants within the constructed wetland system was the sediment, which accounted for 59.5%, 83.5%, and 73.9% of the Cr, Cu and Ni, respectively. The data from the pilot wetlands support the view that CWL could be used to successfully remove Cr, Cu and Ni from electroplating wastewater.

  10. Biology of Anastrepha grandis (Diptera: Tephritidae) in Different Cucurbits.

    Science.gov (United States)

    Bolzan, Anderson; Nava, Dori E; Garcia, Flávio R M; Valgas, Ricardo A; Smaniotto, Giovani

    2015-06-01

    Anastrepha grandis (Macquart) (Diptera: Tephritidae) is one of the main pests of cucurbits in Brazil. Losses occur due to the damage caused to the fruits and the embargo on exports, as A. grandis is considered a quarantine pest in countries that import Brazilian cucurbits. This study aimed to evaluate the development of A. grandis in hosts of the Cucurbitaceae family. The hosts used were stem squash (Cucurbita pepo L.), squash (Cucurbita moschata Duchesne), chayote [Sechium edule (Jacq.) Swartz], mini watermelon [Citrullus lanatus (Thunb.) Matsum & Nakai], Spanish melon (Cucumis melo L.), hybrid squash "Tetsukabuto" (C. moschata×Cucurbita maxima Duchesne), and salad cucumber (Cucumis sativus L.). We evaluated the viability and duration of egg-to-pupa period, pupal weight, sex ratio, and average number of pupae per fruit under controlled conditions of temperature, relative humidity, and photophase. The preoviposition and oviposition periods, fecundity, fertility, and longevity of females were determined for adults. Hosts of the genus Cucurbita provided a better development of A. grandis in comparison with other hosts, and presented a greater number of insects on fruit as well as higher infestation rate. Fecundity and longevity were also higher for females that developed in hosts of the genus Cucurbita, although values of these biological parameters varied between stem squash, squash, hybrid squash "Tetsukabuto." © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Effect of peanut shells amendment on soil properties and growth of seedlings of Senegalia senegal (L.) Britton, Vachellia seyal (Delile) P. Hurter, and Prosopis juliflora (Swartz) DC in salt-affected soils

    OpenAIRE

    Fall, D.; Bakhoum, N.; Fall, F.; Diouf, F.; Ndiaye, C.; Faye, M. N.; Hocher, Valérie; Diouf, D.

    2018-01-01

    Key message The soil amendment with peanut shells (4, 6 or 8 t ha(-1)) improves soil properties and growth of Senegalia senegal (L.) Britton, Vachellia seyal (Delile) P. Hurter and Prosopis juliflora (Swartz) DC seedlings on salty soils (86, 171, 257 mM NaCl). Context Salinization causes the degradation of biological, chemical, and physical properties of soils. Salty soils reclamation can be achieved with organic amendments and afforestation with salt tolerant species.Aims The aim of the stud...

  12. Identificação de diterpenos clerodânicos em diferentes órgãos de Casearia sylvestris Swartz

    Directory of Open Access Journals (Sweden)

    Elisângela Simões de Carvalho

    2010-06-01

    Full Text Available

    Casearia sylvestris Swartz (Salicaceae é uma espécie vegetal arbórea ou arbustiva, disseminada pelo território brasileiro e bastante utilizada em nossa medicina popular. Diversos diterpenos clerodânicos bioativos típicos do gênero Casearia foram isolados desta espécie (ex. casearinas e casearvestrinas. O objetivo principal deste trabalho foi avaliar a presença de diterpenos clerodânicos em diferentes órgãos de C. sylvestris, utilizando técnicas analíticas cromatográficas e espectroscópicas. Os extratos dos diferentes órgãos foram analisados por cromatografia em camada delgada, cromatografia líquida de alta eficiência com detector de arranjo de diodos e ressonância magnética nuclear de 1H. Nas análises cromatográficas foram utilizados diterpenos clerodânicos isolados de C. sylvestris como padrões, incluindo rel-19S-acetóxi- 18R- butanoilóxi-18,19- epóxi -6S -hidróxi -2R- (2 metilbutanoilóxi -5S,8R, 9R, 10S -cleroda-3,13(16,14-trieno, isolado do caule pela primeira vez. Foram obtidos perfis fitoquímicos dos órgãos avaliados. Os resultados indicaram a presença de diterpenos clerodânicos em toda planta, prevalecendo em maior número nas folhas. Além disso, os resultados também indicam que em caules, flores e raízes há predomínio de diterpenos clerodânicos com padrão diênico diferente daqueles obtidos de folhas de C. sylvestris. Palavras-chave: Casearia sylvestris. Diterpenos clerodânicos. Salicaceae. Flacourtiaceae. Cromatografia. ABSTRACT Identification of clerodane diterpenes in different organs of Casearia sylvestris Swartz Casearia sylvestris Swartz (Salicaceae is a tree or shrub distributed widely in Brazil, where it is used in popular medicine. Several bioactive clerodane diterpenes typical of Casearia have been isolated from this species (e.g. casearins and casearvestrins. The main objective of this study was to identify clerodane diterpenes in various organs of C. sylvestris

  13. Mechanism of electron transfer in the bioadsorption of hexavalent chromium within Leersia hexandra Swartz granules by X-ray photoelectron spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Li Jianping, E-mail: likianping@263.net [College of Chemistry and Bioengineering, Guilin University of Technology, Guilin 541004 (China) and Guangxi Key Laboratory of Environmental Engineering, Protection and Assessment, Guilin 541004 (China); Lin Qingyu [College of Chemistry and Bioengineering, Guilin University of Technology, Guilin 541004 (China); Zhang Xuehong [Guangxi Key Laboratory of Environmental Engineering, Protection and Assessment, Guilin 541004 (China)

    2010-10-15

    Leersia hexandra Swartz biogranules were used to adsorb Cr(VI) from aqueous solutions. Batch biosorption experiments showed that the Cr(VI) concentration sharply decreases in the first 15 min. The main functional groups that may be involved in chromium sorption were determined using Fourier transform infrared spectroscopy. The use of X-ray photoelectron spectroscopy confirmed the reduction of Cr(VI) to Cr(III) through L. hexandra Sw. Results indicate that Cr(III) is the dominant species on the surface of the biogranules and that the redox reaction can be accomplished within 40 min. The mechanism of electron transfer during Cr(VI) reduction to Cr(III) was investigated. Protonation of the oxygen-containing groups produces electrostatic-sorption power over Cr(VI). The nitrogen-containing groups serve as the electron-donor groups in the process of reduction-sorption. Moreover, after the complete reduction of Cr(VI), the pH of the suspension significantly increases.

  14. Isolation and characterization of a metallothionein-1 protein in Chloris virgata Swartz that enhances stress tolerances to oxidative, salinity and carbonate stress in Saccharomyces cerevisiae.

    Science.gov (United States)

    Nishiuchi, Shunsaku; Liu, Shenkui; Takano, Tetsuo

    2007-08-01

    Chloris virgata Swartz (C. virgata) is a gramineous wild plant that is found in alkaline soil areas in northeast China and is highly tolerant to carbonate stress. We constructed a cDNA library from C. virgata seedlings treated with NaHCO(3), and isolated a type 1 metallothionein (MT1) gene (ChlMT1: AB294238) from the library. The amino acid sequence of ChlMT1 contained 12 cysteine residues that constituted the Cys-X-Cys (X = amino acid except Cys) motifs in the N- and C-terminal regions. Northern hybridization showed that expression of ChlMT1 was induced by several abiotic stresses, from salts (NaCl and NaHCO(3)), a ROS inducer (paraquat), and metals (CuSO(4), ZnSO(4), and CoCl(2)). ChlMT1 expression in leaf was induced by 200 mM NaCl and 100 mM NaHCO(3). About 5 microM Paraquat, 500 microM Zn(2+), and 500 microM Co(2+) also induced expression of ChlMT1 in leaf after 6 h, and 100 microM Cu(2+) induced it after 24 h. Saccharomyces cerevisiae when transformed with the ChlMT1 gene had dramatically increased tolerances to salts (NaCl and NaHCO(3)) and ROS.

  15. Maturação e morfometria dos frutos de miconia Albicans (Swartz triana (melastomataceae em um remanescente de floresta estacional semidecídua montana em Lavras, MG Maturation and morphometrics of the fruits of Miconia albicans (Swartz triana (melastomataceae in a remnant of montane seasonal semideciduous forest in Lavras, MG

    Directory of Open Access Journals (Sweden)

    Fábio de Almeida Vieira

    2009-12-01

    Full Text Available Os objetivos deste trabalho foram analisar a dinâmica da maturação dos frutos e avaliar quantitativamente algumas características físicas dos frutos de Miconia albicans (Swartz Triana em um remanescente de Floresta Estacional Semidecídua Montana. A atividade, intensidade e sincronia de 20 indivíduos foram analisadas em relação aos eventos de frutificação, correlacionando-os com as variáveis climáticas. Analisou-se a morfometria (comprimento, largura e massa de 130 frutos de 10 indivíduos. A intensidade da fenofase de frutos maduros nas plantas correlacionou-se significativamente com a precipitação média do período (rS = 0,611; P The aim of this study was to examine the dynamics of fruit maturation and quantitatively assess some physical characteristics of the fruits of Miconia albicans (Swartz Triana in a remnant of Montane Seasonal Semideciduous Forest. The activity and synchrony of 20 individuals were analyzed in regard to the proportion of fruiting events, and to help to determine their correlation to abiotic factors. Morphometric traits (fruit length, diameter and mass of 130 fruits from ten individuals were analyzed. The number of fruits maturing showed a significant correlation with the mean precipitation (rS = 0.611; P < 0.05. M. albicans presented a high number of small seeds per fruit ( = 28.05 ± 1.45 s.d.. The fresh mass of the fruit was approximately equal to the pulp mass (rS = 0.988; P < 0.05. Thepulp contributed with 94% of the total mass, demonstrating the potential importance of this species for frugivores. The results indicate the period of high intrapopulation synchrony of the studied phenophases, which can be a useful guide in the collection of seeds for germoplasm banks and recovery of degraded areas.

  16. Phenolic Content, and Antioxidant and Antimicrobial Activities of ...

    African Journals Online (AJOL)

    Erah

    Methods: The content of total phenols, flavonoids and anthocyanins of the alcohol, hydroalcohol and aqueous extracts of ... Keywords: Crataegus oxyacantha L.; Natural phenolic compounds; Antioxidant and antimicrobial activity, Southeast Serbia. ..... Antioxidant activities of Sechium edule (Jacq.) Swart extracts, Food ...

  17. Nutritional composition and antioxidant activities of Curculigo pilosa ...

    African Journals Online (AJOL)

    ajl yemi

    2011-11-28

    Nov 28, 2011 ... Phenolic, flavonoids and proanthocyanidin contents were 65.17, 23.17 and 4.23 mg/g .... The total phenol content in the extract was determined by the modified Folin-Ciocalteu method (Wolfe et al., 2003). 0.5 ml ( ..... activities of Sechium edule (Jacq.) Swart extracts. Food Chem. 97: 452–458. Palazzino G ...

  18. Transfer across the human gut of environmental plutonium, americium, cobalt, caesium and technetium: studies with cockles (Cerastoderma edule) from the Irish Sea

    International Nuclear Information System (INIS)

    Hunt, G.J.

    1998-01-01

    Our previous studies have indicated lower values of the gut transfer factor ('f L values') for plutonium and americium in winkles (Littorina littorea) than adopted by ICRP. The present study was undertaken primarily to investigate whether this observation extends to other species. Samples of cockles (Cerastoderma edule) from Ravenglass, Cumbria were eaten by volunteers who provided 24 samples of urine and faeces. Urine samples indicated f L values for cockles which were higher than for winkles; for plutonium these ranged overall up to 7x10 -4 with an arithmetic mean in the range (2-3)x10 -4 , and for americium up to 2.6x10 -4 with an arithmetic mean of 1.2x10 -4 . Limited data based on volunteers eating cockles from the Solway suggest that f L values for americium may be greater at distance from Sellafield. The measured values compare with 5x10 -4 used by the ICRP for environmental forms of both elements, which would appear to provide adequate protection when calculating doses from Cumbrian cockles. Data for other nuclides were obtained by analysing faecal samples from the volunteers who ate the Ravenglass cockles. Cobalt-60 showed an f L value in the region of 0.2, twice the value currently used by ICRP. For 137 Cs, variabilities were indicated in the range 0.08 to 0.43, within the ICRP value of f L =1.0. Technetium-99 gave f L values up to about 0.6, in reasonable conformity with the ICRP value of 0.5. (author)

  19. Actividad antifúngica in vitro de extractos de Origanum vulgare L., Tradescantia spathacea Swartz y Zingiber officinale Roscoe sobre Moniliophthora roreri (Cif & Par Evans et ál.

    Directory of Open Access Journals (Sweden)

    Sandra Ramírez González

    2011-09-01

    Full Text Available La moniliasis del cacao ocasionada por Moniliophthora roreri origina grandes pérdidas en los países donde se ha estado dispersando; en México, de reciente ingreso ha afectado drásticamente la producción, ya que daña los frutos en sus diferentes estados y son escasas las medidas de control que se han podido implementar, por lo que se investigó el efecto in vitro de extractos de Origanum vulgare L., Tradescantia spathacea Swartz y Zingiber officinale Roscoe sobre M. roreri. Se aisló el hongo de frutos enfermos y se cultivó en laboratorio, las plantas fueron recolectadas y sometidas a cuatro formas de extracción: hidrolato por destilación, presurizado, fermentación aeróbica y anaeróbica. Dichos extractos se incorporaron al medio de cultivo al 50% (V/V, se sembró el hongo y se incubó durante 12 días, cuantificando el crecimiento diario y la formación de conidias; a los extractos que inhibieron totalmente al hongo se les determinó la concentración mínima.

  20. Evaluation des performances de la production de graines par tamisage manuel du sol chez trois variétés de Stylosanthes guianensis (Aublet Swartz, dans les conditions du Plateau des Batéké (RDC

    Directory of Open Access Journals (Sweden)

    Bulakali, BP.

    2013-01-01

    Full Text Available Performance Assessment of the Production of Seeds by Manual Sieving of the Soil of Three Varieties of Stylosanthes guianensis (Aublet Swartz under the Conditions of the Batéké Plateau (DRC. In manual agriculture with low resources level, Stylosanthes guianensis is one of the most interesting cover crop for developing direct seeding mulch-based cropping systems. To promote its cultivation in the DRC, the performances of a seed production method by sieving of the soil were evaluated for three varieties of Stylo (a local ecotype, CIAT 184 variety, and 202cc variety in two sites of the Batéké plateau characterized by contrasted fertility levels. The results obtained demonstrate the interest of the seed multiplication method tested, both in quantities and quality of the produced seeds. The production cost of one kg of seeds varies with the soil fertility, the planting date, and the cultivar. Among the three compared varieties, CIAT 184 variety produced the highest quantity of seeds. If sown at the beginning of the long rainy season, after a long fallow, in one of the most fertile soils of the plateau, this cultivar can produce 600 kg ha-1 seed in the first year of cultivation with a production cost of USD 1.31 kg-1, equivalent to less than 0.5 man.day.kg-1.

  1. Minute co-variations of Sr/Ca ratios and microstructures in the aragonitic shell of Cerastoderma edule (Bivalvia) - Are geochemical variations at the ultra-scale masking potential environmental signals?

    Science.gov (United States)

    Füllenbach, Christoph S.; Schöne, Bernd R.; Shirai, Kotaro; Takahata, Naoto; Ishida, Akizumi; Sano, Yuji

    2017-05-01

    It remains a challenging task to reconstruct water temperatures from Sr/Ca ratios of bivalve shells. Although in many aragonitic species, Sr/Ca is negatively correlated to temperature - which is expected based on abiogenic precipitation experiments, the incorporation of Sr into the shell of bivalves is strongly controlled by physiological processes and occurs away from the predicted thermodynamic equilibrium. Strontium-to-calcium ratios of aragonitic shells remain far below that of the ambient water. Moreover, Sr concentrations vary considerably among shell portions consisting of different microstructures and/or organic content. Values observed at annual growth lines and within the intervening shell portions (= annual growth increments) deviate much stronger from each other than expected from a change in temperature or Sr/Cawater. As demonstrated here by ultra-high-resolution chemical analysis (EPMA, NanoSIMS) of a Cerastoderma edule shell, Sr concentrations are also heterogeneously distributed at approximately micrometer resolution. For example, in the outer portion of the outer shell layer, Sr/Ca ratios were statistically significantly (t-, u-tests) higher at circatidal growth lines (irregular simple prismatic structure; arithmetic mean ± 1 standard deviation = 2.86 ± 0.38 mmol/mol; n = 53) than within circatidal increments (nondenticular prismatic structure; 2.42 ± 0.25 mmol/mol; n = 51). S/Cashell, a representative of the concentration of organics, showed the opposite pattern, i.e., significantly higher values in circatidal increments (2.37 ± 0.29 mmol/mol; n = 51) than at circatidal growth lines (2.13 ± 0.47 mmol/mol; n = 53). Overall highest values of Sr/Cashell (3.47 ± 0.65 mmol/mol; n = 3) and S/Cashell (3.98 ± 0.65 mmol/mol; n = 3), however, were typically associated with annual growth lines and larger biomineral units. The intimate link between Sr/Cashell, S/Cashell and shell architecture may indicate that microstructures or the processes

  2. logical studies of nephrolepis biserrata (swartz)

    African Journals Online (AJOL)

    User

    (c): N. undulata on the (Azardiracta indica) tree trunk opposite. Staff Club, Obafemi Awolowo University, Ile-Ife. (d): N. undulata as epiphytic fern (plant) on Elaeis guniensis near the Department of Botany car park, Obafemi Awolowo University,. Ile-Ife. Fig. 2. Plant forms and habits. (a): Nephrolepis biserrata showing sori ...

  3. Evaluation of the Antioxidant Properties and Aromatic Profile During Maturation of The Blackberry (Rubus glaucus Benth and The Bilberry (Vaccinium meridionale Swartz / Evaluación las Propiedades Antioxidantes y el Perfil Aromático Durante la Maduración

    Directory of Open Access Journals (Sweden)

    Luisa Juana Bernal

    2014-03-01

    Full Text Available The blackberry (Rubus glaucus Benth and thebilberry (Vaccinium meridionale Swartz are natural sourcesof antioxidants; they are known for their preventive role against degenerative diseases. In this study, the aromatic profile was evaluated using an electronic nose, including the antioxidant properties and the vitamin C, phenolic and anthocyanin contents during three stages of blackberry and bilberry ripening. A completely random statistical design was followed and the results presented differences in the aromatic profile: a higher anthocyanin content (1.59 mg of cyn-3-glu g-1 in the bilberry and 0.26 mg of cyn-3-glu g-1 in the blackberry and total phenols (5.57 mg of caffeic acid g-1 bilberry and 2.68 mg caffeic acid g-1 blackberry. The behavior of the evaluated properties was independent in each of the fruits. / Los frutos como la mora (Rubus glaucus Benth y el agraz (Vaccinium meridionale Swartz son fuentes naturales de sustancias antioxidantes reconocidas por su papel preventivo en el desarrollo de enfermedades degenerativas. En este estudio se evaluó el perfil aromático por medio de nariz electrónica, las propiedades antioxidantes y el contenido de vitamina C, fenoles y antocianinas totales, durante tres estados de maduración de mora y agraz. El diseño estadístico que se siguió fue completamente aleatorio y los resultados muestran que las frutas en el último estado de madurez evaluado se diferencian por su perfil aromático, un contenido mayor de antocianinas (1,59 y 0,26 mg cyn-3-glu g-1 en agraz y mora, respectivamente y fenoles totales (5,57 y 2,68 mg ácido caféico g-1 en agraz y mora, respectivamente. El comportamiento de las propiedades evaluadas es independiente en cada una de las frutas.

  4. Vida útil de produto minimamente processado composto por abóbora, cenoura, chuchu e mandioquinha-salsa Shelf life of fresh-cut composed of vegetables

    Directory of Open Access Journals (Sweden)

    Juliana Alvarenga Alves

    2010-02-01

    Full Text Available Objetivou-se avaliar o efeito do tempo de armazenamento sobre a qualidade de produto minimamente processado à base de hortaliças: abóbora (Cucurbita moschata Duch, cenoura (Daucus carota L., chuchu (Sechium edule Swartz e mandioquinha-salsa (Arracacia xanthorrhiza Bancroft. As hortaliças foram sanificadas em hipoclorito de sódio 200 mg.L-1, por 5 minutos, descascadas, manualmente, e cortadas utilizando-se processador. O produto processado foi sanificado em hipoclorito de sódio 50 mg.L-1, por 3 minutos, e apenas as mandioquinhas-salsa foram imersas em solução de ácido ascórbico 1%, por 2 minutos. As embalagens flexíveis de polietileno de baixa densidade linear (25 x 20 cm, contendo 400 g do "mix", foram armazenadas a 5ºC e 99% UR, por 8 dias. A firmeza e o valor L* das hortaliças estudadas não alteraram com o tempo de armazenamento. Os valores a* e b* da abóbora não oscilaram durante o armazenamento. O valor a* da mandioquinha-salsa e do chuchu aumentou e o da cenoura diminuiu com o armazenamento, enquanto o valor b* da cenoura, do chuchu e da mandioquinha-salsa reduziu. O "mix" apresentou taxa de perda de massa muito baixa e ascensão respiratória até o oitavo dia. A atmosfera de equilíbrio, em torno de 2,93% de O2 e 7,06% de CO2, foi alcançada no interior da embalagem, contendo o "mix", a partir do segundo dia. Não foi detectada a presença de coliformes a 45ºC e Salmonella sp. em nenhuma amostra. Os coliformes a 35ºC aumentaram durante o armazenamento. Conclui-se que, o produto minimamente processado, à base de hortaliças mantém a sua qualidade por 8 dias a 5ºC.The objective of this work was to evaluate the effect of storage time on the quality of fresh-cut product made up of four vegetables: pumpkin (Cucurbita moschata Duch, carrot (Daucus carota L., chayote (Sechium edule Swartz, and peruvian carrot (Arracaia xanthorrhiza Bancroft. The vegetables were sanitized in sodium hypochlorite solution (200 mg.L-1 for 5

  5. Caracterização Morfológica de Três Espécies de Broca-da-Haste em Chuchuzeiro (Coleoptera: Cerambycidae, Lamiinae)

    OpenAIRE

    SOUZA FILHO, MIGUEL F. DE; GABRIEL, DALVA; AZEVEDO FILHO, JOAQUIM A. DE

    2001-01-01

    A ocorrência simultânea de Adetus analis (Haldeman), Adetus fuscoapicalis Breuning e Plerodia syrinx (Bates) (Coleoptera: Cerambycidae, Lamiinae), broqueando ramos de chuchuzeiro Sechium edule (Jaqc.) Sw., é relatada. A. analis é sinônima de A. muticus (Thomson), que foi referida por diversos autores no Brasil. A. analis e A. fuscoapicalis são muito semelhantes quanto aos aspectos morfológicos e etológicos. Assim foi realizada uma descrição detalhada e ilustrações de ambas espécies a fim de p...

  6. Thomas Aquinas: On Law, Tyranny and Resistance | Swartz | Acta ...

    African Journals Online (AJOL)

    Thomas Aquinas's notion on law, tyranny and resistance served as a limitation on governmental powers. When those who bear the law command things which exceed the competence of such authority, the subject is free to obey or disobey. The function of the law culminates in two maxims: quantum ad vim coactivam legis ...

  7. Rosmini's metaphysical evidence for the existence of God | Swartz ...

    African Journals Online (AJOL)

    Rosmini is of the opinion that the soul consists of both a bodily (natural) and a godly component. Both components unite in humankind. In Rosmini's cosmology, humankind is viewed in relation to God and the world (cosmos). Cosmology cannot be comprehensively explained without linking ontology and theology, ...

  8. A desalination guide for South African municipal engineers | Swartz ...

    African Journals Online (AJOL)

    The specific objectives of the project were to compile a Guide on the technologies that can be implemented in South Africa to treat saline water to drinking water standards, to identify the pretreatment that is necessary, and to present guidelines on operational, maintenance, management and environmental aspects relevant ...

  9. Fungal endophytes characterization from four species of Diplazium Swartz

    Science.gov (United States)

    Affina-Eliya, A. A.; Noraini, T.; Nazlina, I.; Ruzi, A. R.

    2014-09-01

    Four species on genus Diplazium namely Diplazium tomentosum, D. sorzogonense, D. asperum and D. accedens of Peninsular Malaysia were studied for presence of fungal endophyte. The objective of this study is to characterize fungal endophytes in the rhizome of four Diplazium species. The rhizome was surface sterilized and incubated to isolate fungal endophytes. Characterization of the colonies was performed by macroscopic morphological, microscopic identification, types of hyphae and mycelium, and spore structure. For isolation that produces spores, the structure of conidiophores and conidia were identified. From this study, four fungal have been isolated and determined as Aspergillus sp. (isolates AE 1), Aspergillus fumigatus (isolates AE 2), Aspergillus versicolor (isolates AE 3) and Verticillium sp. (isolates AE 4). The fungal isolates from this study were classified from the same family Moniliaceae.

  10. Uso de plantas medicinais por pessoas com hipertensão

    Directory of Open Access Journals (Sweden)

    Marília Gabrielle Santos Nunes

    2015-01-01

    Full Text Available Objetivo: describir el uso de plantas medicinales en el tratamiento de la hipertensión arterial por personas con hipertensión inscritas en el Programa de Salud Familiar en una ciudad del interior de Pernambuco. Métodos: estudio descriptivo, cuyos datos se obtuvieron a través de guía de entrevistas semiestructuradas aplicada a 172 pacientes. Resultados: el uso de plantas medicinales para el control de la hipertensión fue informado por 39,5%, de los cuales 57,4% utiliza sólo una planta medicinal. Entre las especies citadas predominó el uso de chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusión: plantas medicinales constituyen terapia coadyuvante en el tratamiento de hipertensión, sin embargo requiere monitoreo del manejo y de las especies seleccionadas.

  11. Isolation of Cryptococcus neoformans var. neoformans from bird droppings, fruits and vegetables in Mexico City.

    Science.gov (United States)

    López-Martínez, R; Castañón-Olivares, L R

    1995-01-01

    The presence of Cryptococcus neoformans in various natural sources, such as bird droppings, fruits and vegetables, was investigated. A total of 711 samples were analyzed; C. neoformans var. neoformans was isolated from seven out of 74 bird droppings (9.5%), with parrots as one of the most significant sources. Fruits were positive in 9.5% of the 169 samples studied, specially citrus fruits, particularly grapefruit, in which the highest frequency was found. From the 468 vegetable samples, only 20 were positive (4.2%). It is emphasized that five of the positive vegetables species are autochthonous to Mexico: avocado (Nectandra salicifolia), beet (Beta vulgaris var. quinopodiace), chayote (Sechium edule), stringbean (Cassia sp), and nopal (Opuntia ficus-indica).

  12. Use of medicinal plants by people with hypertension

    Directory of Open Access Journals (Sweden)

    Marília Gabrielle Santos Nunes

    2015-12-01

    Full Text Available Objective: to describe the use of medicinal plants in the treatment of high blood pressure for people with hypertension enrolled in the Family Health Program in a city in Pernambuco State. Methods: a descriptive study, whose data were obtained through semi-structured interview script applied to 172 patients. Results: the use of medicinal plants for hypertension control was reported by 39.5%, of which 57.4% used only one medicinal plant. Among the species cited, there was predominant use of chayote [Sechium edule (Jacq. Sw.-34.8%]. Conclusion: medicinal plants constitute an adjunctive therapy in the treatment of hypertension. However, there is need for monitoring of handling and listed species.

  13. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    OpenAIRE

    Chacón-Villalobos, Alejandro; Molina Angulo, Ruth; Ruíz-González, María José

    2015-01-01

    Este artículo presenta la evaluación de la promoción positiva de los vegetales chayóte (Sechium edule) y brócoli (Brassica olerácea L), al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra), y el agrado sensorial que manifestaba esta población antes de la exposición al Kamishibai y posterior a la misma. Se trabajó con 213 infantes preescolares entre los 4 y ...

  14. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

    Science.gov (United States)

    Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

    2013-09-01

    Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

  15. Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth M. Castro

    2013-09-01

    Full Text Available Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1 was obtained from a chayote (S. edule leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV and Pepper golden mosaic virus (PepGMV were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV infecting chayote in the Western Hemisphere.

  16. Tipificación de Diferentes Estados de Madurez del Fruto de Agraz (Vaccinium meridionale Swartz / Classification of Different Maturity Stages of Agraz (Vaccinium meridionale Swartz Fruit

    Directory of Open Access Journals (Sweden)

    Claudia Marcela Buitrago Guacaneme

    2014-12-01

    Full Text Available Resumen. La planta de agraz o mortiño es un arbusto que perteneceal género Vaccinium, conocido hoy en día por ser fuente de altoscontenidos de antioxidantes en sus frutos, por consiguiente sirvepara inhibir la oxidación de las grasas y es usado como nutracéuticoen la prevención de enfermedades degenerativas en el humano,aspectos que han favorecido sus posibilidades de transformacióny comercialización. En el mercado se observan frutos en diferentesgrados de madurez, en detrimento de la calidad final; en partepor carecer de una caracterización fisicoquímica y de un criteriodefinido para la recolección del fruto. Por lo tanto, se establecieronestados de madurez basados en el color de la epidermis, por mediode los cuales se caracterizó el fruto. En cada estado de madurez,se evaluó el peso promedio, diámetro, pH, sólidos solubles totales(SST, acidez total titulable (ATT, relación de madurez (SST/ATTy porcentaje de germinación de las semillas. De acuerdo al colordel fruto se establecieron seis estados de madurez (0-5, diámetrode 0,8 a 1 cm y peso aproximado de 0,5 g. Los SST presentaronvalores de 7,3 a 13,8 ºBrix con un comportamiento ascendentedurante la maduración, contrario a la tendencia descendente queexhibió la firmeza y el pH con valores de 5,8 a 0,54 y 2,32 a 2,1respectivamente; por su parte la ATT presentó una variación de2,2 a 3. Se observó un incremento en la relación de madurez de2,56 en el estado 0 a 6,17 en el estado 5. / Abstract. Colombian blueberry is a bush from the Vacciniumgenus, known nowadays for the high antioxidants levels of itsfruits known as berries, that is why they are very useful for inhibitthe fat oxidation and also used as a nutraceutic for prevention ofdegenerative diseases in humans, facts which have enhanced thetransformation and marketing possibilities. In the market thereare fruits in different maturity grades, affecting the final qualityobtained, partly because of the lack of a chemical characterizationand a defined criterion for the fruit harvest. Because of that,maturitys grades have been established based on the epidermiscolor, being that a way for characterize the fruit and determinethe harvest patterns. Fruits were taken at each stage of maturityand evaluated the average fruit weight, diameter, pH, total solublesolids (TSS, total titratable acidity (TTA, maturity ratio (TSS/TTAand germination rate of seeds. According to the fruit color wereestablished six maturitys states (0-5, diameter from 0.8 to 1 cmand average weight of 0.5 g. The SST showed values from 7.3 to13.8 °Brix with an ascending behavior during the fruit ripening,contrary to the descending tendency showed by the firmness andthe pH, with values from 5.8 to 0.54 and 2.32 to 2.1 respectively;meanwhile ATT showed a variation, from 2.2 to 3. It was observedan increase in the ripeness ratio from 2.56 in the state 0 to 6.17in the state 5.

  17. On the specific distinctness of Rhomborrhina resplendens Swartz and gigantea Kraatz

    NARCIS (Netherlands)

    Ritsema Cz., C.

    1890-01-01

    In the introduction of his »Uebersicht der Cetoniden der Sunda-Inselu und Molukken” (Troschel’s Archiv für Naturgesckickte. 1871. I. p. 224) Dr. Moknike puts in question the correctness of the statement about the habitat of three Rhomborrhina-specimens (two from Java: Muller, and one from Sumatra:

  18. Koos ühisele edule! = Together towards success / Jüri Järviste

    Index Scriptorium Estoniae

    Järviste, Jüri

    2004-01-01

    Autori hinnangul vaid ettevõtjate endi aktiivne suhtumine ettevõtlust puudutavatesse küsimustesse ja probleemidesse tagab nende kiirema lahendamise. EVEA kui väike- ja keskmise suurusega ettevõtteid ühendav organisatsioon aitab ühenduse liikmetel olla teadlikum oma õigustest ja võimalustest

  19. Applicability Of A Semi-Automated Clinical Chemistry Analyzer In Determining The Antioxidant Concentrations Of Selected Plants

    Directory of Open Access Journals (Sweden)

    Allan L. Hilario

    2017-07-01

    Full Text Available Plants are rich sources of antioxidants that are protective against diseases associated to oxidative stress. There is a need for high throughput screening method that should be useful in determining the antioxidant concentration in plants. Such screening method should significantly simplify and speed up most antioxidant assays. This paper aimed at comparing the applicability of a semi-automated clinical chemistry analyzer Pointe Scientific MI USA with the traditional standard curve method and using a Vis spectrophotometer in performing the DPPH assay for antioxidant screening. Samples of crude aqueous leaf extract of kulitis Amaranthus viridis Linn and chayote Sechium edule Linn were screened for the Total Antioxidant Concentration TAC using the two methods. Results presented in mean SD amp956gdl were compared using unpaired Students t-test P0.05. All runs were done in triplicates. The mean TAC of A. viridis was 646.0 45.5 amp956gdl using the clinical chemistry analyzer and 581.9 19.4 amp956gdl using the standard curve-spectrophotometer. On the other hand the mean TAC of S. edule was 660.2 35.9 amp956gdl using the semi-automated clinical chemistry analyzer and 672.3 20.9 amp956gdl using the spectrophotometer. No significant differences were observed between the readings of the two methods for A. viridis P0.05 and S. edible P0.05. This implies that the clinical chemistry analyzer can be an alternative method in conducting the DPPH assay to determine the TAC in plants. This study presented the applicability of a semi-automated clinical chemistry analyzer in performing the DPPH assay. Further validation can be conducted by performing other antioxidant assays using this equipment.

  20. Population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi

    Directory of Open Access Journals (Sweden)

    RIANI HARDININGSIH

    2004-01-01

    Full Text Available An experiment was conducted in order to know the population of bacteria from soil in Tudu-Aog village, Passi district, Bolaang Mongondow, North Sulawesi, the purpose of the research was to study the population of bacteria from soil. Fourthy six soil samples were taken from two location, namelyTudu-Aog village and Bugis mountain. Isolation was done by dilution methods on YEMA medium (for Rhizobium bacteria, Winogradsky’s (for Azotobacter bacteria, Pycosvkaya (for Phosphat Solubilizing Bacteria, and selective Difco Pseudomonas (for Pseudomonas bacteria. Incubation at room temperature (27-280C until 15 days, and the enumeration with plate count method. The highest enumeration of Rhizobium bacteria with plant rhizosphere of Alocasia esculenta (27x105 CFU/g soil, Theobroma cacao (29x105 CFU/g soil,and Euphorbia paniculata (26x105 CFU/g soil, Azotobacter bacteria with plant rhizosphere of Lycopersicum esculantum (38x105 CFU/g soil, Eugenia aromaticum (43x105 CFU/g soil, Andropogon sp. (34x105 CFU/g soil, Phosphat Solubilizing bacteria with plant rhizosphere of Sechium edule (27x105 CFU/g soil, Cinnamomum sp. (48x105 CFU/g soil, Cyathea sp. (72x105 CFU/g soil, and Pseudomonas bacteria with plant rhizosphere of Oryza sativa (18x105 CFU/g soil, Vanilla sp. (12x105 CFU/g soil, dan Saurauia sp.(19x105 CFU/g soil.

  1. Antioxidant Activity in Extracts of 27 Indigenous Taiwanese Vegetables

    Directory of Open Access Journals (Sweden)

    Pi-Yu Chao

    2014-05-01

    Full Text Available The objectives of this study were to identify the antioxidants and antioxidant axtivity in 27 of Taiwan’s indigenous vegetables. Lycium chinense (Lc, Lactuca indica (Li, and Perilla ocymoides (Po contained abundant quercetin (Que, while Artemisia lactiflora (Al and Gynura bicolor (Gb were rich in morin and kaempferol, respectively. Additionally, Nymphoides cristata (Nc and Sechium edule (Se-yellow had significantly higher levels of myricetin (Myr than other tested samples. Cyanidin (Cyan and malvidin (Mal were abundant in Gb, Abelmoschus esculentus Moench (Abe, Po, Anisogonium esculentum (Retz. Presl (Ane, Ipomoea batatas (Ib-purple, and Hemerocallis fulva (Hf-bright orange. Relatively high levels of Trolox equivalent antioxidant capacity (TEAC, oxygen radical absorption capacity (ORAC, and 1,1-diphenyl-2-picryl-hydrazyl (DPPH radical scavenger were generated from extracts of Toona sinensis (Ts and Po. Significant and positive correlations between antioxidant activity and polyphenols, anthocyanidins, Que, Myr, and morin were observed, indicating that these phytochemicals were some of the main components responsible for the antioxidant activity of tested plants. The much higher antioxidant activity of Po, Ts, and Ib (purple leaf may be related to their higher Cyan, Que, and polyphenol content.

  2. New xenophytes from La Palma (Canary Islands, Spain, with emphasis on naturalized and (potentially invasive species

    Directory of Open Access Journals (Sweden)

    R. Otto

    2016-07-01

    Full Text Available Many years of field work in La Palma (western Canary Islands yielded a number of interesting new records of non-native vascular plants. Amaranthus blitoides, A. deflexus, Aptenia cordifolia, Argemone ochroleuca, Begonia schmidtiana, Capsella rubella, Cardamine hamiltonii, Centratherum punctatum, Cerastium fontanum subsp. vulgare, Chasmanthe floribunda (widely confused with C. aethiopica and Crocosmia xcrocosmiiflora in Macaronesia, Chenopodium probstii, Commelina latifolia var. latifolia, Dichondra micrantha, Dysphania anthelmintica, Epilobium ciliatum, Erigeron sumatrensis, Erodium neuradifolium, Eucalyptus globulus, Euphorbia hypericifolia, E. maculata, Gamochaeta antillana, Geranium pyrenaicum, Hedychium coronarium, Hypochaeris radicata, Kalanchoe daigremontiana, K. delagoensis, K. xhoughtonii, Kickxia commutata subsp. graeca, K. spuria subsp. integrifolia, Lactuca viminea subsp. ramosissima, Landoltia punctata, Malvastrum coromandelianum subsp. capitatospicatum, Oenothera jamesii, Orobanche nana, Oxalis latifolia, Papaver hybridum, P. setigerum, Pilea microphylla, Podranea ricasoliana, Polygonum arenastrum, Portulaca granulatostellulata, P. nicaraguensis, P. nitida, P. papillatostellulata, Rumex crispus subsp. crispus, R. pulcher subsp. pulcher, R. xpratensis, Sechium edule, Sida spinosa var. angustifolia, Silene nocturna, Solanum abutiloides, S. alatum, S. decipiens, Sonchus tenerrimus, Spergularia marina, Stellaria pallida, Tragopogon porrifolius subsp. australis, Tribulus terrestris and Trifolium repens subsp. repens are naturalized or (potentially invasive xenophytes, reported for the first time from either the Canary Islands or from La Palma. 37 additional, presumably ephemeral taxa are reported for the first time from the Canary Islands, whereas 56 ephemeral taxa are new for La Palma..

  3. Uso do farelo de vagem de algaroba (Prosopis juliflora (Swartz D.C. em dietas para eqüinos Effects of feeding mesquite pod meal (Prosopis juliflora (Swartz D.C. for horses

    Directory of Open Access Journals (Sweden)

    Rosane Barros da Silva Stein

    2005-08-01

    Full Text Available Este trabalho foi conduzido para se avaliar o uso do farelo de vagem de algaroba (FVA em substituição ao milho desintegrado com palha e sabugo (MDPS sobre o consumo de nutrientes em dietas para eqüinos. Foram utilizadas 16 éguas da raça Mangalarga Marchador, com idade variando de 3,5 a 18,4 anos e peso médio de 394,8 kg. No ensaio de digestão, foi utilizado o método da coleta total de fezes e foram estimados os coeficientes de digestibilidade aparente da matéria seca (CDMS, matéria orgânica (CDMO, proteína bruta (CDPB, fibra em detergente neutro (CDFDN, hemicelulose (CDHCEL, fibra em detergente ácido (CDFDA e energia bruta (CDEB. As dietas, isoprotéicas e isocalóricas, foram compostas de feno de coastcross e concentrado na proporção de 60:40. Os níveis de substituição do MDPS pelo FVA foram de 0, 33, 66 e 100%. O delineamento experimental adotado foi em blocos casualizados (idade das éguas, com quatro repetições por tratamento. Não houve efeito dos blocos nas variáveis avaliadas. O consumo de matéria seca não foi afetado pela inclusão do FVA, observando-se valores médios de 1,8% do peso vivo (PV, 7,02 kg MS/dia, 79,84 g MS/kg PV0,75. Os CDMS, CDMO, CDPB e CDHCEL não diferiram entre as dietas experimentais, com valores médios de 49,15, 50,18, 56,89 e 35,43%, respectivamente. Verificou-se efeito linear decrescente no CDFDN e quadrático no CDFDA e CDEB, em função dos níveis crescentes de substituição. De acordo com as equações de regressão, o valor máximo do CDFDA seria obtido com 22,3% de substituição, enquanto os valores do CDFDN e CDEB seriam máximos na dieta sem o FVA. Conclui-se que, apesar da redução no aproveitamento das frações fibrosas das dietas, o FVA pode ser utilizado em dietas para eqüinos.Sixteen mares of Mangalarga Marchador breed, averaging from 3.5 to 18.4 years old and 394.8 kg, were assigned to a randomized blocks (mares age design, with four replicates by treatment, to evaluate the effects of replacing corn cob meal (CCM with mesquite pod meal (MPM on nutrient intake. In the digestion trial, the total feces collection method was used and the coefficients of apparent digestibility of dry matter (CDDM, organic matter (CDOM, crude protein (CDCP, acid detergent fiber (CDADF, neutral detergent fiber (CDNDF, hemicellulose (CDHCEL and gross energy (CDGE were estimated. Diets were formulated to be isonitrogenous and isoenergetic, all containing coastcross hay and concentrate (60:40 ratio. The treatments consisted of increasing replacement levels of CCM with MPM, as follows: 0, 33, 66 and 100%. No effects of mare age on the variables were detected. No significant effect of increasing MPM levels on dry matter intake, with mean values of 1.8% body weight (BW, 7.02 kg DM/day, 79.84 g DM/kg BW0.75, was observed. CDDM, CDOM, CDCP and CDHCEL did not differ among diets and showed the respective mean values of 49.15, 50.18, 56.89, and 35.43%. Linear decreasing effect on CDNDF and quadratic effect on CDADF and CDGE were observed as the dietary levels of MPM increased. According to the regression equations, maximum point of CDADF could be obtained by replacing 22.3% MPM and maximum values of CDNDF and CDGE in the diets without MPM. It was concluded that, despite of decrease on dietary fiber digestibility, mesquite pod meal can be used in horses diets.

  4. Bees (Hymenoptera: Apidae present in the flowers of the balsa wood Ochroma lagopus Swartz, 1788 = Abelhas (Hymenoptera: Apidae associadas às flores do pau-de-balsa Ochroma lagopus Swartz, 1788

    Directory of Open Access Journals (Sweden)

    Carla Regina Guimarães Brighenti

    2010-10-01

    Full Text Available The flower of balsa wood holds about 10 to 15 mL of nectar, which helps attracting pollinating agents, since the genus Ochroma is incapable of self-fertilization. However, a high mortality of bees is observed in these flowers. The present study investigated the frequency and constancy of mortality of the individuals of the familyApidae that fed on nectar from the balsa wood. Data was gathered from June to August 2008, in Lavras – Minas Gerais State, Brazil. In addition, the survival of the Africanized bees that fed on the nectar of this flower was compared to those that fed on 50% aqueous solution of honey. Forty flowers were analyzed, and 949 individuals of the orders Hymenoptera (98.1%, Hemiptera (0.95%, Coleoptera (0.74% and Diptera (0.21% were collected. Most Hymenoptera individuals were bees of the genera Partamona and Trigona (677 individuals, which were considered of constant occurrence. Flowers producing up to 16.7 nectar mL were found. The nectar diet contained 16.44% of total sugar, and resulted in low survival of the bees in laboratory (31.32 . 2.37 hours, compared to a diet of 50% aqueous solution of honey (112.32 .2.03 hours.A flor do pau-de-balsa produz cerca de 10 a 15 mL de néctar, útil na atração de polinizadores, uma vez que o gênero Ochroma é incapaz de fazer autofecundação. É observada intensa mortalidade de abelhas em suas flores. Objetivou-se realizar o levantamento da frequência e constância de mortalidade de indivíduos da família Apidae, sendo os dados levantados no período de junho a agosto de 2008 em Lavras, MinasGerais, Brasil. Além disso, avaliou-se a sobrevivência de abelhas africanizadas alimentadas com o néctar desta flor quando comparados com aquelas alimentadas com solução aquosa de mel a 50%. Foram analisadas 40 flores e coletados 949 indivíduos das Ordens: Hymenoptera (98,1%, Hemiptera (0,95%, Coleoptera (0,74% e Diptera (0,21%. Dentre os himenópteros os mais frequentes foram dos gêneros Partamona e Trigona com 677 indivíduos, sendo estes considerados de incidência constante. Observaram-se flores com até 16,7 mL de néctar. O néctar apresentou 16,44% de açúcares totais e baixa sobrevivência das abelhas em laboratório (31,32 . 2,37h quando comparadas com a dieta à base de mel (112,32 . 2,03h.

  5. COMPORTAMIENTO DEL FRUTO DE AGRAZ (Vaccinium meridionale Swartz COSECHADO EN DIFERENTES ESTADOS DE MADUREZ Y ALMACENADO EN REFRIGERACIÓN BEHAVIOR OF AGRAZ FRUIT (Vaccinium meridionale Swartz HARVESTED IN DIFFERENT MATURITY STAGES AND STORED UNDER REFRIGERATION

    Directory of Open Access Journals (Sweden)

    Martha Cecilia Rincón Soledad

    2012-06-01

    Full Text Available Resumen. El agraz o mortiño es un frutal promisorio, considerado como un alimento funcional por su contenido de antocianinas, antioxidantes y vitaminas; no obstante, es un fruto altamente perecedero que pierde rápidamente su calidad comercial y nutricional. El objetivo fue evaluar el comportamiento de frutos de agraz cosechados en tres estados de madurez y almacenados en condiciones de refrigeración. Se utilizó un diseño completamente al azar con arreglo factorial 3x3, donde el primer factor fue la temperatura de almacenamiento: 1, 8 y 20 °C; el segundo factor correspondió al estado de madurez: 3, 4 y 5, el cual se estableció de acuerdo al color de la epidermis del fruto. Se realizaron mediciones de calidad del fruto. Los resultados indicaron que los frutos almacenados a 8 °C en estado de madurez 3 y 4 conservaron las características de calidad comercial hasta los 45 días y para el estado 5 sólo hasta los 25 días. Mientras que a temperatura ambiente los frutos conservaron su vida útil hasta los 21 días en los diferente estados de madurez evaluados. Los frutos del estado 3 y almacenados a 1 °C tuvieron mayor firmeza y acidez total titulable, un alto contenido de sólidos solubles totales y la menor relación de madurez. Para mantener la calidad del fruto de agraz por largo tiempo, se recomienda refrigerar los frutos, en el estado 3 de madurez, a 1 °C.Abstract. The Ericaceae agraz or mortiño is a promising fruit, is considered as a functional food for its high content of anthocyanins, antioxidants and vitamins. It is a highly perishable fruit that quickly loses its commercial and nutritional quality. The objective was to evaluate the behavior of unripe fruits harvested at three maturity stages and stored under refrigeration. It was used a completely randomized design with 3x3 factorial arrangement, where the first factor was the storage temperature: 1, 8 and 20 °C; the second factor corresponded to maturity: 3, 4 and 5, which was established according to the color of the fruit skin; it was made measurements of fruit quality. The results indicated that the fruits stored at 8 °C in maturity stages 3 and 4 retained characteristics commercial grade to 45 days and only state 5 to 25 days. While the fruit at room temperature retained life to 21 days in different maturity stages evaluated. The state 3 fruits stored at 1 °C had higher firmness and total titratable acidity, high total soluble solids content and lower maturity ratio. To maintain the agraz fruit quality for longer time, it is recommended to harvest at state 3 and then be stored at 1 °C.

  6. Pengaruh Lama Penyimpanan Biji Picung (Pangium edule Reinw. Beku terhadap Aktivitasnya dalam Mengawetkan Ikan Nila (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Novalia Rachmawati

    2011-12-01

    Full Text Available Penelitian dilakukan untuk mengetahui pengaruh lama penyimpanan biji picung beku terhadap kemampuannya dalam mengawetkan ikan. Biji picung cacah disimpan dalam kondisi beku (-18° selama 4 bulan. Setiap bulan biji picung beku diambil dan diaplikasikan pada ikan nila segar dengan perbandingan 3% (b/b dengan dan tanpa penambahan garam 2% (b/b. Ikan nila disimpan pada suhu ruang dan dilakukan pengamatan terhadap parameter mikrobiologi (Angka Lempeng Total dan antibakteri, kimiawi (TVB dan kadar air serta organoleptik. Uji aktivitas antibakteri dari biji picung beku dilakukan terhadap bakteri Eschericia colidan Staphylococcus aureus. Hasil penelitian menunjukkan bahwa berdas arkan parameter mikrobiologi, kimia dan organoleptik, biji picung beku yang disimpan hingga 1 bulan mampu mempertahankan kesegaran ikan hingga penyimpanan hari ke-2. Sedangkan dari hasil uji aktivitas antibakteri, biji pic ung beku dapat menghambat pertumbuhan bakteri E. colidan S. aureusdengan kategori aktivitas sangat kuat.

  7. Additions to the flora of Tenerife (Canary Islands, Spain

    Directory of Open Access Journals (Sweden)

    Verloove, F.

    2011-12-01

    Full Text Available Additions to the flora of Tenerife (Canary Islands, Spain.- Recent fieldwork in Tenerife, especially in September 2010, yielded several interesting new records of non-native vascular plants. Bothriochloa ischaemum var. songarica, “Asian” Cardamine flexuosa, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla and Solanum abutiloides are reported for the first time from the Canary Islands, while Eragrostis barrelieri var. pygmaea, Ficus microcarpa, Ipomoea purpurea, Leucaena leucocephala subsp. glabrata, Sechium edule, Tradescantia zebrina and Turnera ulmifolia are new to the flora of the island of Tenerife. New records of Acacia cyclops, Atriplex suberecta, Heliotropium curassavicum, Paspalum dilatatum, P. notatum, Pluchea ovalis, Pulicaria paludosa, Sclerophylax spinescens and Solanum villosum subsp. miniatum confirm their recent expansion on the island of Tenerife. New records are provided for the recently described Sporobolus copei . Finally, Paspalum vaginatum (hitherto possibly confused with P. distichum and Potentilla indica are confirmed from the island of Tenerife.

    Adiciones para la flora de Tenerife (Islas Canarias, España.- Algunos recientes trabajos de campo en Tenerife, especialmente en Septiembre de 2010, trajeron consigo varias nuevas e interesantes adiciones de plantas vasculares no autóctonas. Bothriochloa ischaemum var. songarica, Cardamine flexuosa “Asiática”, Cestrum parqui, Digitaria violascens, Ficus lyrata, Ficus rubiginosa, Hoffmannseggia glauca, Hyparrhenia rufa subsp. altissima, Jacaranda mimosifolia, Merremia tuberosa, Passiflora morifolia, Phytolacca dioica, Schefflera actinophylla y

  8. Pulp fruit added to culture medium for in vitro orchid developmentPolpa de frutos adicionada ao meio de cultivo no crescimento in vitro de orquídea

    Directory of Open Access Journals (Sweden)

    Gilberto Rostirolla Batista de Souza

    2013-06-01

    Full Text Available As an additive in in vitro culture media, fruits have a great potential for facilitating economical orchid production because of lower technology requirements and the ease of obtaining raw materials to formulate culture media. We studied the in vitro growth of Cattleya bicolor Lindl. grown in a simplified culture medium supplemented with different kinds of fruit pulp. The experimental design was completely randomised, with eight seedlings per replication and ten replications per treatment, for a total of 80 seedlings per treatment. The culture medium was made using 150 g L -1 of pulp (without peel or seed from the following fruits: ripe Santa Cruz tomatoes (Solanum lycopersicum L., dwarf bananas (Musa cavendishii L. of intermediate ripeness, light green chayote (Sechium edule (Jacq. Sw, ripe papaya (Carica papaya L. or green coconut (Cocos nucifera L..The treatment control was MS 50 %. The treatments and the control were kept in a growth chamber for seven months before evaluating seedling survival percentage, shoot height, number of leaves, rooting percentage, root number, root length and dry masses of shoot and roots. The highest percentages of seedling survival were obtained using MS 50 %, banana and coconut medium. The seedling survival and rooting percentages illustrate that it is possible to emphasise the culture medium MS 50% and the culture medium supplemented with coconut on the most traditional culture medium with banana or tomato pulp. For the in vitro development of Cattleya bicolor Lindl., a simplified culture medium supplemented with coconut pulp is the most suitable for use as an alternative to MS 50%. A simplified culture medium supplemented with papaya pulp is not recommended for the in vitro development of Cattleya bicolor Lindl. Os frutos apresentam potencial para serem utilizados na elaboração de meios de cultivo para facilitar a produção de orquídeas em pequenas propriedades, contribuindo para a rentabilidade do cultivo

  9. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    Directory of Open Access Journals (Sweden)

    Alejandro Chacón-Villalobos

    2015-01-01

    Full Text Available Este artículo presenta la evaluación de la promoción positiva de los vegetales chayote (Sechium edule y brócoli (Brassica oleracea L, al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra, y el agrado sensorial que manifestaba esta población antes de la exposición al Kamishibai y posterior a la misma. Se trabajó con 213 infantes preescolares entre los 4 y 6 años de edad. Las evaluaciones de actitud se efectuaron por medio de una entrevista, mientras que el agrado se estudió por medio de un panel sensorial. La exposición al Kamishibai consistió en 10 intervenciones en la forma de sesiones de cuentos, donde se dividieron los infantes en cuatro grupos según género del menor y género del personaje del cuento que promocionó el vegetal. Todas las actividades se llevaron a cabo en un espacio de juego acondicionado para tal efecto en el salón de clases. A partir de los resultados obtenidos, puede argumentarse que el uso del Kamishibai como técnica de animación a la lectura incrementó significativamente la opinión positiva y el agrado inicial hacia los vegetales en los menores (p<0,05, indiferentemente de su género y del género de las figuras que efectuaron la promoción.

  10. Promoción positiva de vegetales en preescolares costarricenses empleando el Kamishibai

    Directory of Open Access Journals (Sweden)

    Alejandro Chacón-Villalobos

    2015-07-01

    Full Text Available Este artículo presenta la evaluación de la promoción positiva de los vegetales chayote (Sechium edule y brócoli (Brassica oleracea L, al emplear la estrategia de animación a la lectura conocida como Kamishibai. Durante el año 2012 en San José, se estudió la actitud infantil hacia los vegetales (positiva, negativa o neutra, y el agrado sensorial que sentía esta población antes de la exposición al Kamishibai y, posterior a la misma; se trabajó conn 213 infantes preescolares entre los 4 y 6 años de edad. Las evaluaciones de actitud se efectuaron por medio de una entrevista, mientras que el agrado se estudió por medio de un panel sensorial. La exposición al Kamishibai consistió en 10 intervenciones en la forma de sesiones de cuentos, donde se dividieron los infantes en cuatro grupos según género del menor y género del personaje del cuento que promocionó el vegetal. Todas las actividades se llevaron a cabo en un espacio de juego acondicionado para tal efecto en el salón de clases. A partir de los resultados obtenidos, puede argumentarse que el uso de la técnica del Kamishibai como técnica de animación a la lectura incrementó significativamente la opinión positiva y el agrado inicial hacia los vegetales en estas personas menores (p<0,05, indiferentemente de su género y del género de las figuras que efectuaron la promoción.

  11. Pathogenicity for onion and genetic diversity of isolates of the pathogenic fungus Colletotrichum gloeosporioides (Phyllachoraceae) from the State of Pernambuco, Brazil.

    Science.gov (United States)

    Nova, M X Vila; Borges, L R; de Sousa, A C B; Brasileiro, B T R V; Lima, E A L A; da Costa, A F; de Oliveira, N T

    2011-02-22

    Onion anthracnose, caused by Colletotrichum gloeosporioides, is one of the main diseases of onions in the State of Pernambuco. We examined the pathogenicity of 15 C. gloeosporioides strains and analyzed their genetic variability using RAPDs and internal transcribed spacers (ITS) of the rDNA region. Ten of the strains were obtained from substrates and hosts other than onion, including chayote (Sechium edule), guava (Psidium guajava), pomegranate (Punica granatum), water from the Capibaribe River, maracock (Passiflora sp), coconut (Cocus nucifera), surinam cherry (Eugenia uniflora), and marine soil; five isolates came from onions collected from four different regions of the State of Pernambuco and one region of the State of Amazonas. Pathogenicity tests were carried out using onion leaves and bulbs. All strains were capable of causing disease in leaves, causing a variable degree of lesions on the leaves; four strains caused the most severe damage. In the onion bulb tests, only three of the above strains caused lesions. Seven primers of arbitrary sequences were used in the RAPD analysis, generating polymorphic bands that allowed the separation of the strains into three distinct groups. The amplification products generated with the primers ITS1 and ITS4 also showed polymorphism when digested with three restriction enzymes, DraI, HaeIII and MspI. Only the latter two demonstrated genetic variations among the strains. These two types of molecular markers were able to differentiate the strain from the State of Amazonas from those of the State of Pernambuco. However, there was no relationship between groups of strains, based on molecular markers, and degree of pathogenicity for onion leaves and bulbs.

  12. Aquatic macroinvertebrates associated with Eichhornia azurea (Swartz Kunth and relationships with abiotic factors in marginal lentic ecosystems (São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    CV. Silva

    Full Text Available Marginal lakes are characterised by their having high biological diversity due to the presence of aquatic macrophytes in their coastal zones, providing habitats for refuge and food for animal community members. Among the fauna components associated with macrophytes, aquatic macroinvertebrates are important because they are an energy source for predators and fish. In six lakes and two different seasons (March and August 2009, the ecological attributes of aquatic macroinvertebrate community associated with Eichhornia azurea were compared and the controlling environmental factors were identified. Since the attributes of macroinvertebrate community are strictly associated with abiotic variables of each distinct habitat, our hypothesis was that each site associated with the same floating aquatic macrophyte (E. azurea should have a typical composition and density of organisms. We identified 50 taxa of macroinvertebrates, with greater taxa richness for aquatic insects (37 taxa divided into eight orders; the order Diptera being the most abundant in the two study periods. On the other hand, higher values of total taxa richness were recorded in August. Dissolved oxygen and pH presented the greatest number of significant positive correlations with the different taxa. The animals most frequently collected in the six lakes in March and August 2009 were Hirudinea, Oligochaeta, Hydrachnidae, Conchostraca, Ostracoda, Noteridae, Ceratopogonidae, Chironomidae, Culicidae, Caenidae, Pleidae, Aeshnidae, Libellulidae, Coenagrionidae and Nematoda. Only densities of Trichoptera, Ostracoda and Conchostraca presented the highest significant differences between lakes in both study periods and considering the composition of macroinvertebrates no significant differences were registered for macroinvertebrate composition.

  13. Liberação de componentes do extrato de Casearia sylvestris Swartz empregando membranas de látex natural como suporte

    Directory of Open Access Journals (Sweden)

    Alberto Trecco

    2014-01-01

    Full Text Available A membrana de látex natural (NRL – Natural Rubber Latex, manipulada a partir do látex extraído da seringueira Hevea brasiliensis, tem apresentado grande potencial de aplicação no campo da biomedicina e dos biomateriais. Graças a sua biocompatibilidade e baixa taxa de rejeição, ela tem sido utilizada para próteses e enxertos, atuando como estimulante da angiogênese, adesão celular e barreira física a agentes infecciosos. Além dessas aplicações, as membranas são utilizadas como matriz de sistemas de liberação para avaliar o comportamento da liberação de fármacos e extratos de origem vegetal que apresentam propriedades medicinais. O sistema extrato-membrana tem como objeto de estudo uma nova abordagem dessas substâncias no tratamento de feridas visando à cicatrização e regeneração do tecido envolvido. Casearia sylvestris, conhecida popularmente como guaçatonga, pertence à família Salicaceae, conhecida na medicina popular pelos seus efeitos antiulcerogênicos, cicatrizantes, antiofídicos, anti-inflamatórios e antissépticos, propriedades já comprovadas por estudos. Trabalhos recentes demonstraram que a liberação controlada de fármacos e extratos utilizando membranas de látex natural é uma alternativa interessante e promissora para aplicações biomédicas. Assim, o objetivo deste projeto foi estudar a liberação do extrato de Casearia sylvestris incorporado à membrana de látex em soluções com diferentes valores de pH, com o propósito de estudar seu comportamento e sua liberação de forma controlada. A taxa de liberação do extrato do sistema extrato-membrana foi monitorada e analisada utilizando-se o método de espectroscopia ótica (UV. O pH básico age desestabilizando a membrana indicando que o polímero possui a habilidade de proteger o extrato de ser liberado em valores de pH ácidos, direcionando sua aplicação para o sítio de melhor absorção. Além disso, a liberação segue uma função bi-exponencial y(t=y0 +A1 e−t/τ1+A2 e−t/τ2, sendo que uma parte do extrato se encontra na superfície da membrana enquanto outra parte se encontra dentro da membrana (bulk. O extrato foi agregado à membrana e liberado por até 10 dias, sendo o pH=7,6 o que mais influenciou na liberação do extrato pela membrana. Este resultado é interessante, pois o pH da solução além de modificar o perfil de liberação, modifica o tempo de saturação tornando possível produzir uma membrana para cada aplicação, ou seja, uma membrana para o estômago, outra para a pele, e assim, por diante, pois cada órgão possui um pH característico.

  14. Efeito do extrato acetato de etila de Trichilia pallida Swartz (Meliaceae no desenvolvimento e sobrevivência da lagarta-do-cartucho

    Directory of Open Access Journals (Sweden)

    ROEL ANTONIA RAILDA

    2000-01-01

    Full Text Available O efeito de diferentes concentrações (massa/volume do extrato acetato de etila de folhas e ramos de Trichilia pallida, em relação à lagarta-do-cartucho Spodoptera frugiperda (J.E. Smith, foi avaliado em condições de laboratório. As folhas de milho foram imersas em diferentes concentrações (0,0001%; 0,0008%; 0,006%; 0,05%; 0,4% e 3% desse extrato e oferecidas a lagartas recém-eclodidas e com dez dias de idade, avaliando-se a duração e viabilidade das fases larval e pupal e a massa de pupas. A concentração letal 50 (CL50 estimada para lagartas com sete dias de idade foi de 0,048%. Verificou-se que o extrato causou mortalidade larval de 100% (em concentração igual ou superior a 0,05%, afetou a sobrevivência e o desenvolvimento do inseto (na concentração de 0,006% e não provocou qualquer efeito no mesmo, em concentração igual ou inferior a 0,0008%. Lagartas alimentadas desde a eclosão foram mais afetadas do que as alimentadas a partir dos dez dias.

  15. Liberação de componentes do extrato de Casearia sylvestris Swartz empregando membranas de látex natural como suporte

    OpenAIRE

    Trecco, Alberto [UNESP; Borges, Felipe Azevedo [UNESP; Perri, Elaíse G. [UNESP; Santos, André Gonzaga dos [UNESP; Chin, Chung Man [UNESP; Herculano, Rondinelli Donizetti [UNESP

    2014-01-01

    Natural Rubber Latex (NRL) membrane, made from latex extracted from the rubber tree Hevea brasiliensis, has shown great potential for use in the biomedicine and biomaterials area. Thanks to its biocompatibility and low rejection rate, it has been used for implants and grafts, acting as a stimulant of angiogenesis and cell adhesion and as a barrier against infectious agents. Besides these applications, the membranes are used as model release systems, to assess the release behavior of drugs and...

  16. Liberação de componentes do extrato de Casearia sylvestris Swartz empregando membranas de látex natural como suporte

    OpenAIRE

    Alberto Trecco; Felipe Azevedo Borges; Elaise G. Pierri; André Gonzaga dos Santos; Chung Man Chin; Rondinelli Donizetti Herculano

    2014-01-01

    A membrana de látex natural (NRL – Natural Rubber Latex), manipulada a partir do látex extraído da seringueira Hevea brasiliensis, tem apresentado grande potencial de aplicação no campo da biomedicina e dos biomateriais. Graças a sua biocompatibilidade e baixa taxa de rejeição, ela tem sido utilizada para próteses e enxertos, atuando como estimulante da angiogênese, adesão celular e barreira física a agentes infecciosos. Além dessas aplicações, as membranas são utiliza...

  17. Identification of stress-induced genes from the drought-tolerant plant Prosopis juliflora (Swartz) DC. through analysis of expressed sequence tags.

    Science.gov (United States)

    George, Suja; Venkataraman, Gayatri; Parida, Ajay

    2007-05-01

    Abiotic stresses such as cold, salinity, drought, wounding, and heavy metal contamination adversely affect crop productivity throughout the world. Prosopis juliflora is a phreatophyte that can tolerate severe adverse environmental conditions such as drought, salinity, and heavy metal contamination. As a first step towards the characterization of genes that contribute to combating abiotic stress, construction and analysis of a cDNA library of P. juliflora genes is reported here. Random expressed sequence tag (EST) sequencing of 1750 clones produced 1467 high-quality reads. These clones were classified into functional categories, and BLAST comparisons revealed that 114 clones were homologous to genes implicated in stress response(s) and included heat shock proteins, metallothioneins, lipid transfer proteins, and late embryogenesis abundant proteins. Of the ESTs analyzed, 26% showed homology to previously uncharacterized genes in the databases. Fifty-two clones from this category were selected for reverse Northern analysis: 21 were shown to be upregulated and 16 downregulated. The results obtained by reverse Northern analysis were confirmed by Northern analysis. Clustering of the 1467 ESTs produced a total of 295 contigs encompassing 790 ESTs, resulting in a 54.2% redundancy. Two of the abundant genes coding for a nonspecific lipid transfer protein and late embryogenesis abundant protein were sequenced completely. Northern analysis (after polyethylene glycol stress) of the 2 genes was carried out. The implications of the analyzed genes in abiotic stress tolerance are also discussed.

  18. Digenean trematode species in the cockle Cerastodema edule: identification key and distribution along the north-eastern Atlantic shoreline

    DEFF Research Database (Denmark)

    Montaudouin, Xavier De; Thieltges, David W.; Gam, Mériame

    2009-01-01

    host. The remaining eleven species have cockles as their second intermediate host. Water birds and fish are the definitive hosts to twelve and four species, respectively. Cockles are infected with digeneans along the latitudinal gradient from southern Morocco to the western region of the Barents Sea...

  19. Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas, Mytilus edulis and Cerastoderma edule, in relation to food competition

    NARCIS (Netherlands)

    Troost, K.; Stamhuis, E.J.; van Duren, L.A; Wolff, W.J.

    Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

  20. Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas Mytilus edulis and Cerastoderma edule , in relation to food competition

    NARCIS (Netherlands)

    Troost, K.; Stamhuis, E.J.; Duren, L.A.; Wolff, W.

    2009-01-01

    Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

  1. Desenvolvimento de Spodoptera frugiperda (J. E. Smith em genótipos de milho tratados com extrato acetato de etila de Trichilia pallida (Swartz Development of Spodoptera frugiperda (J. E. Smith on corn genotypes treated with ethyl acetade extract from Trichilia pallida (Swartz

    Directory of Open Access Journals (Sweden)

    Antonia Railda Roel

    1999-07-01

    Full Text Available Avaliou-se o efeito do extrato acetato de etila obtido de folhas e ramos de Trichillia pallida, (a 0,001%, sobre o desenvolvimento de Spodoptera frugiperda alimentada com folhas de quatro genótipos de milho, um suscetível, 'Piranão', e três resistentes, 'CMS 14C', 'Zapalote Chico', 'ESALQ-PB-4', à referida praga. Os parâmetros biológicos avaliados foram peso, duração e viabilidade das fases larval e pupal. Verificou-se que o extrato provocou alongamento da fase larval e redução dos pesos larval e pupal e que os genótipos resistentes não confirmaram esse comportamento pois quando comparados ao genótipo suscetível, apenas reduziram o peso pupal. Não houve interação significativa entre os fatores genótipo e extrato.The effect of the ethyl acetate extract of leaves and branches of Trichilia pallida was evaluated (at 0.001% on larvae of S. frugiperda, fed on leaves of the corn genotypes 'Zapalote Chico', 'CMS 14C' and 'ESALQ-PB-4', considered resistant to this pest, and the susceptible genotype 'Piranão'. The parameters evaluated were length, weight and viability of larval and pupal stages. The extract increased the length of the larval stage, and larval and pupal weight, while resistant genotypes only reduced the pupal weight, did however not confirm the resistant behaviour. There was no interaction between genotype and extract.

  2. Estudio de los síntomas asociados a la pérdida de color del chayote

    Directory of Open Access Journals (Sweden)

    J. Cadena-Iñiguez

    2005-01-01

    Full Text Available Bajo condiciones de invernadero, se reprodujeron los síntomas de deficiencias nutrimentales iniciales asociadas a la pérdida de vigor de planta y color del fruto de Sechium edule (Jacq. Sw. llamado chayote blanco, para evaluar la respuesta de adición de nutrimentos e inoculación de microsimbiontes. Se utilizó suelo de Actopan, Veracruz, México, separándolo en capas a 0-30, 30-60, 60-90 cm y mezcla del perfil completo para determinar su fertilidad. Se aplicaron 8.29 g de (NH42SO4, 1.0 g de Ca3 (PO42, 4.4 g de K2SO4, 1.15 g de FeSO4, MnSO4 y ZnSO4, y 0.75 g de azufre, 40 g de Glomus intraradices (MA y Azospirillum brasilense por cada 30 litros de capa de suelo. Se evaluó altura de planta, clorofila y biomasa total, asimilación de CO2 y análisis con rayos-X de cortes del cuarto entrenudo inferior a la yema apical del tallo principal. El suelo evaluado presentó compuestos solubles de Cl-, SO4 2-, HCO3 -, Na+ y pH de hasta 7.9, además de 5.6, 50.3 y 4.7 veces más P, Ca2+ y Mg2+ que los valores consignados para la especie. En suelo de la capa 0-30 cm, las plantas presentaron mayor crecimiento y menor en 30-60, 60-90 cm y la mezcla. Los nutrimentos combinados con MA, así como con MA y A. brasilense fueron estadísticamente significativos. Las plantas testigo mostraron cristales formados por P, Ca, S, Si, Na y Mg obstruyendo los vasos del xilema de tallo. La evidencia experimental mostró que los síntomas iniciales asociados a chayote blanco, se deben en gran medida a deficiencias nutrimentales, siendo más evidentes en capas de suelo inferiores a 0-30 cm

  3. Estudo da concordância das citações de uso e importância das espécies e famílias utilizadas como medicinais pela comunidade do bairro Ponta Grossa, Porto Alegre, RS, Brasil

    Directory of Open Access Journals (Sweden)

    Giovana Secretti Vendruscolo

    2006-06-01

    Full Text Available Ferramentas para quantificar dados etnobotânicos estão sendo usadas como complementares aos levantamentos sobre a utilização de plantas por populações. Neste trabalho são utilizadas técnicas para avaliar a concordância das citações de uso e a importância das espécies e famílias para as 51 pessoas entrevistadas no bairro Ponta Grossa, Porto Alegre, Rio Grande do Sul. Para tal, foram utilizados os cálculos de Valor de Uso (UV e a porcentagem corrigida de Concordância quanto aos Usos Principais (CUPc para as 142 espécies mencionadas no levantamento. As espécies Aloe arborescens Mill., Citrus × aurantium L., Achyrocline satureioides (Lam. DC., Foeniculum vulgare Mill, Eugenia uniflora L., Cunila microcephala Benth., Citrus limon (L. Osveck, Plectranthus barbatus Andrews, Cymbopogon citratus (DC. Stapf, Psidium guajava L., Artemisia absinthium L., Ocimum basilicum L., Plantago tomentosa Lam., Rosmarinus officinalis L., Persea americana Mill., Aloysia citrodora Palau, Sambucus australis Cham. & Schltdl., Cuphea carthagenensis (Jacq. J.F. Macbr., Petroselinum crispum (Mill. Nyman ex A.W. Hill, Ocimum selloi Benth. e Tanacetum vulgare L., nesta ordem de Valor de Uso, foram consideradas como as mais importantes para a população estudada. As famílias mais importantes foram Asphodelaceae, Caprifoliaceae, Rutaceae e Lythraceae. Para o cálculo da porcentagem a corrigida de Concordância quanto aos Usos Principais (CUPc foram consideradas como espécies principais as que apresentaram valores acima de 24%: Eugenia uniflora, Achyrocline satureioides, Psidium guajava, Cunila microcephala, Plectranthus barbatus, Citrus × aurantium, Citrus limon, Cymbopogon citratus, Punica granatum L., Sechium edule (Jacq. Sw., Sphagneticola trilobata (L. Pruski, Aloysia citrodora, Foeniculum vulgare, Plectranthus neochilus Schltr., Artemisia absinthium, Lippia alba (Mill. N.E. Br., Mikania laevigata Sch. Bip ex Baker, Aloe arborescens e Petroselinum

  4. Aplicación de Tecnología de Barreras para la Conservación de Mezclas de Vegetales Mínimamente Procesados / Application of Barrier Technology for the Conservation of Minimally Processed Vegetables Mixtures

    Directory of Open Access Journals (Sweden)

    Alejandro Escobar Hernández

    2014-03-01

    Full Text Available Los vegetales son componentes esenciales de la dietahumana y su procesamiento trae como consecuencia el rápido deterioro ocasionado por el aumento de las reacciones metabólicas, esto hace necesario que se utilicen tecnologías emergentes de conservación. En este trabajo se estudió el efecto de la tecnología de barreras (desinfección, tratamiento térmico, recubrimiento comestible, atmósfera modificada y refrigeración sobre la vida útil de una mezcla de vegetales mínimamente procesados compuesta por brócoli (Brassica oleracea var. itálica, coliflor (Brassica oleracea var. botrytis, zucchini (Cucurbita pepo L., chayote (Sechium edule, apio (Apium graveolens y zanahoria (Daucus carota. Las barreras fueron aplicadas a las hortalizas para luego ser envasadas en dos tipos de bandejas (empaque en atmósfera modificada y empaque en bandeja sello plus. Los vegetales se almacenaron durante 12 días en refrigeración (4 °C y 95% HR, se llevaron a cabo análisis microbiológicos, físicoquímicos y sensoriales, y un estudio de vida útil. Los resultados mostraron que el proceso de desinfección con NaClO 100 ppm y el tratamiento térmico de 60 °C durante 2 min, tuvieron efecto en la reducción de la población microbiana para el día cero de evaluación. La calidad general se conservó para los 12 días dealmacenamiento, en la zanahoria, chayote, coliflor y apio. Laevaluación fisicoquímica presentó diferencias estadísticamente significativas de los parámetros evaluados con respecto al tiempo de almacenamiento. El estudio de vida útil arrojó tiempos de 7 y 5 días para la mezcla de vegetales empacada en bandeja sello plus en atmósfera modificada, respectivamente. La combinación debarreras se muestra como alternativa viable en la conservación de mezclas de vegetales mínimamente procesados. /  Vegetables are essential components of the human diet. However, rapid deterioration of vegetables occurs after

  5. Aplicación de tratamiento térmico, recubrimiento comestible y baño químico como tratamientos poscosecha para la conservación de hortalizas mínimamente procesadas

    Directory of Open Access Journals (Sweden)

    Alejandro Escobar Hernández

    2014-01-01

    Full Text Available El consumo creciente ha estimulado el desarrollo de los vegetales cuarta gama o mínimamente procesados. Actualmente, se promueve el uso de tecnologías aplicadas a estos productos que les brinden mayor duración y garanticen la reducción de pérdidas poscosecha. En esta investigación se evaluó el efecto de tres de estas tecnologías poscosecha sobre la intensidad de la respiración y la calidad sensorial general de las hortalizas mínimamente procesadas: brócoli (Brassica oleracea var. Itálica, coliflor (Brassica oleracea var. Botrytis, zucchini (Cucurbita pepo L., apio (Apium graveolens, zanahoria (Daucus carota y chayote (Sechium edule. Para el recubrimiento comestible se utilizó pectina de bajo metoxilo (2%, cera carnauba (1%, glicerol (1.5% y ácido ascórbico (0.05%. El tratamiento térmico se hizo a 60 °C durante 2 min, con adición de ácido ascórbico (0.25%, ácido cítrico (0.5% y cloruro de calcio (0.025%. El baño químico se realizó con una solución de ácido cítrico (0.5%, ácido ascórbico (0.05% y cloruro de calcio (0.05%. La tasa de producción de CO2 se midió por el método estático, monitoreando la composición de los gases del espacio de cabeza durante 24 h a 8 °C y humedad relativa de 90%. La evaluación sensorial de color, aroma, crujencia y sabor objetable fueron las características organolépticas tomadas en cuenta para evaluar la calidad general de cada vegetal, la cual fue realizada con un panel de siete jueces previamente entrenados. Se utilizó un diseño de bloques completos al azar, siendo los bloques cada uno de los vegetales y las variables de respuesta la tasa de respiración y la calidad sensorial general. Se encontró que el tratamiento térmico y el recubrimiento comestible permitieron que los vegetales conservaran la calidad sensorial. El análisis estadístico no mostró diferencias significativas respecto al control (P > 0.05. La celeridad de la respiración disminuyó en el apio, el br

  6. 78 FR 70191 - Post-Employment Conflict of Interest Regulations; Exempted Senior Employee Positions; Withdrawal...

    Science.gov (United States)

    2013-11-25

    ...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0...: Christopher J. Swartz, Assistant Counsel, Ethics Law & Policy Branch, Office of Government Ethics; telephone...

  7. 78 FR 24785 - Public Hearing

    Science.gov (United States)

    2013-04-26

    ... Spring, Logan Branch Watershed), Spring Township, Centre County, Pa. Application for surface water...: April 19, 2013. Paul O. Swartz, Executive Director. [FR Doc. 2013-09887 Filed 4-25-13; 8:45 am] BILLING...

  8. Genetic structure of Pseudococcus microcirculus (Hemiptera ...

    Indian Academy of Sciences (India)

    J. A. ZETTLER

    Life Technologies, Carlsbad, USA) to ... N, genetic diversity estimates including sample size; Ar, allelic richness; pAr, private allelic richness; HE, expected heterozygosity; HO, .... Harrington D. 1985 Burton–Swartz cypress company of Florida.

  9. Baltic leaders who returned from West to East

    Index Scriptorium Estoniae

    2006-01-01

    Artiklis tutvustatakse kolme Balti riigi presidentide sarnast minevikku eksiilis ning nenditakse, et varasem demokraatlikus riigis elamise kogemus on kindlasti kaasa aidanud Eesti, Läti ja Leedu majanduslikule ning välispoliitilisele edule

  10. Выборы как предвестник перемен / Айн Тоотс

    Index Scriptorium Estoniae

    Тоотс, Айн, 1944-

    2009-01-01

    Kohalike omavalitsuste volikogude valimiste tulemustest. Endise Tallinna linnapea Hardo Aasmäe sõnul võib Keskerakonna võit kohalikel valimistel sillutada teed Edgar Savisaare edule 2011. a. presidendivalimistel

  11. Author Details

    African Journals Online (AJOL)

    Swartz, Sharlene. Vol 9, No 1 (2010) - Articles Bereavement, silence and culture within a peer-led HIV/AIDS-prevention strategy for vulnerable children in South Africa Abstract · Vol 13, No 1 (2014) - Articles 'Something for something': The importance of talking about transactional sex with youth in South Africa using a ...

  12. African Journal of AIDS Research - Vol 9, No 1 (2010)

    African Journals Online (AJOL)

    Bereavement, silence and culture within a peer-led HIV/AIDS-prevention strategy for vulnerable children in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ingrid Van der Heijden, Sharlene Swartz. http://dx.doi.org/10.2989/16085906.2010.484563 ...

  13. 'Cascading participation' and the role of teachers in a collaborative ...

    African Journals Online (AJOL)

    'Cascading participation' and the role of teachers in a collaborative HIV and Aids curriculum development project. D Scott, A Cooper, S Swartz. Abstract. This paper presents findings of four Grade 6 teachers' involvement as facilitators of a participatory action research (PAR) project conducted in three South African primary ...

  14. Internal Drivers of External Flexibility: A Detailed Analysis

    Science.gov (United States)

    2007-08-14

    and Stephen Swartz for giving me the opportunity to obtain my Ph. D.. Dave Ulrich, Basilio Perez, Kevin James, and Pete Cabrera were my first USAF...Arndt, and Scott Grawe , I couldn’t have made it without you. Elten Briggs was the “senior” doctoral student when I arrived and when he graduated I saw

  15. Book Review Counselling and Coping by Kerry Gibson, Leslie ...

    African Journals Online (AJOL)

    Book Review Counselling and Coping by Kerry Gibson, Leslie Swartz and Rob Sandenbergh. Alison Moultrie, Alison Moultrie. Abstract. 2002, Oxford University Press ISBN 0–19–571868 2. Journal of Child and. Adolescent Mental Health 2003, 15(1): 55. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL ...

  16. Efficacy of Aqueous and Methanol Extracts of Some Medicinal Plants for Potential Antibacterial Activity

    OpenAIRE

    PAREKH, Jigna; JADEJA, Darshana; CHANDA, Sumitra

    2014-01-01

    Twelve medicinal plants were screened, namely Abrus precatorius L., Caesalpinia pulcherrima Swartz., Cardiospermum halicacabum L., Casuarina equisetifolia L., Cynodon dactylon (L.) Pers., Delonix regia L., Euphorbia hirta L., Euphorbia tirucalli L., Ficus benghalensis L., Gmelina asiatica L., Santalum album L., and Tecomella undulata (Sm.) Seem, for potential antibacterial activity against 5 medically important bacterial strains, namely Bacillus subtilis ATCC6633, Staphylococcus epidermidis A...

  17. Author Details

    African Journals Online (AJOL)

    Swartz, E. Vol 54, No 2 (2012) - Articles Emotional intelligence and locus of control of adult patients with breast cancer receiving treatment. Abstract PDF. ISSN: 2078-6204. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

  18. RECONSTRUCTING DIET COMPOSITION ON THE BASIS OF FECES IN A MOLLUSK-EATING WADER, THE KNOT CALIDRIS-CANUTUS

    NARCIS (Netherlands)

    DEKINGA, A; PIERSMA, T

    Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

  19. Reconstructing diet composition on the basis of faeces in a mollusc-eating wader, the Knot Calidris canutus

    NARCIS (Netherlands)

    Dekinga, A.; Piersma, T.

    1993-01-01

    Methods are described to assess the molluscan diet of Knots feeding on intertidal flats in western Europe from their faecal output. The size distributions of two common bivalve prey, Macoma balthica and Cerastoderma edule, can be estimated from the heights of shell hinges retrieved from droppings.

  20. ENVIRONMENTAL-EFFECTS ON THE GROWTH-RATE OF INTERTIDAL INVERTEBRATES AND SOME IMPLICATIONS FOR FORAGING WADERS

    NARCIS (Netherlands)

    WANINK, JH; ZWARTS, L

    1993-01-01

    The paper describes effects of intertidal height and sediment type on growth rate of the bivalves Cerastoderma edule, Macoma balthica, Mya arenaria, Mytilus edulis and Scrobicularia plana, and of the worms Arenicola marina, Nephtys hombergii and Nereis diversicolor in the eastern part of the Dutch

  1. India hiilgav viletsus / Andrei Hvostov

    Index Scriptorium Estoniae

    Hvostov, Andrei, 1963-

    2006-01-01

    Hiinat nimetatakse maailma töökojaks, Indiat aga bürooks (back office), võrdlus põhineb India IT-firmade edul - kõik tegevused, mida saab teha arvutite abil, kipuvad kolima Indiasse. Tulevikuriik India on hädas keskaegsete tavadega

  2. Interkultuurilised võimalused ja ohud turunduses / Kristel Kaljund

    Index Scriptorium Estoniae

    Kaljund, Kristel

    2002-01-01

    Kasut. kirj. lk. 27. - Kokkuvõte ingl. k. lk. 28. Artiklis põhjendatakse kultuuritausta mõju majanduslikule edule ning tuuakse ära kõige sagedasemad vigade põhjused ning pakutakse välja, kuidas Eesti majandusspetsialistidel oleks võimalik neid vigu vältida

  3. Burrowing and avoidance behaviour in marine organisms exposed to pesticide-contaminated sediment

    DEFF Research Database (Denmark)

    Møhlenberg, Flemming; Kiørboe, Thomas

    1983-01-01

    Behavioural effects of marine sediment contaminated with pesticides (6000 ppm parathion, 200 ppm methyl parathion, 200 ppm malathion) were studied in a number of marine organisms in laboratory tests and in situ. The burrowing behaviour in Macoma baltica, Cerastoderma edule, Abra alba, Nereis...

  4. Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2008-01-01

    Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

  5. Kultuuritegelaste luhtunud katse ajalugu korrata / Ando Leps

    Index Scriptorium Estoniae

    Leps, Ando, 1935-

    2003-01-01

    Kultuuritegelaste pöördumine nelja erakonna poole üritas olla signaaliks nelja partei lähenemisele ja ühisele koostöövandele seista vastu Keskerakonna arvatavale edule Riigikogu valimistel. Võrdlus 1980. aasta 40 kirjaga

  6. Edukaks töö ja arengu kaudu / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti 2. veebr. lk. 11. TOP-i 2. koht. Ehituse, kaevetööde ja kinnisvaraga tegeleva Malkati Kaubanduse OÜ juhatuse liikme Indrek Puhalaineni sõnul on ettevõtet edule aidanud aktiivne töö. Diagramm

  7. Chemical composition profiling and antifungal activity of the ...

    African Journals Online (AJOL)

    Background: Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could ...

  8. Ultrasound-Assisted Extraction: Effect of Extraction Time and Solvent ...

    African Journals Online (AJOL)

    Purpose: To investigate the influence of extraction conditions assisted by ultrasound on the quality of extracts obtained from Mesembryanthemum edule shoots. Methods: The extraction procedure was carried out in an ultrasonic bath. The effect of two solvents (methanol and ethanol) and two extraction times (5 and 10 min) ...

  9. An Analysis of Estimated Versus Actual Development Costs for an Electronics State-of-the-Art (SOA) Extension.

    Science.gov (United States)

    1987-12-01

    DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%𔄂ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to

  10. Power, politics and rehabilitation in sub-Saharan Africa: from the personal to the political.

    Science.gov (United States)

    Campbell, Catherine

    2011-01-01

    This article discusses the complexities of facilitating community-based rehabilitation in resource-poor contexts in Sub-Saharan Africa. It does so through a reflection on the book Able-Bodied: Scenes from a Curious Life, written by Leslie Swartz, a South African expert on disability in the context of international development. Swartz uses his own personal experiences as son of a disabled father as a springboard for reflections on his long involvement in the often-fraught areas of disability research and activism. He pays particular attention to the way in which emotions shape the struggles around expertise and power that bedevil disability identity politics. In particular, his work highlights how the complex dynamics of race, class and disability undermine the effectiveness of the movement.

  11. Bioindicators in the tropical forest of Kaiga environment

    International Nuclear Information System (INIS)

    Somashekarappa, H.M.; Narayana, Y.; Radhakrishna, A.P.; Karunakara, N.; Balakrishna, K.M.; Siddappa, K.

    1996-01-01

    Investigations on the natural and artificial fallout radionuclides 210 Po and 137 Cs and the primordial radionuclide 40 K in the prominent tree species of Western Ghat tropical forests near Kaiga have been carried out as a part of baseline background radiation studies in the environment of Kaiga where nuclear power reactors are being installed. The prominent tree species of the region Tectona grandis L.f. and Terminalia paniculata Roth., and the commonly available epiphytic plant species Pterobryopsis tumida (Hook.) Dix. and Cymbidium aliofolium (Lo) Swartz. were chosen and concentrations of 40 K, 210 Po and 137 Cs were measured employing well-established nuclear techniques. The different parts of Cumbidium aloifolium (Lo) Swartz. such as leaves, stem, etc. were analysed to understand the absorption mechanism of fallout radionuclides. From a careful analysis of the results, the epiphytic plant species are identified as bioindicators to monitor fallout radionuclides. (Author)

  12. RHOEO SPATHACEA: A CYTOGENETICAL REVIEW

    OpenAIRE

    Datta Animesh K.; Mandal Aninda; Bhattacharya Arnab; Saha Aditi; Paul Rita

    2012-01-01

    A cytogenetical review is conducted on Rhoeo spathacea (Swartz) Stearn (monotypic genus of the family Commelinaceae) including conventional heterozygote (var. bicolor) form (2n=12) and a rare bivalent forming clone of var. concolor (2n=12) with an objective to provide cytological configurations explaining some of the important cytogenetical aspects, which is rather difficult in sexually propagated plant species due to sterility barriers. Cytological configurations documented may generate inte...

  13. A method to fabricate solid free form scaffolds for liver tissue engineering by using 3D printing

    OpenAIRE

    Mallikarjunaiah, Chetan Aradhya

    2015-01-01

    In recent years, there has been a great demand for the development of bio-artificial organs/tissues in the field of organ transplantation and in-vitro toxicological drug screening (L. G. Griffith & Swartz, 2006). Engineering of functional tissue/organs by controlling the cells microenvironment to resemble in vivo situation is of central importance. This has led to the evolution of various techniques for controlling the cellular microenvironment to facilitate cell proliferation, organization a...

  14. Environmental Impact Research Program. Ruffed Grouse (Bonasa umbellus) Section 4.1.1, US Army Corps of Engineers Wildlife Resources Management Manual.

    Science.gov (United States)

    1986-07-01

    tors in most populations (Edminster 1954, Gullion and Marshall 1968). However, hunting may depress grouse numbers on areas that receive intensive...in the diversity of ruffed grouse diets. Clover and other green leafy material and the fruits of Arctostaphylos, cranberry , and meadow rue contribute...Christmas fern Polystichum acrostichoides Clover Trifoliwn spp. Cranberry Viburnum edule Dandelion Taraxaum spp. Dogwood Corfus spp. Douglas fir Pseudotsuga

  15. Evaluation of the potential of translocated common cockle for ecological risk assessment studies: bioaccumulation and biomarkers test

    OpenAIRE

    Arteaga, Jorge Lobo

    2009-01-01

    Thesis submitted to the Faculdade de Ciências e Tecnologia to obtain the Master’s degree in Environmental Engineering, profile in Ecological Engineering Sediment–bound contamination is a major concern factor in estuaries and other confined coastal water bodies, frequently subjected to anthropogenic sources of pollution. In order to investigate the effects and responses of the common cockle (Cerastoderma edule, L. 1558, Bivalvia: Cardiidae) to sediment contaminants and to assess the species...

  16. Installation Restoration Program. Site Investigation Report. 147th Fighter Interceptor Group, Texas Air National Guard, Ellington, Field, Houston, Texas

    Science.gov (United States)

    1991-01-01

    N4.L.....-I~C1 01AME TER ...... SACKS OF TON’O 4-1At AN SCH4EDULE 40PVC SAK pTA rEINO 8LANK VLT TRAP I o GALLONS OF GVOUT USED SOTTOM WELL CAP POUNDS...and fungi on leaf surfaces and in soil. Many of these microorganisms play key roles in the decomposer food chain. Cases of lead poisoning have been

  17. Venemaa ja Georgia sõda : suurvõimu lõks / Ivan Krastev ; tõlk. Triinu Pakk

    Index Scriptorium Estoniae

    Krastev, Ivan

    2008-01-01

    Autor kirjutab, et Venemaa-Gruusia konflikti puhul on tegemist 19. sajandi sõjaga 21. sajandi Euroopas, millele on iseloomulik võimukonfrontatsioon ilma laiema ideoloogilise polarisatsioonita. Konflikt näitas kolmekordset nurjumist: Gruusia presidendil Mihheil Saakashvilil ei õnnestunud taastada riigi territoriaalset terviklikkust, USA administratsioon näitas oma võimetust strateegilise liitlase abistamisel ning vaatamata sõjalisele edule, ei õnnestunud Venemaal mõjutada Euroopa poliitikat

  18. Thermal Catalytic Syngas Cleanup for High-Efficiency Waste-to-Energy Converters

    Science.gov (United States)

    2015-12-01

    recuperator used was an off-the-shelf item that is used for high-temperature (1150°C) heat recovery in industrial furnaces. It was a shell -and-tube...design and was installed such that the raw syngas passed within the tubes and the reformed gas passed through the shell side. Figure 11...R.Q.; Monfort, S.M.; Arkenberg, G.B.; Matter, P.H.; Swartz, S.L. Sulfur Tolerant Magnesium Nickel Silicate Catalyst for Reforming of Biomass

  19. Platelet-activating factor (PAF) receptor-binding antagonist activity of Malaysian medicinal plants.

    Science.gov (United States)

    Jantan, I; Rafi, I A A; Jalil, J

    2005-01-01

    Forty-nine methanol extracts of 37 species of Malaysian medicinal plants were investigated for their inhibitory effects on platelet-activating factor (PAF) binding to rabbit platelets, using 3H-PAF as a ligand. Among them, the extracts of six Zingiberaceae species (Alpinia galanga Swartz., Boesenbergia pandurata Roxb., Curcuma ochorrhiza Val., C. aeruginosa Roxb., Zingiber officinale Rosc. and Z. zerumbet Koenig.), two Cinnamomum species (C. altissimum Kosterm. and C. pubescens Kochummen.), Goniothalamus malayanus Hook. f. Momordica charantia Linn. and Piper aduncum L. are potential sources of new PAF antagonists, as they showed significant inhibitory effects with IC50 values ranging from 1.2 to 18.4 microg ml(-1).

  20. Helosis (Balanophoraceae en Argentina Helosis (Balanophoraceae in Argentina

    Directory of Open Access Journals (Sweden)

    José Luis Fontana

    2006-07-01

    Full Text Available Se cita por primera vez para Argentina Helosis cayennensis (Swartz Sprengel var. cayennensis en base a colecciones hechas por los autores en la Isla argentina de Apipé Grande, Ituzaingó, provincia de Corrientes. Se describe e ilustra la especie, el desarrollo de la planta y su estado de conservación. Esta cita de Helosis corresponde a un género nuevo para la flora argentina.Helosis cayennensis var. cayennensis is reported for the first time for Argentina. The species is described and ilustrated. Developement and ecology are also given. Helosis is also a new generic record for Argentina.

  1. Atmospheric Triatomic Molecular Studies.

    Science.gov (United States)

    1980-11-17

    ADORE.SS(Jf dlII.,.nt tra 05), tivl 15, SECURITY CLA’.SS. (of this rwpofl) __ 1 P7 jl / 15&. DECLASSJFI CAT DJGft*114I1 -J SCmEDULE If- DiSTRIBUT ION...work in Table I are given in Appendix I. I (3) 41 S. - I + t/n LU ) *C14~ & c .) a)Z. W i 0 0 uL a) NCDNN N 0 4-3 0) cl b -4 cu a x of acca Lm %- a

  2. The Use of Tailored Testing with Instructional Programs.

    Science.gov (United States)

    1986-03-01

    AVAILABILITY OF REPORT Approved for public release: distribution un- t~X DWNCADNGSCHiEDULE li-mited. Reproduction in whole or in part is...of Education ,-’ Washington, DC 20V 0 Chicago, IL r06𔄁 Air Force Human Resources Lab Cdt. Arnold Bohrer . AFHRL/MPD Sectie Psychologisch Cnderzoek...University of Texas-Austin Univ-ir-tat Puss-ldorf Measurement and Evalu-,tion Er zi, gswi ssensch;ftl iches Cpnter Un ivf rsit ’tsst r. 1 Austin, TX 787

  3. Variación genética en el complejo infraespecífico de chayote evaluada mediante sistemas isoenzimáticos

    Directory of Open Access Journals (Sweden)

    Carlos Hugo Avendaño-Arrazate

    2012-02-01

    Full Text Available El objetivo de este trabajo fue estimar el grado de variación genética dentro del complejo infraespecífico de Sechium mediante el uso de sistemas isoenzimáticos. Se analizaron 23 loci codificados por 12 sistemas isoenzimáticos, en geles de almidón, en 10 individuos de cada una de las 30 accesiones (27 cultivadas y tres silvestres. La variación genética se estimó con base en el número promedio de alelos por locus (NPAL, porcentaje de porlimorfismo (PP, heterocigosidad observada y esperada (Ho y He, índice relativo de heterocigosidad (IRH e índice de Shannon (IS. Para NPAL y PP, el promedio para las 30 accesiones fue de 2, 03 y 59, 8%, respectivamente. El análisis de Ho y He mostró variación genética en el complejo infraespecífico de Sechium, con valores promedio de 0, 05 y 0, 26, respectivamente. El IRH mostró una deficiencia de individuos heterocigotos (promedio de -0, 75. El IS mostró gran diversidad en las 30 accesiones (0, 41. Las poblaciones con mayor diversidad fueron Negrito, Verde liso, Negro xalapa, Verde espinoso y Negro cónico; con una variación intermedia fueron Castilla blanco, Caldero y Blanco pequeño; y, con poca variación, Castilla verde, Cambray y los parientes silvestres.

  4. Cubozoa e Scyphozoa (Cnidaria: Medusozoa de águas costeiras do Brasil Cubozoa and Scyphozoa (Cnidaria: Medusozoa from Brazilian coastal waters

    Directory of Open Access Journals (Sweden)

    André C. Morandini

    2005-09-01

    Full Text Available As espécies de Cubozoa e Scyphozoa costeiras que ocorrem no Brasil são descritas, com base em espécimes de coleções de museus e exemplares recém-coletados. Chaves de identificação e um glossário também são apresentados. As espécies descritas são: Aurelia sp.; Cassiopea xamachana Bigelow, 1892; Chiropsalmus quadrumanus (Müller, 1859; Chrysaora lactea Eschscholtz, 1829; Drymonema dalmatinum Haeckel, 1880; Linuche unguiculata (Swartz, 1788; Lychnorhiza lucerna Haeckel, 1880; Nausithoe aurea Silveira & Morandini, 1997; Phyllorhiza punctata von Lendenfeld, 1884; Stomolophus meleagris Agassiz, 1862; Tamoya haplonema Müller, 1859 e Tripedalia cystophora Conant, 1897.Coastal species of Cubozoa and Scyphozoa occurring in Brazil are described, based on museum specimens and recently collected ones. Identification keys and a glossary are also presented. The listed species are: Aurelia sp.; Cassiopea xamachana Bigelow, 1892; Chiropsalmus quadrumanus (Müller, 1859; Chrysaora lactea Eschscholtz, 1829; Drymonema dalmatinum Haeckel, 1880; Linuche unguiculata (Swartz, 1788; Lychnorhiza lucerna Haeckel, 1880; Nausithoe aurea Silveira & Morandini, 1997; Phyllorhiza punctata von Lendenfeld, 1884; Stomolophus meleagris Agassiz, 1862; Tamoya haplonema Müller, 1859; and Tripedalia cystophora Conant, 1897.

  5. Maritime Halophyte Species from Southern Portugal as Sources of Bioactive Molecules

    DEFF Research Database (Denmark)

    Rodrigues, Maria João; Gangadhar, Katkam N.; Vizetto-Duarte, Catarina

    2014-01-01

    -ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical was obtained in the ether extract of J. acutus (IC50 = 0.4 mg/mL) and H. portulacoides (IC50 = 0.9 mg/mL). The maximum total phenolic content (TPC) was found in the methanol extract of M. edule (147 mg gallic acid equivalents (GAE)/g) and in the ether extract of J......,1-diphenyl-2-picrylhydrazyl (DPPH) radical were the methanol extracts of M. edule (IC50 = 0.1 mg/mL) and J. acutus (IC50 = 0.4 mg/mL), and the ether extracts of J. acutus (IC50 = 0.2 mg/mL) and A. macrostachyum (IC50 = 0.3 mg/mL). The highest radical scavenging activity (RSA) against the 2,2'-azino-bis (3...... activity and selectivity was obtained with the ether extract of J. acutus. Juncunol was identified as the active compound and for the first time was shown to display selective in vitro cytotoxicity towards various human cancer cells....

  6. Climate change impacts on potential recruitment in an ecosystem engineer.

    Science.gov (United States)

    Morgan, Emer; O' Riordan, Ruth M; Culloty, Sarah C

    2013-03-01

    Climate variability and the rapid warming of seas undoubtedly have huge ramifications for biological processes such as reproduction. As such, gametogenesis and spawning were investigated at two sites over 200 km apart on the south coast of Ireland in an ecosystem engineer, the common cockle, Cerastoderma edule. Both sites are classed as Special Areas of Conservation (SACs), but are of different water quality. Cerastoderma edule plays a significant biological role by recycling nutrients and affecting sediment structure, with impacts upon assemblage biomass and functional diversity. It plays a key role in food webs, being a common foodstuff for a number of marine birds including the oystercatcher. Both before and during the study (early 2010-mid 2011), Ireland experienced its two coldest winters for 50 years. As the research demonstrated only slight variation in the spawning period between sites, despite site differences in water and environmental quality, temperature and variable climatic conditions were the dominant factor controlling gametogenesis. The most significant finding was that the spawning period in the cockle extended over a greater number of months compared with previous studies and that gametogenesis commenced over winter rather than in spring. Extremely cold winters may impact on the cockle by accelerating and extending the onset and development of gametogenesis. Whether this impact is positive or negative would depend on the associated events occurring on which the cockle depends, that is, presence of primary producers and spring blooms, which would facilitate conversion of this extended gametogenesis into successful recruitment.

  7. Management of Cosmetic Embarrassment Caused by Malassezia spp. with Fruticose Lichen Cladia Using Phylogenetic Approach

    Directory of Open Access Journals (Sweden)

    Anand Pandey

    2013-01-01

    Full Text Available During anti-Malassezia screening of plants by CLSI broth microdilution method, Cladia aggregata (Swartz Nyl. (family Cladoniaceae, a fruticose lichen from Sikkim (northeast Himalayan region, has been found effective at minimum inhibitory concentrations (mg/mL of 2.72, 0.63, and 1.28 against yeast-like fungi namely, M. furfur, M. globosa and M. sympodialis, respectively. These test pathogens are responsible for pityriasis versicolor (PV and seborrheic dermatitis (SD in humans. We tried to establish the reason for variable MICs against various Malassezia spp. using bioinformatical tools, thereby reducing the cost of the experimentation. This is the first report on anti-Malassezia activity of C. aggregata and thus can serve as a potential source for the development of cosmaceuticals.

  8. Stable carbon isotope analysis of soil organic matter illustrates vegetation change at the grassland/woodland boundary in southeastern Arizona, USA.

    Science.gov (United States)

    McPherson, G R; Boutton, T W; Midwood, A J

    1993-02-01

    In southeastern Arizona, Prosopis juliflora (Swartz) DC. and Quercus emoryi Torr. are the dominant woody species at grassland/woodland boundaries. The stability of the grassland/woodland boundary in this region has been questioned, although there is no direct evidence to confirm that woodland is encroaching into grassland or vice versa. We used stable carbon isotope analysis of soil organic matter to investigate the direction and magnitude of vegetation change along this ecotone. δ 13 C values of soil organic matter and roots along the ecotone indicated that both dominant woody species (C 3 ) are recent components of former grasslands (C 4 ), consistent with other reports of recent increases in woody plant abundance in grasslands and savannas throughout the world. Data on root biomass and soil organic matter suggest that this increase in woody plant abundance in grasslands and savannas may increase carbon storage in these ecosystems, with implications for the global carbon cycle.

  9. EEGLAB, SIFT, NFT, BCILAB, and ERICA: new tools for advanced EEG processing.

    Science.gov (United States)

    Delorme, Arnaud; Mullen, Tim; Kothe, Christian; Akalin Acar, Zeynep; Bigdely-Shamlo, Nima; Vankov, Andrey; Makeig, Scott

    2011-01-01

    We describe a set of complementary EEG data collection and processing tools recently developed at the Swartz Center for Computational Neuroscience (SCCN) that connect to and extend the EEGLAB software environment, a freely available and readily extensible processing environment running under Matlab. The new tools include (1) a new and flexible EEGLAB STUDY design facility for framing and performing statistical analyses on data from multiple subjects; (2) a neuroelectromagnetic forward head modeling toolbox (NFT) for building realistic electrical head models from available data; (3) a source information flow toolbox (SIFT) for modeling ongoing or event-related effective connectivity between cortical areas; (4) a BCILAB toolbox for building online brain-computer interface (BCI) models from available data, and (5) an experimental real-time interactive control and analysis (ERICA) environment for real-time production and coordination of interactive, multimodal experiments.

  10. Short-term fluctuations in bivalve larvae compared with some environmental factors in a coastal lagoon (South Portugal

    Directory of Open Access Journals (Sweden)

    Luis M.Z. Chícaro

    2000-12-01

    Full Text Available In this study, short-term fluctuations in bivalve larvae were compared with some triggering factors for a period of sixteen months. Data on the abundance of planktonic larvae, collected two to three times a week were related to water temperature, salinity, wind velocity, tidal amplitude and chlorophyll a. Higher densities of planktonic bivalve larvae were caught between May and August, but intense fluctuations in abundance were observed. Planktonic bivalve larvae of eighteen taxa were identified. Larvae of Mytilus galloprovincialis, Cerastoderma edule, Ruditapes decussates and Venerupis spp. were the most abundant. The seasonal fluctuations of bivalve abundance seem to be controlled by temperature, the major factor in the timing of the reproduction of bivalves. Nevertheless, advection may be also a key factor during the planktonic life of bivalve species in coastal systems, such as the Ria Formosa.

  11. Efeito de extratos aquosos de meliáceas sobre Bemisia tabaci biótipo B em tomateiro Effect of aqueous extracts of meliaceous plants on Bemisia tabaci B biotype on tomato plants

    Directory of Open Access Journals (Sweden)

    ANTONIO PANCRÁCIO DE SOUZA

    2000-01-01

    Full Text Available Comparou-se a bioatividade de extratos aquosos a 3% (p/v de três meliáceas, Melia azedarach L. (frutos verdes, Trichilia pallida Swartz (ramos e Azadirachta indica A. Juss (sementes, em relação à mosca branca Bemisia tabaci (Gennadius biótipo B, criada em tomateiro. No primeiro experimento os extratos foram aplicados sobre ovos e sobre ninfas com três dias de idade, avaliando-se a mortalidade e a duração das fases de ovo e de ninfa. No segundo experimento os extratos foram aplicados apenas sobre as ninfas, avaliando-se a mortalidade nessa fase e a longevidade e fecundidade dos adultos. Em relação à fase de ovo, o extrato de T. pallida foi o que provocou maior mortalidade, seguindo-se os de A. indica e M. azedarach. A maior mortalidade ninfal foi constatada com o extrato de A. indica, seguindo-se os de T. pallida e M. azedarach. Nenhum dos extratos afetou a duração das fases de ovo e de ninfa, assim como a longevidade e fecundidade.The objective of this research was to compare the effect of aqueous extracts of fresh fruits of Melia azedarach L., twigs of Trichilia pallida Swartz and seeds of zadirachta indica A. Juss, on eggs and nymphs of silverleaf whitefly Bemisia tabaci (Gennadius B biotype reared on tomato plants. The extracts were tested at a concentration of 3%. In the first experiment, the extracts were applied on eggs and 3-day-old nymphs. Records were taken on mortality, duration of egg and nymphal stages. In the second experiment the extracts were applied on 3-day-old nymphs and records were taken on nymphal mortality, adult longevity and fecundity. The extracts of T. pallida were the most effective on eggs, followed by A. indica and M. azedarach. The extracts of A. indica were the most effective on nymphs followed by T. pallida and M. azedarach. In both experiments, the duration of egg and nymph stages, longevity and fecundity were not affected by the extracts.

  12. Structure and dynamics of the cyclopoid copepod (Crustacea assemblage associated with aquatic macrophytes in two lotic environments of the Upper Paraná river basin, Brazil Estrutura e dinâmica da assembléia de copépodos ciclopóides (Crustacea associados com macrófitas aquática em dois ambientes lóticos da bacia do alto rio Paraná, Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Machado Velho

    2001-05-01

    Full Text Available Spatial and temporal variation was analyzed in the composition, diversity, and abundance of cyclopoid copepods associated with Eichhornia azurea (Swartz Kunth in two lotic environments of the Upper Paraná river basin. Sixteen cyclopoid taxa were identified. There were no differences in the composition of copepod species between environments or hydrological phases. Cyclopoids were generally more abundant during the low water phase. The most abundant species in both environments were Macrocyclops albidus albidus (Jurine and Microcyclops finitimus Dussart. Densities and some measurements of species richness were in general higher in the Ivinheima River, which has many associated floodplain lakes. This fact suggests the importance of associated lentic environments for patterns of abundance and species richness found in lotic environments. Low values for β diversity of the cyclopoid assemblage in both environments seem to indicate that the littoral region has low temporal heterogeneityAnalisamos a variação espacial e temporal da composição, diversidade e abundância dos copépodos ciclopóides associados à Eichhornia azurea (Swartz Kunth em dois ambientes lóticos da bacia do alto rio Paraná. Foram identificados dezesseis táxons de ciclopóides. Não foram constatadas diferenças na composição de espécies entre os ambientes ou fases hidrológicas. Os ciclopóides foram, em geral, mais abundantes durante a fase de águas baixas. As espécies mais abundantes nos dois ambientes foram Macrocyclops albidus albidus (Jurine e Microcyclops finitimus Dussart. As densidades e algumas medidas de riqueza de espécies foram, em geral, maiores no rio Ivinheima, o qual apresenta muitas lagoas de várzea associadas. Esse fato sugere a importância de ambientes lênticos para os padrões de abundância e riqueza de espécies encontrados em ambientes lóticos. Os baixos valores de diversidade β para a assembléia de ciclopóides nos dois ambientes

  13. Are metallothioneins equally good biomarkers of metal and oxidative stress?

    Science.gov (United States)

    Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa

    2012-10-01

    Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine

  14. Recursos vegetais usados por Acromyrmex striatus (Roger (Hymenoptera, Formicidae em restinga da Praia da Joaquina, Florianópolis, Santa Catarina, Brasil Vegetable resources used by Acromyrmex striatus (Roger (Hymenoptera, Formicidae in sand dunes at Joaquina Beach, Florianópolis, Santa Catarina State, Brazil

    Directory of Open Access Journals (Sweden)

    Benedito C. Lopes

    2005-06-01

    Full Text Available Foram amostrados 400 ninhos de Acromyrmex striatus entre 1997 e 1998, nas dunas da praia da Joaquina, Florianópolis, SC, para a verificação do material vegetal trazido para o ninho. Estas formigas usam partes de 50 espécies de plantas dispostas em 22 famílias, sendo as principais, representantes de Compositae, Gramineae e Leguminosae. Nesta última família, Stylosanthes viscosa foi a espécie mais utilizada nos dois anos de amostragem. Acromyrmex striatus corta matéria vegetal fresca, bem como se utiliza de material vegetal já caído, podendo, então se comportar como cortadeira ou como uma espécie oportunista.A total of 400 nests of Acromyrmex striatus (Roger, 1863 was evaluated between 1997 and 1998 at the dunes of the Joaquina Beach, Florianópolis, Santa Catarina State, in order to determine the vegetable substrate brought back to the nests. These ants use some parts of 50 plant species in 22 botanical families, being Compositae, Gramineae and Leguminosae the principal ones. In this last family, Stylosanthes viscosa Swartz was the most herbivored species in the two years samplings. Acromyrmex striatus cut fresh vegetables, as well as use decayed materials, being then a true leaf-cutter ant or a opportunistic ant.

  15. Colonization by Chironomidae larvae in decomposition leaves of Eichhornia azurea in a lentic system in Southeastern Brazil.

    Science.gov (United States)

    da Silveira, Lidimara Souza; Martins, Renato Tavares; da Silveira, Guilherme Augusto; Grazul, Richard Michael; Lobo, Danielle Pinheiro; Alves, Roberto da Gama

    2013-01-01

    The objective of this study was to analyze the colonization of Chironomidae (Diptera) larvae during the decomposition of Eichhornia azurea (Swartz) Kunth (Commelinales: Pontederiaceae) leaves in a lake in southeastern Brazil in two seasons of the year. The experiment was conducted from September to November 2007 and February to April 2008. In each period, 21 litter bags were used, each containing 10 g of dried leaves. Three bags were removed after 2, 5, 8, 12, 25, 45, and 65 days of colonization. The decomposition rate of the E. azurea leaves was rapid in both seasons, with no significant difference between them. The Chironomidae showed higher density than the other invertebrates. Goeldichironomus, Tonytarsus, and Corynoneura were the most abundant genera of Chironomidae. The invertebrate density increased during the experiment, differing within days but not between seasons. The faunal composition differed between the decomposition phases (initial and final), but did not differ between the seasons (dry and wet). The taxa Ablabesmyia, Caladomyia, Chironomus, Goeldichironomus, and Parachironomus were the most closely related to the final days of the experiment. Litter was the main food item found in the gut contents of the organisms of all the genera analyzed, both at the beginning and end of the decomposition. We believe that the feeding activity combined with the high larval density is an important factor contributing to the rapid decomposition of the E. azurea leaves. In conclusion, the succession process along the detritus chain of E. azurea was more important in structuring the assemblage of Chironomidae larvae than seasonal variations.

  16. Brine shrimp cytotoxicity of Caesalpinia pulcherrima aerial parts, antimicrobial activity and characterisation of isolated active fractions.

    Science.gov (United States)

    Chanda, Sumitra; Baravalia, Yogesh

    2011-12-01

    Caesalpinia pulcherrima Swartz. is an ornamental plant, shrub or a small tree belonging to the family Caesalpiniaceae. The plant has been used for the treatment of inflammatory disorders, skin diseases and so on. In this study, the cytotoxicity of the methanol extract of the aerial parts of C. pulcherrima was tested using an Artemia salina (brine shrimp) bioassay. Further, the methanol extract was fractionated by silica gel column chromatography using a solvent gradient of hexane:ethyl acetate:methanol in different ratios and 56 fractions were collected. On the basis of thin layer chromatography profiles, 13 major fractions were obtained, which were tested for antimicrobial activity against 14 microorganisms using the agar disc diffusion method and also tested for their minimal inhibitory concentration and minimal bactericidal concentration values. In terms of cytotoxicity, the extract caused 26% mortality of brine shrimp larvae after 24 h at a concentration of 1000 µg mL(-1). Fractions 3, 9 and 10 showed significant antimicrobial activities. Phytochemical analysis of these three fractions led to the identification of 11 compounds, and their structures were established by means of gas chromatography-mass spectroscopy techniques. These findings suggest that these bioactive compounds may be useful as potential antimicrobials. Further investigation is needed to establish the mode of action of these bioactive compounds.

  17. In vitro antiviral activities of Caesalpinia pulcherrima and its related flavonoids.

    Science.gov (United States)

    Chiang, L C; Chiang, W; Liu, M C; Lin, C C

    2003-08-01

    The aim of this study was to search for new antiviral agents from Chinese herbal medicine. Pure flavonoids and aqueous extracts of Caesalpinia pulcherrima Swartz were used in experiments to test their influence on a series of viruses, namely herpesviruses (HSV-1, HSV-2) and adenoviruses (ADV-3, ADV-8, ADV-11). The EC50 was defined as the concentration required to achieve 50% protection against virus-induced cytopathic effects, and the selectivity index (SI) was determined as the ratio of CC50 (concentration of 50% cellular cytotoxicity) to EC50. Results showed that aqueous extracts of C. pulcherrima and its related quercetin possessed a broad-spectrum antiviral activity. Among them, the strongest activities against ADV-8 were fruit and seed (EC50 = 41.2 mg/l, SI = 83.2), stem and leaf (EC50 = 61.8 mg/l, SI = 52.1) and flower (EC50 = 177.9 mg/l, SI = 15.5), whereas quercetin possessed the strongest anti-ADV-3 activity (EC50 = 24.3 mg/l, SI = 20.4). In conclusion, some compounds of C. pulcherrima which possess antiviral activities may be derived from the flavonoid of quercetin. The mode of action of quercetin against HSV-1 and ADV-3 was found to be at the early stage of multiplication and with SI values greater than 20, suggesting the potential use of this compound for treatment of the infection caused by these two viruses.

  18. Black client, white therapist: working with race in psychoanalytic psychotherapy in South Africa.

    Science.gov (United States)

    Knight, Zelda Gillian

    2013-02-01

    In post-apartheid South Africa we speak about race extensively. It permeates our workplace, weaves a thread through the fabric of our professional and personal lives, as well as our private conversations and public interactions with others. From within psychoanalytic theory, the thread weaves through the unknown content of our racialized unconscious. When there is a focus on race in the South African psychoanalytic context it largely takes the form of the struggle to articulate the complexities of working with difference, as Swartz notes, or the struggle to map out issues of race. Such struggles are not localized in South Africa, but strongly reflect a much broader struggle within the global psychoanalytic community, as mirrored in the expanding focus on race. Although the consulting rooms seem far removed from the ongoing political tensions that have recently emerged in South Africa, psychoanalytic psychotherapy remains a space of meaningful engagement with the other, and where the therapeutic dyad is one of racial difference it permits an encounter with our racialized unconscious. This article seeks to document the experience of my black client and my white response to her racial pain and struggle; in doing so, I describe the racial 'contact' between us and within us that triggers a racialized transference and countertransference dynamic, which contains the space for racial healing for both of us. Copyright © 2013 Institute of Psychoanalysis.

  19. Imbalances in the knowledge about infant mental health in rich and poor countries: too little progress in bridging the gap.

    Science.gov (United States)

    Tomlinson, Mark; Bornstein, Marc H; Marlow, Marguerite; Swartz, Leslie

    2014-01-01

    The vast majority of infants are born in poor countries, but most of our knowledge about infants and children has emerged from high-income countries. In 2003, M. Tomlinson and L. Swartz conducted a survey of articles on infancy between 1996 and 2001 from major international journals, reporting that a meager 5% of articles emanated from parts of the world other than North America, Europe, or Australasia. In this article, we conducted a similar review of articles on infancy published between 2002 and 2012 to assess whether the status of cross-national research has changed in the subsequent decade. Results indicate that despite slight improvements in research output from the rest of world, only 2.3% of articles published in 11 years included data from low- and middle-income countries--where 90% of the world's infants live. These discrepancies are indicative of the progress still needed to bridge the so-called 10/90 gap (S. Saxena, G. Paraje, P. Sharan, G. Karam, & R. Sadana,) in infant mental health research. Cross-national collaboration is urgently required to ensure expansion of research production in low-resource settings. © 2014 Michigan Association for Infant Mental Health.

  20. Analytic approach to auroral electron transport and energy degradation

    International Nuclear Information System (INIS)

    Stamnes, K.

    1980-01-01

    The interaction of a beam of auroral electrons with the atmosphere is described by the linear transport equation, encompassing discrete energy loss, multiple scattering, and secondary electrons. A solution to the transport equation provides the electron intensity as a function of altitude, pitch angle (with respect to the geomagnetic field) and energy. A multi-stream (discrete ordinate) approximation to the transport equation is developed. An analytic solution is obtained in this approximation. The computational scheme obtained by combining the present transport code with the energy degradation method of Swartz (1979) conserves energy identically. The theory provides a framework within which angular distributions can be easily calculated and interpreted. Thus, a detailed study of the angular distributions of 'non-absorbed' electrons (i.e., electrons that have lost just a small fraction of their incident energy) reveals a systematic variation with incident angle and energy, and with penetration depth. The present approach also gives simple yet accurate solutions in low order multi-stream approximations. The accuracy of the four-stream approximation is generally within a few per cent, whereas two-stream results for backscattered mean intensities and fluxes are accurate to within 10-15%. (author)

  1. Phototoxicity of petroleum products to marine invertebrate larvae and niles

    International Nuclear Information System (INIS)

    Pelletier, M.C.; Burgess, R.; Ho, K.; Kuhn, A.; McKinney, R.; Ryba, S.

    1995-01-01

    Ultraviolet light can activate certain polycyclic aromatic hydrocarbons (PAHs), inducing the production of free radicals. In biological organisms these free radicals destroy tissues, causing up to a 4,000 fold increase in toxicity. This dramatic response is a potential marker for PAH contamination in environmental samples. Ultraviolet enhancement of toxicity has ecological relevance as well. An oil spill can release large amounts of PAHs into the marine environment. Oil spill assessments to date have not included observations of any phototoxic effect on pelagic larvae or juveniles of benthic or epibenthic invertebrates. In this study, larvae and juveniles of the bivalve, Mulinia lateralis and juveniles of the mysid shrimp, Mysidopsis bahia were exposed to individual PAHs, as well as the water accommodated fractions of several petroleum products to verify the ability of this method to detect PAHs in environmental samples, and to determine if phototoxicity is a concern during and after an oil spill. Significant phototoxicity was seen in both single chemical and petroleum product exposures. Swartz's EPAH model was not applicable to the authors' results. They hoped to show causality but were not fully successful due to the need to further develop the model with their species and expand the number of PAH analyzed

  2. Extrato aquoso de ramos de Trichilia pallida e o desenvolvimento de Spodoptera frugiperda em genótipos de milho

    Directory of Open Access Journals (Sweden)

    Torrecillas Sônia Martins

    2001-01-01

    Full Text Available Avaliaram-se o desenvolvimento e a sobrevivência da lagarta-do-cartucho, Spodoptera frugiperda (J. E. Smith criada em folhas de dois genótipos de milho (o padrão comercial C 901 e o resistente CMS 23 tratados com extratos aquosos (0,1 e 1% de ramos da planta inseticida Trichilia pallida Swartz (Meliaceae. As variáveis biológicas avaliadas foram peso, duração e viabilidade das fases larval e pupal. Em plantas tratadas com o extrato a 1%, ocorreu mortalidade total das lagartas nos dois genótipos, enquanto que a 0,1% o extrato reduziu a sobrevivência e o peso larval e prolongou o período de desenvolvimento. Lagartas alimentadas com o genótipo CMS 23 apresentaram menor sobrevivência, menor peso e maior período de desenvolvimento do que no genótipo C 901.

  3. EXPLORATION UNDER SHADE PLANTS OF CASSAVA AND IT’S POTENTIAL AS FORAGE

    Directory of Open Access Journals (Sweden)

    Novia Qomariyah

    2014-01-01

    Full Text Available Utilization of forage plants growing among cassava (Manihot esculenta Crantz is not optimal. Potential for development of integration of both very large and mutually beneficial. Purpose of this study is to explore and identify types of forage that grows in shade of the cassava plant and potential for development as a source of forage. This study took place in March 2014 Month held at IPB Sinar Sari Complex Dramaga. This research method to define area of cassava plants as treatments that cassava plants were planted separately with another crop (monoculture and cassava crops are planted among crops and horticultural crops such as pariah plants, beans, squash and corn (polyculture. Furthermore, observed and forage samples taken were grown in both location and made herbarium and identified its kind. Results: forage crops are grown between cassava monoculture is more diverse than polyculture. Types of forage crops grown on cassava monoculture is Echinochloa colona, Setaria barbata, Family Juncaceae, Cyperus sp., Conjugatum paspalum, Cynodon dactylon, Stenotaphrum secundatum, Axonophus compressus (Swartz P. Beauv, Eleusine indica and Panicum maximum. Types of forage crops grown on cassava polyculture is colona Echinochloa, Setaria barbata, Family Juncaceae, Cyperus sp., Stenotaphrum secundatum, Eleusine indica and Leucaena leucephala.

  4. Pirate philosophy for a digital posthumanities

    CERN Document Server

    Hall, Gary

    2016-01-01

    In Pirate Philosophy, Gary Hall considers whether the fight against the neoliberal corporatization of higher education in fact requires scholars to transform their own lives and labor. Is there a way for philosophers and theorists to act not just for or with the antiausterity and student protestors—“graduates without a future”—but in terms of their political struggles? Drawing on such phenomena as peer-to-peer file sharing and anticopyright/pro-piracy movements, Hall explores how those in academia can move beyond finding new ways of thinking about the world to find instead new ways of being theorists and philosophers in the world. Hall describes the politics of online sharing, the battles against the current intellectual property regime, and the actions of Anonymous, LulzSec, Aaron Swartz, and others, and he explains Creative Commons and the open access, open source, and free software movements. But in the heart of the book he considers how, when it comes to scholarly ways of creating, performing, an...

  5. Seawater: an alternative grassy weed control method for post emergence herbicides in tropical turfgrass

    International Nuclear Information System (INIS)

    Uddin, M.K.; Ismail, M.R.; Juraimi, A.S.; Hamdani, S.A.

    2014-01-01

    Research was designed to reduce herbicide use by replacing post emergence herbicides with readily available sea water to control tropical turfgrass weeds. In studies evaluating the use of saline solutions for weed control, four salinity levels (0, 24, 48 and 72 dS m/sup -1/) were applied once to 30 grassy weed species, along with seashore paspalum (Paspalum vaginatum Swartz) (as a control) during December, 2007 to March, 2008. The results on injury ratings for salt tolerant weeds were categorized as highly susceptible, moderately susceptible and extremely tolerant. C. dactylon, E. indica, E. virescense, E. unioloides and I. globosa were very susceptible and found to be effectively controlled (100%) at 72 dS m/sup -1/ salinity treatment. However, two most serious weeds viz. wiry eragrostis (E. atrovirens) and lesser dropseed (S. diander), were found to be extremely tolerant, and were not controlled even at the highest salinity level of 72 dS m/sup -1/. P. vaginatum and E. atrovirens did not show significant decrease in shoot and root dry weight at highest salinity levels (72 dS m/sup -1/). The results indicate that sea water has excellent potential for sustainable control of several common grassy weeds in tropical turf. (author)

  6. Analysis of expressed sequence tags from a NaHCO(3)-treated alkali-tolerant plant, Chloris virgata.

    Science.gov (United States)

    Nishiuchi, Shunsaku; Fujihara, Kazumasa; Liu, Shenkui; Takano, Tetsuo

    2010-04-01

    Chloris virgata Swartz (C. virgata) is a gramineous wild plant that can survive in saline-alkali areas in northeast China. To examine the tolerance mechanisms of C. virgata, we constructed a cDNA library from whole plants of C. virgata that had been treated with 100 mM NaHCO(3) for 24 h and sequenced 3168 randomly selected clones. Most (2590) of the expressed sequence tags (ESTs) showed significant similarity to sequences in the NCBI database. Of the 2590 genes, 1893 were unique. Gene Ontology (GO) Slim annotations were obtained for 1081 ESTs by BLAST2GO and it was found that 75 genes of them were annotated with GO terms "response to stress", "response to abiotic stimulus", and "response to biotic stimulus", indicating these genes were likely to function in tolerance mechanism of C. virgata. In a separate experiment, 24 genes that are known from previous studies to be associated with abiotic stress tolerance were further examined by real-time RT-PCR to see how their expressions were affected by NaHCO(3) stress. NaHCO(3) treatment up-regulated the expressions of pathogenesis-related gene (DC998527), Win1 precursor gene (DC998617), catalase gene (DC999385), ribosome inactivating protein 1 (DC999555), Na(+)/H(+) antiporter gene (DC998043), and two-component regulator gene (DC998236). Copyright 2010 Elsevier Masson SAS. All rights reserved.

  7. Assessing the role of benthic filter feeders on phytoplankton production in a shellfish farming site: Mont Saint Michel Bay, France

    Science.gov (United States)

    Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric

    2010-07-01

    The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.

  8. Maximization of Energy Efficiency in Wireless ad hoc and Sensor Networks With SERENA

    Directory of Open Access Journals (Sweden)

    Saoucene Mahfoudh

    2009-01-01

    Full Text Available In wireless ad hoc and sensor networks, an analysis of the node energy consumption distribution shows that the largest part is due to the time spent in the idle state. This result is at the origin of SERENA, an algorithm to SchEdule RoutEr Nodes Activity. SERENA allows router nodes to sleep, while ensuring end-to-end communication in the wireless network. It is a localized and decentralized algorithm assigning time slots to nodes. Any node stays awake only during its slot and the slots assigned to its neighbors, it sleeps the remaining time. Simulation results show that SERENA enables us to maximize network lifetime while increasing the number of user messages delivered. SERENA is based on a two-hop coloring algorithm, whose complexity in terms of colors and rounds is evaluated. We then quantify the slot reuse. Finally, we show how SERENA improves the node energy consumption distribution and maximizes the energy efficiency of wireless ad hoc and sensor networks. We compare SERENA with classical TDMA and optimized variants such as USAP in wireless ad hoc and sensor networks.

  9. Levantamento etnobotânico de plantas medicinais na comunidade quilombola Carreiros, Mercês – Minas Gerais

    Directory of Open Access Journals (Sweden)

    Flávia M. C. Ferreira

    2014-09-01

    Full Text Available O objetivo do trabalho foi identificar as espécies medicinais utilizadas pela comunidade quilombola Carreiros, bem como traçar o perfil social das famílias desta comunidade. Para tanto, foram realizadas entrevistas semiestruturadas da comunidade, sendo um representante de cada família. Para fins de registro foram coletados dois exemplares de cada espécie medicinal identificada, os quais foram conservados na forma de exsicatas e mantidos no Laboratório de Ecologia do IF Sudeste MG – Campus Rio Pomba. As mulheres aparentemente desempenham importante papel social e estão bastante envolvidas no conhecimento das plantas medicinais. Nota-se, que o conhecimento existente foi adquirido de forma empírica e éevidente entre as famílias a preocupação em repassar os conhecimentos tradicionais sobre o uso das plantas medicinais aos jovens. Dentre as principais espécies utilizadas pela comunidade estão: Citrus Sinensis L., Psidium guajava L., Leonurus sibiricus L., Citrus Limonia (Osbeck, Carica sp., Vernonia condensataBacker, Sechuium edule (Jacq. Sw, Sansevieria trifasciata Prain, Malpighia glabra L., e Saccharum zofficinarum L..

  10. Accumulation of Sellafield-derived radiocarbon ((14)C) in Irish Sea and West of Scotland intertidal shells and sediments.

    Science.gov (United States)

    Tierney, Kieran M; Muir, Graham K P; Cook, Gordon T; MacKinnon, Gillian; Howe, John A; Heymans, Johanna J; Xu, Sheng

    2016-01-01

    The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ((14)C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This (14)C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate (14)C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in (14)C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine (14)C-enriched material close to Sellafield. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  11. Metabolites of saxitoxin analogues in bivalves contaminated by Gymnodinium catenatum.

    Science.gov (United States)

    Vale, Paulo

    2010-01-01

    Bivalve metabolites of saxitoxin analogues, not present in microalgae, were recently described as an important toxin fraction in mussels contaminated by Alexandrium tamarense. These possess very low fluorescence, and require mass spectrometry detection. HILIC-MS was implemented to look for these metabolites in bivalves contaminated during Gymnodinium catenatum blooms at the Portuguese coast. The presence of M1 was tentatively identified in several bivalves, ranging from estuarine (Mytilus galloprovinciallis, Cerastoderma edule and Ruditapes decussatus) to oceanic habitat (Donax trunculus and Ensis spp.). It was hypothesized that M1 could contribute to an important fraction of the profile of STX analogues. M1 was more abundant in estuarine bivalves that retain longer PSP toxins, in the following order: mussels>cockles>clams. These data highlight that the study by fluorimetry alone of the carbamoyl, N-sulfocarbamoyl, and decarbamoyl families is manifestly insufficient to fully understand toxin dynamics in bivalves feeding on G. catenatum without a proper study of hydroxybenzoate and hydroxylated M-toxins.

  12. Immediate effect of intertidal non-mechanised cockle harvesting on macrobenthic communities: a comparative study

    Directory of Open Access Journals (Sweden)

    Francisco Miguel Sousa Leitão

    2007-12-01

    Full Text Available In Ria Formosa cockles (Cerastoderma edule have traditionally been harvested with a harvesting-knife (HK. However, over the last six years there has been an increase in the use of a hand-dredge (HD to exploit cockle beds. A comparative study on the impact of these harvesting methods on the benthic macrofauna was undertaken with the aim of evaluating the possible introduction of the hand-dredge in the fishery. Macrofaunal mortality was very low regardless of the gear. However, the total mortality resulting from using the HK was superior to the one observed for the HD. For the same fishing time the hand-dredge covers an area approximately five times greater that the one covered by the knife, with the former yielding 5 times the catch of the latter. Consequently, the use of hand-dredges increases the fishing effort, which may lead to the overexploitation of the cockle populations. Our results revealed that the immediate effect of both gears on macrobenthic communities was similar and minimal. Therefore, we believe that introducing the hand-dredge in the cockle fishery should only be authorised if other management measures, such as daily quotas, closed areas and limiting the number of fishing licenses, are implemented.

  13. Shifting baselines in the Ems Dollard estuary: A comparison across three decades reveals changing benthic communities

    Science.gov (United States)

    Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.

    2017-09-01

    At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.

  14. Shellfish dredging pushes a flexible avian top predator out of a marine protected area.

    Directory of Open Access Journals (Sweden)

    Jan A van Gils

    2006-11-01

    Full Text Available There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called "marine protected areas" (MPAs, which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule. Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica, a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell. From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives.

  15. Mesocosm validation of the marine No Effect Concentration of dissolved copper derived from a species sensitivity distribution.

    Science.gov (United States)

    Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K

    2015-07-15

    The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.

  16. Potensi Ekstrak Tumbuhan Sebagai Pengawet Produk Pangan

    Directory of Open Access Journals (Sweden)

    I Nengah Kencana Putra

    2015-04-01

    Full Text Available Nowadays, the use of natural antimicrobials such as plants extracts to preserve food get much attention of the researchers. This is related to the increasing of public concern over synthetic chemical food preservatives. Various types of plants had been declared can produce extracts that effectively inhibited the growth of food-contaminating microbes, such as methanol and ethanol extracts of bark Saccoglottis gabonensis, effectively inhibited the growth of Leuconostoc mesenteroides and Lactobacillus plantarum; extracts of onion and red pepper inhibited Candida crucei and Candida utilis; ethanol and water extracts of Eugenia Jambos had antimicrobial properties against bacteria such as Staphylococcus aureus, Yersenia enterocolitica, Staphylococcus hominis, Staphylococcus cohnii, Staphylococcus warneri; Picung seed extract (Pagium edule inhibited the growth of Staphylococcus aureus; and ethanol extract of Salvia pratensis leaves inhibited Escherichia coli, Bacillus cereus and Saccharomyces cerevisiae. Extraction of antimicrobial compounds from plant material could be done by using different types of solvents. Among the various types of solvents, ethanol and methanol solvents are most commonly used.Keyword: antimicrobial, plant extract, food preservative

  17. Repelência e deterrência na oviposição de Bemisia tabaci biótipo B pelo uso de extratos vegetais em Cucurbita pepo L Repellence and deterrence on oviposition of Bemisia tabaci biotype B by the use of vegetal extracts in Cucurbita pepo L

    Directory of Open Access Journals (Sweden)

    J.P.G.F. Silva

    2012-01-01

    Full Text Available Bemisia tabaci biótipo B é um dos principais insetos-praga na cultura da abobrinha (Cucurbita pepo L.. O manejo dessa mosca-branca tornou-se grande desafio aos agricultores, uma vez que esta apresenta rápida capacidade de desenvolver resistência a diferentes classes de inseticidas. Como alternativa vem sendo investigado o uso de extratos vegetais com atividades inseticida e/ou insetistática, os quais têm revelado resultados promissores no combate a inseto. O presente trabalho teve por objetivo avaliar os possíveis efeitos de sete extratos provenientes de cinco espécies vegetais, Ruta graveolens L. (folhas, Azadirachta indica A. Juss. (folhas + ramos, Trichilia pallida Swartz (ramos, T. pallida (folhas, A. indica (amêndoas, Chenopodium ambrosioides L. (inflorescências + ramos+ folhas e Mentha pulegium L. (folhas, sobre Bemisia tabaci biótipo B em abobrinha, por meio de testes de repelência e deterrência para oviposição. Em teste com chance de escolha, avaliou-se a atratividade e determinou-se o índice de repelência após 6, 24 e 48 horas da aplicação dos extratos. A oviposição foi verificada após a terceira contagem do número de adultos. O extrato à base de folhas de M. pulegium mostrou repelência e deterrência à oviposição de B. tabaci biótipo B, podendo ser recomendado como alternativa para o manejo do inseto.Bemisia tabaci biotype B is one of the main pests in squash (Cucurbita pepo L.. The management of this whitefly has become a major challenge to growers, since they have the ability to quickly develop resistance to different classes of insecticides. Alternatively, the use of plant extracts with insecticide and/or insectistatic activities has been investigated, showing promising results for the whitefly control. The present study evaluated the possible effects of seven extracts from five plant species, Ruta graveolens L. (leaves, Azadirachta indica A. Juss. (leaves + branches, Trichilia pallida Swartz (branches

  18. Taxonomical and ecological characteristics of the desmids placoderms in reservoir: analyzing the spatial and temporal distribution

    Directory of Open Access Journals (Sweden)

    Sirlene Aparecida Felisberto

    2014-12-01

    Full Text Available AIM: This study aimed to evaluate the influence of river-dam axis and abiotic factors on the composition of Closteriaceae, Gonatozygaceae, Mesotaeniaceae and Peniaceae in a tropical reservoir METHODS: Water samples for physical, chemical and periphyton analysis were collected in April and August 2002 in different regions along the axis of the river-dam of Rosana Reservoir, River Basin Paranapanema. The substrates collected, always in the litoranea region, were petioles of Eichhornia azurea (Swartz Kunth. To examine the relationship of abiotic variables with reservoir zones and between the floristic composition of desmids, we used principal component analysis (PCA and canonical correspondence analysis (CCA RESULTS: The results of the PCA explained 81.3% of the total variability in the first two axes. In the first axis, the variables of conductivity, water temperature and the pH were related to the sampling regions of April with higher values, while for the month of August, nitrate, total phosphorus and dissolved oxygen showed higher values. We identified 20 taxa, distributed in the genera Closterium (14, Gonatozygon (4, Netrium (1 and Penium (1. Spatially, the higher taxa were recorded in the lacustrine region for both collection periods. The canonical correspondence analysis (CCA summarized 62.2% of total data variability of taxa in the first two axes, and in August, Closterium incurvum Brébisson, C. cornu Ehrenberg ex Ralfs and Gonatozygon monotaenium De Bary, were related to higher values of turbidity and nitrate to the lacustrine and intermediate regions CONCLUSION: Thus, the formation of groups was due to the regions along the longitudinal axis, then the seasonal period, which must be related to the low current velocity, the higher values of temperature and the water transparency, especially in late summer

  19. Nitrogen removal from concentrated latex wastewater by land treatment

    Directory of Open Access Journals (Sweden)

    Vikanda Thongnuekhang

    2004-05-01

    Full Text Available Most of the concentrated latex factories in the South of Thailand discharge treated wastewater that contains high level of nitrogen to a nearby river or canals leading to a water pollution problem. A study of land treatment system was conducted to treat and utilize nitrogen in treated wastewater from the concentrated latex factory. The experimental pilot-scale land treatment system was constructed at the Faculty of Engineering, Prince of Songkla University, Hat Yai Campus. It consisted of water convolvulus (Ipomea aquatica, I. Reptans, tropical carpet grass (Axonopus compresus (Swartz Beav. and control unit (no plantation. The treated wastewater from the stabilization pond system of the selected concentrated latex factoryin Songkhla was used to irrigate each experimental unit. Influent and effluent from the experimental units were analyzed for TKN, NH3-N, Org-N, NO3 --N, NO2 --N, BOD5, sulfate, pH and EC. The land treatment system resulted a high removal efficiency for nitrogen. Tropical carpet grass provided higher removal efficiency than other units for all parameters. The removal efficiency of water convolvulus and control unit were not significantly different. The average removal efficiency of TKN, NH3-N, Org-N, BOD5 and sulfate for tropical carpet grass unit were 92, 97, 61, 88 and 52%, for water convolvulus unit were 75, 80, 43, 41 and 30%, and for control unit were 74, 80, 41, 31 and 28%, respectively. Mass balance of nitrogen transformation was conducted. It revealed that plant uptake was the major mechanism for nitrogen removal in land treatment.

  20. Temporal Dynamics of Arthropods on Six Tree Species in Dry Woodlands on the Caribbean Island of Puerto Rico

    Science.gov (United States)

    Beltrán, William; Wunderle, Joseph M.

    2014-01-01

    Abstract The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis–Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L. , Bucida buceras L. , Pithecellobium dulce , and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora , (Swartz) De Candolle, Pi. dulce , Leucaena leucocephala , and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. PMID:25502036

  1. Temporal dynamics of arthropods on six tree species in dry woodlands on the Caribbean Island of Puerto Rico.

    Science.gov (United States)

    Beltrán, William; Wunderle, Joseph M

    2014-01-01

    The seasonal dynamics of foliage arthropod populations are poorly studied in tropical dry forests despite the importance of these studies for understanding arthropod population responses to environmental change. We monitored the abundance, temporal distributions, and body size of arthropods in five naturalized alien and one native tree species to characterize arthropod seasonality in dry novel Prosopis-Leucaena woodlands in Puerto Rico. A branch clipping method was used monthly to sample foliage arthropod abundance over 39 mo. Seasonal patterns of rainfall and abundance within various arthropod taxa were highly variable from year to year. Abundance for most taxa did not show significant seasonality over the 3 yr, although most taxa had abundance peaks each year. However, Homoptera displayed high seasonality with significant temporal aggregations in each year. Formicidae, Orthoptera, and Coleoptera showed high variation in abundance between wet and dry periods, whereas Hemiptera were consistently more abundant in the wet period. Seasonal differences in mean abundance were found only in a few taxa on Tamarindus indica L., Bucida buceras L., Pithecellobium dulce, and (Roxburgh) Benth. Mean arthropod abundance varied among tree species, with highest numbers on Prosopis juliflora, (Swartz) De Candolle, Pi. dulce, Leucaena leucocephala, and (Lamarck) de Wit. Abundance of Araneae, Orthoptera, Coleoptera, Lepidoptera larvae, and all arthropods showed weak relationships with one or more climatic variables (rainfall, maximum temperature, or relative humidity). Body size of arthropods was usually largest during the dry periods. Overall, total foliage arthropod abundance showed no consistent seasonality among years, which may become a more common trend in dry forests and woodlands in the Caribbean if seasonality of rainfall becomes less predictable. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

  2. Species and cultivar influences on survival and parasitism of fall armyworm.

    Science.gov (United States)

    Braman, S K; Duncan, R R; Hanna, W W; Engelke, M C

    2004-12-01

    Interactions between host plant resistance and biological control may benefit or hinder pest management efforts. Turfgrass cultivars have rarely been tested for extrinsic resistance characteristics such as occurrence and performance of beneficial arthropods on plant genotypes with resistance to known turf pests. Parasitism of fall armyworm, Spodoptera frugiperda (J.E. Smith), among six turfgrass genotypes was evaluated. The six grasses tested [Sea Isle-1 and 561-79 seashore paspalum, Paspalum vaginatum Swartz; TifSport and TifEagle hybrid Bermuda grass, Cynodon dactylon (L.) x C. transvaalensis (Burtt-Davy); and Cavalier and Palisades zoysiagrass, Zoysia japonica von Steudel and Z. matrella (L.) Merrill, respectively] represented a range in resistance to S. frugiperda. Differential recovery of larvae released as first instars reflected this gradient in resistance of Cavalier > or = Palisades > or = TifSport = TifEagle > or = 561- = Sea Isle-1 Larval recovery (percentage of initial number released) was greatest in May, less in July and August, and least in October, probably reflecting the increase in activity of on-site predators and disease pressure. Parasitism of the fall armyworm by the braconid Aleiodes laphygmae Viereck varied among turfgrass genotypes. Parasitism was greatest during July. In total, 20,400 first instars were placed in the field; 2,368 were recovered; 468 parasitoids were subsequently reared; 92.2% were A. laphygmae. In the field, the greatest percentage of reduction in S. frugiperda larvae by A. laphygmae occurred on the armyworm-susceptible seashore paspalums (51.9% on Sea Isle-1 in July). Cotesia marginiventris Cresson and Meteorus sp. also were reared from collected larvae. No parasitoids were reared from larvae collected from resistant Cavalier zoysiagrass. A. laphygmae and C. marginiventris were reared from larvae collected from the other five grass cultivars. No parasitoids of older larvae or pupae were observed.

  3. Co-expression of NCED and ALO improves vitamin C level and tolerance to drought and chilling in transgenic tobacco and stylo plants.

    Science.gov (United States)

    Bao, Gegen; Zhuo, Chunliu; Qian, Chunmei; Xiao, Ting; Guo, Zhenfei; Lu, Shaoyun

    2016-01-01

    Abscisic acid (ABA) regulates plant adaptive responses to various environmental stresses, while L-ascorbic acid (AsA) that is also named vitamin C is an important antioxidant and involves in plant stress tolerance and the immune system in domestic animals. Transgenic tobacco (Nicotiana tabacum L.) and stylo [Stylosanthes guianensis (Aublet) Swartz], a forage legume, plants co-expressing stylo 9-cis-epoxycarotenoid dioxygenase (SgNCED1) and yeast D-arabinono-1,4-lactone oxidase (ALO) genes were generated in this study, and tolerance to drought and chilling was analysed in comparison with transgenic tobacco overexpressing SgNCED1 or ALO and the wild-type plants. Compared to the SgNCED1 or ALO transgenic plants, in which only ABA or AsA levels were increased, both ABA and AsA levels were increased in transgenic tobacco and stylo plants co-expressing SgNCED1 and ALO genes. Compared to the wild type, an enhanced drought tolerance was observed in SgNCED1 transgenic tobacco plants with induced expression of drought-responsive genes, but not in ALO plants, while an enhanced chilling tolerance was observed in ALO transgenic tobaccos with induced expression of cold-responsive genes, but not in SgNCED1 plants. Co-expression of SgNCED1 and ALO genes resulted in elevated tolerance to both drought and chilling in transgenic tobacco and stylo plants with induced expression of both drought and cold-responsive genes. Our result suggests that co-expression of SgNCED1 and ALO genes is an effective way for use in forage plant improvement for increased tolerance to drought and chilling and nutrition quality. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  4. Influence of fuelwood trees on sodic soils

    International Nuclear Information System (INIS)

    Garg, V.K.; Jain, R.K.

    1992-01-01

    The persistent acute fuelwood shortage problem in India has necessitated having tree plantations on waste lands to obtain renewable energy. Fuelwood production screening trials initiated in 1981 at the Biomass Research Centre in Banthra, India identified babul, Acacia nilotica (L.) Wild. ex Delile, and mesquite, Prosopis juliflora (Swartz) DC., to be the most promising and suitable leguminous trees in terms of biomass production on sodic sites. A study was carried out to assess soil enrichment due to the growth of these fuelwood trees planted a decade past on sordic soil that had had no other amendments. Results showed preferential nutrient accumulation and greater reduction in soil pH (from 9.5 to 7.9) and exchangeable sodium (from 30 to 8%) at the P. juliflora plantation compared with at the A. nilotica plantation. There was also a reduction in surface soil (0-15 cm) bulk density, but an enhancement in porosity and water holding capacity, making soil more friable. The P. juliflora plantation produced markedly more leaf litter than the A. nilotica plantation. Both the species had fibrous lateral root systems on the surface in the sodic soil. However, the penetration and spread of roots were almost 2-fold greater in P. juliflora than in A. nilotica. Thus, the potential magnitude of changes in soil properties was related to the distribution of roots and amount of litter falling on the soil surface. Prosopis juliflora appeared to be better than A. nilotica under adverse sodic soil conditions in establishing an enlarged plant-litter nutrient cycle relationship. This study also provides an assessment of soil amelioration by leguminous trees under short-rotation forestry practices. 16 refs., 7 figs., 4 tabs

  5. Influence of fuelwood trees on sodic soils

    Energy Technology Data Exchange (ETDEWEB)

    Garg, V.K.; Jain, R.K. (National Botanical Research Inst., Lucknow (India))

    1992-01-01

    The persistent acute fuelwood shortage problem in India has necessitated having tree plantations on waste lands to obtain renewable energy. Fuelwood production screening trials initiated in 1981 at the Biomass Research Centre in Banthra, India identified babul, Acacia nilotica (L.) Wild. ex Delile, and mesquite, Prosopis juliflora (Swartz) DC., to be the most promising and suitable leguminous trees in terms of biomass production on sodic sites. A study was carried out to assess soil enrichment due to the growth of these fuelwood trees planted a decade past on sordic soil that had had no other amendments. Results showed preferential nutrient accumulation and greater reduction in soil pH (from 9.5 to 7.9) and exchangeable sodium (from 30 to 8%) at the P. juliflora plantation compared with at the A. nilotica plantation. There was also a reduction in surface soil (0-15 cm) bulk density, but an enhancement in porosity and water holding capacity, making soil more friable. The P. juliflora plantation produced markedly more leaf litter than the A. nilotica plantation. Both the species had fibrous lateral root systems on the surface in the sodic soil. However, the penetration and spread of roots were almost 2-fold greater in P. juliflora than in A. nilotica. Thus, the potential magnitude of changes in soil properties was related to the distribution of roots and amount of litter falling on the soil surface. Prosopis juliflora appeared to be better than A. nilotica under adverse sodic soil conditions in establishing an enlarged plant-litter nutrient cycle relationship. This study also provides an assessment of soil amelioration by leguminous trees under short-rotation forestry practices. 16 refs., 7 figs., 4 tabs.

  6. How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

    Science.gov (United States)

    Zwarts, Leo; Wanink, Jan H.

    For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low

  7. Shellfish Fishery Severely Reduces Condition and Survival of Oystercatchers Despite Creation of Large Marine Protected Areas

    Directory of Open Access Journals (Sweden)

    Simon Verhulst

    2004-06-01

    Full Text Available Fisheries and other human activities pose a global threat to the marine environment. Marine protected areas (MPAs are an emerging tool to cope with such threats. In the Dutch Wadden Sea, large MPAs (covering 31% of all intertidal flats have been created to protect shellfish-eating birds and allow recovery of important habitats. Even though shellfish fishing is prohibited in these areas, populations of shellfish-eating birds in the Wadden Sea have declined sharply. The role of shellfish fisheries in these declines is hotly debated, therefore, we investigated the effectiveness of MPAs for protecting oystercatcher (Haematopus ostralegus populations. Shellfish stocks (cockles, Cerastoderma edule were substantially higher in the MPAs, but surprisingly this has not resulted in a redistribution of wintering oystercatchers. Oystercatchers in unprotected areas had less shellfish in their diet and lower condition (a combined measure of mass and haematological parameters, and their estimated mortality was 43% higher. It is likely, therefore, that shellfish fishing explains at least part of the 40% decline in oystercatcher numbers in recent years. Condition and mortality effects were strongest in males, and the population sex ratio was female biased, in agreement with the fact that males rely more on shellfish. The unprotected areas apparently function as an "ecological trap," because oystercatchers did not respond as anticipated to the artificial spatial heterogeneity in food supply. Consequently, the MPAs are effective on a local scale, but not on a global scale. Similar problems are likely to exist in terrestrial ecosystems, and distribution strategies of target species need to be considered when designing terrestrial and marine protected areas if they are to be effective.

  8. STUDI KOMUNITAS RUMPUT LAUT DI PANTAI SANUR DAN PANTAI SAWANGAN NUSA DUA BALI

    Directory of Open Access Journals (Sweden)

    GALIH INDRAWATI

    2012-11-01

    Full Text Available Aims of this research are to analyze structure community population, relative population, variety domination, heterogeneous, and equality of seaweed species in Sanur and Sawangan Beach Nusa Dua.The result of the study shows that in Sanur and Sawangan Beach observed 13 related seaweed species were observed, which are: Ulva reticulata, Chaetomorpha crassa, Bornetella nitida, Halimeda macroloba, Padina australis, Sargassum binderi, Hypnea asperi, Dictyopteris sp, Gracilaria coronapifolia, Gracilaria gracilis, Acanthopora spicifera, Euchema edule, Euchema denticulatum Meanwhile, , Caulerpa racemosa, Boergesiana forbessii, Sargassum crassifolium, Gelidium sp, Turbinaria ornata, Gracilaria foliifera only observed in Sanur Beach and species of Actinotrichia fragilis, Ulva lactuca, Euchema serra, Turbinaria conoides observed in Sawangan Beach, Nusa Dua.Heterogeneous value index (H in Sanur Beach is 0.75 – 1.87 categorized as medium category, except in station five characterized as low category. Domination index (C is 0.10 – 0.28, where there is no dominated species. Equality index value (E is 0.32 – 0.85 in unstable condition, except in station one is stable. In Sawangan Beach, heterogeneous indexes is 1.04 – 1.54, that spread in all stations by medium category. Domination index is 0.14 – 0.30, indicated that there is no dominant species. Equality index is 0.47 – 0.74, by stabile condition in station one, while others station is unstable. Highest relatif population in Sanur Beach is 37.63% in station three (Gracilaria foliifera. In Sawangan Nusa Dua Beach is Hypnea asperi (48.65%.Substrate analysis show that Sanur and Sawangan Beach has mud sand types. Water temperature in both research locations approximately is 28.90 C – 30.40 C, pH 7.00 – 7.80 and dissolved oxygen around 6.8mg/1-7.4mg/l.

  9. Penggunaan Ekstrak Bahan Alami Untuk Menghambat Infestasi Lalat Selama Penjemuran Ikan Jambal Asin

    Directory of Open Access Journals (Sweden)

    Farida Ariyani

    2007-11-01

    Full Text Available lkan jambal asin adalah ikan asin kering yang dibuat dengan cara memfermentasikan ikan dalam garam sebelum penjemuran. Untuk mengurangi infestasi lalat selama penjemuran pada pengolahan ikan jambal asin, penelitian penggunaan ekstrak bahan alami sebagai insektisida telah dilakukan. Penelitian ini dilakukan 2 tahap, yaitu penelitian pendahuluan dan penelitian utama. Pada penelitian pendahuluan, bahan baku yang digunakan adalah ikan manyung (Arius thalassinus dan bahan alami yang diuji adalah ekstrak daun mimba (Azadirachta indica A. Juss dan daun picung (Pangium edule Reinw masing‑masing dengan konsentrasi 2,5; 7,5; 10,0; 12,5 % (b/v, serta ekstrak bawang putih (Allium sativum dengan konsentrasi 1,5; 3,0; 4,5; 6,0; 7,5 % (b/v. lkan yang telah difermentasi dalam garam direndam dalarn ekstrak bahan alami selama 30 detik, kemudian dilakukan penjemuran sehingga menjadi ikan jambal asin. Selama penjemuran dan penyimpanan dilakukan pengamatan tingkat infestasi lalat, larva dan pupa. Hasil penelitian pendahuluan menunjukkan bahwa ekstrak bawang putih merupakan bahan yang paling efektif untuk menghambat infestasi lalat sehingga dipilih untuk digunakan pada penelitian utama. Pada penelitian utama, bahan baku yang digunakan adalah ikan patin (Pangasius hypophthalmus. lkan patin yang telah difermentasi direndam dalam ekstrak bawang putih dengan konsentrasi 3, 6 dan 9% (b/v dengan waktu perendaman 0, 5, 10, dan 15 menit. Pengamatan dilakukan terhadap tingkat infestasi lalat dan karakteristik organoleptik produk ikan jambal asin. Hasil penelitian utama menunjukkan bahwa perlakuan terbaik yang memberikan tingkat infestasi lalat terkecil dan dapat diterima panelis adalah perendaman dalarn ekstrak bawang putih 9% selama 10 menit.

  10. Accumulation of Sellafield-derived radiocarbon ("1"4C) in Irish Sea and West of Scotland intertidal shells and sediments

    International Nuclear Information System (INIS)

    Tierney, Kieran M.; Muir, Graham K.P.; Cook, Gordon T.; MacKinnon, Gillian; Howe, John A.; Heymans, Johanna J.; Xu, Sheng

    2016-01-01

    The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ("1"4C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This "1"4C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate "1"4C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in "1"4C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine "1"4C-enriched material close to Sellafield. - Highlights: • We measure "1"4C activity in shells and sediment at sites on the UK west coast. • Mussel shell activity varies in response to average "1"4C discharges from Sellafield. • Shell activities reflect species feeding habits and ecological niche. • NE Irish Sea inorganic sediment activity will gradually increase. • Increases in sediment activity will occur at remote sites on the Scottish west coast.

  11. BMAA in shellfish from two Portuguese transitional water bodies suggests the marine dinoflagellate Gymnodinium catenatum as a potential BMAA source.

    Science.gov (United States)

    Lage, Sandra; Costa, Pedro Reis; Moita, Teresa; Eriksson, Johan; Rasmussen, Ulla; Rydberg, Sara Jonasson

    2014-07-01

    The neurotoxin β-N-methylamino-l-alanine (BMAA) and its putative role in multiple neurodegenerative diseases have been intensely studied since 2005 when the toxin was discovered to be produced by worldwide-distributed cyanobacterial species inhabiting terrestrial, marine, brackish, and freshwater ecosystems. Recently, BMAA production was also associated with one eukaryotic group, namely, diatoms, raising questions about its production by other phytoplanktonic groups. To test for BMAA bioavailability in ecosystems where abundant phytoplanktonic blooms regularly occur, samples of filter-feeding shellfish were collected in two Portuguese transitional water bodies. BMAA content in cockles (Cerastoderma edule) collected weekly between September and November 2009 from Ria de Aveiro and at least once a month from May to November from Ria Formosa, fluctuated from 0.079±0.055 to 0.354±0.066μg/g DW and from below the limit of detection to 0.434±0.110μg/g DW, respectively. Simultaneously to BMAA occurrence in cockles, paralytic shellfish toxins were detected in shellfish as a result of Gymnodinium catenatum blooms indicating a possible link between this marine dinoflagellate and BMAA production. Moreover, considerable high BMAA levels, 0.457±0.186μg/g DW, were then determined in a laboratory grown culture of G. catenatum. This work reveals for the first time the presence of BMAA in shellfish from Atlantic transitional water bodies and consubstantiate evidences of G. catenatum as one of the main sources of BMAA in these ecosystems. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Ecology of megabenthic bivalve communities from sandy beaches on the south coast of Portugal

    Directory of Open Access Journals (Sweden)

    Marta M. Rufino

    2010-03-01

    Cardiidae (except Acanthocardia tuberculata and Cerastoderma edule included mostly species occurring in deeper waters. Bathymetric sequence of species distribution within some families was observed.

  13. The human alimentary tract transfer and body retention of environmental polonium-210

    International Nuclear Information System (INIS)

    Hunt, G J; Rumney, H S

    2007-01-01

    This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f A value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent f A values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first ∼7 days provided additional data on f A values. Pooled results for the apparent f A for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true f A value of ∼0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation

  14. Trematode infection modulates cockles biochemical response to climate change.

    Science.gov (United States)

    Magalhães, Luísa; de Montaudouin, Xavier; Figueira, Etelvina; Freitas, Rosa

    2018-05-06

    Resulting mainly from atmospheric carbon dioxide (CO 2 ) build-up, seawater temperature rise is among the most important climate change related factors affecting costal marine ecosystems. Global warming will have implications on the water cycle, increasing the risk of heavy rainfalls and consequent freshwater input into the oceans but also increasing the frequency of extreme drought periods with consequent salinity increase. For Europe, by the end of the century, projections describe an increase of CO 2 concentration up to 1120 ppm (corresponding to 0.5 pH unit decrease), an increase in the water temperature up to 4 °C and a higher frequency of heavy precipitation. These changes are likely to impact many biotic interactions, including host-parasite relationships which are particularly dependent on abiotic conditions. In the present study, we tested the hypothesis that the edible cockle, Cerastoderma edule, exposed to different salinity, temperature and pH levels as proxy for climate change, modify the infection success of the trematode parasite Himasthla elongata, with consequences to cockles biochemical performance. The results showed that the cercariae infection success increased with acidification but higher biochemical alterations were observed in infected cockles exposed to all abiotic experimental stressful conditions tested. The present study suggested that changes forecasted by many models may promote the proliferation of the parasites infective stages in many ecosystems leading to enhanced transmission, especially on temperate regions, that will influence the geographical distribution of some diseases and, probably, the survival capacity of infected bivalves. Copyright © 2018 Elsevier B.V. All rights reserved.

  15. Reproductive investment in the intertidal bivalve Macoma balthica

    Science.gov (United States)

    Honkoop, P. J. C.; Van der Meer, J.; Beukema, J. J.; Kwast, D.

    1999-05-01

    Bivalve eggs generally contain large amounts of lipids which, in comparison with proteins and carbohydrates, have high energy contents and are thus costly in energetic terms. As lipid contents vary between species, comparisons of reproductive investments should not only include numbers and sizes of eggs, but also their energy content. We estimated the investment in egg material of mature females of the Baltic tellin Macoma balthica (L.) in terms of both mass and energy content. All mass below a minimum body mass (below which no eggs are produced) was defined as structural mass. This threshold amounts to a body mass index (BMI) of 5.6 (ash-free dry mass per cubic shell length in mg cm -3). More than half (55%) of the mass above the structural mass was invested in egg material and 45% in extra somatic tissue and tissue for production and storage of gametes. This means that the amount of eggs spawned ranged from 0 (at BMI = 5.6 mg cm -3) to 33% of the total ash-free dry mass (at a high BMI value of 14 mg cm -3). Eggs contained a relatively large amount of lipids, about 30% of their ash-free dry mass, whereas non-egg material contained only about 7% lipids. Eggs of two other bivalves in the Wadden Sea, the cockle Cerastoderma edule and the mussel Mytilus edulis, were smaller and contained only about 11% and 20% lipids, respectively. Energy content of M. balthica eggs amounted to ˜0.006 J, in the other two species to ˜0.002 J. The function of the more expensive eggs in M. balthica may be related to its early spawning in spring, causing slower larval development until first feeding.

  16. Multiscale patterns in the diversity and organization of benthic intertidal fauna among French Atlantic estuaries

    Science.gov (United States)

    Blanchet, Hugues; Gouillieux, Benoît; Alizier, Sandrine; Amouroux, Jean-Michel; Bachelet, Guy; Barillé, Anne-Laure; Dauvin, Jean-Claude; de Montaudouin, Xavier; Derolez, Valérie; Desroy, Nicolas; Grall, Jacques; Grémare, Antoine; Hacquebart, Pascal; Jourde, Jérôme; Labrune, Céline; Lavesque, Nicolas; Meirland, Alain; Nebout, Thiebaut; Olivier, Frédéric; Pelaprat, Corine; Ruellet, Thierry; Sauriau, Pierre-Guy; Thorin, Sébastien

    2014-07-01

    Based on a parallel sampling conducted during autumn 2008, a comparative study of the intertidal benthic macrofauna among 10 estuarine systems located along the Channel and Atlantic coasts of France was performed in order to assess the level of fauna similarity among these sites and to identify possible environmental factors involved in the observed pattern at both large (among sites) and smaller (benthic assemblages) scales. More precisely this study focused on unraveling the observed pattern of intertidal benthic fauna composition and diversity observed at among-site scale by exploring both biotic and abiotic factors acting at the among- and within-site scales. Results showed a limited level of similarity at the among-site level in terms of intertidal benthic fauna composition and diversity. The observed pattern did not fit with existing transitional water classification methods based on fish or benthic assemblages developed in the frame of the European Water Framework Directive (WFD). More particularly, the coastal plain estuaries displayed higher among-site similarity compared to ria systems. These coastal plain estuaries were characterized by higher influence of river discharge, lower communication with the ocean and high suspended particulate matter levels. On the other hand, the ria-type systems were more dissimilar and different from the coastal plain estuaries. The level of similarity among estuaries was mainly linked to the relative extent of the intertidal "Scrobicularia plana-Cerastoderma edule" and "Tellina tenuis" or "Venus" communities as a possible consequence of salinity regime, suspended matter concentrations and fine particles supply with consequences on the trophic functioning, structure and organization of benthic fauna. Despite biogeographical patterns, the results also suggest that, in the context of the WFD, these estuaries should only be compared on the basis of the most common intertidal habitat occurring throughout all estuarine systems

  17. Evolution of the fracture process zone in high-strength concrete under different loading rates

    Directory of Open Access Journals (Sweden)

    Cámara M.

    2010-06-01

    Full Text Available For cementitious materials, the inelastic zone around a crack tip is termed as fracture process zone (FPZ and dominated by complicated mechanism, such as microcracking, crack deflection, bridging, crack face friction, crack tip blunting by voids, crack branching, and so on. Due to the length of the FPZ is related with the characteristic length of the cementitious materials, the size, extent and location of the FPZ has been the object of countless research efforts for several decades. For instance, Cedolin et al. [1] have used an optical method based on the moiré interferometry to determine FPZ in concrete. Castro-Montero et al. [2] have applied the method of holographic interferometry to mortar to study the extension of the FPZ. The advantage of the interferometry method is that the complete FPZ can be directly observed on the surface of the sample. Swartz et al. [3] has adopted the dye penetration technique to illustrate the changing patterns observed as the crack progress from the tensile side to the compression side of the beam. Moreover, acoustic emission (AE is also an experimental technique well suited for monitoring fracture process. Haidar et al. [4] and Maji et al. [5] have studied the relation between acoustic emission characteristics and the properties of the FPZ. Compared with the extensive research on properties of the FPZ under quasi-static loading conditions, much less information is available on its dynamic characterization, especially for high-strength concrete (HSC. This paper presents the very recent results of an experimental program aimed at disclosing the loading rate effect on the size and velocity of the (FPZ in HSC. Eighteen three-point bending specimens were conducted under a wide range of loading rates from from 10-4 mm/s to 103 mm/s using either a servo-hydraulic machine or a self-designed drop-weight impact device. The beam dimensions were 100 mm 100 mm in cross section, and 420 mm in length. The initial notch

  18. The effects of online science instruction using geographic information systems to foster inquiry learning of teachers and middle school science students

    Science.gov (United States)

    Hagevik, Rita Anne

    This study investigated the effects of using Geographic Information Systems (GIS) to improve middle school students' and their teachers' understanding of environmental content and GIS. Constructivism provided the theoretical framework with Bonnstetter's inquiry evolution and Swartz's problem solving as the conceptual framework for designing these GIS units and interpreting the results. Teachers from nine schools in five counties attended a one-week workshop and follow-up session, where they learned how to teach the online Mapping Our School Site (www.ncsu.edu/scilink/studysite) and CITYgreen GIS inquiry-based problem-solving units. Two years after the workshop, two teachers from the workshop taught the six week Mapping Our School Site (MOSS) unit in the fall and one teacher from a different school taught the MOSS unit in the fall and the CITYgreen GIS unit in the spring. The students in the MOSS experimental group (n = 131) and the CITYgreen GIS comparison group (n = 33) were compared for differences in understanding of environmental content. Other factors were investigated such as students' spatial abilities, experiences, and learning preferences. Teachers and students completed the online Learning Styles Inventory (LSI), Spatial Experience Survey (SES), and the Purdue Spatial Visualization Test: Rotations (PSVT:R). Using qualitative and quantitative analyses, results indicated that the CITYgreen GIS group learned the environmental content better than the MOSS group. The MOSS group better understood how to design experiments and to use GIS to analyze problem questions. Both groups improved in problem identification and problem solving, data accuracy, and hypothesis testing. The spatial reasoning score was compared to learning style as reported on the LSI, and other spatial experiences as reported on the SES. Males scored higher than females on the spatial reasoning test, the more computer games played the higher the score, and the fewer shop classes taken the

  19. EFEITO DO TRATAMENTO TÉRMICO NAS CARACTERÍSTICAS FÍSICO-QUÍMICAS E MICROBIOLÓGICAS DA POLPA DE MARACUJÁ

    Directory of Open Access Journals (Sweden)

    ALESSANDRA PADOVANE AMARO

    2009-07-01

    Full Text Available

    Frutos de maracujá amarelo (Passjflora edulls f. flavicarpa Deg., material IAC-275, foram processados para a obtenção da polpa. A polpa obtida foi pasteurizada durante 30 segundos empregando três faixas de temperatura (69 a 72ºC, 73 a 76ºC e 77 a 82ºC. Foi também obtida polpa fresca (sem pasteurizar. Polpas fresca e pasteurizadas foram comparadas utilizando avaliações físico-químicas e microbiológicas. Não houve diferença significativa (p > 0,05 nos valores de acidez total, no pH e no ratio das polpas fresca e pasteurizada. A polpa fresca apresentou menor conteúdo de sólidos solúveis totais (p < 0,05 em relação à polpa pasteurizada e conteúdo de vitamina C praticamente similar, embora tenha havido diferença significativa (p < 0,05 entre a polpa pasteurizada na faixa de temperatura de 69 a 72ºC e as demais. As perdas de vitamina C decorrentes do processamento foram de 5%,4% e 0,6%, quando as faixas de temperatura de 69 a 72°C, 73 a 76°C e 77 a 82°C foram, respectivamente, empregadas. Os resultados da análise microbiológica mostraram que as polpas pasteurizadas apresentaram contagem de bolores e leveduras, de mesófilos aeróbios e de psicrófilos aeróbios significativamente (p < 0,05 menor quando comparadas à polpa fresca, indicando que o tratamento térmico empregado foi adequado.

  20. [State strategy for Cycad (Zamiaceae) conservation: a proposal for the State of Hidalgo, Mexico].

    Science.gov (United States)

    Vite, Aurelia; Pulido, María T; Flores-Vázquez, Juan C

    2013-09-01

    Mexico has the second largest cycad diversity in the world, and the Sierra Madre Oriental (SMO) is one of the richest biogeographic regions for these plants. Despite there is a general Cycad National Program in the country, there are no state-level cycad conservation strategies or programs. Thus the aim of this study was to propose a cycad conservation strategy for the state of Hidalgo, which is located in the Southern part of the SMO. For this, a cycad species inventory was made in the state, for which three methods were used: review of published literature; consultation in the main Mexican herbaria to verify botanical specimens; and exhaustive field research to compare findings with previously reported species and to recognize new records at the county and state level. The proposed research work strategy combined the following elements: prioritize the county and local areas with greatest cycad species richness; prioritize the species least resistant to environmental change and/or having restricted geographic distribution; and to consider the main uses of these plants by local residents. The results showed that Hidalgo has three genera and eight species ofcycads: Ceratozamia fuscoviridis, C. latifolia, C. mexicana, C. sabatoi, Dioon edule, Zamia fischeri, Z. loddigesii and Z. vazquezii, all of which are considered by the International Union for Conservation of Nature (IUCN). This study added two new species records for Hidalgo and 21 at the county level. The species are distributed in 26 counties, of which Chapulhuacán and Pisaflores are notable for their high species richness. Hidalgo has the fourth-greatest cycad species richness among Mexican states, although its area accounts for only 1.07% of the country. The state's diversity is greater than in other states with larger area, and even than in some other entire countries in Mesoamerica. The presented state cycad conservation strategy proposes that a total of some 11,325 ha to be conserved in nine zones

  1. Source and impact of lead contamination on δ-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

    International Nuclear Information System (INIS)

    Company, R.; Serafim, A.; Lopes, B.; Cravo, A.; Kalman, J.; Riba, I.; DelValls, T.A.; Blasco, J.; Delgado, J.; Sarmiento, A.M.; Nieto, J.M.; Shepherd, T.J.; Nowell, G.; Bebianno, M.J.

    2011-01-01

    Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme (δ-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ( 206 Pb/ 204 Pb, 207 Pb/ 204 Pb and 208 Pb/ 204 Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 ± 1.09 μg g -1 Pb d.w.) and D. trunculus (1.95 ± 0.10 μg g -1 Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels ( -1 Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e -8.3[Pb] ; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in marine bivalve species with different feeding habits. Lead isotope data

  2. The impact of extreme flooding events and anthropogenic stressors on the macrobenthic communities’ dynamics

    Science.gov (United States)

    Cardoso, P. G.; Raffaelli, D.; Lillebø, A. I.; Verdelhos, T.; Pardal, M. A.

    2008-02-01

    , heavy flooding in the Mondego region during the recovery process had more severe effects on these assemblages than expected, effectively re-setting the recovery clock, with significant socio-economic impacts (e.g. high mortality of fish in fish farms, and a large decline of economically important species, such as the bivalves Scrobicularia plana and Cerastoderma edule). The frequency and magnitude of these extreme events is predicted to increase in future years [IPCC WGI, 2001. Climate change 2001: the scientific basis, contribution of working group I to the third assessment report of the Intergovernmental Panel on Climate Change (IPCC). In: Houghton, J.T., Ding, Y., Griggs, D.J., Noguer, M., van der Linden, P.J., Xiaosu, D. (Eds.), Cambridge University Press, UK, 944 p.] and there is a risk that impacted ecosystems will never recover fully, with far-reaching consequences for human well being.

  3. Renovação de pastagem degradada de capim-gordura com a introdução de forrageiras tropicais adubadas com nitrogênio ou em consórcios Renewing the degraded Melinis minutiflora pasture by introduction of tropical forages fertilized with nitrogen or under mixture cropping system

    Directory of Open Access Journals (Sweden)

    Luciano de Melo Moreira

    2005-04-01

    Full Text Available Um experimento foi conduzido com objetivo de avaliar a produtividade e qualidade do capim-braquiária (Brachiaria decumbens Stapf. cv. Basilisk e do capim-jaraguá (Hyparrhenia rufa (Ness Stapf. adubados com nitrogênio (N ou em consórcios com estilosantes (Stylosanthes guianensis (Aubl. Swartz cv. Mineirão, introduzidos em uma pastagem degradada. Foram avaliadas duas gramíneas (capim-braquiária e capim-jaraguá, quatro doses de N (0, 50, 100 e 150 kg/ha e dois tratamentos referentes aos consórcios capim-braquiária + estilosantes e capim-jaraguá + estilosantes. Após estabelecimento das forrageiras, foram realizadas duas avaliações (colheitas. As produções de matéria seca (MS do capim-braquiária aumentaram de 1.824 para 4.604 kg/ha e de 1.019 para 2.149 kg/ha nas duas colheitas, respectivamente, quando as doses de N extremas foram comparadas, porém não houve resposta do capim-jaraguá. O teor de proteína bruta (PB do capim-braquiária elevou de 3,18 para 5,68 dag/kg apenas na primeira colheita, enquanto o capim-jaraguá apresentou incremento de 2,53 para 3,72 dag/kg e de 7,32 para 8,45 dag/kg, respectivamente, em ambas as colheitas, quando comparadas às doses extremas. Os teores de fibra em detergente neutro (FDN e fibra em detergente ácido das gramíneas não foram influenciados pela aplicação de N. Em ambas as colheitas, ao se elevarem as doses de N, houve diminuição dos teores de P nas duas gramíneas e de K no capim-braquiária. Os teores de Ca e Mg das gramíneas, em sua maioria, não foram influenciados pelo N, em ambas as colheitas. As produções médias de MS dos dois consórcios foram superiores às produções médias das duas gramíneas adubadas, com incrementos de 42,62 e 15,00% no rendimento forrageiro, na primeira e segunda colheitas, respectivamente. As forrageiras em consórcios, de forma geral, apresentaram teores de PB e Ca mais elevados e de FDN mais baixos que as gramíneas puras adubadas com N

  4. Avaliação de herbicidas no controle de plantas daninhas na cultura da soja Evaluation of herbicides in the control of weeds in the soybean crop

    Directory of Open Access Journals (Sweden)

    A.C. De Barros

    1992-01-01

    Full Text Available Foi conduzido em Serranópolis, GO, um ensaio objetivando avaliar a eficiência e a seletividade de herbicidas no controle de plantas daninhas na cultura da soja (Glycine max (L. Merril, utilizando-se os seguintes tratamentos: A 100 g/ha de imazethapyr (ácido 2-[4,5-dihidro-4-metil-4(1-metiletil-5-oxo-1H-imidazol-2-ilo]-5-etil-3-piridinacarboxilico + surfactante, a 0,25% v/v; B tratamento A e 15 dias após, 230 g/ha de sethoxydim (2-1-etoximino-butil-5-2(etiltio-propil-3-hidroxi-2-ciclohexeno-1-ona + óleo mineral, a 0,25% v/v; C 230 g/ha de sethoxydim + óleo mineral, a 0,25% v/v; D 480 + 200 + 230 g/ha de bentazon (3-isopropil-2,1,3-benzotiadiazinona-(4-2,2-dióxido + fomesafen (5-2-cloro-4-(trifluorometil-fenoxiN-metilsulfonil-2-nitrobenzamida + sethoxydim + óleo mineral, 0,25% v/v; E 150 g/ha de imazaquim (2-[4,5-dihidro-4-metil-4-(1-metiletil-5-oxo-1H-imidazol-2-ilo]-3-quinolinacarboxílico pré-e e 230 g/ha de sethoxydim + óleo mineral, 0,25% v/v; F 250 g/ha de fomesafen + 187 g/ha de fluazipop-p-butil (butil-(R-2-(4-(5-trifluorometil-2-piridiloxi-fenoxi-propionato + surfactante a 0,2% v/v; G 120 g/ha de imazethapyr + surfactante a 0,2% v/v; H testemunha capinada; I testemunha não capinada. O delineamento experimental foi de blocos ao acaso, com quatro repetições. O capim-custódio (Pennisetum setosum (Swartz L. Rich foi eficientemente controlado por todos os tratamentos químicos, enquanto a falsa-serralha (Emilia sonchifolia DC. foi somente pelo tratamento D. O capim-carrapicho (Cenchrus echinatus L. por C, D, E e F. O joá-de-capote (Nicandra physaloides (L. Pers. por D.F. e G. Ocorreram injúrias iniciais às plantas de soja, nos tratamentos D, E. e F. As alturas de plantas e de inserção da primeira vagem, além do rendimento de grãos, não foram influenciados significativamente pelos herbicidas.An experiment was carried out in Serranópolis, State of Goiás, Brazil, aiming to evaluate herbicides efficiency in weeds control

  5. Using mHealth to Increase Treatment Utilization Among Recently Incarcerated Homeless Adults (Link2Care): Protocol for a Randomized Controlled Trial.

    Science.gov (United States)

    Reingle Gonzalez, Jennifer M; Businelle, Michael S; Kendzor, Darla; Staton, Michele; North, Carol S; Swartz, Michael

    2018-06-05

    (smartphone-based case management). Those assigned to smartphone-based case management will receive smartphones that prompt (twice weekly) connections to shelter-based case managers. The app will also offer direct links to case managers (available during normal business hours) and crisis interventionists (available 24 hours a day, 7 days a week) with the touch of a button. Recruitment began in the spring of 2018, and data collection will conclude in 2021. This research represents an important step toward integrated service connection and health care service provision for one of the most underserved, high need, and understudied populations in the United States. ClinicalTrials.gov NCT03399500; https://clinicaltrials.gov/ct2/show/NCT03399500 (Archived by WebCite at http://www.webcitation.org/6zSJwdgUS). RR1-10.2196/9868. ©Jennifer M Reingle Gonzalez, Michael S Businelle, Darla Kendzor, Michele Staton, Carol S North, Michael Swartz. Originally published in JMIR Research Protocols (http://www.researchprotocols.org), 05.06.2018.

  6. Source and impact of lead contamination on {delta}-aminolevulinic acid dehydratase activity in several marine bivalve species along the Gulf of Cadiz

    Energy Technology Data Exchange (ETDEWEB)

    Company, R.; Serafim, A.; Lopes, B.; Cravo, A. [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal); Kalman, J.; Riba, I.; DelValls, T.A. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Blasco, J. [Instituto Ciencias Marinas Andalucia (CSIC), Campus Rio San Pedro, 11510 Puerto Real, Cadiz (Spain); Delgado, J. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Sarmiento, A.M. [Catedra UNESCO/UNITWIN/WiCop, Department of Physical-Chemistry, Faculty Marine and Environmental Sciences, University of Cadiz, 11510 Puerto Real, Cadiz (Spain); Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Nieto, J.M. [Department of Geology, University of Huelva, Avda Fuerzas Armadas s/n, 21071 Huelva (Spain); Shepherd, T.J.; Nowell, G. [Department of Earth Sciences, University of Durham, Science Laboratories, Durham DH1 3LE (United Kingdom); Bebianno, M.J., E-mail: mbebian@ualg.pt [CIMA, University of Algarve, Campus de Gambelas, 8005-139 Faro (Portugal)

    2011-01-17

    Coastal areas and estuaries are particularly sensitive to metal contamination from anthropogenic sources and in the last few decades the study of space-time distribution and variation of metals has been extensively researched. The Gulf of Cadiz is no exception, with several rivers draining one of the largest concentrations of sulphide deposits in the world, the Iberian Pyrite Belt (IPB). Of these rivers, the Guadiana, one of the most important in the Iberian Peninsula, together with smaller rivers like the Tinto and Odiel, delivers a very high metal load to the adjacent coastal areas. The purpose of this work was to study the source and impact of lead (Pb) drained from historical or active mining areas in the IPB on the activity of a Pb inhibited enzyme ({delta}-aminolevulinic acid dehydratase, ALAD) in several bivalve species along the Gulf of Cadiz. Seven marine species (Chamelea gallina, Mactra corallina, Donax trunculus, Cerastoderma edule, Mytilus galloprovincialis, Scrobicularia plana and Crassostrea angulata) were collected at 12 sites from Mazagon, near the mouth of the rivers Tinto and Odiel (Spain), to Cacela Velha (Ria Formosa lagoon system, Portugal). Lead concentrations, ALAD activity and lead isotope ratios ({sup 206}Pb/{sup 204}Pb, {sup 207}Pb/{sup 204}Pb and {sup 208}Pb/{sup 204}Pb) were determined in the whole soft tissues. The highest Pb concentrations were determined in S. plana (3.50 {+-} 1.09 {mu}g g{sup -1} Pb d.w.) and D. trunculus (1.95 {+-} 0.10 {mu}g g{sup -1} Pb d.w.), while M. galloprovincialis and C. angulata showed the lowest Pb levels (<0.38 {mu}g g{sup -1} Pb d.w.). In general, ALAD activity is negatively correlated with total Pb concentration. However this relationship is species dependent (e.g. linear for C. gallina ALAD = -0.36[Pb] + 0.79; r = 0.837; or exponential for M. galloprovincialis ALAD = 2.48e{sup -8.3[Pb]}; r = 0.911). This indicates that ALAD activity has considerable potential as a biomarker of Pb and moreover, in

  7. Artificial radioactivity in the environmental samples as IAEA reference materials

    International Nuclear Information System (INIS)

    Salagean, M.; Pantelica, A.

    1998-01-01

    Radioactivity levels of 110m Ag, 241 Am, 60 Co, 134 Cs, 137 Cs, 106 Ru, 125 Sb in some biological and environmental materials have been determined by gamma-ray spectrometry in the frame of 15 intercomparison runs organized by IAEA during 1986-1995. The investigated materials were polluted by various nuclear activities, as follows: 1. Nuclear experiments: IAEA-367, sediment collected in 1982 at the Enewetak Atoll (Marshall Islands in the Pacific Ocean). This atoll was used by the USA during 1948-1958 to test nuclear devices; IAEA-368, sediment collected in June 1989 from the Pacific Ocean at the Mururoa Atoll. Since 1966 this atoll has been used by France to test different nuclear devices. 2. Nuclear installations: IAEA-134, cockle flesh of Cardium edule collected in March 1991 from the Irish Sea (Morecambe Bay), England, about 45 km S-E of Sellafield radioactive discharge; IAEA-135, sediment collected in July 1991 in Lune Estuary-England. This area is influenced by the radioactive discharges of the nuclear installations of Sellafield; IAEA-326, soil collected in 1990 in the region of Kursk Atomic Power Plant (Russia). 3. Nuclear accidents (Chernobyl): IAEA-306, sediment collected in the Baltic Sea during October-November 1986; IAEA-307, seaplant Posidonia oceanica, collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-308, mixed seaweeds collected in October 1986 in Mediterranean Sea along the shore, in the vicinity of the Principality of Monaco; IAEA-156, clover collected during the summer harvest 1986 in Austria; IAEA-321, milk powder collected in autumn 1987 from a processing plant in Europe; IAEA-352, tuna fish flesh collected in April 1988 in the Western Mediterranean Sea; IAEA-373, grass collected from Kiev region during the summer harvest 1990; IAEA-375, soil collected in July 1990 from Brjansk region, Russia; IAEA-300, sediment collected in July 1992 in Bothnian Sea (Baltic Sea). 4

  8. BiodosEPR-2006 Meeting: Acute dosimetry consensus committee recommendations on biodosimetry applications in events involving uses of radiation by terrorists and radiation accidents

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, George A. [U.S. Department of Health and Human Services, Office of Preparedness and Emergency Operations, 200 Independence Avenue, SW, Room 403B-1, Washington, DC 20201 (United States); Swartz, Harold M. [Dept. of Radiology and Physiology Dept., Dartmouth Medical School, HB 7785, Vail 702, Rubin 601, Hanover, NH 03755 (United States); Amundson, Sally A. [Center for Radiological Research, Columbia University Medical Center, 630 W. 168th Street, VC11-215, New York, NY 10032 (United States); Blakely, William F. [Armed Forces Radiobiology Research Inst., 8901 Wisconsin Avenue, Bethesda, MD 20889-5603 (United States)], E-mail: blakely@afrri.usuhs.mil; Buddemeier, Brooke [Science and Technology, U.S. Department of Homeland Security, Washington, DC 20528 (United States); Gallez, Bernard [Biomedical Magnetic Resonance Unit and Lab. of Medicinal Chemistry and Radiopharmacy, Univ. Catholique de Louvain, Brussels (Belgium); Dainiak, Nicholas [Dept. of Medicine, Bridgeport Hospital, 267 Grant Street, Bridgeport, CT 06610 (United States); Goans, Ronald E. [MJW Corporation, 1422 Eagle Bend Drive, Clinton, TN 37716-4029 (United States); Hayes, Robert B. [Remote Sensing Lab., MS RSL-47, P.O. Box 98421, Las Vegas, NV 89193 (United States); Lowry, Patrick C. [Radiation Emergency Assistance Center/Training Site (REAC/TS), Oak Ridge Associated Universities, P.O. Box 117, Oak Ridge, TN 37831-0117 (United States); Noska, Michael A. [Food and Drug Administration, FDA/CDRH, 1350 Piccard Drive, HFZ-240, Rockville, MD 20850 (United States); Okunieff, Paul [Dept. of Radiation Oncology (Box 647), Univ. of Rochester, 601 Elmwood Avenue, Rochester, NY 14642 (United States); Salner, Andrew L. [Helen and Harry Gray Cancer Center, Hartford Hospital, 80 Seymour Street, Hartford, CT 06102 (United States); Schauer, David A. [National Council on Radiation Protection and Measurements, 7910 Woodmont Avenue, Suite 400, Bethesda, MD 20814-3095 (United States)] (and others)

    2007-07-15

    In the aftermath of a radiological terrorism incident or mass-casualty radiation accident, first responders and receivers require prior guidance and pre-positioned resources for assessment, triage and medical management of affected individuals [NCRP, 2005. Key elements of preparing emergency responders for nuclear and radiological terrorism. NCRP Commentary No. 19, Bethesda, Maryland, USA]. Several recent articles [Dainiak, N., Waselenko, J.K., Armitage, J.O., MacVittie, T.J., Farese, A.M., 2003. The hematologist and radiation casualties. Hematology (Am. Soc. Hematol. Educ. Program) 473-496; Waselenko, J.K., MacVittie, T.J., Blakely, W.F., Pesik, N., Wiley, A.L., Dickerson, W.E., Tsu, H., Confer, D.L., Coleman, C.N., Seed, T., Lowry, P., Armitage, J.O., Dainiak, N., Strategic National Stockpile Radiation Working Group, 2004. Medical management of the acute radiation syndrome: recommendations of the Strategic National Stockpile Radiation Working Group. Ann. Intern. Med. 140(12), 1037-1051; Blakely, W.F., Salter, C.A., Prasanna, P.G., 2005. Early-response biological dosimetry-recommended countermeasure enhancements for mass-casualty radiological incidents and terrorism. Health Phys. 89(5), 494-504; Goans, R.E., Waselenko, J.K., 2005. Medical management of radiation casualties. Health Phys. 89(5), 505-512; Swartz, H.M., Iwasaki, A., Walczak, T., Demidenko, E., Salikhov, I., Lesniewski, P., Starewicz, P., Schauer, D., Romanyukha, A., 2005. Measurements of clinically significant doses of ionizing radiation using non-invasive in vivo EPR spectroscopy of teeth in situ. Appl. Radiat. Isot. 62, 293-299; . Acute radiation injury: contingency planning for triage, supportive care, and transplantation. Biol. Blood Marrow Transplant. 12(6), 672-682], national [. Management of persons accidentally contaminated with radionuclides. NCRP Report No. 65, Bethesda, Maryland, USA; . Management of terrorist events involving radioactive material. NCRP Report No. 138, Bethesda, Maryland

  9. BiodosEPR-2006 Meeting: Acute dosimetry consensus committee recommendations on biodosimetry applications in events involving uses of radiation by terrorists and radiation accidents

    International Nuclear Information System (INIS)

    Alexander, George A.; Swartz, Harold M.; Amundson, Sally A.; Blakely, William F.; Buddemeier, Brooke; Gallez, Bernard; Dainiak, Nicholas; Goans, Ronald E.; Hayes, Robert B.; Lowry, Patrick C.; Noska, Michael A.; Okunieff, Paul; Salner, Andrew L.; Schauer, David A.

    2007-01-01

    In the aftermath of a radiological terrorism incident or mass-casualty radiation accident, first responders and receivers require prior guidance and pre-positioned resources for assessment, triage and medical management of affected individuals [NCRP, 2005. Key elements of preparing emergency responders for nuclear and radiological terrorism. NCRP Commentary No. 19, Bethesda, Maryland, USA]. Several recent articles [Dainiak, N., Waselenko, J.K., Armitage, J.O., MacVittie, T.J., Farese, A.M., 2003. The hematologist and radiation casualties. Hematology (Am. Soc. Hematol. Educ. Program) 473-496; Waselenko, J.K., MacVittie, T.J., Blakely, W.F., Pesik, N., Wiley, A.L., Dickerson, W.E., Tsu, H., Confer, D.L., Coleman, C.N., Seed, T., Lowry, P., Armitage, J.O., Dainiak, N., Strategic National Stockpile Radiation Working Group, 2004. Medical management of the acute radiation syndrome: recommendations of the Strategic National Stockpile Radiation Working Group. Ann. Intern. Med. 140(12), 1037-1051; Blakely, W.F., Salter, C.A., Prasanna, P.G., 2005. Early-response biological dosimetry-recommended countermeasure enhancements for mass-casualty radiological incidents and terrorism. Health Phys. 89(5), 494-504; Goans, R.E., Waselenko, J.K., 2005. Medical management of radiation casualties. Health Phys. 89(5), 505-512; Swartz, H.M., Iwasaki, A., Walczak, T., Demidenko, E., Salikhov, I., Lesniewski, P., Starewicz, P., Schauer, D., Romanyukha, A., 2005. Measurements of clinically significant doses of ionizing radiation using non-invasive in vivo EPR spectroscopy of teeth in situ. Appl. Radiat. Isot. 62, 293-299; . Acute radiation injury: contingency planning for triage, supportive care, and transplantation. Biol. Blood Marrow Transplant. 12(6), 672-682], national [. Management of persons accidentally contaminated with radionuclides. NCRP Report No. 65, Bethesda, Maryland, USA; . Management of terrorist events involving radioactive material. NCRP Report No. 138, Bethesda, Maryland

  10. Brain order disorder 2nd group report of f-EEG

    Science.gov (United States)

    Lalonde, Francois; Gogtay, Nitin; Giedd, Jay; Vydelingum, Nadarajen; Brown, David; Tran, Binh Q.; Hsu, Charles; Hsu, Ming-Kai; Cha, Jae; Jenkins, Jeffrey; Ma, Lien; Willey, Jefferson; Wu, Jerry; Oh, Kenneth; Landa, Joseph; Lin, C. T.; Jung, T. P.; Makeig, Scott; Morabito, Carlo Francesco; Moon, Qyu; Yamakawa, Takeshi; Lee, Soo-Young; Lee, Jong-Hwan; Szu, Harold H.; Kaur, Balvinder; Byrd, Kenneth; Dang, Karen; Krzywicki, Alan; Familoni, Babajide O.; Larson, Louis; Harkrider, Susan; Krapels, Keith A.; Dai, Liyi

    2014-05-01

    Since the Brain Order Disorder (BOD) group reported on a high density Electroencephalogram (EEG) to capture the neuronal information using EEG to wirelessly interface with a Smartphone [1,2], a larger BOD group has been assembled, including the Obama BRAIN program, CUA Brain Computer Interface Lab and the UCSD Swartz Computational Neuroscience Center. We can implement the pair-electrodes correlation functions in order to operate in a real time daily environment, which is of the computation complexity of O(N3) for N=102~3 known as functional f-EEG. The daily monitoring requires two areas of focus. Area #(1) to quantify the neuronal information flow under arbitrary daily stimuli-response sources. Approach to #1: (i) We have asserted that the sources contained in the EEG signals may be discovered by an unsupervised learning neural network called blind sources separation (BSS) of independent entropy components, based on the irreversible Boltzmann cellular thermodynamics(ΔS function. (i) Although the entropy itself is not the information per se, but the concurrence of the entropy sources is the information flow as a functional-EEG, sketched in this 2nd BOD report. Area #(2) applying EEG bio-feedback will improve collective decision making (TBD). Approach to #2: We introduce a novel performance quality metrics, in terms of the throughput rate of faster (Δt) & more accurate (ΔA) decision making, which applies to individual, as well as team brain dynamics. Following Nobel Laureate Daniel Kahnmen's novel "Thinking fast and slow", through the brainwave biofeedback we can first identify an individual's "anchored cognitive bias sources". This is done in order to remove the biases by means of individually tailored pre-processing. Then the training effectiveness can be maximized by the collective product Δt * ΔA. For Area #1, we compute a spatiotemporally windowed EEG in vitro average using adaptive time-window sampling. The sampling rate depends on the type of neuronal

  11. Basidiomicetes de Costa Rica: nuevas especies de Exobasidium (Exobasidiaceae y registros de Cryptobasidiales

    Directory of Open Access Journals (Sweden)

    Luis D. Gómez P

    1998-12-01

    centroamericanos.Six new species in the genus Exobasidium are described: E. aequatorianum n. sp., parasitic on Vaccinium crenatum (Don Sleumer from Ecuador where it is widely distributed; E. arctostaphyli Harkn., found on Arctostaphylos arbutoides (Lindl. Hemsl., and on Comarostaphylos costaricensis Small in Costa Rica is redescribed; E. jamaicense n. sp., on Lyonia jamaicensis (Swartz D.Don from Jamaica and possibly throughout the Caribbean range of the host genus; E. disterigmicola n.sp., on Disterigma humboldtii (Kl. Nied., from the Talamanca Range, Costa Rica and possibly, throughout the range of its host, E. sphyrospermii n. sp.,on Sphyrospermum cordifolium Bentham in Costa Rica, E. poasanum n. sp., on Cavendishia bracteata (R. & P. ex J. St.-Hil. Hoer., from the Poás massif in Costa Rica. Exobasidium escalloniae Gómez & Kisimova, described from Costa Rica, is now known to occur in Ecuador on the same host, Escallonia myrtilloides L.f. Exobasidium vaccinii (Fkl. Wor. is here reported from Vaccinium floribundum H.B.K. from various Ecuadorean localities, and E. pernettyae n. sp. is described as a parasite of Pernettya prostrata (Cav. DC in Costa Rica. With the exception of Escallonia, of saxifragaceous affinities, all hosts belong in the Ericaceae. Exobasidium arctostaphyli is a first record for the neotropical region. With the exception of E. jamaicense, not seen in the wild by us, all others have been found associated with small slugs (Mollusca: Limacidae which are suspected to be one of the vectors of the parasite. Some biogeographical considerations are presented. The Cryptobasidiaceae Clinoconidium bullatum Syd., not collected since first described in 1925, and Clinoconidium farinosum (P. Henn. Pat., are both parasites of Lauraceae, Cinnamomum sp. and Ocotea monteverdensis Burger, respectively, and were found in the Monteverde Reserve, Costa Rica. Drepanoconis larviformis (Speg. Speg. is reported as a parasite of Aiouea costaricensis (Mez Kosterm. from the cloud forests

  12. Light responses in Photoperiodism in Arabidopsis thaliana

    Energy Technology Data Exchange (ETDEWEB)

    Anthony R. Cashmore

    2006-08-01

    domains. It is this cysteine residue that forms a covalent adduct with the bound flavin in the photocycle of PHOT1 and FKF1. In the mutant ADO1 this cysteine is replaced by an alanine. We argue that if ADO1 functions as a photoreceptor in a similar fashion to PHOT1, then this mutant ADO1 should not be able to rescue the altered circadian phenotype of ado1 mutant plants. We find under white light, that indeed this is the case. Experiments underway are aimed at determining if the altered circadian phenotype under blue and red light are similarly unable to be rescued by the mutant gene, and we are performing similar experiments under red light with respect to the defect in hypocotyl elongation. The results from these experiments will likely support the hypothesis that ADO1 functions as a blue light photoreceptor, and they will address the question concerning whether or not the altered properties of the ado1 mutant under red light are also a reflection of this photoreceptor function. References. Briggs, W. R., Beck, C. F., Cashmore, A. R., Christie, J. M., Hughes, J., Jarillo, J. A., Kagawa, T., Kanegae, H., Liscum, E., Nagatani, A., et al. (2001). The phototropin family of photoreceptors. Plant Cell 13, 993-997. Christie, J. M., Reymond, P., Powell, G. K., Bernasconi, P., Raibekas, A. A., Liscum, E., and Briggs, W. R. (1998). Arabidopsis NPH1: A flavoprotein with the properties of a photoreceptor for phototropism. Science 282, 1698-1701. Froehlich, A. C., Liu, Y., Loros, J. J., and Dunlap, J. C. (2002). White Collar-1, a circadian blue light photoreceptor, binding to the frequency promoter. Science 297, 815-819. Imaizumi, T., Tran, H. G., Swartz, T. E., Briggs, W. R., and Kay, S. A. (2003). FKF1 is essential for photoperiodic-specific light signalling in Arabidopsis. Nature 426, 302-306. Jarillo, J. A., Capel, J., Tang, R.-H., Yang, H.-Q., Alonso, J. M., Ecker, J. R., and Cashmore, A. R. (2001a). An Arabidopsis circadian clock component interacts with both CRY1 and phy

  13. NEWS: AAPT Summer Meeting

    Science.gov (United States)

    Mellema, Steve

    2000-11-01

    The 2000 Summer Meeting of the American Association of Physics Teachers (AAPT) was held from 28~July-2~August at the University of Guelph in Ontario, Canada. Despite somewhat rainy weather throughout the week, the annual gathering was an enjoyable one, filled with interesting talks on the state of physics education in North America. Using a new scheduling format for the summer meeting, all of the paid workshops and tutorials were held on Saturday and Sunday 29-30 July. The invited and contributed papers for the main AAPT meeting were then presented on Monday, Tuesday and Wednesday. As had been done in 1999 in San Antonio, a two-day tandem meeting dedicated to Physics Education Research (PER) was held on Wednesday and Thursday 2-3 August, immediately after the main AAPT meeting. Over the three days of the main meeting, 60 sessions were held under the sponsorship of various AAPT committees. These included sessions (numbers in parentheses) organized by the committees on Apparatus (1), Astronomy Education (3), Awards (2), Computers (5), Graduate Education (2), High Schools (1), History and Philosophy (1), Instructional Media (3), International Education (1), Laboratories (2), Pre-High School Education (2), Programs (4), Professional Concerns (6), Research in Physics Education (8), Science Education for the Public (2), Two-Year Colleges (5), Undergraduate Education (7) and Women in Physics (4). Figure 1. Guelph Church of Our Lady. The main meeting opened on Sunday evening with an invited lecture by Dr John J Simpson from the host institution, the University of Guelph, describing the Sudbury Neutrino Observatory. At the ceremonial session that began the activities on Monday morning, recognition was given to Clifford Swartz for his almost 30 years of service as Editor of the AAPT journal, The Physics Teacher. This was followed by an invited talk by Jim Nelson from Seminole County Public School in Florida, who received the Excellence in Pre-College Teaching Award. The

  14. The 15th Biannual National Congress of the South African Society of Psychiatrists, 10-14 August 2008, Fancourt, George, W Cape

    Directory of Open Access Journals (Sweden)

    Eugene Allers

    2008-08-01

    , Allison Breen, Allan J Flisher, Ritsuko Kakuma, Leslie Swartz, John Joska, Joanne Corrigall, Vikram Patel, MHaPP Research Programe Consortium 31. The cost of scaling up mental health care in low- and middle-income countries Crick Lund, Dan Chishlom, Shekhar Saxena 32. 'Tikking'Clock: The impact of a methamphetamine epidemic at a psychiatric hospital in the Western Cape P Milligan, J S Parker 33. Durban youth healh-sk behaviour: Prevalence f Violence-related behaviour D L Mkize 34. Profile of morality of patients amitted Weskoppies Psychiatric Hospital in Sout frican over a 5-Year period (2001-2005 N M Moola, N Khamker, J L Roos, P Rheeder 35. One flew over Psychiatry nest Leverne Mountany 36. The ethical relationship betwe psychiatrists and the pharmaceutical indutry Margaret  G Nair 37. Developing the frameor of a postgraduate da programme in mental health R J Nichol, B de Klerk, M M Nel, G van Zyl, J Hay 38. An unfolding story: The experience with HIV-ve patients at a Psychiatric Hospital J S Parker, P Milligan 39. Task shifting: A practical strategy for scalingup mental health care in developing countries Vikram Patel 40. Ethics: Informed consent and competency in the elderly Willie Pienaar 41. Confronting ommonmoral dilemmas. Celebrating uncertainty, while in search  patient good Willie Pienaar 42. Moral dilemmas in the treatment and repatriation of patients with psychtorders while visiting our country Duncan Ian Rodseth 43. Geriatrics workshop (Psegal symposium: Medico-legal issuess in geriatric psyhiatry Felix Potocnik 44. Brain stimulation techniques - update on recent research P J Pretorius 45. Holistic/Alternative treatments in psychiatry T Rangaka, J Dill 46. Cognitive behaviour therapy and other brief interventions for management of substances Solomon Rataemane 47. A Transtheoretical view of change Nathan P Rogerson 48. Profile of security breaches in longerm mental health care users at Weskoppies Hospital over a 6-month period Deleyn Rema, Lindiwe Mthethwa

  15. Obituary: Thomas Robert Metcalf, 1961-2007

    Science.gov (United States)

    Leka, K. D.

    2007-12-01

    recycled everything. Tom is survived by his daughters Shanon Brower, Alyssa Metcalf, and Keri Metcalf to whom he was a devoted father, their mother Janet Biggs, his parents Fred and Marilyn Metcalf, and his sister Karen (Metcalf) Swartz. A vast array of friends, colleagues, and extended family will also sorely miss him. To honor Tom's long-standing support for young researchers in solar physics, Tom's family and the Solar Physics Division of the AAS have established a travel fund for young scientists, to which contributions are most welcome: The Thomas Metcalf SPD Travel Fund American Astronomical Society 2000 Florida Ave., NW Suite 400 Washington, DC 20009-1231, USA https://members.aas.org/contributions/ Thomas_Metcalf_SPD_Travel_Fund.cfm

  16. 16th National Congress of the South African Society of Psychiatrists (SASOP

    Directory of Open Access Journals (Sweden)

    Christer Allgulander

    2010-10-01

    of start Sean Kaliski 21. Psychiatric disorders abd psychosocial correlates of high HIV risk sexual behaviour in war-effected Eatern Uganda E Kinyada, H A Weiss, M Mungherera, P Onyango Mangen, E Ngabirano, R Kajungu, J Kagugube, W Muhwezi, J Muron, V Patel 22. One year of Forensic Psychiatric assessment in the Northern Cape: A comparison with an established assessment service in the Eastern Cape N K Kirimi, C Visser 23. Mental Health service user priorities for service delivery in South Africa Sharon Kleintjes, Crick Lund, Leslie Swartz, Alan Flisher and MHaPP Research Programme Consortium 24. The nature and extent of over-the-counter and prescription drug abuse in cape town Liezl Kramer 25. Physical health issues in long-term psychiatric inpatients: An audit of nursing statistics and clinical files at Weskoppies Hospital Christa Kruger 26. Suicide risk in Schizophrenia - 20 Years later, a cohort study Gian Lippi, Ean Smit, Joyce Jordaan, Louw Roos 27.Developing mental health information systems in South Africa: Lessons from pilot projects in Northern Cape and KwaZulu-Natal Crick Lund, S Skeen, N Mapena, C Isaacs, T Mirozev and the Mental Health and Poverty Research Programme Consortium Institution 28. Mental health aspects of South African emigration Maria Marchetti-Mercer 29. What services SADAG can offer your patients Elizabeth Matare 30. Culture and language in psychiatry Dan Mkize 31. Latest psychotic episode Povl Munk-Jorgensen 32. The Forensic profile of female offenders Mo Nagdee, Helmut Fletcher 33. The intra-personal emotional impact of practising psychiatry Margaret Nair 34. Highly sensitive persons (HSPs and implications for treatment Margaret Nair 35. Task shifting in mental health - The Kenyan experience David M Ndetei 36. Bridging the gap between traditional healers and mental health in todya's modern psychiatry David M Ndetei 37. Integrating to achieve modern psychiatry David M Ndetei 38. Non-medical prescribing: Outcomes from a pharmacist-led post