WorldWideScience

Sample records for seaborgium 273

  1. First thermochemical property of Seaborgium determined

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration

    1997-09-01

    The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.

  2. Sorption behaviour of W, Hf, Lu, U, and Th on ion exchangers from HCl/H2O2 solutions. Model experiments for chemical studies of seaborgium (Sg)

    International Nuclear Information System (INIS)

    Schumann, D.; Andrassy, M.; Nitsche, H.; Misiak, R.; Schaedel, M.; Bruechle, W.; Schausten, B.; Kratz, J.V.

    1997-08-01

    In model experiments with W, Hf, Th, and U radionuclides, a chemical system was developed for the separation of seaborgium from element 104 and heavy actinides, i.e., cation exchange on DOWEX 50 x 8 from solutions containing 0.1-1.0 M HCl and 0.5-2.0 vol.% H 2 O 2 . The system should be suitable for fast on-line experiments if seaborgium exibits a non-uranium-like behaviour. Adding hydrogen peroxide to mixed HCl/HF solutions suppresses the partial sorption of W and, presumably seaborgium, on the cation exchanger. This way, the elution volume can be minimized. Prospects for anion exchange separations of group 6 from 4 elements are also briefly discussed. (orig.)

  3. First aqueous chemistry with Seaborgium (element 106)

    International Nuclear Information System (INIS)

    Schaedel, M.; Bruechle, W.; Schausten, B.; Schimpf, E.; Jaeger, E.; Wirth, G.; Guenther, R.; Gregorich, K.E.; Hoffman, D.C.; Lee, D.M.; Sylwester, E.R.; Nagame, Y.; Oura, Y.

    1996-11-01

    For the first time, chemical separations of element 106 (Seaborgium, Sg) were performed in aqueous solutions. The isotopes 265 Sg and 266 Sg were produced in the 248 Cm+ 22 Ne reaction at a beam energy of 121 MeV. The reaction products were continuously transported by a He(KCl)-jet to the computer-controlled liquid chromatography system ARCA. In 0.1 M HNO 3 /5 x 10 -4 M HF, Sg was found to be eluted within 10 s from 1.6 x 8 mm cation-exchange columns (Aminex A6, 17.5±2 μm) together with the hexavalent Mo- and W-ions, while hexavalent U-ions and tetravalent Zr-, Hf-, and element 104 ions were strongly retained on the column. Element 106 was detected by measuring correlated α-decays of the daughter isotopes 78-s 261 104 and 26-s 257 102. For the isotope 266 Sg, we have evidence for a spontaneous fission branch. It yields a partial spontaneous-fission half-life which is in agreement with recent theoretical predictions. The chemical results show that the most stable oxidation state of Sg in aqueous solution is +6, and that like its homologs Mo and W, Sg forms neutral or anionic oxo- or oxohalide-compounds under the present condition. In these first experiments, Sg exhibits properties very characteristic of group 6 elements, and does not show U-like properties. (orig.)

  4. Dicty_cDB: SLH273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH273 (Link to dictyBase) - - - Contig-U16280-1 SLH273P (Link to Original site) SLH2...73F 241 SLH273Z 294 SLH273P 535 - - Show SLH273 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH273Q.Seq.d/ Representative seq. ID SLH2...73P (Link to Original site) Representative DNA sequence >SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH2...ducing significant alignments: (bits) Value SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH273Q.Seq.d/ 868 0.0 SSK467 (S

  5. 39 CFR 273.10 - Reports.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual report...

  6. Dicty_cDB: VFK273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFK273 (Link to dictyBase) - - - Contig-U16028-1 | Contig-U16311-1 VFK2...73P (Link to Original site) VFK273F 633 VFK273Z 575 VFK273P 1188 - - Show VFK273 Library VF (Link to library) Clone ID VFK2...028-1 | Contig-U16311-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-D/VFK2...73Q.Seq.d/ Representative seq. ID VFK273P (Link to Original site) Representative DNA sequence >VFK273 (VFK2...73Q) /CSM/VF/VFK2-D/VFK273Q.Seq.d/ AAATCTTTATTAATATTTTTCAAAATAAATAAATAAATAAATTAAAAATGAAAGTTTTAT

  7. Erratum: IJSNEM 27(3).

    Science.gov (United States)

    2017-08-01

    The International Journal of Sport Nutrition and Exercise Metabolism 27(3), http://journals.humankinetics.com/toc/ijsnem/27/3 , was incorrectly paginated. The correct page range for this issue is 197-292. The online versions of these articles have been corrected.

  8. Dicty_cDB: VHK273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK273 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...73F 620 - - - - - - Show VHK273 Library VH (Link to library) Clone ID VHK273 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-D/VHK273Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK273 (VHK273Q) /CSM/VH/VHK2-D/VHK273Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  9. 40 CFR 273.52 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.52 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.52 Waste management. (a) A universal waste transporter must comply with all applicable U.S. Department of...

  10. 7 CFR 273.1 - Household concept.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Household concept. 273.1 Section 273.1 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.1 Household concept...

  11. 40 CFR 273.3 - Applicability-pesticides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-pesticides. 273.3... (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.3 Applicability—pesticides. (a) Pesticides covered under this part 273. The requirements of this part apply to persons managing pesticides, as...

  12. 40 CFR 273.13 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.13 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.13 Waste management. (a) Universal waste batteries. A small quantity handler of universal waste must manage...

  13. 40 CFR 273.33 - Waste management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Waste management. 273.33 Section 273...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.33 Waste management. (a) Universal waste batteries. A large quantity handler of universal waste must manage...

  14. 40 CFR 273.2 - Applicability-batteries.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Applicability-batteries. 273.2 Section...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.2 Applicability—batteries. (a) Batteries covered under 40 CFR part 273. (1) The requirements of this part apply to persons managing batteries, as...

  15. 39 CFR 273.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Definitions. 273.2 Section 273.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION ADMINISTRATION OF PROGRAM FRAUD CIVIL... representation, certification, affirmation, document, record, or accounting or bookkeeping entry made: (1) With...

  16. 25 CFR 273.53 - Applicable procurement regulations.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Applicable procurement regulations. 273.53 Section 273.53 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT General Contract Requirements § 273.53...

  17. 48 CFR 719.273-6 - Application process.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application process. 719.273-6 Section 719.273-6 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...égé Program 719.273-6 Application process. Entities interested in becoming a Mentor firm must...

  18. 40 CFR 273.4 - Applicability-Mercury-containing equipment.

    Science.gov (United States)

    2010-07-01

    ... equipment. 273.4 Section 273.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT General § 273.4 Applicability—Mercury...-containing components have been removed. (c) Generation of waste mercury-containing equipment. (1) Used...

  19. 40 CFR 273.36 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.36 Section 273.36 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A large quantity handler of universal waste must ensure that all employees are...

  20. 40 CFR 273.16 - Employee training.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Employee training. 273.16 Section 273.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... Employee training. A small quantity handler of universal waste must inform all employees who handle or have...

  1. 48 CFR 852.273-71 - Alternative negotiation techniques.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative negotiation techniques. 852.273-71 Section 852.273-71 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-71 Alternative negotiation technique...

  2. 39 CFR 273.7 - Concurrence of Attorney General.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Concurrence of Attorney General. 273.7 Section 273... PROGRAM FRAUD CIVIL REMEDIES ACT § 273.7 Concurrence of Attorney General. (a) The Attorney General is... the Attorney General or his designee approves such action in a written statement which specifies: (1...

  3. 36 CFR 27.3 - Seashore District.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Seashore District. 27.3 Section 27.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR CAPE...' studio, for appropriate small scale home occupations as the making and selling of traditional Cape Cod...

  4. 43 CFR 27.3 - Discrimination prohibited.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Discrimination prohibited. 27.3 Section 27... ISSUED UNDER TITLE II OF PUBLIC LAW 93-153 § 27.3 Discrimination prohibited. (a) General. No person shall... through contractual or other arrangements, subject an individual to discrimination on the grounds of race...

  5. 40 CFR 265.273 - Waste analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Waste analysis. 265.273 Section 265... FACILITIES Land Treatment § 265.273 Waste analysis. In addition to the waste analyses required by § 265.13... listed as a hazardous waste. As required by § 265.13, the waste analysis plan must include analyses...

  6. 47 CFR 25.273 - Duties regarding space communications transmissions.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Duties regarding space communications transmissions. 25.273 Section 25.273 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Operations § 25.273 Duties regarding space...

  7. 40 CFR 273.54 - Response to releases.

    Science.gov (United States)

    2010-07-01

    ... 273.54 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.54 Response to... other residues from universal wastes. (b) A universal waste transporter must determine whether any...

  8. 40 CFR 273.17 - Response to releases.

    Science.gov (United States)

    2010-07-01

    ... 273.17 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.17... of universal wastes and other residues from universal wastes. (b) A small quantity handler of...

  9. 40 CFR 273.37 - Response to releases.

    Science.gov (United States)

    2010-07-01

    ... 273.37 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.37... of universal wastes and other residues from universal wastes. (b) A large quantity handler of...

  10. 7 CFR 273.6 - Social security numbers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Social security numbers. 273.6 Section 273.6... normally uses the Receipt of Application for a Social Security Number, Form SSA-5028, as evidence that an... security numbers. (a) Requirements for participation. The State agency shall require that a household...

  11. 48 CFR 852.273-70 - Late offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Late offers. 852.273-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.273-70 Late offers. As prescribed in 873.110(a), insert the following provision: Late Offers (JAN 2003) This provision replaces...

  12. 33 CFR 273.17 - Annual budget request.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Annual budget request. 273.17... DEFENSE AQUATIC PLANT CONTROL § 273.17 Annual budget request. The Aquatic Plant Control Program is a... to utilize within the budget year taking into account the foreseeable availability of local funds to...

  13. 48 CFR 719.273-10 - Internal controls.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Internal controls. 719.273...égé Program 719.273-10 Internal controls. (a) OSDBU will oversee the Program and will work in... objectives. OSDBU will establish internal controls as checks and balances applicable to the Program. These...

  14. 25 CFR 273.16 - Powers and duties of Indian Education Committee.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Powers and duties of Indian Education Committee. 273.16 Section 273.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.16...

  15. 26 CFR 1.273-1 - Life or terminable interests.

    Science.gov (United States)

    2010-04-01

    ....273-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.273-1 Life or terminable interests. Amounts paid as income to the holder of a life or a terminable interest acquired by gift, bequest, or inheritance shall not...

  16. 49 CFR 192.273 - General.

    Science.gov (United States)

    2010-10-01

    ... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Joining of Materials Other Than by Welding § 192.273...

  17. A modified stratified model for the 3C 273 jet

    International Nuclear Information System (INIS)

    Liu Wenpo; Shen Zhiqiang

    2009-01-01

    We present a modified stratified jet model to interpret the observed spectral energy distributions of knots in the 3C 273 jet. Based on the hypothesis of the single index of the particle energy spectrum at injection and identical emission processes among all the knots, the observed difference of spectral shape among different 3C 273 knots can be understood as a manifestation of the deviation of the equivalent Doppler factor of stratified emission regions in an individual knot from a characteristic one. The summed spectral energy distributions of all ten knots in the 3C 273 jet can be well fitted by two components: a low-energy component (radio to optical) dominated by synchrotron radiation and a high-energy component (UV, X-ray and γ-ray) dominated by inverse Compton scattering of the cosmic microwave background. This gives a consistent spectral index of α = 0.88 (S v ∝ v -α ) and a characteristic Doppler factor of 7.4. Assuming the average of the summed spectrum as the characteristic spectrum of each knot in the 3C 273 jet, we further get a distribution of Doppler factors. We discuss the possible implications of these results for the physical properties in the 3C 273 jet. Future GeV observations with GLAST could separate the γ-ray emission of 3C 273 from the large scale jet and the small scale jet (i.e. the core) through measuring the GeV spectrum.

  18. 40 CFR 273.8 - Applicability-household and conditionally exempt small quantity generator waste.

    Science.gov (United States)

    2010-07-01

    ... conditionally exempt small quantity generator waste. 273.8 Section 273.8 Protection of Environment ENVIRONMENTAL....8 Applicability—household and conditionally exempt small quantity generator waste. (a) Persons... universal wastes defined at § 273.9; and/or (2) Conditionally exempt small quantity generator wastes that...

  19. 25 CFR 273.38 - Equal quality and standard of education.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Equal quality and standard of education. 273.38 Section... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.38 Equal quality and standard of education. Contracts with State education agencies or school districts...

  20. 49 CFR 40.273 - What is the effect of a cancelled alcohol test?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled alcohol test? 40.273 Section 40.273 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Alcohol Testing § 40.273 What is the...

  1. CKD273, a new proteomics classifier assessing CKD and its prognosis.

    Directory of Open Access Journals (Sweden)

    Ángel Argilés

    Full Text Available National Kidney Foundation CKD staging has allowed uniformity in studies on CKD. However, early diagnosis and predicting progression to end stage renal disease are yet to be improved. Seventy six patients with different levels of CKD, including outpatients and dialysed patients were studied for transcriptome, metabolome and proteome description. High resolution urinary proteome analysis was blindly performed in the 53 non-anuric out of the 76 CKD patients. In addition to routine clinical parameters, CKD273, a urinary proteomics-based classifier and its peptides were quantified. The baseline values were analyzed with regard to the clinical parameters and the occurrence of death or renal death during follow-up (3.6 years as the main outcome measurements. None of the patients with CKD2730.55. Unsupervised clustering analysis of the CKD273 peptides separated the patients into two main groups differing in CKD associated parameters. Among the 273 biomarkers, peptides derived from serum proteins were relatively increased in patients with lower glomerular filtration rate, while collagen-derived peptides were relatively decreased (p<0.05; Spearman. CKD273 was different in the groups with different renal function (p<0.003. The CKD273 classifier separated CKD patients according to their renal function and informed on the likelihood of experiencing adverse outcome. Recently defined in a large population, CKD273 is the first proteomic-based classifier successfully tested for prognosis of CKD progression in an independent cohort.

  2. 48 CFR 719.273-1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 719.273-1 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-ProtégÃ... developmental assistance to Protégé entities, fostering the establishment of long-term business relationships...

  3. An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273 (ApJ, 496, L9 [1998])

    Science.gov (United States)

    Xia, X.-Y.; Boller, Th.; Wu, H.; Deng, Z.-G.; Gao, Y.; Zou, Z.-L.; Mao, S.; Börner, G.

    1998-11-01

    In the Letter ``An X-Ray Luminous, Dwarf Seyfert Companion of Markarian 273'' by X.-Y. Xia, Th. Boller, H. Wu, Z.-G. Deng, Y. Gao, Z.-L. Zou, S. Mao, and G. Börner (ApJ, 496, L9 [1998]), an observational error occurred that invalidates some of our conclusions. Since Mrk 273x was essentially invisible (B~21) in our acqusition image, in order to position the slit on the faint Mrk 273x, a slit rotation had to be applied. Unfortunately, the amount of rotation was applied incorrectly. As a result, the spectrum obtained (shown in Fig. 2) was not for the intended target, Mrk 273x, but for an object very close to, but northeast of, Mrk 273. A new spectrum of Mrk 273x indicates that Mrk 273x is at redshift 0.458, not at 0.0378 as quoted in the Letter. The larger redshift implies that both the optical and X-ray luminosity have to be revised upward by a factor of ~170. Mrk 273x is therefore not a dwarf galaxy optically. The X-ray properties of Mrk 273x remain the same except that its soft X-ray luminosity now reaches ~1044 ergs s-1 for H0=50 km s-1 Mpc-1. The new observations will be presented in a subsequent paper (X.-Y. Xia et al., in preparation [1998]) in order to make corrections and shed further insights on the objects in the Mrk 273 field.

  4. 48 CFR 719.273-9 - Obligations under the Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... Mentor-Protégé Program. 719.273-9 Section 719.273-9 Federal Acquisition Regulations System AGENCY FOR... Development (USAID) Mentor-Protégé Program 719.273-9 Obligations under the Mentor-Protégé Program. (a) A Mentor or Protégé may voluntarily withdraw from the Program. However, in no event shall such withdrawal...

  5. 40 CFR 273.55 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.55 Off-site... universal waste being shipped off-site meets the Department of Transportation's definition of hazardous...

  6. The Multi-component X-ray Emission of 3C 273

    Science.gov (United States)

    Soldi, S.; Türler, M.; Paltani, S.; Courvoisier, T. J.-L.

    2009-05-01

    3C 273 is the brightest quasar in the sky and among the most extensively observed and studied AGN, therefore one of the most suitable targets for a long-term, multi-frequency study. The superposition of a thermal Comptonisation component, similar to that observed in Seyfert galaxies, and of a non-thermal component, related to the jet emission, seems to explain some of the spectral and timing properties of the X-ray emission of 3C 273. Yet, during some observations this dichotomy has not been observed and the variability properties could also be consistent with a single-component scenario, characterised by two parameters varying independently. In order to understand the nature of the X-ray emission in 3C 273, a series of observations up to 80-100 keV, possibly catching the source in different flux states, are essential. Simbol-X will be able to study the emission of 3C 273 in the broad 0.5-80 keV band with high sensitivity, allowing us to disentangle the emission from different spectral components, with 20-30 ks long observations. In addition, the shape and the origin of the high-energy emission of this quasar will be further constrained thanks to the AGILE and Fermi satellites, monitoring the γ-ray sky in the MeV-GeV energy domain.

  7. Prediction of Chronic Kidney Disease Stage 3 by CKD273, a Urinary Proteomic Biomarker

    DEFF Research Database (Denmark)

    Pontillo, Claudia; Zhang, Zhen-Yu; Schanstra, Joost P

    2017-01-01

    Introduction: CKD273 is a urinary biomarker, which in advanced chronic kidney disease predicts further deterioration. We investigated whether CKD273 can also predict a decline of estimated glomerular filtration rate (eGFR) to ... threshold (P = 0.086). Discussion: In conclusion, while accounting for baseline eGFR, albuminuria, and covariables, CKD273 adds to the prediction of stage 3 chronic kidney disease, at which point intervention remains an achievable therapeutic target....

  8. 40 CFR 273.14 - Labeling/marking.

    Science.gov (United States)

    2010-07-01

    ... distributed; and (2) The words “Universal Waste-Pesticide(s)” or “Waste-Pesticide(s);” (c) A container, tank... administered or recognized by a state; and (2) The words “Universal Waste-Pesticide(s)” or “Waste-Pesticide(s...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.14...

  9. 40 CFR 273.34 - Labeling/marking.

    Science.gov (United States)

    2010-07-01

    ... distributed; and (2) The words “Universal Waste—Pesticide(s)” or “Waste—Pesticide(s);” (c) A container, tank...) The words “Universal Waste—Pesticide(s)” or “Waste—Pesticide(s).” (d) (1) Mercury-containing equipment...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.34...

  10. 25 CFR 273.72 - Appeal from decision to cancel contract for cause.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Appeal from decision to cancel contract for cause. 273.72 Section 273.72 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND... decision to cancel contract for cause. A contractor may appeal the decision of a Bureau official to cancel...

  11. 40 CFR 273.18 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Small Quantity Handlers of Universal Waste § 273.18... universal waste. (c) If a universal waste being offered for off-site transportation meets the definition of...

  12. 40 CFR 273.38 - Off-site shipments.

    Science.gov (United States)

    2010-07-01

    ....38 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Large Quantity Handlers of Universal Waste § 273.38... universal waste. (c) If a universal waste being offered for off-site transportation meets the definition of...

  13. An embedded circumnuclear disk in Mrk 273

    NARCIS (Netherlands)

    Klockner, HR; Baan, WA

    Radio observations using very long baseline interferometry (VLBI) and the Westerbork interferometer have been carried out to study the hydroxyl Megamaser emission in Mrk 273 at different spatial resolutions. Line and continuum observations were carried out by the European VLBI network (EVN) at 1.6

  14. 7 CFR 273.9 - Income and deductions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE FOOD STAMP AND FOOD DISTRIBUTION PROGRAM CERTIFICATION OF ELIGIBLE HOUSEHOLDS § 273.9 Income and...) Payments under Title I (VISTA, University Year for Action, etc.) of the Domestic Volunteer Service Act of...

  15. 40 CFR 273.53 - Storage time limits.

    Science.gov (United States)

    2010-07-01

    ...) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Standards for Universal Waste Transporters § 273.53 Storage time limits. (a) A universal waste transporter may only store the universal waste at a universal waste transfer facility for ten days or less. (b) If a universal waste transporter stores universal waste for...

  16. 8 CFR 273.5 - General criteria used for reduction, refund, or waiver of fines.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false General criteria used for reduction, refund, or waiver of fines. 273.5 Section 273.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY..., liquidated damages, and user fee payment records; and, (3) The existence of any extenuating circumstances. ...

  17. 48 CFR 719.273 - The U.S. Agency for International Development (USAID) Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... International Development (USAID) Mentor-Protégé Program. 719.273 Section 719.273 Federal Acquisition.... Agency for International Development (USAID) Mentor-Protégé Program 719.273 The U.S. Agency for International Development (USAID) Mentor-Protégé Program. ...

  18. High-voltage power supplies for traveling wave tube WV-273A; Vysokovol`tnye istochniki pitaniya dlya LBV UV-273A

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, N I; Fateev, A A

    1996-12-31

    Paper presents a description of two modifications of high-volt power sources described for preamplifier on UV-273A type travelling wave tube (TWT). Power source where anode power circuit contains semiconducting high-volt switch on thyristors was designed to average pulse mode of TWT operation. Time of switching-in this power circuit constitutes 20 mcs. 2 refs.

  19. 39 CFR 273.6 - Evaluation by reviewing official.

    Science.gov (United States)

    2010-07-01

    ... supports the allegations of liability; (4) An estimate of the amount of money or the value of property or...)(4) and (5) of this section, the Reviewing Official recommends be demanded from the person alleged to... PROGRAM FRAUD CIVIL REMEDIES ACT § 273.6 Evaluation by reviewing official. (a) Based upon the...

  20. 25 CFR 273.18 - Additional requirements for education plan.

    Science.gov (United States)

    2010-04-01

    ... EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Application Process § 273.18... of employees for each special program and number of Indian employees for that program. (k) State the...) Program goals and objectives related to the learning needs of potential target students. (2) Procedures...

  1. OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

    International Nuclear Information System (INIS)

    Fan, J. H.; Liu, Y.; Yuan, Y. H.; Kurtanidze, O.; Chanishvili, R.; Richter, G. M.

    2014-01-01

    Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works

  2. OPTICAL MONITORING OF TWO BRIGHTEST NEARBY QUASARS, PHL 1811 AND 3C 273

    Energy Technology Data Exchange (ETDEWEB)

    Fan, J. H.; Liu, Y.; Yuan, Y. H. [Center for Astrophysics, Guangzhou University, Guangzhou 510006 (China); Kurtanidze, O.; Chanishvili, R. [Abastumani Observatory, Mt. Kanobili, 0301 Abastumani, Georgia (United States); Richter, G. M. [Astrophysikalisches Institut Potsdam, An der Sternwarte 16, D-14482 Potsdam (Germany)

    2014-08-01

    Variability is one of the most observable characteristics of active galactic nuclei, and it is important when considering the emission mechanism. In this paper, we report optical photometry monitoring of two nearby brightest quasars, PHL 1811 and 3C 273, using the ST-6 camera attached to the Newtonian focus and the Ap6E CCD camera attached to the primary focus of the 70 cm meniscus telescope at the Abastumani Observatory, Georgia. PHL 1811 was monitored during the period from 2002 September to 2012 December, while 3C 273 was monitored during the period from 1998 February to 2008 May. During our monitoring period, the two sources did not show any significant intra-day variability. The largest detected variations are ΔR = 0.112 ± 0.010 mag. for PHL 1811, ΔB = 0.595 ± 0.099 mag, ΔV = 0.369 ± 0.028 mag, ΔR = 0.495 ± 0.076 mag, and ΔI = 0.355 ± 0.009 mag for 3C 273. When the periodicity analysis methods are adopted for the observations of the sources, a period of p = 5.80 ± 1.12 yr is obtained for PHL 1811 in the R light curve in the present work, and periods of p = 21.10 ± 0.14, 10.00 ± 0.14, 7.30 ± 0.09, 13.20 ± 0.09, 2.10 ± 0.06, and 0.68 ± 0.05 yr are obtained for 3C 273 based on the data in the present work combined with historical works.

  3. 25 CFR 273.37 - Use of funds outside of schools.

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT PROGRAM EDUCATION CONTRACTS UNDER JOHNSON-O'MALLEY ACT Funding Provisions § 273.37 Use of funds outside of schools. Nothing in these regulations shall prevent the Commissioner from contracting...

  4. THE INNER KILOPARSEC OF Mrk 273 WITH KECK ADAPTIVE OPTICS

    Energy Technology Data Exchange (ETDEWEB)

    U, Vivian; Sanders, David; Kewley, Lisa [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Dr., Honolulu, HI 96822 (United States); Medling, Anne; Max, Claire [Department of Astronomy and Astrophysics, University of California, Santa Cruz, 1156 High Street, Santa Cruz, CA 95064 (United States); Armus, Lee [Spitzer Science Center, California Institute of Technology, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Iwasawa, Kazushi [ICREA and Institut del Ciències del Cosmos, Universitat de Barcelona (IEEC-UB), Martí i Franquès, 1, E-08028 Barcelona (Spain); Evans, Aaron [Department of Astronomy, University of Virginia, 530 McCormick Road, Charlottesville, VA 22904 (United States); Fazio, Giovanni, E-mail: vivianu@ucr.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)

    2013-10-01

    There is X-ray, optical, and mid-infrared imaging and spectroscopic evidence that the late-stage ultraluminous infrared galaxy merger Mrk 273 hosts a powerful active galactic nucleus (AGN). However, the exact location of the AGN and the nature of the nucleus have been difficult to determine due to dust obscuration and the limited wavelength coverage of available high-resolution data. Here we present near-infrared integral-field spectra and images of the nuclear region of Mrk 273 taken with OSIRIS and NIRC2 on the Keck II Telescope with laser guide star adaptive optics. We observe three spatially resolved components, and analyze the nuclear molecular and ionized gas emission lines and their kinematics. We confirm the presence of the hard X-ray AGN in the southwest nucleus. In the north nucleus, we find a strongly rotating gas disk whose kinematics indicate a central black hole of mass 1.04 ± 0.1 × 10{sup 9} M{sub ☉}. The H{sub 2} emission line shows an increase in velocity dispersion along the minor axis in both directions, and an increased flux with negative velocities in the southeast direction; this provides direct evidence for a collimated molecular outflow along the axis of rotation of the disk. The third spatially distinct component appears to the southeast, 640 and 750 pc from the north and southwest nuclei, respectively. This component is faint in continuum emission but shows several strong emission line features, including [Si VI] 1.964 μm which traces an extended coronal-line region. The geometry of the [Si VI] emission combined with shock models and energy arguments suggest that [Si VI] in the southeast component must be at least partly ionized by the SW AGN or a putative AGN in the northern disk, either through photoionization or through shock-heating from strong AGN- and circumnuclear-starburst-driven outflows. This lends support to a scenario in which Mrk 273 may be a dual AGN system.

  5. 20 CFR 404.273 - When are automatic cost-of-living increases effective?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When are automatic cost-of-living increases..., SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.273 When are automatic cost-of-living increases effective? We make automatic cost-of-living...

  6. 43 CFR 30.273 - What action will the judge take to record title?

    Science.gov (United States)

    2010-10-01

    ... PROBATE HEARINGS PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.273 What action will...) File the complete record, including the decision, with the LTRO as provided in § 30.233; (c) Furnish a... decision to each interested party. ...

  7. The Physics of AGN, a Deep Understanding of the Quasar 3C 273

    Science.gov (United States)

    Courvoisier, T.; Bottcher, Markus

    2004-01-01

    Upon our successful AO-1 proposal no. 120023, the quasar 3C 273 has been observed with INTEGRAL in 3 epochs in January 2003. The first observation, on January 5, 2003, with a total INTEGRAL exposure of 1.2 x 10(exp 5) s, was simultaneous with RXTE and XMM- Newton observations. Two more INTEGRAL observations were carried out on January 11, 2003 (exposure: lo4 s) and January 17, 2003 (exposure: 1.1 x 10(exp 5) s). The source was detected with high significance by all INTEGRAL instruments, the OMC, JEM-X, SPI, and IBIS/ISGRI. Being one of the first INTEGRAL observations simultaneous with XMM and RXTE, our observations were also used to fix the cross calibration with those instruments. The combined spectrum resulting from the XMM-Newton, JEM-X, RXTE, SPI and ISGRI X-ray / soft gamma-ray observations is consistent with a straight power-law of photon index Gamma = (1.73 +/- 0.015) between 3 keV and at least 200 keV. A possible detection in the 200 keV - 500 keV band by SPI can not be confirmed with our observations. The normalization of the X/gamma-ray spectrum is (2.24 +/- 0.05) x 10(exp -2) photons /sq cm keV at 1 keV. The source showed a moderate amount of optical variability as observed with the OMC onboard INTEGRAL. No evidence for variability at X-rays and gamma-rays could be reported, which may have been a result of insufficient photon statistics. The X-/gamma-ray spectrum observed in our 2003 observations is consistent with previously measured and modelled broadband spectral energy distributions of 3C 273. It has been included in the U.S. lead Col's work on spectral and variability modelling of gamma-ray blazars, supporting the trend of flat-spectrum radio quasars such as 3C 273 being 7-ray dominated due to a strong contribution from Compton upscattering of external radiation by ultrarelativistic electrons in a relativistic jet. 3C 273 is a particularly convincing example for such a picture since it provides very direct evidence for a strong external radiation

  8. AN HST PROPER-MOTION STUDY OF THE LARGE-SCALE JET OF 3C273

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Eileen T.; Georganopoulos, Markos [University of Maryland Baltimore County, Baltimore, MD 21250 (United States); Sparks, William B. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Anderson, Jay; Marel, Roeland van der; Biretta, John; Chiaberge, Marco; Norman, Colin [Space Telescope Science Institute, Baltimore, MD 21210 (United States); Tony Sohn, Sangmo [Johns Hopkins University, Baltimore, MD 21210 (United States); Perlman, Eric, E-mail: meyer@stsci.edu [Florida Institute of Technology, Melbourne, FL 32901 (United States)

    2016-02-20

    The radio galaxy 3C 273 hosts one of the nearest and best-studied powerful quasar jets. Having been imaged repeatedly by the Hubble Space Telescope (HST) over the past twenty years, it was chosen for an HST program to measure proper motions in the kiloparsec-scale resolved jets of nearby radio-loud active galaxies. The jet in 3C 273 is highly relativistic on sub-parsec scales, with apparent proper motions up to 15c observed by very long baseline interferometry. In contrast, we find that the kiloparsec-scale knots are compatible with being stationary, with a mean speed of −0.2 ± 0.5c over the whole jet. Assuming the knots are packets of moving plasma, an upper limit of 1c implies a bulk Lorentz factor Γ < 2.9. This suggests that the jet has either decelerated significantly by the time it reaches the kiloparsec scale, or that the knots in the jet are standing shock features. The second scenario is incompatible with the inverse Compton off the Cosmic Microwave Background (IC/CMB) model for the X-ray emission of these knots, which requires the knots to be in motion, but IC/CMB is also disfavored in the first scenario due to energetic considerations, in agreement with the recent finding of Meyer and Georganopoulos which ruled out the IC/CMB model for the X-ray emission of 3C 273 via gamma-ray upper limits.

  9. Ten Years of Monitoring 3C 273 with XMM–Newton Liu Liu ...

    Indian Academy of Sciences (India)

    Abstract. We present ten years optical/UV/X-ray observations of 3C. 273 performed using XMM–Newton between 2000 and 2009. The short- time scale variability behaviour of the soft and hard X-ray light curves may suggest different origins of the soft/hard X-ray emissions. We fit well the 0.2–10 keV X-ray spectrum with a ...

  10. Simultaneous observations of the quasar 3C 273 with INTEGRAL, XMM-Newton and RXTE

    DEFF Research Database (Denmark)

    Courvoisier, T.J.L.; Beckmann, V.; Bourban, G.

    2003-01-01

    INTEGRAL has observed the bright quasar 3C 273 on 3 epochs in January 2003 as one of the first observations of the open programme. The observation on January 5 was simultaneous with RXTE and XMM-Newton observations. We present here a first analysis of the continuum emission as observed by these 3...

  11. 48 CFR 719.273-4 - Eligibility of Mentor and Protégé firms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Eligibility of Mentor and... Development (USAID) Mentor-Protégé Program 719.273-4 Eligibility of Mentor and Protégé firms. Eligible business entities approved as Mentors may enter into agreements (hereafter referred to as “Mentor-Protégé...

  12. Some observations on the use of the triple points of deuterium and xenon in interpolation schemes for platinum resistance thermometers below 273 K

    International Nuclear Information System (INIS)

    Kemp, R.C.

    1988-01-01

    The use of the triple points of deuterium and xenon is investigated in some interpolation schemes for platinum resistance thermometers between 13.8 K and 273 K. The use of these triple points together is shown to lead to a large sensitivity to errors in the realization of the boiling point of water or the triple point of gallium and of the triple point of xenon for interpolated temperatures below 25 K. The behaviour of these interpolation schemes is presented as evidence that the large non-uniqueness observed in temperature scales between 84 K and 273 K is due in part to measurement errors at the boiling point of water. The use of the triple point of xenon and in interpolation scheme between 25 K and 273 K is shown to lead to a large sensitivity to calibration errors in the triple points of xenon and gallium between 25 K and 54 K. (orig.)

  13. 33 CFR Appendix C to Part 273 - Information Requirements for Aquatic Plant Control Program Environmental Impact Statements

    Science.gov (United States)

    2010-07-01

    ... Aquatic Plant Control Program Environmental Impact Statements C Appendix C to Part 273 Navigation and... Environmental Impact Statements 1. Description of the problem. a. Pests. Identify the pest to be controlled by.... Relationship to environmental situation. Non-target organisms and integrated pest management programs. 2...

  14. Constraining the location of rapid gamma-ray flares in the flat spectrum radio quasar 3C 273 [Constraining the location of rapid gamma-ray flares in the FSRQ 3C 273

    International Nuclear Information System (INIS)

    Rani, B.; Lott, B.; Krichbaum, T. P.; Fuhrmann, L.; Zensus, J. A.

    2013-01-01

    Here, we present a γ-ray photon flux and spectral variability study of the flat-spectrum radio quasar 3C 273 over a rapid flaring activity period between September 2009 to April 2010. Five major flares were observed in the source during this period. The most rapid flare observed in the source has a flux doubling time of 1.1 hr. The rapid γ-ray flares allow us to constrain the location and size of the γ-ray emission region in the source. The γγ-opacity constrains the Doppler factor δ_γ ≥ 10 for the highest energy (15 GeV) photon observed by the Fermi-Large Area Telescope (LAT). Causality arguments constrain the size of the emission region to 1.6 × 10"1"5 cm. The γ-ray spectra measured over this period show clear deviations from a simple power law with a break in the 1–2 GeV energy range. We discuss possible explanations for the origin of the γ-ray spectral breaks. Our study suggests that the γ-ray emission region in 3C 273 is located within the broad line region (< 1.6 pc). As a result, the spectral behavior and temporal characteristics of the individual flares indicate the presence of multiple shock scenarios at the base of the jet.

  15. Gammay rays from Penrose powered black holes in centaurus A, 3C 273, and NGC 4151

    International Nuclear Information System (INIS)

    Kafatos, M.; and Laboratory for Astronomy and Solar Physics, NASA Goddard Space Flight Center)

    1980-01-01

    Gamma-ray observations of active galaxies have important consequences for theories of the activity in their nuclei. The observations of Cen A, 3C 273, and NGC 4151 are examined under the assumption that Penrose collision processes in the ergospheres of massive black holes power their nuclei. The observed sharp break in the MeV region of the NGC 4151 spectrum cannot be due to the γ-γ pair production process. We attribute this break to the Penrose Compton scattering (PCS), in which γ-rays escape from the ergosphere as a result of Penrose processes involving electrons and lower energy X-ray photons in the ergosphere of the black hole. The absence of an MeV break in the spectra of Cen A and 3C 273 argues in favor of the Penrose pair production (PPP), in which high-energy pairs (a few GeV in energy) escape as result of Penrose processes involving protons and γ-rays that are present in any hot, optically thin, vertically extended accretion disk. An intrinsic break in the GeV region is predicted for both Cen A and 3C 273 as well as any other PPP powered nucleus.If PPP is important for QSOs and radio galaxies and some Seyferts, powerful radio objects should also be powerful γ-ray objects. Nuclei in which the black hole is spinning slowly would still emit visible light, UV, and X-rays as result of accretion without Penrose processes but would be weak in radio or high-energy γ-rays. Future γ-ray observations should provide clues as to whether this scenario is correct. Besides spectral information at γ-ray frequencies, possible variability at γ-ray frequencies should be searched for

  16. Optical monitoring of BL Lac object S5 0716+714 and FSRQ 3C 273 from 2000 to 2014

    Science.gov (United States)

    Yuan, Yu-Hai; Fan, Jun-hui; Tao, Jun; Qian, Bo-Chen; Costantin, Denise; Xiao, Hu-Bing; Pei, Zhi-Yuan; Lin, Chao

    2017-09-01

    Context. Using the 1.56 m telescope at the Shanghai Observatory (ShAO), China, we monitored two sources, BL Lac object S5 0716+714 and flat spectrum radio quasar (FSRQ) 3C 273. For S5 0716+714, we report 4969 sets of CCD (Charge-coupled Device) photometrical optical observations (1369 for V band, 1861 for R band and 1739 for I band) in the monitoring time from Dec. 4, 2000 to Apr. 5, 2014. For 3C 273, we report 460 observations (138 for V band, 146 for R band and 176 for I band) in the monitoring time from Mar. 28, 2006 to Apr. 9, 2014. Aims: The observations provide us with a large amount of data to analyze the short-term and long-term optical variabilities. Based on the variable timescales, we can estimate the central black hole mass and the Doppler factor. An abundance of multi-band observations can help us to analyze the relations between the brightness and spectrum. Methods: We use Gaussian fitting to analyze the intra-day light curves and obtain the intra-day variability (IDV) timescales. We use the discrete correlation function (DCF) method and Jurkevich method to analyze the quasi-periodic variability. Based on the VRI observations, we use the linear fitting to analyze the relations between brightness and spectrum. Results: The two sources both show IDV properties for S5 0716+714. The timescales are in the range from 17.3 min to 4.82 h; for 3C 273, the timescale is ΔT = 35.6 min. Based on the periodic analysis methods, we find the periods PV = 24.24 ± 1.09 days, PR = 24.12 ± 0.76 days, PI = 24.82 ± 0.73 days for S5 0716+714, and P = 12.99 ± 0.72, 21.76 ± 1.45 yr for 3C 273. The two sources displayed the "bluer-when-brighter" spectral evolution properties. Conclusions: S5 0716+714 and 3C 273 are frequently studied objects. The violent optical variability and IDV may come from the jet. Gaussian fitting can be used to analyze IDVs. The relations between brightness (flux density) and spectrum are strongly influenced by the frequency. A table of the

  17. Effects of hyperoxia and caffeine on the expression of fragile site at Xq27.3

    Energy Technology Data Exchange (ETDEWEB)

    Rafi, S.K.; Surana, R.B.; Christopher, K.L. [Armed Forces Institute of Pathology, Washington, DC (United States)] [and others

    1996-02-02

    To enhance the cytogenetic expression of the fragile X chromosome, we studied the effects of hyperoxia and caffeine on the induction of fragile Xq27.3. A lymphoblastoid cell line (GM 06912) derived from a fragile X male proband was cultured in RPMI 1640 containing 16% dialyzed fetal calf serum. The cells were synchronously subjected to one of 3 different atmospheric oxygen tensions (21%, 21.3 kPa, hyperoxic) during the last 24 hours of the 72 hour culture, immediately after the addition of 2{prime}-deoxy-5-fluorouridine (FUdR) at 25 ng/ml. To study the enhancing effect of caffeine, with or without hyperoxia, a second set of cultures was additionally subjected to caffeine (2.5 mM) during the last 6 hours of the culture. When the fragility of hyperoxic cells (38.1 kPa dissolved oxygen) was compared to that of normoxic control cells (13.3 kPa dissolved oxygen), the difference was significant (P < 0.05). These data suggest that there is a mean increase in the fragile Xq27.3 expressivity as the dissolved oxygen tension increases. Additionally, we observed that caffeine, with or without hyperoxia, significantly (P <0.05) suppressed the expression of the fragile X site in this lymphoblastoid cell line. 34 refs., 2 tabs.

  18. Study on the KM capacitor base thermometers in the 42-273 K range

    International Nuclear Information System (INIS)

    Luzganov, V.S.; Mats'ko, A.A.

    1988-01-01

    Thermometric characteristics of the KM-5a-HZ0 monolithic capacitors in the 42-273 K temperature range are studied. Capacitors capacitance - temperature relation is considered in details. The data reproducibility after 5, 23, 34, 50, 51 and 57 days is studied, the accuracy of temperature measurements by the given thermometers is determined. Recommendations on selection of cpacitors, suitable for application as thermometer, are given. These capacitors permit temperature measurement in the 42-225 K range with the error of ± 0.5 K, and above 225 K the error is ± 1K. 8 refs.; 1 fig.; 1 tab

  19. Fulltext PDF

    Indian Academy of Sciences (India)

    the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.

  20. Rapid infrared and optical variability in the bright quasar 3C273

    International Nuclear Information System (INIS)

    Courvoisier, T.J.-L.; Robson, E.I.; Hughes, D.H.; Bouchet, P.; Schwarz, H.E.; Krisciunas, K.

    1988-01-01

    We have observed variations by a factor of two in the infrared flux from the bright quasar 3C273 on a timescale as short as one day. In February 1988, the behaviour of the source changed from having a stable infrared flux and slow optical variations to a state characterized by recurrent infrared and optical flaring. The optical variations were of several per cent per day, changing from increase to decrease approximately every week. The amplitude of the repeated optical flares was 30-40%. The data are consistent with re-injection/acceleration of electrons followed by rapid cooling. The inferred magnetic field is 0.7 gauss and the data are marginally consistent with no relativistic beaming. (author)

  1. Mitochondrial protection by the mixed muscarinic/σ1 ligand ANAVEX2-73, a tetrahydrofuran derivative, in Aβ25-35 peptide-injected mice, a nontransgenic Alzheimer's disease model.

    Science.gov (United States)

    Lahmy, Valentine; Long, Romain; Morin, Didier; Villard, Vanessa; Maurice, Tangui

    2014-01-01

    Alzheimer's disease (AD), the most prevalent dementia in the elderly, is characterized by progressive synaptic and neuronal loss. Mitochondrial dysfunctions have been consistently reported as an early event in AD and appear before Aβ deposition and memory decline. In order to define a new neuroprotectant strategy in AD targeting mitochondrial alterations, we develop tetrahydro-N,N-dimethyl-2,2-diphenyl-3-furanmethanamine (ANAVEX2-73, AE37), a mixed muscarinic receptor ligand and a sigma-1 receptor (σ1R) agonist. We previously reported that ANAVEX2-73 shows anti-amnesic and neuroprotective activities in mice injected intracerebroventricular (ICV) with oligomeric amyloid-β25-35 peptide (Aβ25-35). The σ1R is present at mitochondria-associated endoplasmic reticulum (ER) membranes, where it acts as a sensor/modulator of ER stress responses and local Ca(2+) exchanges with the mitochondria. We therefore evaluated the effect of ANAVEX2-73 and PRE-084, a reference σ1R agonist, on preservation of mitochondrial integrity in Aβ25-35-injected mice. In isolated mitochondria from hippocampus preparations of Aβ25-35 injected animals, we measured respiration rates, complex activities, lipid peroxidation, Bax/Bcl-2 ratios and cytochrome c release into the cytosol. Five days after Aβ25-35 injection, mitochondrial respiration in mouse hippocampus was altered. ANAVEX2-73 (0.01-1 mg/kg IP) restored normal respiration and PRE-084 (0.5-1 mg/kg IP) increased respiration rates. Both compounds prevented Aβ25-35-induced increases in lipid peroxidation levels, Bax/Bcl-2 ratio and cytochrome c release into the cytosol, all indicators of increased toxicity. ANAVEX2-73 and PRE-084 efficiently prevented the mitochondrial respiratory dysfunction and resulting oxidative stress and apoptosis. The σ1R, targeted selectively or non-selectively, therefore appears as a valuable target for protection against mitochondrial damages in AD.

  2. Yeast Interacting Proteins Database: YDL239C, YDR273W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available of a Don1p-containing structure at the leading edge of the prospore membrane via interaction with spindle p...it as prey (1) YDR273W DON1 Meiosis-specific component of the spindle pole body, part of the leading... edge protein (LEP) coat, forms a ring-like structure at the leading edge of the prospore...ption Protein required for spore wall formation, thought to mediate assembly of a Don1p-containing structure at the leading...description Meiosis-specific component of the spindle pole body, part of the leading edge protein (LEP) coat

  3. A cosmic double helix in the archetypical quasar 3C273.

    Science.gov (United States)

    Lobanov, A P; Zensus, J A

    2001-10-05

    Finding direct evidence for plasma instability in extragalactic jets is crucial for understanding the nature of relativistic outflows from active galactic nuclei. Our radio interferometric observations of the quasar 3C273 made with the orbiting radio telescope, HALCA, and an array of ground telescopes have yielded an image in which the emission across the jet is resolved, revealing two threadlike patterns that form a double helix inside the jet. This double helical structure is consistent with a Kelvin-Helmholtz instability, and at least five different instability modes can be identified and modeled by a light jet with a Lorentz factor of 2 and Mach number of 3.5. The model reproduces in detail the internal structure of the jet on scales of up to 30 milli-arc seconds ( approximately 300 parsecs) and is consistent with the general morphology of the jet on scales of up to 1 kiloparsec.

  4. Integral Field Spectroscopy of Markarian 273: Mapping High-Velocity Gas Flows and an Off-Nucleus Seyfert 2 Nebula.

    Science.gov (United States)

    Colina; Arribas; Borne

    1999-12-10

    Integral field optical spectroscopy with the INTEGRAL fiber-based system is used to map the extended ionized regions and gas flows in Mrk 273, one of the closest ultraluminous infrared galaxies. The Hbeta and [O iii] lambda5007 maps show the presence of two distinct regions separated by 4&arcsec; (3.1 kpc) along position angle (P.A.) 240 degrees. The northeastern region coincides with the optical nucleus of the galaxy and shows the spectral characteristics of LINERs. The southwestern region is dominated by [O iii] emission and is classified as a Seyfert 2. Therefore, in the optical, Mrk 273 is an ultraluminous infrared galaxy with a LINER nucleus and an extended off-nucleus Seyfert 2 nebula. The kinematics of the [O iii] ionized gas shows (1) the presence of highly disturbed gas in the regions around the LINER nucleus, (2) a high-velocity gas flow with a peak-to-peak amplitude of 2.4x103 km s-1, and (3) quiescent gas in the outer regions (at 3 kpc). We hypothesize that the high-velocity flow is the starburst-driven superwind generated in an optically obscured nuclear starburst and that the quiescent gas is directly ionized by a nuclear source, similar to the ionization cones typically seen in Seyfert galaxies.

  5. Synthesis and detection of a seaborgium carbonyl complex

    NARCIS (Netherlands)

    Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.

    2014-01-01

    Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been

  6. Reaction of ammonium triphosphate with gadolinium nitrate in aqueous solution at 273K

    International Nuclear Information System (INIS)

    Rodicheva, G.V.; Tananaev, I.V.; Romanova, N.M.

    1982-01-01

    The solubility in the system (NW 4 ) 5 P 3 O 10 -Gd(NO 3 ) 3 - H 2 O (273 K) is studied. Depending on the reagent ratio formation of the compounds Gd 5 (P 3 O 10 ) 3 x22H 2 O, NH 4 Gd 3 (P 3 O 10 ) 2 x12H 2 O and (NH 4 ) 3 Gd 4 (P 3 O 10 ) 3 x14H 2 O is established. Gadolinium triphosphates, separated from solution, are studied using the methods of paper chromatography, X-ray diffractometry, thermography. Simultaneously with thermal dehydration of gadolinium triphosphates the processes of triphosphate decomposition and phosphate anion condensation take place. A mixture of crystalline ortho-phosphate and long- chain polyphosphate of gadolinium is the final product of thermal decomposition (1063 K) of normal and doubl e ammonium- containing gadolinium triphosphates [ru

  7. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  8. Testing a double AGN hypothesis for Mrk 273

    Science.gov (United States)

    Iwasawa, K.; U, V.; Mazzarella, J. M.; Medling, A. M.; Sanders, D. B.; Evans, A. S.

    2018-04-01

    The ultra-luminous infrared galaxy (ULIRG) Mrk 273 contains two infrared nuclei, N and SW, separated by 1 arcsecond. A Chandra observation has identified the SW nucleus as an absorbed X-ray source with NH 4 × 1023 cm-2 but also hinted at the possible presence of a Compton-thick AGN in the N nucleus, where a black hole of 109 M⊙ is inferred from the ionized gas kinematics. The intrinsic X-ray spectral slope recently measured by NuSTAR is unusually hard (Γ 1.3) for a Seyfert nucleus, for which we seek an alternative explanation. We hypothesize a strongly absorbed X-ray source in N, of which X-ray emission rises steeply above 10 keV, in addition to the known X-ray source in SW, and test it against the NuSTAR data, assuming the standard spectral slope (Γ = 1.9). This double X-ray source model gives a good explanation of the hard continuum spectrum, deep Fe K absorption edge, and strong Fe K line observed in this ULIRG, without invoking the unusual spectral slope required for a single source interpretation. The putative X-ray source in N is found to be absorbed by NH = 1.4+0.7-0.4 × 1024 cm-2. The estimated 2-10 keV luminosity of the N source is 1.3 × 1043 erg s-1, about a factor of 2 larger than that of SW during the NuSTAR observation. Uncorrelated variability above and below 10 keV between the Suzaku and NuSTAR observations appears to support the double source interpretation. Variability in spectral hardness and Fe K line flux between the previous X-ray observations is also consistent with this picture.

  9. Nuclear structure studies in the seaborgium region at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

    2015-10-15

    New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

  10. RADIOASTRON OBSERVATIONS OF THE QUASAR 3C273: A CHALLENGE TO THE BRIGHTNESS TEMPERATURE LIMIT

    Energy Technology Data Exchange (ETDEWEB)

    Kovalev, Y. Y.; Kardashev, N. S.; Voitsik, P. A.; Kovalev, Yu. A.; Lisakov, M. M.; Sokolovsky, K. V. [Astro Space Center of Lebedev Physical Institute, Profsoyuznaya 84/32, 117997 Moscow (Russian Federation); Kellermann, K. I. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903-2475 (United States); Lobanov, A. P.; Zensus, J. A.; Anderson, J. M.; Bach, U.; Kraus, A. [Max-Planck-Institute for Radio Astronomy, Auf dem Hügel 69, D-53121 (Germany); Johnson, M. D. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gurvits, L. I. [Joint Institute for VLBI ERIC, P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Jauncey, D. L. [CSIRO Astronomy and Space Sciences, Epping, NSW 1710 (Australia); Ghigo, F. [National Radio Astronomy Observatory, Rt. 28/92, Green Bank, WV 24944-0002 (United States); Ghosh, T.; Salter, C. J. [Arecibo Observatory, NAIC, HC3 Box 53995, Arecibo, Puerto Rico, PR 00612 (United States); Petrov, L. Yu. [Astrogeo Center, 7312 Sportsman Drive, Falls Church, VA 22043 (United States); Romney, J. D. [National Radio Astronomy Observatory, P.O. Box O, 1003 Lopezville Road, Socorro, NM 87801-0387 (United States)

    2016-03-20

    Inverse Compton cooling limits the brightness temperature of the radiating plasma to a maximum of 10{sup 11.5} K. Relativistic boosting can increase its observed value, but apparent brightness temperatures much in excess of 10{sup 13} K are inaccessible using ground-based very long baseline interferometry (VLBI) at any wavelength. We present observations of the quasar 3C 273, made with the space VLBI mission RadioAstron on baselines up to 171,000 km, which directly reveal the presence of angular structure as small as 26 μas (2.7 light months) and brightness temperature in excess of 10{sup 13} K. These measurements challenge our understanding of the non-thermal continuum emission in the vicinity of supermassive black holes and require a much higher Doppler factor than what is determined from jet apparent kinematics.

  11. 3C 273 with NuSTAR: Unveiling the Active Galactic Nucleus

    DEFF Research Database (Denmark)

    Madsen, Kristin K.; Fürst, Felix; Walton, Dominic J.

    2015-01-01

    We present results from a 244 ks NuSTAR observation of 3C 273 obtained during a cross-calibration campaign with the Chandra, INTEGRAL, Suzaku, Swift, and XMM-Newton observatories. We show that the spectrum, when fit with a power-law model using data from all observatories except INTEGRAL over the 1......-78 keV band, leaves significant residuals in the NuSTAR data between 30 and 78 keV. The NuSTAR 3-78 keV spectrum is well. described by an exponentially cutoff power law (Γ = 1.646± 0.006, Ecutoff = 202-34 +51 keV) with a weak reflection component from cold, dense material. There is also evidence......-energy power. law is consistent with the presence of a beamed jet, which begins to dominate over emission from the inner accretion flow at 30-40 keV. Modeling the jet locally (in the NuSTAR + INTEGRAL band) as a power. law, we find that the coronal component is fit by ΓAGN = 1.638 ± 0.045, Ecutoff = 47 ± 15 ke...

  12. IACHEC CROSS-CALIBRATION OF CHANDRA , NuSTAR , SWIFT , SUZAKU , XMM-NEWTON WITH 3C 273 ANDPKS 2155-304

    Energy Technology Data Exchange (ETDEWEB)

    Madsen, Kristin K.; Forster, Karl [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Beardmore, Andrew P.; Page, Kim L. [X-ray and Observational Astronomy Group, Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom); Guainazzi, Matteo [Japan Aerospace Exploration Agency, Institute of Space and Astronautical Science, 3-1-1, Yoshinodai, Sagamihara, Kanagawa, 252-5201 (Japan); Marshall, Herman L.; Miller, Eric D. [Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Stuhlinger, Martin [European Space Astronomy Centre (ESAC), P.O. Box 78, E-28691 Villanueva de la Caada, Madrid (Spain)

    2017-01-01

    On behalf of the International Astronomical Consortium for High Energy Calibration, we present results from the cross-calibration campaigns in 2012 on 3C 273 and in 2013 on PKS 2155-304 between the then active X-ray observatories Chandra , NuSTAR , Suzaku , Swift, and XMM-Newton . We compare measured fluxes between instrument pairs in two energy bands, 1–5 keV and 3–7 keV, and calculate an average cross-normalization constant for each energy range. We review known cross-calibration features and provide a series of tables and figures to be used for evaluating cross-normalization constants obtained from other observations with the above mentioned observatories.

  13. The rate coefficient for the reaction NO2 + NO3 yielding NO + NO2 + O2 from 273 to 313 K

    Science.gov (United States)

    Cantrell, Chris A.; Shetter, Richard E.; Mcdaniel, Anthony H.; Calvert, Jack G.

    1990-01-01

    The ratio of rate constants for the reaction NO3 + NO yielding 2 NO2 (k3) and the reaction NO2 + NO3 yielding NO + NO2 + O2 (k4) were determined by measuring of NO and NO2 concentrations of NO and NO2 in an N2O5/NO2/N2 mixture over the temperature range 273-313 K. The measured ratio was found to be expressed by the equation k3/k4 = 387 exp(-1375/T). The results are consistent with those of Hammer et al. (1986).

  14. FERMI-LARGE AREA TELESCOPE OBSERVATIONS OF THE EXCEPTIONAL GAMMA-RAY OUTBURSTS OF 3C 273 IN 2009 SEPTEMBER

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Blandford, R. D.; Bloom, E. D.; Borgland, A. W.; Bouvier, A.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We present the light curves and spectral data of two exceptionally luminous gamma-ray outbursts observed by the Large Area Telescope experiment on board the Fermi Gamma-ray Space Telescope from 3C 273 in 2009 September. During these flares, having a duration of a few days, the source reached its highest γ-ray flux ever measured. This allowed us to study, in some details, their spectral and temporal structures. The rise and the decay are asymmetric on timescales of 6 hr, and the spectral index was significantly harder during the flares than during the preceding 11 months. We also found that short, very intense flares put out the same time-integrated energy as long, less intense flares like that observed in 2009 August.

  15. Image of the Quasar 3C 273 Taken by the High Energy Astronomy Observatory (HEAO)-2

    Science.gov (United States)

    1979-01-01

    This image is an observation of Quasar 3C 273 by the High Energy Astronomy Observatory (HEAO)-2/Einstein Observatory. It reveals the presence of a new source (upper left) with a red shift that indicates that it is about 10 billion light years away. Quasars are mysterious, bright, star-like objects apparently located at the very edge of the visible universe. Although no bigger than our solar system, they radiate as much visible light as a thousand galaxies. Quasars also emit radio signals and were previously recognized as x-ray sources. The HEAO-2, the first imaging and largest x-ray telescope built to date, was capable of producing actual photographs of x-ray objects. Shortly after launch, the HEAO-2 was nicknamed the Einstein Observatory by its scientific experimenters in honor of the centernial of the birth of Albert Einstein, whose concepts of relativity and gravitation have influenced much of modern astrophysics, particularly x-ray astronomy. The HEAO-2 was designed and developed by TRW, Inc. under the project management of the Marshall Space Flight Center.

  16. Partial molar volumes of (acetonitrile + water) mixtures over the temperature range (273.15 to 318.15) K

    International Nuclear Information System (INIS)

    Yeow, Y. Leong; Leong, Yee-Kwong

    2007-01-01

    Isothermal molar volume data of (acetonitrile + water) mixtures, between T = 273.15 K and T = 318.15 K, extracted from different sources are combined and treated as a single set to even out minor differences between sources and to increase the number of data points for each temperature. Tikhonov regularization is applied to compute the isothermal first and second derivatives of these data with respect to molar composition. For the reference temperature of 298.15 K, this computation is extended to the third derivative. Generalized Cross Validation is used to guide the selection of the regularization parameter that keeps noise amplification under control. The resulting first derivatives are used to construct the partial molar volume curves which are then checked against published results. Properties of the partial molar volumes are analysed by examining their derivatives. Finally the general shape of the second derivative curve of molar volume is explained qualitatively in terms of tripartite segmentation of the molar composition interval but quantitative comparisons are required to confirm this explanation

  17. Phase equilibrium measurements and thermodynamic modeling of aqueous solutions of polyamines CO_2 absorbents: 3-aminopropylmethylamine, 3-aminopropyldimethylamine and N,N-diethyl 1,3-propanediamine at temperatures from 273 K to 363 K

    International Nuclear Information System (INIS)

    Bouzina, Zahida; Mokbel, Ilham; Negadi, Amina; Jose, Jacques; Negadi, Latifa

    2016-01-01

    Highlights: • Experimental vapor pressures of pure MAPA, DMAPA, DEAPA and their aqueous solutions are reported. • The investigated temperatures are 273 K through 363 K. • The MAPA binary system exhibits negative deviations in G"E values. • The DMAPA and DEAPA systems exhibit negative, sinusoidal and positive deviations in G"E values. • The 3rd order Redlich–Kister, and NRTL or UNIQUAC models have been used to correlate the (P-x-y) data. - Abstract: The vapor pressures of the pure components 3-aminopropylmethylamine (MAPA), 3-aminopropyldimethylamine (DMAPA) and N,N-diethyl 1,3-propanediamine (DEAPA) along with the binary mixtures (MAPA + water), (DMAPA + water) and (DEAPA + water) were measured by means of a static apparatus at temperatures between (273 and 363) K. The data were correlated with the Antoine equation. From these data, excess Gibbs functions (G"E) were calculated for several constant temperatures, and fitted to a three parameters Redlich–Kister equation using the Barker’s method. Additionally, the NRTL and UNIQUAC models have been used for the correlation of the total pressure.

  18. Alternative synthetic route for the heterometallic CO-releasing [Sb@Rh12(CO27]3− icosahedral carbonyl cluster and synthesis of its new unsaturated [Sb@Rh12(CO24]4− and dimeric [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− derivatives

    Directory of Open Access Journals (Sweden)

    Cristina Femoni

    2016-10-01

    Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.

  19. CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

    Energy Technology Data Exchange (ETDEWEB)

    Hill, K.D.; Steele, A.G. [National Research Council of Canada, Institute for National Measurement Standards, Ottawa, ON (Canada); Dedikov, Y.A.; Shkraba, V.T. [Institute for Physical-Technical and Radiotechnical Measurements (VNIIFTRI), Moscow (Russian Federation)

    2005-04-01

    The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 {omega} capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L and N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. (authors)

  20. Results of the independent verification of radiological remedial action at 273 East 1st South Street, Monticello, Utah (MS00092)

    International Nuclear Information System (INIS)

    Crutcher, J.W.; Smuin, M.W.

    1989-12-01

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1984 and 1985, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 273 East 1st South Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  1. Transesterification of waste cooking oil by an organic solvent-tolerant alkaline lipase from Streptomyces sp. CS273.

    Science.gov (United States)

    Mander, Poonam; Yoo, Hah-Young; Kim, Seung Wook; Choi, Yun Hee; Cho, Seung Sik; Yoo, Jin Cheol

    2014-02-01

    The aim of this present study was to produce a microbial enzyme that can potentially be utilized for the enzymatic transesterification of waste cooking oil. To that end, an extracellular lipase was isolated and purified from the culture broth of Streptomyces sp. CS273. The molecular mass of purified lipase was estimated to be 36.55 kDa by SDS PAGE. The optimum lipolytic activity was obtained at alkaline pH 8.0 to 8.5 and temperature 40 °C, while the enzyme was stable in the pH range 7.0 ∼ 9.0 and at temperature ≤40 °C. The lipase showed highest hydrolytic activity towards p-nitrophenyl myristate (C14). The lipase activity was enhanced by several salts and detergents including NaCl, MnSo₄, and deoxy cholic acid, while phenylmethylsulfonyl fluoride at concentration 10 mM inhibited the activity. The lipase showed tolerance towards different organic solvents including ethanol and methanol which are commonly used in transesterification reactions to displace alcohol from triglycerides (ester) contained in renewable resources to yield fatty acid alkyl esters known as biodiesel. Applicability of the lipase in transesterification of waste cooking oil was confirmed by gas chromatography mass spectrometry analysis.

  2. Emissions Inventory Report Summary: Reporting Requirements for the New Mexico Administrative code, Title 20, Chapter 2, Part 73 (20 NMAC 2.73) for Calendar Year 1997

    International Nuclear Information System (INIS)

    1999-01-01

    Los Alamos National Laboratory (the Laboratory) is subject to emissions reporting requirements for regulated air contaminants under Title 20 of the New Mexico Administrative Code, Chapter 2, Part 73, (20 NMAC 2.73), Notice of Intent and Emissions Inventory Requirements. The Laboratory has the potential to emit 100 tons per year of suspended particulate matter (PM), nitrogen oxides (NO x ), carbon monoxide (CO), and volatile organic compounds (VOCs). For 1997, combustion products from the industrial sources contributed the greatest amount of regulated air emissions from the Laboratory. Research and development activities contributed the greatest amount of VOCs. Emissions of beryllium and aluminum were reported for activities permitted under 20 NMAC 2.72, Construction Permits

  3. Structural Investigation of the Oligosaccharide Portion Isolated from the Lipooligosaccharide of the Permafrost Psychrophile Psychrobacter arcticus 273-4.

    Science.gov (United States)

    Casillo, Angela; Parrilli, Ermenegilda; Filomena, Sannino; Lindner, Buko; Lanzetta, Rosa; Parrilli, Michelangelo; Tutino, Maria Luisa; Corsaro, Maria Michela

    2015-07-22

    Psychrophilic microorganisms have successfully colonized all permanently cold environments from the deep sea to mountain and polar regions. The ability of an organism to survive and grow in cryoenviroments depends on a number of adaptive strategies aimed at maintaining vital cellular functions at subzero temperatures, which include the structural modifications of the membrane. To understand the role of the membrane in the adaptation, it is necessary to characterize the cell-wall components, such as the lipopolysaccharides, that represent the major constituent of the outer membrane. The aim of this study was to investigate the structure of the carbohydrate backbone of the lipooligosaccharide (LOS) isolated from the cold-adapted Psychrobacter arcticus 273-4. The strain, isolated from a 20,000-to-30,000-year-old continuously frozen permafrost in Siberia, was cultivated at 4 °C. The LOS was isolated from dry cells and analyzed by means of chemical methods. In particular, it was degraded either by mild acid hydrolysis or by hydrazinolysis and investigated in detail by (1)H and (13)C NMR spectroscopy and by ESI FT-ICR mass spectrometry. The oligosaccharide was characterized by the substitution of the heptose residue, usually linked to Kdo in the inner core, with a glucose, and for the unusual presence of N-acetylmuramic acid.

  4. KEY COMPARISON: CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

    Science.gov (United States)

    Hill, K. D.; Steele, A. G.; Dedikov, Y. A.; Shkraba, V. T.

    2005-01-01

    The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 Ω capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L&N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions

  5. Periodontitis and cancer mortality: Register-based cohort study of 68,273 adults in 10-year follow-up.

    Science.gov (United States)

    Heikkilä, Pia; But, Anna; Sorsa, Timo; Haukka, Jari

    2018-06-01

    Periodontitis, a multifactorial infection-induced low-grade chronic inflammation, can influence the process of carcinogenesis. We studied with 10 years follow-up of 68,273 adults-based cohort the involvement of periodontitis as a risk factor for cancer mortality. Periodontal status was defined based on procedure codes of periodontal treatment. Rate ratios and absolute differences of overall and cancer mortality rates were assessed with respect to periodontal status using multiplicative and additive Poisson regression models, respectively. We adjusted for effect of age, sex, calendar time, socio-economic status, oral health, dental treatments and diabetes. Data about smoking or alcohol consumption were not available. Altogether 797 cancer deaths occurred during 664,020 person-years accumulated over a mean 10.1-year follow-up. Crude cancer mortality rate per 10,000 person-years for participants without and with periodontitis was 11.36 (95% CI 10.47-12.31) and 14.45 (95% CI 12.51-16.61), respectively. Crude rate ratios for periodontitis indicated an increased risk of overall (RR 1.27, 95% CI 1.08-1.39) and pancreatic cancer (RR 1.69, 95% CI 1.04-2.76) mortality. After adjustment, the results showed even stronger associations of periodontitis with increased overall (RR 1.33, 95% CI 1.10-1.58) and pancreatic cancer (RR 2.32, 95% CI 1.31-3.98) mortality. A higher pancreatic cancer mortality among individuals with periodontitis contributed considerably to the difference in overall cancer mortality, but this difference was not due to pancreatic cancer deaths alone. © 2018 UICC.

  6. Probing the innermost regions of AGN jets and their magnetic fields with RadioAstron. II. Observations of 3C 273 at minimum activity

    Science.gov (United States)

    Bruni, G.; Gómez, J. L.; Casadio, C.; Lobanov, A.; Kovalev, Y. Y.; Sokolovsky, K. V.; Lisakov, M. M.; Bach, U.; Marscher, A.; Jorstad, S.; Anderson, J. M.; Krichbaum, T. P.; Savolainen, T.; Vega-García, L.; Fuentes, A.; Zensus, J. A.; Alberdi, A.; Lee, S.-S.; Lu, R.-S.; Pérez-Torres, M.; Ros, E.

    2017-08-01

    Context. RadioAstron is a 10 m orbiting radio telescope mounted on the Spektr-R satellite, launched in 2011, performing Space Very Long Baseline Interferometry (SVLBI) observations supported by a global ground array of radio telescopes. With an apogee of 350 000 km, it is offering for the first time the possibility to perform μas-resolution imaging in the cm-band. Aims: The RadioAstron active galactic nuclei (AGN) polarization Key Science Project (KSP) aims at exploiting the unprecedented angular resolution provided by RadioAstron to study jet launching/collimation and magnetic-field configuration in AGN jets. The targets of our KSP are some of the most powerful blazars in the sky. Methods: We present observations at 22 GHz of 3C 273, performed in 2014, designed to reach a maximum baseline of approximately nine Earth diameters. Reaching an angular resolution of 0.3 mas, we study a particularly low-activity state of the source, and estimate the nuclear region brightness temperature, comparing with the extreme one detected one year before during the RadioAstron early science period. We also make use of the VLBA-BU-BLAZAR survey data, at 43 GHz, to study the kinematics of the jet in a 1.5-yr time window. Results: We find that the nuclear brightness temperature is two orders of magnitude lower than the exceptionally high value detected in 2013 with RadioAstron at the same frequency (1.4 × 1013 K, source-frame), and even one order of magnitude lower than the equipartition value. The kinematics analysis at 43 GHz shows that a new component was ejected 2 months after the 2013 epoch, visible also in our 22 GHz map presented here. Consequently this was located upstream of the core during the brightness temperature peak. Fermi-LAT observations for the period 2010-2014 do not show any γ-ray flare in conjunction with the passage of the new component by the core at 43 GHz. Conclusions: These observations confirm that the previously detected extreme brightness temperature in

  7. Measurement of the D/H, 18O/16O, and 17O/16O Isotope Ratios in Water by Laser Absorption Spectroscopy at 2.73 μm

    Directory of Open Access Journals (Sweden)

    Tao Wu

    2014-05-01

    Full Text Available A compact isotope ratio laser spectrometry (IRLS instrument was developed for simultaneous measurements of the D/H, 18O/16O and 17O/16O isotope ratios in water by laser absorption spectroscopy at 2.73 μm. Special attention is paid to the spectral data processing and implementation of a Kalman adaptive filtering to improve the measurement precision. Reduction of up to 3-fold in standard deviation in isotope ratio determination was obtained by the use of a Fourier filtering to remove undulation structure from spectrum baseline. Application of Kalman filtering enables isotope ratio measurement at 1 s time intervals with a precision (<1‰ better than that obtained by conventional 30 s averaging, while maintaining a fast system response. The implementation of the filter is described in detail and its effects on the accuracy and the precision of the isotope ratio measurements are investigated.

  8. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    Energy Technology Data Exchange (ETDEWEB)

    Peleties, F. [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Segovia, J.J. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain); Trusler, J.P.M., E-mail: m.trusler@imperial.ac.u [Department of Chemical Engineering, Imperial College London, South Kensington Campus, London SW7 2AZ (United Kingdom); Vega-Maza, D. [Grupo de Termodinamica y Calibracion (TERMOCAL), Dpto. Ingenieria Energetica y Fluidomecanica, E.T.S. de Ingenieros Industriales, Universidad de Valladolid, E-47011 Valladolid (Spain)

    2010-05-15

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  9. Thermodynamic properties and equation of state of liquid di-isodecyl phthalate at temperature between (273 and 423) K and at pressures up to 140 MPa

    International Nuclear Information System (INIS)

    Peleties, F.; Segovia, J.J.; Trusler, J.P.M.; Vega-Maza, D.

    2010-01-01

    We report measurements of the thermodynamic properties of liquid di-isodecyl phthalate (DIDP) and an equation of state determined therefrom. The speed of sound in DIDP was measured at temperatures between (293.15 and 413.15) K and a pressures between (0.1 and 140) MPa with a relative uncertainty of 0.1%. In addition, the isobaric specific heat capacity was measured at temperatures between (293.15 and 423.15) K at a pressure of 0.1 MPa with a relative uncertainty of 1%, and the density was measured at temperatures between (273.15 and 413.15) K at a pressure of 0.1 MPa with a relative uncertainty of 0.015%. The thermodynamic properties of DIDP were obtained from the measured speeds of sound by thermodynamic integration starting from the initial values of density and isobaric specific heat capacity obtained experimentally. The results have been represented by a new equation of state containing nine parameters with an uncertainty in density not worse than 0.025%. Comparisons with literature data are made.

  10. Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table

    International Nuclear Information System (INIS)

    Hobart, David E.

    2012-01-01

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  11. Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Laboratory

    2012-08-17

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  12. The X-ray emission mechanism of large scale powerful quasar jets: Fermi rules out IC/CMB for 3C 273.

    Directory of Open Access Journals (Sweden)

    Georganopoulos Markos

    2013-12-01

    Full Text Available The process responsible for the Chandra-detected X-ray emission from the large-scale jets of powerful quasars is not clear yet. The two main models are inverse Compton scattering off the cosmic microwave background photons (IC/CMB and synchrotron emission from a population of electrons separate from those producing the radio-IR emission. These two models imply radically different conditions in the large scale jet in terms of jet speed, kinetic power, and maximum energy of the particle acceleration mechanism, with important implications for the impact of the jet on the larger-scale environment. Georganopoulos et al. (2006 proposed a diagnostic based on a fundamental difference between these two models: the production of synchrotron X-rays requires multi-TeV electrons, while the EC/CMB model requires a cutoff in the electron energy distribution below TeV energies. This has significant implications for the γ-ray emission predicted by these two models. Here we present new Fermi observations that put an upper limit on the gamma-ray flux from the large-scale jet of 3C 273 that clearly violates the flux expected from the IC/CMB X-ray interpretation found by extrapolation of the UV to X-ray spectrum of knot A, thus ruling out the IC/CMB interpretation entirely for this source. Further, the upper limit from Fermi puts a limit on the Doppler beaming factor of at least δ <9, assuming equipartition fields, and possibly as low as δ <5 assuming no major deceleration of the jet from knots A through D1.

  13. Recurrent Microdeletions at Xq27.3-Xq28 and Male Infertility: A Study in the Czech Population.

    Directory of Open Access Journals (Sweden)

    Blanka Chylíková

    Full Text Available Genetic causes of male infertility are hypothesized to involve multiple types of mutations, from single gene defects to complex chromosome rearrangements. Recently, several recurrent X-chromosome microdeletions (located in subtelomeric region of the long arm were reported to be associated with male infertility in Spanish and Italian males. The aim of our study was to test their prevalence and infertility association in population of men from the Czech Republic.107 males with pathological sperm evaluation resulting in nonobstructive infertility were compared to 131 males with normal fecundity. X-chromosome microdeletions were assessed by +/- PCR with three primer pairs for each region Xcnv64 (Xq27.3, Xcnv67 (Xq28 and Xcnv69 (Xq28. The latter microdeletion was further characterized by amplification across the deleted region, dividing the deletion into three types; A, B and C.We detected presence of isolated Xcnv64 deletion in 3 patients and 14 controls, and Xcnv69 in 3 patients and 6 controls (1 and 1 patient vs.4 and 1 control for types A and B respectively. There was one control with combined Xcnv64 and Xcnv69 type B deletions, and one patient with combination of Xcnv64 and Xcnv69 type C deletions. The frequency of the deletions was thus not higher in patient compared to control group, Xcnv64 was marginally associated with controls (adjusted Fisher´s exact test P = 0.043, Xcnv69 was not associated (P = 0.452. We excluded presence of more extensive rearrangements in two subjects with combined Xcnv64 and Xcnv69 deletions. There was no Xcnv67 deletion in our cohort.In conclusion, the two previously reported X-linked microdeletions (Xcnv64 and Xcnv69 do not seem to confer a significant risk to impaired spermatogenesis in the Czech population. The potential clinical role of the previously reported patient-specific Xcnv67 remains to be determined in a larger study population.

  14. Gastric Medullary Carcinoma with Sporadic Mismatch Repair Deficiency and a TP53 R273C Mutation: An Unusual Case with Wild-Type BRAF

    Directory of Open Access Journals (Sweden)

    Brett M. Lowenthal

    2017-01-01

    Full Text Available Medullary carcinoma has long been recognized as a subtype of colorectal cancer associated with microsatellite instability and Lynch syndrome. Gastric medullary carcinoma is a very rare neoplasm. We report a 67-year-old male who presented with a solitary gastric mass. Total gastrectomy revealed a well-demarcated, poorly differentiated carcinoma with an organoid growth pattern, pushing borders, and abundant peritumoral lymphocytic response. The prior cytology was cellular with immunohistochemical panel consistent with upper gastrointestinal/pancreaticobiliary origin. Overall, the histopathologic findings were consistent with gastric medullary carcinoma. A mismatch repair panel revealed a mismatch repair protein deficient tumor with loss of MLH1 and PMS2 expression. BRAF V600E immunostain (VE1 and BRAF molecular testing were negative, indicating a wild-type gene. Tumor sequencing of MLH1 demonstrated a wild-type gene, while our molecular panel identified TP53 c.817C>T (p.R273C mutation. These findings were compatible with a sporadic tumor. Given that morphologically identical medullary tumors often occur in Lynch syndrome, it is possible that mismatch repair loss is an early event in sporadic tumors with p53 mutation being a late event. Despite having wild-type BRAF, this tumor is sporadic and unrelated to Lynch syndrome. This case report demonstrates that coordinate ancillary studies are needed to resolve sporadic versus hereditary rare tumors.

  15. Theoretical predictions of properties and gas-phase chromatography behaviour of carbonyl complexes of group-6 elements Cr, Mo, W, and element 106, Sg.

    Science.gov (United States)

    Pershina, V; Anton, J

    2013-05-07

    Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.

  16. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  17. Solution of the Skyrme-Hartree–Fock–Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VIII) HFODD (v2.73y): A new version of the program

    International Nuclear Information System (INIS)

    Schunck, N.; Dobaczewski, J.

    2017-01-01

    Here, we describe the new version (v2.73y) of the code hfodd which solves the nuclear Skyrme Hartree–Fock or Skyrme Hartree–Fock–Bogolyubov problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following new features: (i) full proton–neutron mixing in the particle–hole channel for Skyrme functionals, (ii) the Gogny force in both particle–hole and particle–particle channels, (iii) linear multi-constraint method at finite temperature, (iv) fission toolkit including the constraint on the number of particles in the neck between two fragments, calculation of the interaction energy between fragments, and calculation of the nuclear and Coulomb energy of each fragment, (v) the new version 200d of the code hfbtho, together with an enhanced interface between HFBTHO and HFODD, (vi) parallel capabilities, significantly extended by adding several restart options for large-scale jobs, (vii) the Lipkin translational energy correction method with pairing, (viii) higher-order Lipkin particle-number corrections, (ix) interface to a program plotting single-particle energies or Routhians, (x) strong-force isospin-symmetry-breaking terms, and (xi) the Augmented Lagrangian Method for calculations with 3D constraints on angular momentum and isospin. Finally, an important bug related to the calculation of the entropy at finite temperature and several other little significant errors of the previous published version were corrected.

  18. 48 CFR 812.301 - Solicitation provisions and contract clauses for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ....216-70, Estimated quantities. (15) 852.228-71, Indemnification and insurance. (16) 852.229-70, Sales...) 852.273-71, Alternative negotiation techniques. (3) 852.273-72, Alternative evaluation. (4) 852.273-73...

  19. Characterization of the diatomite binding domain in the ribosomal protein L2 from E. coli and functions as an affinity tag.

    Science.gov (United States)

    Li, Junhua; Zhang, Yang; Yang, Yanjun

    2013-03-01

    The ribosomal protein L2, a constituent protein of the 50S large ribosomal subunit, can be used as Si-tag using silica particles for the immobilization and purification of recombinant proteins (Ikeda et al. (Protein Expr Purif 71:91-95, 2010); Taniguchi et al. (Biotechnol Bioeng 96:1023-1029, 2007)). We applied a diatomite powder, a sedimentary rock mainly composed with diatoms silica, as an affinity solid phase and small ubiquitin-like modifier (SUMO) technology to release a target protein from the solid phase. The L2 (203-273) was the sufficient region for the adsorption of ribosomal protein L2 on diatomite. We comparatively analyzed the different adsorption properties of the two deleted proteins of L2 (L2 (1-60, 203-273) and L2 (203-273)) on diatomite. The time required to reach adsorption equilibrium of L2 (203-273) fusion protein on diatomite was shorter than that of L2 (1-60, 203-273) fusion protein. The maximum adsorption capacity of L2 (203-273) fusion protein was larger than that of L2 (1-60, 203-273) fusion protein. In order to study whether the L2 (203-273) can function as an affinity purification tag, SUMO was introduced as one specific protease cleavage site between the target protein and the purification tags. The L2 (203-273) and SUMO fusion protein purification method was tested using enhanced green fluorescent protein as a model protein; the result shows that the purification performance of this affinity purification method was good. The strong adsorption characteristic of L2 (203-273) on diatomite also provides a potential protein fusion tag for the immobilization of enzyme.

  20. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  1. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  2. Solubility measurement and correlation of 4-nitrophthalimide in (methanol, ethanol, or acetone) + N,N-dimethylformamide mixed solvents at temperatures from 273.15 K to 323.15 K

    International Nuclear Information System (INIS)

    Li, Rongrong; Han, Shuo; Du, Cunbin; Cong, Yang; Wang, Jian; Zhao, Hongkun

    2016-01-01

    Highlights: • Solubility of 4-nitrophthalimide in binary mixed solvents were determined. • Solubility data were correlated and calculated by four models. • The standard dissolution enthalpy for the dissolution processes were calculated. - Abstract: The solubility of 4-nitrophthalimide in binary (methanol + N,N-dimethylformamide (DMF), ethanol + DMF) and (acetone + DMF) solvent mixtures were investigated by the isothermal dissolution equilibrium method under atmosphere pressure. These studies were carried out at different mass fractions of methanol, ethanol or acetone ranging from 0.1 to 0.9 at temperature T = (273.15–323.15) K. For the nine groups of each solvent mixture studied, the solubility of 4-nitrophthalimide in mixed solutions increased with increasing temperature and mass fraction of methanol, ethanol or acetone for the three systems including (methanol + DMF), (ethanol + DMF) and (acetone + DMF). At the same temperature and mass fraction of methanol, ethanol or acetone, the mole fraction solubility of 4-nitrophthalimide in (acetone + DMF) was greater than that in the other two binary solvents. In addition, the experimental mole fraction solubility was correlated by four models (Jouyban–Acree model, van’t Hoff–Jouyban–Acree model, modified Apelblat–Jouyban–Acree model and Sun model). The Jouyban–Acree model gave best representation for the experimental solubility values. Furthermore, the standard molar enthalpies of 4-nitrophthalimide during the dissolving process (Δ sol H o ) were also obtained in this work, and the results show that the dissolution process is endothermic. The experimental solubility and the models used in this work will be helpful in separating 4-nitrophthalimide from its isomeric mixtures.

  3. 7 CFR 273.5 - Students.

    Science.gov (United States)

    2010-01-01

    ... one natural, adoptive or stepparent (regardless of marital status) is in the same food stamp household... participating in a State or federally financed work study program during the regular school year. (i) To qualify under this provision, the student must be approved for work study at the time of application for food...

  4. 40 CFR 273.9 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., metal, or any combination of these materials. Battery means a device consisting of one or more... not limited to, fluorescent, high intensity discharge, neon, mercury vapor, high pressure sodium, and metal halide lamps. Large Quantity Handler of Universal Waste means a universal waste handler (as...

  5. 33 CFR 273.12 - References.

    Science.gov (United States)

    2010-07-01

    ... pesticide chemicals, 2,4-D, subpart C (F) 16 December 1975. (d) Pub. L. 91-596, Occupational Safety and Health Act of 1970, (84 Stat. 1609, 29 U.S.C. 668), 29 December 1970. (e) 29 CFR 1960, Safety and Health... Management System.” (h) ER 1105-2-507, “Preparation and Coordination of Environmental Statements.” (33 CFR...

  6. 25 CFR 273.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    .... (e) “Economic enterprise” means any commercial, industrial, agricultural, or business activity that...) “Education plan” means a comprehensive plan for the programmatic and fiscal services of and accountability by.... 2203). (l) “Operational support” means those expenditures for school operational costs in order to meet...

  7. Synthesis, characterization, mucoadhesion and biocompatibility of thiolated carboxymethyl dextran-cysteine conjugate.

    Science.gov (United States)

    Shahnaz, G; Perera, G; Sakloetsakun, D; Rahmat, D; Bernkop-Schnürch, A

    2010-05-21

    This study was aimed at improving the mucoadhesive properties of carboxymethyl dextran by the covalent attachment of cysteine. Mediated by a carbodiimide, l-cysteine was covalently attached to the polymer. The resulting CMD-cysteine conjugate (CMD-(273) conjugate) displayed 273+/-20 micromol thiol groups per gram of polymer (mean+/-S.D.; n=3). Within 2h the viscosity of an aqueous mucus/CMD-(273) conjugate mixture pH 7.4 increased at 37 degrees C by more than 85% compared to a mucus/carboxymethyl dextran mixture indicating enlarged interactions between the mucus and the thiolated polymer. Due to the immobilization of cysteine, the swelling velocity of the polymer was significantly accelerated (ppolymer disintegrated within 15 min, whereas tablets of the CMD-(273) conjugate remained stable for 160 min (means+/-S.D.; n=3). Results from LDH and MTT assays on Caco-2 cells revealed 4.96+/-0.98% cytotoxicity and 94.1+/-0.9% cell viability for the CMD-(273) conjugate, respectively. Controlled release of model compound from CMD-(273) conjugate tablets was observed over 6h. These findings suggest that CMD-(273) conjugate is a promising novel polymer for drug delivery systems providing improved mucoadhesive and cohesive properties, greater stability and biocompatibility. Copyright 2010 Elsevier B.V. All rights reserved.

  8. Generation of a novel live rabies vaccine strain with a high level of safety by introducing attenuating mutations in the nucleoprotein and glycoprotein.

    Science.gov (United States)

    Nakagawa, Keisuke; Nakagawa, Kento; Omatsu, Tsutomu; Katayama, Yukie; Oba, Mami; Mitake, Hiromichi; Okada, Kazuma; Yamaoka, Satoko; Takashima, Yasuhiro; Masatani, Tatsunori; Okadera, Kota; Ito, Naoto; Mizutani, Tetsuya; Sugiyama, Makoto

    2017-10-09

    The current live rabies vaccine SAG2 is attenuated by only one mutation (Arg-to-Glu) at position 333 in the glycoprotein (G333). This fact generates a potential risk of the emergence of a pathogenic revertant by a back mutation at this position during viral propagation in the body. To circumvent this risk, it is desirable to generate a live vaccine strain highly and stably attenuated by multiple mutations. However, the information on attenuating mutations other than that at G333 is very limited. We previously reported that amino acids at positions 273 and 394 in the nucleoprotein (N273/394) (Leu and His, respectively) of fixed rabies virus Ni-CE are responsible for the attenuated phenotype by enhancing interferon (IFN)/chemokine gene expressions in infected neural cells. In this study, we found that amino acid substitutions at N273/394 (Phe-to-Leu and Tyr-to-His, respectively) attenuated the pathogenicity of the oral live vaccine ERA, which has a virulent-type Arg at G333. Then we generated ERA-N273/394-G333 attenuated by the combination of the above attenuating mutations at G333 and N273/394, and checked its safety. Similar to the ERA-G333, which is attenuated by only the mutation at G333, ERA-N273/394-G333 did not cause any symptoms in adult mice after intracerebral inoculation, indicating a low level of residual pathogenicity of ERA-N273/394-G333. Further examination revealed that infection with ERA-N273/394-G333 induces IFN-β and CXCL10 mRNA expressions more strongly than ERA-G333 infection in a neuroblastoma cell line. Importantly, we found that the ERA-N273/394-G333 stain has a lower risk for emergence of a pathogenic revertant than does the ERA-G333. These results indicate that ERA-N273/394-G333 has a potential to be a promising candidate for a live rabies vaccine strain with a high level of safety. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

    Science.gov (United States)

    Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

    2018-05-24

    Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

  10. 40 CFR 273.81 - Factors for petitions to include other wastes under 40 CFR part 273.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR UNIVERSAL WASTE MANAGEMENT Petitions To Include... generic name to identify the waste category (e.g., batteries), the definition of universal waste in § 260..., and specific management standards proposed or referenced by the petitioner (e.g., waste management...

  11. 7 CFR 273.15 - Fair hearings.

    Science.gov (United States)

    2010-01-01

    ... in the event it is not possible for the household to attend the scheduled hearing. (2) Specify that... with due process to insure an orderly hearing; (v) Order, where relevant and useful, an independent..., shall constitute the exclusive record for a final decision by the hearing authority. This record shall...

  12. 7 CFR 273.7 - Work provisions.

    Science.gov (United States)

    2010-01-01

    ... office of the State employment services agency. (vi) A regular participant in a drug addiction or... and casework to facilitate the transition from economic dependency to self-sufficiency through work...

  13. 8 CFR 273.3 - Screening procedures.

    Science.gov (United States)

    2010-01-01

    ... this section apply to those owners, operators, or agents of carriers which transport passengers to the... examination of their travel documents to ensure that: (i) The passport or travel document presented is not...

  14. Suicide Prevention: 1-800-273-8255

    Science.gov (United States)

    ... Spanish: Informacion y Apoyo para los Sobrevivientes del Suicidio: Guía de Recursos del Departamento de Veteran Affairs para las familias que estén lidiando con el suicidio How to Talk to a Child about a ...

  15. Publications | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Visit the IDRC Digital Library now. ... initiative in Latin America and the Caribbean is tackling the environmental problem of e-waste disposal, providing computers for schools, and creating jobs at the same time. ... Several Latin American neighbours have toured this rural county in the mountains of Honduras to see.

  16. 3q27.3 microdeletional syndrome

    DEFF Research Database (Denmark)

    Thevenon, Julien; Callier, Patrick; Poquet, Hélène

    2014-01-01

    BACKGROUND: Since the advent of array-CGH, numerous new microdeletional syndromes have been delineated while others remain to be described. Although 3q29 subtelomeric deletion is a well-described syndrome, there is no report on 3q interstitial deletions. METHODS: We report for the first time seve...

  17. 48 CFR 719.273-2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., small disadvantaged business, women-owned small business, veteran-owned and service-disabled veteran..., women-owned small business, HUBZone small business, veteran-owned small business or service-disabled... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development (USAID) Mentor-Prot...

  18. 33 CFR 273.14 - Planning procedures.

    Science.gov (United States)

    2010-07-01

    ... control project programs which involve pest control operations, such as aquatic plant control, and affect... Environmental Policy Act. (The information outlined in Appendix C should be included in the analysis section of...

  19. 40 CFR 60.273 - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... sensor must provide output of relative particulate matter loadings and the owner or operator shall... system including quality assurance procedures; (iv) How the bag leak detection system will be maintained... stack, the bag leak detection sensor must be installed downstream of the baghouse and upstream of any...

  20. 33 CFR 273.13 - Program policy.

    Science.gov (United States)

    2010-07-01

    ... project. (iii) Analysis based on sound economic principles clearly demonstrates that the project will... Program is designed to deal primarily with weed infestations of major economic significance including... infestation should constitute a known problem of economic importance in the area involved. Initial planning...

  1. 12 CFR 27.3 - Recordkeeping requirements.

    Science.gov (United States)

    2010-01-01

    ... work or profession for the applicant(s). (xii) Years on present job. Number of continuous years... accounts, stocks and bonds, cash value of life insurance, value of real estate owned, net worth of business... deposit balance is required, and if so, the amount. (iv) The note (simple) interest rate. (v) The number...

  2. Publications | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-04-20

    Seeking justice: Women's police stations in Latin America. On April 20, 2009, in the small town of Diriomo, Nicaragua, Luz Marina Lezama Suazo, aged 47, was shot dead, allegedly by her husband. According to her sister, “She'd been having problems with him for a while and we had told her to leave.

  3. Acute, reproductive toxicity and two-generation teratology studies of a standardized quassinoid-rich extract of Eurycoma longifolia Jack in Sprague-Dawley rats.

    Science.gov (United States)

    Low, Bin-Seng; Das, Prashanta Kumar; Chan, Kit-Lam

    2014-07-01

    The roots of Eurycoma longifolia Jack are popularly sought as herbal medicinal supplements to improve libido and general health amongst the local ethnic population. The major quassinoids of E. longifolia improved spermatogenesis and fertility but toxicity studies have not been well documented. The reproductive toxicity, two generation of foetus teratology and the up-and-down acute toxicity were investigated in Sprague-Dawley rats orally treated with quassinoid-rich E. longifolia extract (TAF273). The results showed that the median lethal dose (LD50 ) of TAF273 for female and male rats was 1293 and >2000 mg/kg, respectively. Fertility index and litter size of the TAF273 treated were significantly increased when compared with those of the non-treated animals. The TAF273-treated dams decreased in percentage of pre-implantation loss, post-implantation loss and late resorption. No toxic symptoms were observed on the TAF273-treated pregnant female rats and their foetuses were normal. The no-observed adverse effect level (NOAEL) obtained from reproductive toxicity and teratology studies of TAF273 in rats was 100 mg/kg body weight/day, being more than 10-fold lower than the LD50 value. Thus, any human dose derived from converting the rat doses of 100 mg/kg and below may be considered as safe for further clinical studies. Copyright © 2013 John Wiley & Sons, Ltd.

  4. Characteristics of high- and low-risk individuals in the PRIORITY study

    DEFF Research Database (Denmark)

    Tofte, N; Lindhardt, M; Adamova, K

    2018-01-01

    variable. In a logistic regression model including clinical variables known to be associated with diabetic kidney disease, estimated GFR, gender, log urinary albumin:creatinine ratio and use of renin-angiotensin system-blocking agents remained significant determinants of the CKD273 high-risk group: area......AIM: To compare clinical baseline data in individuals with Type 2 diabetes and normoalbuminuria, who are at high or low risk of diabetic kidney disease based on the urinary proteomics classifier CKD273. METHODS: We conducted a prospective, randomized, double-blind, placebo-controlled international...... multicentre clinical trial and observational study in participants with Type 2 diabetes and normoalbuminuria, stratified into high- or low-risk groups based on CKD273 score. Clinical baseline data for the whole cohort and stratified by risk groups are reported. The associations between CKD273 and traditional...

  5. Vaginal Yeast Infections

    Science.gov (United States)

    ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ...

  6. Are You Thinking about Suicide? How to Stay Safe and Find Treatment

    Science.gov (United States)

    ... number — in the United States, call the National Suicide Prevention Lifeline at 800-273-TALK (800-273-8255) ... www.dbsalliance.org/site/PageServer?pagename=education_brochures_suicide_prevention. Accessed April 30, 2015. McDowell AK, et al. ...

  7. Chemical and biological evaluation of Sm-153 and Ho-166 complexes with tetraethylester of DOTP ( DOTPOEt )

    Czech Academy of Sciences Publication Activity Database

    Forsterová, Michaela; Margues, M. M.; Jandurová, Z.; Gano, L.; Hermann, P.; Melichar, František

    2007-01-01

    Roč. 50, č. 1 (2007), s. 273-273 ISSN 0362-4803 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : Phosphonate Complexes Subject RIV: FR - Pharmacology ; Medidal Chemistry

  8. L-Glutamic acid production by Bacillus spp. isolated from vegetable ...

    African Journals Online (AJOL)

    Ogiri” (fermented vegetable proteins) in Nigeria. The isolates were identified as Bacillus subtilis (6), (27.3%), Bacillus pumilus (5), (22.7%), Bacillus licheniformis (5), (27.3%) and Bacillus polymyxa (6), (22.7%). Four species of the Bacillus isolates ...

  9. The importance and measurement of new production

    Digital Repository Service at National Institute of Oceanography (India)

    Platt, T.; Jauhari, P.; Sathyendranath, S.

    stream_size 12 stream_content_type text/plain stream_name Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt stream_source_info Primary_Prod_Biogeochem_Cycle_Sea_1992_273.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  10. NCBI nr-aa BLAST: CBRC-PHAM-01-0930 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0930 ref|YP_264072.1| competence protein, ComEC [Psychrobacter arcticu...s 273-4] gb|AAZ18638.1| possible competence protein, ComEC [Psychrobacter arcticus 273-4] YP_264072.1 2.8 24% ...

  11. NCBI nr-aa BLAST: CBRC-PABE-13-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-13-0007 ref|YP_264072.1| possible competence protein, ComEC [Psychrobacte...r arcticus 273-4] gb|AAZ18638.1| possible competence protein, ComEC [Psychrobacter arcticus 273-4] YP_264072.1 2.2 24% ...

  12. Too large or too small? Returns to scale in a retail network

    Czech Academy of Sciences Publication Activity Database

    Brázdik, František; Druska, V.

    -, č. 273 (2005), s. 1-45 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : data envelopment analysis application * linear programming * retail units Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp273.pdf

  13. Rozdíly v klinickém obraze a laboratorních nálezech v časné fázi aseptického zánětu CNS dle vyvolávajícího agens

    Czech Academy of Sciences Publication Activity Database

    Heinige, P.; Fajt, M.; Šilhánková, I.; Halašková, P.; Jiroušová, M.; Matějčková, Eva; Ješina, Pavel

    2006-01-01

    Roč. 61, č. 5 (2006), s. 273-273 ISSN 0069-2328. [Český pediatrický kongres s mezinárodní účastí /7./. 08.06.2006-11.06.2006, Praha] Keywords : CNS * aseptic inflammation Subject RIV: FG - Pediatrics

  14. L’art. 27 ultimo capoverso del Concordato lateranense e la sua applicazione al Santuario della B. Vergine delle Grazie in Brescia

    Directory of Open Access Journals (Sweden)

    Maria Vismara Missiroli

    2012-02-01

    Full Text Available SOMMARIO: 1. Problemi interpretativi dell’art. 27.3 del Concordato Lateranense - 2. L'Istruzione della Congregazione del Concilio del 1930. - 3. La qualificazione di una chiesa come Santuario - 4. Requisiti per l’applicazione ai santuari dell’art. 27.3 - 4.1. Amministrazione civile - 4.2. Personalità giuridica - 5. La questione dei santuari di proprietà di persone fisiche o giuridiche - 6. Il Santuario della Beata Vergine delle Grazie di Brescia. Brevi cenni storici - 7. L’applicazione dell’art. 27.3 del Concordato lateranense al Santuario di S. Maria delle Grazie - 8. Conclusione.

  15. Catalytic isotope exchange reaction between deuterium gas and water pre-adsorbed on platinum/alumina

    International Nuclear Information System (INIS)

    Iida, Itsuo; Kato, Junko; Tamaru, Kenzi.

    1976-01-01

    The catalytic isotope exchange reaction between deuterium gas and the water pre-adsorbed on Pt/Al 2 O 3 was studied. At reaction temperatures above 273 K, the exchange rate was proportional to the deuterium pressure and independent of the amount of adsorbed water, which suggests that the rate determining step is the supply of deuterium from the gas phase. Its apparent activation energy was 38 kJ mol -1 . Below freezing point of water, the kinetic behaviour was different from that above freezing point. At higher deuterium pressures the rate dropped abruptly at 273 K. Below the temperature the apparent activation energy was 54 kJ mol -1 and the exchange rate depended not on the deuterium pressure but on the amount of the pre-adsorbed water. At lower pressures, however, the kinetic behaviour was the same as the above 273 K, till the rate of the supply of deuterium from the gas phase exceeded the supply of hydrogen from adsorbed water to platinum surface. These results suggest that below 273 K the supply of hydrogen is markedly retarded, the state of the adsorbed water differing from that above 273 K. It was also demonstrated that when the adsorbed water is in the state of capillary condensation, the exchange rate becomes very small. (auth.)

  16. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  17. 76 FR 59927 - Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were Approved After...

    Science.gov (United States)

    2011-09-28

    ...-0029] RIN 1615-AA90 Treatment of Aliens Whose Employment Creation Immigrant (EB-5) Petitions Were... qualifying aliens whose employment-creation immigrant petitions were approved by the former Immigration and...-273 Provisions C. Summary of the Adjudications Required by Public Law 107-273 III. Aliens Eligible To...

  18. Flight activity and habitat preference of bats in a karstic area, as revealed by bat detectors

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Řehák, Z.

    2006-01-01

    Roč. 55, č. 3 (2006), s. 273-281 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : Moravian Karst * echolocation calls * bat community * detectoring Subject RIV: EG - Zoology Impact factor: 0.529, year: 2006 http://www.ivb.cz/folia/55/3/273-281.pdf

  19. Veterans Crisis Line: 1-800-273-8255

    Science.gov (United States)

    Veterans Crisis Line Skip to Main Content SuicidePreventionLifeline.org Get Help Materials Get Involved Crisis Centers About Be There ... Line FAQs Veteran Suicide Welcome to the Veterans Crisis Line Website The Veterans Crisis Line connects Veterans ...

  20. 273 LEKSIKOGRAFIE EN LINGUISTIEK Piet Swanepoel UNISA ...

    African Journals Online (AJOL)

    daar die neiging bestaan om die leksikografie eenvoudig te reduseer tot die toegepaste been van die .... vakgebied, wat dit uitsluit dat enige toegepaste taaldissipJine eenvoudig tot die praktiese komponent van die ..... examples of each phenomenon that they study, remaining oblivious to how large or small a set of lexical ...

  1. 25 CFR 273.49 - Freedom of information.

    Science.gov (United States)

    2010-04-01

    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE... disclosure only when both of the following conditions exist: (1) The reports and information fall within one... where disclosure would be a clearly unwarranted invasion of personal privacy. (2) Disclosure is...

  2. Flow-induced vibration -- 1994. PVP-Volume 273

    International Nuclear Information System (INIS)

    Au-Yang, M.K.; Fujita, K.

    1994-01-01

    Flow-induced vibration is a subject of practical interest to many engineering disciplines, including the power generation, process, and petrochemical industries. In the nuclear industry, flow-induced vibration reaches a higher level of concern because of safety issues and the huge cost associated with down time and site repair. Not surprisingly, during the last 25 years a tremendous amount of effort has been spent in the study of flow-induced vibration phenomena related to nuclear plant components, notably nuclear steam generator tube banks and nuclear fuel bundles. Yet, in spite of this concentrated effort, the industry is still not free from flow-induced vibration-related problems. This explains why in this volume almost half of the papers address the issue of cross-flow induced vibration in tube bundles, with applications to the nuclear steam generator and nuclear fuel bundles in mind. Unlike 10 or 15 years ago, when flow-induced vibration studies almost always involved experimentation and empirical studies, the advent of high-speed computers has enabled numerical calculation and simulation of this complex phenomenon to take place. Separate abstracts were prepared for 27 papers in this volume

  3. 40 CFR 60.273a - Emission monitoring.

    Science.gov (United States)

    2010-07-01

    ... sensor must provide output of relative particulate matter loadings and the owner or operator shall... the bag leak detection system including quality assurance procedures; (iv) How the bag leak detection... discharged to the atmosphere through a stack, the bag leak detection sensor must be installed downstream of...

  4. 7 CFR 273.18 - Claims against households.

    Science.gov (United States)

    2010-01-01

    ..., referrals to collection and/or other similar private and public sector agencies, state tax refund and... different type of claim (e.g., as an IHE rather than an IPV claim). (B) all adult household members die must... public service This form of payment must be ordered by a court and specifically be in lieu of paying any...

  5. 48 CFR 719.273-8 - Developmental assistance.

    Science.gov (United States)

    2010-10-01

    ... relating to— (1) Financial management; (2) Organizational management; (3) Overall business management/planning; (4) Business development; and (5) Technical assistance. (b) Loans; (c) Rent-free use of... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The U.S. Agency for International Development...

  6. 7 CFR 273.8 - Resource eligibility standards.

    Science.gov (United States)

    2010-01-01

    ... by the Department of Housing and Urban Development through the individual and family grant program or... any business or corporation under the control, direction, or influence of a household member; and (iv...

  7. Measurement of Aerosol Optical Properties by Integrating Cavity Ring-Down Spectroscopy and Nephelometry

    Science.gov (United States)

    2013-01-01

    Getachew Tedela North Carolina A&T State University 1601 East Market Street Greensboro, NC 27411 -3209 REPORT DOCUMENTATION PAGE b. ABSTRACT UU c. THIS...2.1013 3.273 )( P TSTPgasKgasK  (18) Where, the standard temperature and pressure ( STP ) are 273.2 k and 1013.2 mb

  8. Interventional studies in childhood dystonia do not address the concerns of children and their carers.

    Science.gov (United States)

    Lumsden, Daniel E; Gimeno, Hortensia; Tustin, Kylee; Kaminska, Margaret; Lin, Jean-Pierre

    2015-05-01

    This study aimed to determine the main concerns/priorities of the parents and carers of children with dystonia referred to our service and whether medical interventional studies addressed these concerns. Records of children assessed by our service from June 2005-December 2012 were reviewed and expressed parental/carer concerns at initial assessment categorized using the International Classification of Functioning (ICF) Framework. Medline, CINAHL and Embase databases were searched for outcome measures of medical and surgical interventional studies in childhood dystonia. Data was collected from 273 children and young people with dystonia. The most commonly expressed concerns were: pain (104/273, 38.1%); difficulties in delivering activities of daily-living (66/273, 24.2%), difficulties with hand-use (59/273, 21.6%) and seating (41/273, 15.0%). Literature review identified 70 interventional studies, 46 neurosurgical and 24 pharmacological. The majority of neurosurgical studies (34/46) used impairment scales to measure change, with pharmacological studies typically reporting more subjective changes in motor symptoms. Only a minority of studies used assessments or scales capable of objectively addressing the concerns reported by our cohort. Existing interventional studies in childhood dystonia poorly address the main concerns of children with dystonia and their carers, limiting the conclusions which may be drawn as to true impact of these interventions in childhood. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.

  9. Reactive oxygen metabolites (ROMs) are associated with cardiovascular disease in chronic hemodialysis patients.

    Science.gov (United States)

    Bossola, Maurizio; Vulpio, Carlo; Colacicco, Luigi; Scribano, Donata; Zuppi, Cecilia; Tazza, Luigi

    2012-02-11

    The aim of our study was to measure reactive oxygen metabolites (ROMs) in chronic hemodialysis (HD) patients and evaluate the possible association with cardiovascular disease (CVD) and mortality. We measured ROMs in 76 HD patients and correlated with CVD, cardiovascular (CV) events in the follow-up and all-cause and CVD-related mortality. The levels of ROMs presented a median value of 270 (238.2-303.2) CARR U (interquartile range). We created a ROC curve (ROMs levels vs. CVD) and we identified a cut-off point of 273 CARR U. Patients with ROMs levels ≥273 CARR U were significantly older, had higher C-reactive protein levels and lower creatinine concentrations. The prevalence of CVD was higher in patients with ROMs levels ≥273 (87.1%) than in those with ROMs levels <273 CARR U (17.7%; p<0.0001). ROMs levels were significantly higher in patients with CVD (317±63.8) than in those without (242.7±49.1; p<0.0001). At multiple regression analysis, age, creatinine and C-reactive protein were independent factors associated with ROMs. At multiple logistic regression analysis the association between ROMs and CVD was independent (OR: 1.02, 95% CI: 1.00-1.05; p=0.03). Twenty six patients developed cardiovascular (CV) events during the follow-up. Of these, seven were in the group with ROMs levels <273 CARR U and 19 in the group with ROMs levels ≥273 CARR U. The logistic regression analysis showed that both age (OR: 1.06, 95% CI: 1.01-1.12; p=0.013) and ROMs levels (OR: 1.10, 95% CI: 1.00-1.02; p=0.045) were independently associated with CV events in the follow-up. ROMs are independently associated with CVD and predict CV events in chronic HD patients.

  10. Glutathionylation of Yersinia pestis LcrV and Its Effects on Plague Pathogenesis

    Directory of Open Access Journals (Sweden)

    Anthony Mitchell

    2017-05-01

    Full Text Available Glutathionylation, the formation of reversible mixed disulfides between glutathione and protein cysteine residues, is a posttranslational modification previously observed for intracellular proteins of bacteria. Here we show that Yersinia pestis LcrV, a secreted protein capping the type III secretion machine, is glutathionylated at Cys273 and that this modification promotes association with host ribosomal protein S3 (RPS3, moderates Y. pestis type III effector transport and killing of macrophages, and enhances bubonic plague pathogenesis in mice and rats. Secreted LcrV was purified and analyzed by mass spectrometry to reveal glutathionylation, a modification that is abolished by the codon substitution Cys273Ala in lcrV. Moreover, the lcrVC273A mutation enhanced the survival of animals in models of bubonic plague. Investigating the molecular mechanism responsible for these virulence attributes, we identified macrophage RPS3 as a ligand of LcrV, an association that is perturbed by the Cys273Ala substitution. Furthermore, macrophages infected by the lcrVC273A variant displayed accelerated apoptotic death and diminished proinflammatory cytokine release. Deletion of gshB, which encodes glutathione synthetase of Y. pestis, resulted in undetectable levels of intracellular glutathione, and we used a Y. pestis ΔgshB mutant to characterize the biochemical pathway of LcrV glutathionylation, establishing that LcrV is modified after its transport to the type III needle via disulfide bond formation with extracellular oxidized glutathione.

  11. Stability and Rheology of Dilute TiO2 – Water Nanofluids

    Czech Academy of Sciences Publication Activity Database

    Pěnkavová, Věra; Tihon, Jaroslav; Wein, Ondřej

    2011-01-01

    Roč. 6, č. 1 (2011), s. 273 ISSN 1931-7573 R&D Projects: GA ČR GA104/08/0428; GA ČR GA104/09/0972 Institutional research plan: CEZ:AV0Z40720504 Keywords : nanofluids * zeta potential * aws viscometry Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.726, year: 2011 http://www.nanoscalereslett.com/content/6/1/273

  12. Spectral Variability in Hard X-rays and the Evidence for a 13.5 Years ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    fit in the X-ray and gamma ray energy bands points to a common origin of these photons and the ... relativistic jets in relation to BL Lac objects in general, and 3C273 in particular has ..... emission must also explain the long term period of ∼ 5000 days in 3C273 as discussed above. .... data available on public archives.

  13. Electrically injected GaAsBi/GaAs single quantum well laser diodes

    Directory of Open Access Journals (Sweden)

    Juanjuan Liu

    2017-11-01

    Full Text Available We present electrically injected GaAs/GaAsBi single quantum well laser diodes (LDs emitting at a record long wavelength of 1141 nm at room temperature grown by molecular beam epitaxy. The LDs have excellent device performances with internal quantum efficiency of 86%, internal loss of 10 cm-1 and transparency current density of 196 A/cm2. The LDs can operate under continuous-wave mode up to 273 K. The characteristic temperature are extracted to be 125 K in the temperature range of 77∼150 K, and reduced to 90 K in the range of 150∼273 K. The temperature coefficient of 0.3 nm/K is extracted in the temperature range of 77∼273 K.

  14. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  15. Baseline characteristics in PRIORITY study: Proteomics and mineralocorticoid receptor antagonism for prevention of diabetic nephropathy in type 2 diabetes

    DEFF Research Database (Denmark)

    Tofte, Nete

    diabetic nephRopathy In TYpe 2 diabetic patients with normoalbuminuria) trial, the aim is to confirm that CKD273 can predict microalbuminuria prospectively, and to test whether mineralocorticoid receptor antagonism (MRA) delays progression to microalbuminuria. Here we report the association between CKD273...... and traditional risk factors for diabetic nephropathy at baseline. Materials and methods PRIORITY is an investigator-initiated, prospective, randomized, double blind, placebo-controlled multicentre clinical trial and observational study in normoalbuminuric type 2 diabetic patients. Patients are stratified...... is development of microalbuminuria. Results In total 2277 type 2 diabetic patients have been screened over a time period of 2.5 years and 1811 are included from 15 sites. Table 1 shows the baseline characteristics. 224 (12.4%) have the high-risk CKD273 pattern. The high- and low-risk populations differ...

  16. Mercury removal from natural gas and associated condensates

    Energy Technology Data Exchange (ETDEWEB)

    Hennico, A.; Barthel, Y.; Courty, P. (Institut Francais du Petrole, 31 - Rueil-Malmaison (France). Direction Industrielle)

    1990-01-01

    IFP mercury trapping systems are based on CMG 273, the recently developed Procatalyse product which is the heart of IFP's gas phase and liquid phase mercury removal technology. This material, made of highly macroporous alumina supporting a metal sulfide, presents a very high reactivity towards mecury within a broad range of operating conditions, including those operating in the liquid phase. Characteristics of CMG 273 are presented. (orig.).

  17. Human Rights and Internal Security in Malaysia: Rhetoric and Reality

    Science.gov (United States)

    2006-03-01

    government is to integrate the population. According to Lauder and Mansor, population integration is seen as a sine qua non for nation building.273 Also, as...273 Kathleen Lauder and Norma Mansor, “Effective States and Engaged Societies: Capacity Development for Growth, Source Delivery...There are several reasons. People are not willing to lose what they have (property, money and good employment, for example). They are not willing

  18. 40 CFR 264.273 - Design and operating requirements.

    Science.gov (United States)

    2010-07-01

    ... the facility permit how the owner or operator will design, construct, operate, and maintain the land..., construct, operate, and maintain the treatment zone to minimize run-off of hazardous constituents during the... maintain a run-on control system capable of preventing flow onto the treatment zone during peak discharge...

  19. 77 FR 273 - Combined Notice of Filings #1

    Science.gov (United States)

    2012-01-04

    ... Numbers: QF12-120-000. Applicants: The Coca-Cola Company. Description: Form 556--Notice of self-certification of qualifying cogeneration facility status of The Coca-Cola Company. Filed Date: 12/21/2011...

  20. 7 CFR 273.4 - Citizenship and alien status.

    Science.gov (United States)

    2010-01-01

    ... the Indian Self-Determination and Education Assistance Act (25 U.S.C. 450b(e)) which is recognized as... verification. Until the alien provides information or verification necessary to carry out the provisions of... cooperate in providing information or verification, other adult members of the alien's household are...

  1. 31 CFR 27.3 - Assessment of civil penalties.

    Science.gov (United States)

    2010-07-01

    ..., Tobacco and Firearms,” “Bureau of the Public Debt,” “Bureau of Engraving and Printing,” “Comptroller of the Currency,” “Federal Law Enforcement Training Center,” “Financial Crimes Enforcement Network... Engraving and Printing,” “Comptroller of the Currency,” “Director of the Federal Law Enforcement Training...

  2. 47 CFR 27.3 - Other applicable rule parts.

    Science.gov (United States)

    2010-10-01

    ... standards and procedures concerning the marketing and importation of radio frequency devices, and for.... This part sets forth the requirements and conditions applicable to commercial mobile radio service providers. (h) Part 22. This part sets forth the requirements and conditions applicable to public mobile...

  3. 14 CFR 171.273 - Maintenance and operations requirements.

    Science.gov (United States)

    2010-01-01

    ... authorized persons. (3) FCC licensing requirements for operations and maintenance personnel. (4) Posting of..., with a maximum corrective maintenance time of not greater than 1.5 hours. This measure applies to... than 1,500 hours. This measure applies to unscheduled outages, out-of-tolerance conditions, and...

  4. Translations on Narcotics and Dangerous Drug No. 273

    Science.gov (United States)

    1976-11-26

    address Farahnaz Avenue, Mehrabad, age 25; Naser Aarakhani, butcher , age 2k; Mansur Sa’adatbakhsh; Da’ud Amini, age l8; Hoseyn Dastani...a police uniform was not to show off. Also arrested were: Hassan Nezam ’Ali, age 30, a poultry dealer living in Sarcheshmeh, with 3

  5. A kinetic study of the formation of organic solids from formaldehyde: Implications for the origin of extraterrestrial organic solids in primitive Solar System objects

    Science.gov (United States)

    Kebukawa, Yoko; Cody, George D.

    2015-03-01

    Aqueous organic solid formation from formaldehyde via the formose reaction and subsequent reactions is a possible candidate for the origin of complex primitive chondritic insoluble organic matter (IOM) and refractory carbon in comets. The rate of formation of organic solids from formaldehyde was studied as a function of temperature and time, with and without ammonia, in order to derive kinetic expressions for polymer yield. The evolution in molecular structure as a function of time and temperature was studied using infrared spectroscopy. Using these kinetic expressions, the yield of organic solids is estimated for extended time and temperature ranges. For example, the half-life for organic solid formation is ∼5 days at 373 K, ∼200 days at 323 K, and ∼70 years at 273 K with ammonia, and ∼25 days at 373 K, ∼13 years at 323 K, and ∼2 × 104 years at 273 K without ammonia. These results indicate that organic solids could form during the aqueous alteration in meteorite parent bodies. If liquid water existed early in the interiors of Kuiper belt objects (KBOs), formaldehyde could convert into organic solids at temperatures close to 273 K, and possibly even below 273 K in the ammonia-water system.

  6. Survival patterns and hemopathological responses of dogs under continuous gamma irradiation

    International Nuclear Information System (INIS)

    Seed, T.M.; Fritz, T.E.; Tolle, D.V.; Poole, C.M.; Lombard, L.S.; Doyle, D.E.; Kaspar, L.V.; Cullen, S.M.; Carnes, B.A.

    1983-01-01

    Survival curves were constructed and analyzed relative to contributing hematopathological responses for groups of beagles exposed continuously for duration of life to low daily doses of whole body 60 Co gamma irradiation (27.3 rads/day to 4 rads/day). The survival curves versus time were progressively displaced toward longer survival as rates of exposure were reduced from the relatively high dose rate of 27.3 rads/day to the low dose rate of 4.0 rads/day. Average survival times increased from 57 days at 27.3 rads/day to 1830 days at 4.0 rads/day, representing fractional increased life-spans from 1.5% to 50.8%, respectively. Survival curves versus total dose were markedly displaced along the cumulative radiation dose axis at the extreme dose rates (i.e., 27.3 and 4.0 rads/day), but not at the intermediate dose rates (i.e., 13.4 and 7.9 rads/day) in which the upper linear portions of the survival curves are superimposed. From these dose-dependent survival curves, LD 50 values for whole body gamma irradiation, delivered chronically at 27.3, 13.4, 7.9, and 4.0 rads per day were estimated to be 1442, 2124, 2039, and 7161 rads, respectively. Both time- and dose-dependent survival curves for the intermediate dose rates, in contrast to the extreme dose rates, exhibited pronounced transitions in the lethality rate below the 50% survival level. These lethality rate transitions occurred at approx. 2500 rads of accumulated dose and were attributed to a shift in the spectrum of developing hematopathologies: namely, from a predominance of the acutely ablative radiation-induced lymphohematopoietic syndromes (i.e., septicemias and aplastic anemias) to a predominance of the late arising hematopoietic neoplasias (myelogenous leukemia and related myeloproliferative disorders)

  7. Department of Defense Suicide Event Report (DoDSER) Calendar Year 2014 Annual Report

    Science.gov (United States)

    2015-07-16

    diagnoses identified in suicide DoDSER reports included mood (n= 17, 28.3%), adjustment (n = 14, 23.3%) and anxiety (n = 13, 21.7%) disorders . For suicide ...n = 35, 27.3%) and substance abuse (n = 35, 27.3%) disorders . For suicide attempt DoDSER reports, the most common diagnoses identified were mood (n...diagnoses identified in suicide DoDSER reports included mood (n= 10, 17.2%), adjustment (n = 8, 13.8%) and substance abuse (n = 8, 13.8%) disorders . For

  8. CO₂ Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues.

    Science.gov (United States)

    Bermúdez, José M; Dominguez, Pablo Haro; Arenillas, Ana; Cot, Jaume; Weber, Jens; Luque, Rafael

    2013-10-18

    Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO₂ adsorption properties, with interestingly high gas selectivities for CO₂ (α > 200 at a gas composition of 15% CO₂/85% N₂, 273K, 1 bar) and capacities (>2 mmol·g -1 at 273 K). Both CO₂ isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO₂ which may be correlated with both: N content in the leather residues and ultrasmall pore sizes.

  9. Development of an Atmospheric Dispersion Model for Heavier-Than-Air Gas Mixtures. Volume 1.

    Science.gov (United States)

    1985-05-01

    aspirated concentration sensor used a balanced Wheatstone bridge to measure the heat loss from a sensing element placed in the sample stream. Shaded...a semipermeable membrane and electrochemical cell. A fast response sensor (10 Hz) basically aspirated a sample past the cell membrane. Reported...ramp function around the freezing point of water by X11., X= vap for T 273.15 K vap fus 263.15 for 263.15 <T < 273.15 Xvap +x fus for T < 263.15 (A-4

  10. 7 CFR 273.2 - Office operations and application processing.

    Science.gov (United States)

    2010-01-01

    ... reservations, households with adult members who are not proficient in English, and households with earned... knowledge that the member in question is a U.S. citizen or non-citizen national. The signed statement must... because a household fits a profile of an error-prone household does not constitute lack of verification...

  11. 7 CFR 273.12 - Requirements for change reporting households.

    Science.gov (United States)

    2010-01-01

    ... issue a supplementary ATP for the amount of the increase by June 10. (iii) The State agency may elect to...; (iii) Changes in residence and the resulting change in shelter costs; (iv) The acquisition of a... recertification. (iii) Failure to file a complete form by the specified filing date. If a household fails to file...

  12. 14 CFR 21.273 - Airworthiness certificates other than experimental.

    Science.gov (United States)

    2010-01-01

    ... TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS Delegation Option Authorization... airworthiness certificate for aircraft manufactured under a delegation option authorization if he finds, on the... authorize any employee to sign airworthiness certificates if that employee— (1) Performs, or is in direct...

  13. All projects related to | Page 273 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-10

    The Fifth International Conference on Information and Communication Technologies and Development (ICTD2012) will take place 12-15 March 2012 at the Georgia Institute of Technology (Georgia Tech) in Atlanta, USA. Start Date: January 10, 2012. End Date: January 10, 2013. Topic: RESEARCH RESULTS ...

  14. BKR 27(3) pp. 123-128 (Lakshmikanth et al)

    African Journals Online (AJOL)

    Femi J. Olorunniji

    2015-09-30

    Sep 30, 2015 ... An International Journal of the Nigerian Society for Experimental Biology ... Department of Studies in Biochemistry, University of Mysore, Manasagangothri, Mysore – 570 006,. India ... many simple and rapid colorimetric methods of protein .... Samples of 1 and 2 µg of BSA and apparently purified BLP.

  15. CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

    Directory of Open Access Journals (Sweden)

    Ana Arenillas

    2013-10-01

    Full Text Available Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar and capacities (>2 mmol·g−1 at 273 K. Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes.

  16. CO2 Separation and Capture Properties of Porous Carbonaceous Materials from Leather Residues

    Science.gov (United States)

    Bermúdez, José M.; Dominguez, Pablo Haro; Arenillas, Ana; Cot, Jaume; Weber, Jens; Luque, Rafael

    2013-01-01

    Carbonaceous porous materials derived from leather skin residues have been found to have excellent CO2 adsorption properties, with interestingly high gas selectivities for CO2 (α > 200 at a gas composition of 15% CO2/85% N2, 273K, 1 bar) and capacities (>2 mmol·g−1 at 273 K). Both CO2 isotherms and the high heat of adsorption pointed to the presence of strong binding sites for CO2 which may be correlated with both: N content in the leather residues and ultrasmall pore sizes. PMID:28788352

  17. Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place, FY83, Part 2 (Gillespie Delorenzo Asla & Assocs-Planning Analysis Corp).

    Science.gov (United States)

    1983-01-01

    BURLINGTON MASS 85 85 85 85 N L AVIATION LTD UN KINGDOM 2,558 273 2,285 2,556 273 2,285 M L ENERGIA INC PRINCETON NEW JERSEY 28 28 28 28 M M L...155 155 PIPE INC PORTSMOUTH VIRGINIA 588 588 743 743 PIPE INSTALLATION CORP ATCO ILw jE6EY 42 42 42 42 PIPELINE RENOVATION SERVICE INC FORT BRAGG NCAR...107 107 PIPELINE RENOVATION SERVICE INC LANGLEY AFB VIRGINIA 205 161 44 PIPELINE RENOVATION SERVICE INC NORFOLK VIRGINIA 248 248 560 268 248 44

  18. Glutathionylation of Yersinia pestis LcrV and Its Effects on Plague Pathogenesis.

    Science.gov (United States)

    Mitchell, Anthony; Tam, Christina; Elli, Derek; Charlton, Thomas; Osei-Owusu, Patrick; Fazlollahi, Farbod; Faull, Kym F; Schneewind, Olaf

    2017-05-16

    Glutathionylation, the formation of reversible mixed disulfides between glutathione and protein cysteine residues, is a posttranslational modification previously observed for intracellular proteins of bacteria. Here we show that Yersinia pestis LcrV, a secreted protein capping the type III secretion machine, is glutathionylated at Cys 273 and that this modification promotes association with host ribosomal protein S3 (RPS3), moderates Y. pestis type III effector transport and killing of macrophages, and enhances bubonic plague pathogenesis in mice and rats. Secreted LcrV was purified and analyzed by mass spectrometry to reveal glutathionylation, a modification that is abolished by the codon substitution Cys 273 Ala in lcrV Moreover, the lcrV C273A mutation enhanced the survival of animals in models of bubonic plague. Investigating the molecular mechanism responsible for these virulence attributes, we identified macrophage RPS3 as a ligand of LcrV, an association that is perturbed by the Cys 273 Ala substitution. Furthermore, macrophages infected by the lcrV C273A variant displayed accelerated apoptotic death and diminished proinflammatory cytokine release. Deletion of gshB , which encodes glutathione synthetase of Y. pestis , resulted in undetectable levels of intracellular glutathione, and we used a Y. pestis Δ gshB mutant to characterize the biochemical pathway of LcrV glutathionylation, establishing that LcrV is modified after its transport to the type III needle via disulfide bond formation with extracellular oxidized glutathione. IMPORTANCE Yersinia pestis , the causative agent of plague, has killed large segments of the human population; however, the molecular bases for the extraordinary virulence attributes of this pathogen are not well understood. We show here that LcrV, the cap protein of bacterial type III secretion needles, is modified by host glutathione and that this modification contributes to the high virulence of Y. pestis in mouse and rat

  19. Chromatographic enrichment of isotopes in hydrogen and water samples on palladium

    International Nuclear Information System (INIS)

    Andreev, B.M.; Polevoi, A.S.; Perevezentsev, A.N.

    1987-01-01

    Data on the isotopic enrichment of hydrogen and water samples by chromatography on palladium have been analyzed. Experimental data on the effect of temperature, hydrogen flow, volume of the enriched fraction, and length of the chromatographic column on the degree of separation attainable in the column have been obtained. It has been shown that the maximum separation achievable (regardless of the type of the isotope mixture) at 273 K falls with increase of hydrogen flow and volume of the enriched gas fraction recoverable from the column. A separation degree of ∼ 1040 has been achieved for a mixture of protium and deuterium in a 10-mm wide and 0.6-m long chromatographic column packed with palladium black with a grain size of 0.2-0.5 mm at 273 K and a specific hydrogen flow of 1.22 mole/m 2 x sec. For a protium-tritium mixture a separation degree of ∼ 90 has been reached in a similar column at 273 K and a specific hydrogen flow of 0.4 mole/m 2 x sec

  20. Preputial skin free graft as dorsal onlay urethroplasty: Our experience of 73 patients.

    Science.gov (United States)

    Bapat, Shivadeo S; Padhye, Abhijit S; Yadav, Pushkaraj B; Bhave, Ashish A

    2007-10-01

    To present the outcome of dorsal onlay urethroplasty in 73 patients for stricture urethra over a period of eight years. Seventy-three patients of stricture urethra have undergone dorsal onlay urethroplasty from July 1998 to February 2006. Age distribution: 14-58 years. Trauma 20/73 (27.39%), Balanitis Xerotica Obliterans 2/73 (2.73%), Iatrogenic 26/73(35.61%), Infection 3/73 (4.10%), Idiopathic 22/73 (30.13%). Site: Penobulbar-25/73, bulbar-38/73, membranous-8/73 and long length-2/73. Suprapubic catheter was inserted preoperatively: 21/73 patients. Preputial / distal penile skin was used in all patients. Buccal mucosa was not used in any patient. Hospitalization was for four to five days. Catheter was removed after 21 days. All patients had their first endoscopic checkup after three months. Subsequently they were followed up by uroflometry. Routine imaging of urethra for follow-up was not carried out. 63/73 (86.30%) patients had satisfactory outcome not requiring any further treatment, 8/73 (10.95%) developed anastomotic stricture (3/8-optical internal urethrotomy, 5/8 dilatation alone). 2/73 (2.75%) developed external meatal stenosis. None had urinary fistula and required repeat urethroplasty. Follow-up ranged from three months to eight years. Dorsal onlay urethroplasty using preputial/distal penile skin is a satisfactory procedure. Preputial/distal penile skin is devoid of hair and fat and hence an ideal graft material. Even in circumscribed patients distal penile skin can be harvested. Long-term follow-up is required in judging results of patients with stricture urethra.

  1. Waterborne Commerce of the United States, Calendar Year 1980. Part 2. Waterways and Harbors, Gulf Coast, Mississippi River System and Antilles.

    Science.gov (United States)

    1982-09-01

    IX.UEX, * PASS6 199S--0𔄁,9M6. ( WORT TDS ) - - - -07 0 - - - - - - - --S R-S-, - -- ----------..........----- -----4,--3 - ,--- -- ...... 1091~~ 3,N126~v...OECCAST.ISE, INAATERR!?O~V -F O C O M M TD M E STY , IMPORTS ,,poP Ts CIP S w s TOTAL ---------------------------------------------------------- 1 ,4S,325...d6 680 1 1.9 62 262 1 - 776 776 273 273 TOTAL .---------- 300 1.452 2,132 171 4,055 265 1.451 1.904 163 3.803 MISSOURI 6rVE, S! 7UX CITY TO !’MA.A

  2. Effect of copper, tin, phosphorous and arsenic on the surface cracking of a 18-8 stainless steel during hot compression tests

    International Nuclear Information System (INIS)

    Botella, J.; Fernandez, M.T.; Fernandez de Castillo, I.

    1998-01-01

    The effect of certain different concentrations of Cu, Sn, P and As on the surface cracking of 18-8 austenitic stainless steel hot compressed specimens has been studied, at 1,123 and 1,273 K, in an oxidizing atmosphere (air). A procedure for determining surface cracking has been established, and the cracking factor obtained in this ways is correlated with the chemical composition of the materials at both temperatures. The cracking factors obtained at 1,273 K have been compared with the reduction of area drops obtained by hot tension tests at the same temperature. (Author) 5 refs

  3. Nuclear Science Division 1994 annual report

    International Nuclear Information System (INIS)

    Myers, W.D.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium

  4. Nuclear Science Division 1994 annual report

    Energy Technology Data Exchange (ETDEWEB)

    Myers, W.D. [ed.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.

  5. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Streptomyces coelicolor ... Length = 117 ... Query: 214 ETPVRDLMAPAAGIVAVDXX...XXXXXXXXXXXXHDRTRLLVRQEDAILGSVHARDVLVXXX 273 ... ETPVRDLMAPAAGIVAVD ... HDRTRLLVRQEDAILGSVHA...RDVLV ... Sbjct: 1 ... ETPVRDLMAPAAGIVAVDAGAEAEEILALAAAHDRTRLLVRQEDAILGSVHARDVLVARA 60 ...

  6. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  7. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EIN+K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  8. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  9. ORF Alignment: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EIN+K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  10. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  11. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  12. ORF Alignment: NC_004603 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EIQVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  13. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKYDRERTR...VSLGLKQLGEDPWLEISKR 273 ... EIN+K+LK+DRERTRVSLGLKQLGEDPW+ ISKR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  14. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EIAVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  15. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  16. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EIN+K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  17. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  18. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  19. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  20. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EIN+K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  1. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWADIANR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW ... I+ R Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  2. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EINVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EIN+K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  3. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  4. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1 ... FTVELNDIRAFLPGSLVDVRPVRDTIHLEGKELEFKVIKLDQKRNNVVVSRRAVIESENS 60 ... Query: 240 EITVKVLKFDRERTR...VSLGLKQLGEDPWVAIAKR 273 ... EI +K+LKFDRERTRVSLGLKQLGEDPW+AI+KR Sbjct: 121 EINIKILKFDRERTRVSLGLKQLGEDPWIAISKR 154

  5. Preputial skin free graft as dorsal onlay urethroplasty: Our experience of 73 patients

    Directory of Open Access Journals (Sweden)

    Shivadeo S Bapat

    2007-01-01

    Full Text Available Objective: To present the outcome of dorsal onlay urethroplasty in 73 patients for stricture urethra over a period of eight years. Materials and Methods: Seventy-three patients of stricture urethra have undergone dorsal onlay urethroplasty from July 1998 to February 2006. Age distribution: 14-58 years. Etiology: Trauma 20/73 (27.39%, Balanitis Xerotica Obliterans 2/73 (2.73%, Iatrogenic 26/73(35.61%, Infection 3/73 (4.10%, Idiopathic 22/73 (30.13%. Site: Penobulbar-25/73, bulbar-38/73, membranous-8/73 and long length-2/73. Suprapubic catheter was inserted preoperatively: 21/73 patients. Preputial / distal penile skin was used in all patients. Buccal mucosa was not used in any patient. Hospitalization was for four to five days. Catheter was removed after 21 days. All patients had their first endoscopic checkup after three months. Subsequently they were followed up by uroflometry. Routine imaging of urethra for follow-up was not carried out. Results: 63/73 (86.30% patients had satisfactory outcome not requiring any further treatment, 8/73 (10.95% developed anastomotic stricture (3/8-optical internal urethrotomy, 5/8 dilatation alone. 2/73 (2.75% developed external meatal stenosis. None had urinary fistula and required repeat urethroplasty. Follow-up ranged from three months to eight years. Conclusion: Dorsal onlay urethroplasty using preputial/distal penile skin is a satisfactory procedure. Preputial/distal penile skin is devoid of hair and fat and hence an ideal graft material. Even in circumscribed patients distal penile skin can be harvested. Long-term follow-up is required in judging results of patients with stricture urethra.

  6. Over-expression of p53 mutants in LNCaP cells alters tumor growth and angiogenesis in vivo

    International Nuclear Information System (INIS)

    Perryman, L.A.; Blair, J.M.; Kingsley, E.A.; Szymanska, B.; Ow, K.T.; Wen, V.W.; MacKenzie, K.L.; Vermeulen, P.B.; Jackson, P.; Russell, P.J.

    2006-01-01

    This study has investigated the impact of three specific dominant-negative p53 mutants (F134L, M237L, and R273H) on tumorigenesis by LNCaP prostate cancer cells. Mutant p53 proteins were associated with an increased subcutaneous 'take rate' in NOD-SCID mice, and increased production of PSA. Tumors expressing F134L and R273H grew slower than controls, and were associated with decreased necrosis and apoptosis, but not hypoxia. Interestingly, hypoxia levels were increased in tumors expressing M237L. There was less proliferation in F134L-bearing tumors compared to control, but this was not statistically significant. Angiogenesis was decreased in tumors expressing F134L and R273H compared with M237L, or controls. Conditioned medium from F134L tumors inhibited growth of normal human umbilical-vein endothelial cells but not telomerase-immortalized bone marrow endothelial cells. F134L tumor supernatants showed lower levels of VEGF and endostatin compared with supernatants from tumors expressing other mutants. Our results support the possibility that decreased angiogenesis might account for reduced growth rate of tumor cells expressing the F134L p53 mutation

  7. Radiographic findings in pulmonary hypertension from unresolved embolism

    Energy Technology Data Exchange (ETDEWEB)

    Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

    1985-04-01

    Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms.

  8. Radiographic findings in pulmonary hypertension from unresolved embolism

    International Nuclear Information System (INIS)

    Woodruff, W.W. III; Hoeck, B.E.; Chitwood, W.R. Jr.; Lyerly, H.K.; Sabiston, D.C. Jr.; Chen, J.T.T.

    1985-01-01

    Pulmonary artery hypertension with chronic pulmonary embolism is an uncommon entity that is potentially treatable with pulmonary embolectomy. Although the classic radiographic features have been described, several recent investigators report a significant percentage of these patients with normal chest radiographs. In a series of 22 patients, no normal radiographs were seen. Findings included cardiomegaly (86.4%) with right-sided enlargement (68.4%), right descending pulmonary artery enlargement (54.5%), azygos vein enlargement (27.3%), mosaic oligemia (68.2%), chronic volume loss (27.3%), atelectasis and/or effusion (22.7%), and pleural thickening (13.6%). Good correlation with specific areas of diminished vascularity was seen on chest radiographs compared with pulmonary angiograms

  9. People and things. CERN Courier, Apr 1987, v. 27(3)

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. On Friday February 13, bulldozers began clearing a 200 acre (80 hectare) site at Newport News, Virginia, for the proposed US Continuous Electron Beam Accelerator Facility (CEBAF) to provide high energy electron beams for nuclear physics. The XI International Workshop on Weak Interactions will be held in Santa Fe, New Mexico, from 14- 19 June. Discussion sessions covering current topics in weak interaction physics will allow active participation by workshop attendees. The Division of Particles and Fields of the American Physical Society and the Central Design Group of the proposed US SSC Superconducting Supercollider are organizing a Workshop on Experiments, Detectors and Experimental Areas for the SSC, to be held at Berkeley from 7-17 July. As southern hemisphere astronomers witnessed a gigantic supernova explosion towards the end of February, underground neutrino detectors all over the world picked up bursts of particles

  10. 7 CFR 273.24 - Time limit for able-bodied adults.

    Science.gov (United States)

    2010-01-01

    ... unfitness is not obvious, provides a statement from a physician, physician's assistant, nurse, nurse...) of this section, within the 30 days subsequent to application; or (v) Becomes exempt. (2) An...

  11. 7 CFR 273.11 - Action on households with special circumstances.

    Science.gov (United States)

    2010-01-01

    ... existence for less than a year, the income from that self-employment enterprise must be averaged over the...) Comparing the household's resources with the resource eligibility limits. (3) Ineligible alien. The State... containing an ineligible alien as follows: (i) The State agency must count all or, at the discretion of the...

  12. 33 CFR Appendix D to Part 273 - Work Progress Report

    Science.gov (United States)

    2010-07-01

    ... difference. Not applicable. 4. Outlook for meeting programmed objectives. a. Programmed objectives. Full utilization of work allowance. b. Outlook. We expect to meet our programmed objectives. 5. Problems and.... Surplus funds in the amount of $21,700 will be revoked. ...

  13. People and things. CERN Courier, Apr 1987, v. 27(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. On Friday February 13, bulldozers began clearing a 200 acre (80 hectare) site at Newport News, Virginia, for the proposed US Continuous Electron Beam Accelerator Facility (CEBAF) to provide high energy electron beams for nuclear physics. The XI International Workshop on Weak Interactions will be held in Santa Fe, New Mexico, from 14- 19 June. Discussion sessions covering current topics in weak interaction physics will allow active participation by workshop attendees. The Division of Particles and Fields of the American Physical Society and the Central Design Group of the proposed US SSC Superconducting Supercollider are organizing a Workshop on Experiments, Detectors and Experimental Areas for the SSC, to be held at Berkeley from 7-17 July. As southern hemisphere astronomers witnessed a gigantic supernova explosion towards the end of February, underground neutrino detectors all over the world picked up bursts of particles.

  14. 7 CFR 273.23 - Simplified application and standardized benefit projects.

    Science.gov (United States)

    2010-01-01

    ... implementation costs and, on an annual basis, operating costs, administrative costs, error reduction, and benefit... Exchange (SDX) tape. TANF or Medicaid applications may need to be modified, or be subject to an addendum in... historical data on deductions claimed by such households. Such deductions must be updated, as necessary, on...

  15. 7 CFR 273.10 - Determining household eligibility and benefit levels.

    Science.gov (United States)

    2010-01-01

    ... merely because of changes in mailing cycles or pay dates or because weekends or holidays cause additional... for urban, rural I, and rural II Alaska as defined in § 272.7(c). The TFPs for Guam and the Virgin...

  16. 7 CFR 273.21 - Monthly Reporting and Retrospective Budgeting (MRRB).

    Science.gov (United States)

    2010-01-01

    ..., it may omit the oral explanation of MRRB required under paragraph (c)(1). (ii) The State agency shall... understanding that the provided information may result in changes in the level of benefits, including reduction...

  17. Characterization of Novel Calmodulin Binding Domains within IQ Motifs of IQGAP1

    Science.gov (United States)

    Jang, Deok-Jin; Ban, Byungkwan; Lee, Jin-A

    2011-01-01

    IQ motif-containing GTPase-activating protein 1 (IQGAP1), which is a well-known calmodulin (CaM) binding protein, is involved in a wide range of cellular processes including cell proliferation, tumorigenesis, adhesion, and migration. Interaction of IQGAP1 with CaM is important for its cellular functions. Although each IQ domain of IQGAP1 for CaM binding has been characterized in a Ca2+-dependent or -independent manner, it was not clear which IQ motifs are physiologically relevant for CaM binding in the cells. In this study, we performed immunoprecipitation using 3xFLAGhCaM in mammalian cell lines to characterize the domains of IQGAP1 that are key for CaM binding under physiological conditions. Interestingly, using this method, we identified two novel domains, IQ(2.7-3) and IQ(3.5-4.4), within IQGAP1 that were involved in Ca2+-independent or -dependent CaM binding, respectively. Mutant analysis clearly showed that the hydrophobic regions within IQ(2.7-3) were mainly involved in apoCaM binding, while the basic amino acids and hydrophobic region of IQ(3.5-4.4) were required for Ca2+/CaM binding. Finally, we showed that IQ(2.7-3) was the main apoCaM binding domain and both IQ(2.7-3) and IQ(3.5-4.4) were required for Ca2+/CaM binding within IQ(1- 2-3-4). Thus, we identified and characterized novel direct CaM binding motifs essential for IQGAP1. This finding indicates that IQGAP1 plays a dynamic role via direct interactions with CaM in a Ca2+-dependent or -independent manner. PMID:22080369

  18. A unique 3D ultramicroporous triptycene-based polyimide framework for efficient gas sorption applications

    KAUST Repository

    Ghanem, Bader

    2016-10-03

    A novel 3D ultramicroporous triptycene-based polyimide framework with high surface area (1050 m2 g−1) and thermal stability was synthesized. It exhibits relatively high CO2 (3.4 mmol g−1 at 273 K and 1 bar), H2 (7 mmol g−1 at 77 K and 1 bar), and olefin sorption capacity, good CO2/N2 (45) and CO2/CH4 (9.6) selectivity at 273 K and 1 bar, as well as promising C2H4/CH4 and C3H6/CH4 selectivities at 298 K, making it a potential candidate for CO2 capture, H2 storage, and hydrocarbon gas separation applications.

  19. A unique 3D ultramicroporous triptycene-based polyimide framework for efficient gas sorption applications

    KAUST Repository

    Ghanem, Bader; Belmabkhout, Youssef; Wang, Yingge; Zhao, Yunfeng; Han, Yu; Eddaoudi, Mohamed; Pinnau, Ingo

    2016-01-01

    A novel 3D ultramicroporous triptycene-based polyimide framework with high surface area (1050 m2 g−1) and thermal stability was synthesized. It exhibits relatively high CO2 (3.4 mmol g−1 at 273 K and 1 bar), H2 (7 mmol g−1 at 77 K and 1 bar), and olefin sorption capacity, good CO2/N2 (45) and CO2/CH4 (9.6) selectivity at 273 K and 1 bar, as well as promising C2H4/CH4 and C3H6/CH4 selectivities at 298 K, making it a potential candidate for CO2 capture, H2 storage, and hydrocarbon gas separation applications.

  20. Screening and Identifying a Novel ssDNA Aptamer against Alpha-fetoprotein Using CE-SELEX

    Science.gov (United States)

    Dong, Lili; Tan, Qiwen; Ye, Wei; Liu, Dongli; Chen, Haifeng; Hu, Hongwei; Wen, Duo; Liu, Yang; Cao, Ya; Kang, Jingwu; Fan, Jia; Guo, Wei; Wu, Weizhong

    2015-01-01

    Alpha-fetoprotein (AFP) is a liver cancer associated protein and has long been utilized as a serum tumor biomarker of disease progression. AFP is usually detected in HCC patients by an antibody based system. Recently, however, aptamers generated from systematic evolution of ligands by exponential enrichment (SELEX) were reported to have an alternative potential in targeted imaging, diagnosis and therapy. In this study, AFP-bound ssDNA aptamers were screened and identified using capillary electrophoresis (CE) SELEX technology. After cloning, sequencing and motif analysis, we successfully confirmed an aptamer, named AP273, specifically targeting AFP. The aptamer could be used as a probe in AFP immunofluorescence imaging in HepG2, one AFP positive cancer cell line, but not in A549, an AFP negative cancer cell line. More interesting, the aptamer efficiently inhibited the migration and invasion of HCC cells after in vivo transfection. Motif analysis revealed that AP273 had several stable secondary motifs in its structure. Our results indicate that CE-SELEX technology is an efficient method to screen specific protein-bound ssDNA, and AP273 could be used as an agent in AFP-based staining, diagnosis and therapy, although more works are still needed. PMID:26497223

  1. 76 FR 80930 - Agency Information Collection Activities; Submission to OMB for Review and Approval; Comment...

    Science.gov (United States)

    2011-12-27

    ... Wastes include certain batteries, pesticides, mercury- containing lamps and thermostats. The Part 273... prevention and cleanup of releases to the environment during storage and transit. EPA believes these...

  2. A CASE STUDY ON ETHIOPIAN BIRR NOTE Zewde Dinku and K

    African Journals Online (AJOL)

    hp

    COUNTERFEIT CURRENCY IDENTIFICATION SYSTEM - A CASE STUDY ON. ETHIOPIAN BIRR NOTE .... for measuring the similarity measure between two images. ... DESIGN OF CCIS. Hence, two .... Applications, p.273-278, 1994.

  3. Analysis of geodetic surveying on the margin of subsidence depression

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Hana; Müller, Karel; Bláha, P.

    -, č. 273 (2006), s. 103-112 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : subsidence depression * levelling * height changes Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  4. Rate Measurements of the Hydrolysis of Complex Organic Macromolecules in Cold Aqueous Solutions: Implications for Prebiotic Chemistry on the Early Earth and Titan

    Science.gov (United States)

    Neish, C. D.; Somogyi, Á.; Imanaka, H .; Lunine, J. I.; Smith, M. A.

    2008-04-01

    Organic macromolecules (``complex tholins'') were synthesized from a 0.95 N2 / 0.05 CH4 atmosphere in a high-voltage AC flow discharge reactor. When placed in liquid water, specific water soluble compounds in the macromolecules demonstrated Arrhenius type first order kinetics between 273 and 313 K and produced oxygenated organic species with activation energies in the range of ~60 +/- 10 kJ mol-1. These reactions displayed half lives between 0.3 and 17 days at 273 K. Oxygen incorporation into such materials-a necessary step toward the formation of biological molecules-is therefore fast compared to processes that occur on geologic timescales, which include the freezing of impact melt pools and possible cryovolcanic sites on Saturn's organic-rich moon Titan.

  5. : tous les projets | Page 273 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HIV, AIDS, PROPHYLAXIS, VACCINES, VACCINATION, Immunization. Région: North of Sahara, South of Sahara, Benin. Programme: Santé des mères et des enfants. Financement total : CA$ 369,100.00. Mise en place des préalables aux essais randomisés d'interventions préventives du VIH au Bénin. Projet.

  6. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    on the analysis of the Einstein data, it was argued that the broken power law or power law + black body model is ... power law ( soft) is 2.7 when the photon index ( hard) of the harder power law is fixed at 1.5, and there are small but ..... J. Trümper for the kind hospitality at the Max-Planck-Institut für. Extraterrestrische Physik ...

  7. Soft X-ray Variability of the Bright Quasar 3C273

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... The hardness ratio for hard and soft bands shows irregular variation but there was no correlation between them. There is no distinct variation of the photon index in the case of simple power law model fitting. For power law + free absorption model fitting, the average photon index () is 2.08.

  8. Physics in a spin. CERN Courier, Apr 1987, v. 27(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1987-04-15

    The biennial international high energy spin physics meetings (Lausanne, 1980; Brookhaven, 1982; Marseille, 1984) provide a useful focus of attention for the enthusiastic community of followers of a sector of physics rarely lacking in interest and where the unexpected is increasingly expected.

  9. Antarctica: The Continuing Experiment. Foreign Policy Association Headline Series, No. 273.

    Science.gov (United States)

    Quigg, Philip W.

    One of a series of booklets on world issues examines the sharpened differences between those nations that have declared sovereignty over parts of Antarctica and those that have not; between those nations that have arbitrarily assumed responsibility for the administration of Antarctica and the smaller, more numerous nations that believe their…

  10. On-ground characterization of the Euclid's CCD273-based readout chain

    Science.gov (United States)

    Szafraniec, Magdalena; Azzollini, R.; Cropper, M.; Pottinger, S.; Khalil, A.; Hailey, M.; Hu, D.; Plana, C.; Cutts, A.; Hunt, T.; Kohley, R.; Walton, D.; Theobald, C.; Sharples, R.; Schmoll, J.; Ferrando, P.

    2016-07-01

    Euclid is a medium class European Space Agency mission scheduled for launch in 2020. The goal of the survey is to examine the nature of Dark Matter and Dark Energy in the Universe. One of the cosmological probes used to analyze Euclid's data, the weak lensing technique, measures the distortions of galaxy shapes and this requires very accurate knowledge of the system point spread function (PSF). Therefore, to ensure that the galaxy shape is not affected, the detector chain of the telescope's VISible Instrument (VIS) needs to meet specific performance performance requirements. Each of the 12 VIS readout chains consisting of 3 CCDs, readout electronics (ROE) and a power supply unit (RPSU) will undergo a rigorous on-ground testing to ensure that these requirements are met. This paper reports on the current status of the warm and cold testing of the VIS Engineering Model readout chain. Additionally, an early insight to the commissioning of the Flight Model calibration facility and program is provided.

  11. 273 Etude de la culture en couloirs de manioc (Manihot esculenta ...

    African Journals Online (AJOL)

    administrateur

    La culture en couloirs pourrait constituer une solution intéressante de ..... pourrait s'expliquer par le type de fumure de fond utilisé lors de la mise en place des parcelles ..... performances des variétés améliorées de manioc ont été observées dans ... Organisation des Nations Unies pour l'alimentation et l'agriculture, Bureau ...

  12. Kontroling jakości zarzadzania bezpieczeństwem pracy realizowany metoda audytu stanowiskowego

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Hana; Doležal, M.; Mikoláš, M.; Kondras, I.; Korban, Z.

    -, č. 273 (2006), s. 95-102 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : work safety * controlling * post audit method Subject RIV: AQ - Safety, Health Protection, Human - Machine

  13. An ERK/Cdk5 axis controls the diabetogenic actions of PPARγ.

    Science.gov (United States)

    Banks, Alexander S; McAllister, Fiona E; Camporez, João Paulo G; Zushin, Peter-James H; Jurczak, Michael J; Laznik-Bogoslavski, Dina; Shulman, Gerald I; Gygi, Steven P; Spiegelman, Bruce M

    2015-01-15

    Obesity-linked insulin resistance is a major precursor to the development of type 2 diabetes. Previous work has shown that phosphorylation of PPARγ (peroxisome proliferator-activated receptor γ) at serine 273 by cyclin-dependent kinase 5 (Cdk5) stimulates diabetogenic gene expression in adipose tissues. Inhibition of this modification is a key therapeutic mechanism for anti-diabetic drugs that bind PPARγ, such as the thiazolidinediones and PPARγ partial agonists or non-agonists. For a better understanding of the importance of this obesity-linked PPARγ phosphorylation, we created mice that ablated Cdk5 specifically in adipose tissues. These mice have both a paradoxical increase in PPARγ phosphorylation at serine 273 and worsened insulin resistance. Unbiased proteomic studies show that extracellular signal-regulated kinase (ERK) kinases are activated in these knockout animals. Here we show that ERK directly phosphorylates serine 273 of PPARγ in a robust manner and that Cdk5 suppresses ERKs through direct action on a novel site in MAP kinase/ERK kinase (MEK). Importantly, pharmacological inhibition of MEK and ERK markedly improves insulin resistance in both obese wild-type and ob/ob mice, and also completely reverses the deleterious effects of the Cdk5 ablation. These data show that an ERK/Cdk5 axis controls PPARγ function and suggest that MEK/ERK inhibitors may hold promise for the treatment of type 2 diabetes.

  14. Abelovu cenu za matematiku získal v roce 2014 Jakov G. Sinaj

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal

    2014-01-01

    Roč. 59, č. 4 (2014), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : billiards * entropy * binary sequences Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144076

  15. Politicising curriculum implementation: The case of primary schools

    African Journals Online (AJOL)

    Department of Educational Leadership and Management, University of South Africa, Pretoria, South Africa pillav2@unisa.ac. ... primary school educators; South Africa; teacher unions ...... Science and Technology Education, 16(3):273–. 288.

  16. Serotype markers in a Streptococcus agalactiae strain collection from Zimbabwe

    Directory of Open Access Journals (Sweden)

    Mavenyengwa R

    2010-01-01

    Full Text Available Objective: Group B streptococci (GBS from Southern African areas have been less well characterized. Our objective was to study serotype and serovariant distribution of carrier GBS strains as part of a study of the epidemiology of GBS carriage in pregnant women from Zimbabwe. Materials and Methods: We studied GBS isolated from 121 healthy pregnant women living in Harare and surrounding areas, Zimbabwe. Capsular polysaccharide (CPS testing for serotype determination and surface-anchored protein testing for serosubtype determination were done by gene-based serotyping (PCR, except for the proteins R3 and a novel protein called Z, which were detected by antibody-based methods. Results: Strains of the CPS types Ia (15.7%, Ib (11.6%, II (8.3%, III (38.8%, V (24.0% and NT (1.7% were detected along with the strain-variable proteins Cί (15.7% of isolates, Cα (19.8%, Alp1 (epsilon-22.3%, Alp3 (5.0%, R4/Rib (46.3%, R3 (27.3%, Z (27.3%, and SAR5 (28.9%, which encodes the R5 protein. Up to four of the protein genes could be possessed or the gene product expressed by one and the same isolate. A total of 32 serovariants were detected. The findings assessed by us as most important were the very low prevalence of the gene Alp3 (Alp3 - 4.9%, high prevalence of R4 (Rib - 46.2%, the proteins R3 (27.3%, Z (27.3%, and of SAR5 (R5 - 28.9%. The low prevalence of Alp3, notably in GBS type V strains, differed from findings with CPS type V GBS from non-African areas. Bacteria of the various CPS types showed distinct CPS/protein-marker associations. Conclusion: The results are of importance in relation to regional variations of GBS phenotypes and genotypes and thus, of importance in planning and research in the context of future vaccine formulations.

  17. A microporous MOF with a polar pore surface exhibiting excellent selective adsorption of CO2 from CO2-N2 and CO2-CH4 gas mixtures with high CO2 loading.

    Science.gov (United States)

    Pal, Arun; Chand, Santanu; Elahi, Syed Meheboob; Das, Madhab C

    2017-11-14

    A microporous MOF {[Zn(SDB)(L) 0.5 ]·S} n (IITKGP-5) with a polar pore surface has been constructed by the combination of a V-shaped -SO 2 functionalized organic linker (H 2 SDB = 4,4'-sulfonyldibenzoic acid) with an N-rich spacer (L = 2,5-bis(3-pyridyl)-3,4-diaza-2,4-hexadiene), forming a network with sql(2,6L1) topology. IITKGP-5 is characterized by TGA, PXRD and single crystal X-ray diffraction. The framework exhibits lozenge-shaped channels of an approximate size of 4.2 × 5.6 Å 2 along the crystallographic b axis with a potential solvent accessible volume of 26%. The activated IITKGP-5a revealed a CO 2 uptake capacity of 56.4 and 49 cm 3 g -1 at 273 K/1 atm and 295 K/1 atm, respectively. On the contrary, it takes up a much smaller amount of CH 4 (17 cm 3 g -1 at 273 K and 13.6 cm 3 g -1 at 295 K) and N 2 (5.5 cm 3 g -1 at 273 K; 4 cm 3 g -1 at 295 K) under 1 atm pressure exhibiting its potential for a highly selective adsorption of CO 2 from flue gas as well as a landfill gas mixture. Based on the ideal adsorbed solution theory (IAST), a CO 2 /N 2 selectivity of 435.5 and a CO 2 /CH 4 selectivity of 151.6 have been realized at 273 K/100 kPa. The values at 295 K are 147.8 for CO 2 /N 2 and 23.8 for CO 2 /CH 4 gas mixtures under 100 kPa. In addition, this MOF nearly approaches the target values proposed for PSA and TSA processes for practical utility exhibiting its prospect for flue gas separation with a CO 2 loading capacity of 2.04 mmol g -1 .

  18. The duration of the transitory period of public gas distribution

    International Nuclear Information System (INIS)

    Gazzola, D.

    2006-01-01

    The article describes the interpretative problems concerning the duration of the transitory period of public gas distribution after law decree 273/05 came into effect. This decree is the third legislative measure which, in a period of five years, reforms the transitory provisions. The article outlines the normative background of legislative decree n. 164/00 (so called Letta decree) and law n. 239/04 (so called Marzano law) and it analyses their judicial interpretations. It then explains the changes introduced by law decree n. 273/05 and the new interpretative problems there might be with reference to this decree. The decree clarifies the due date of the transitory period and specifies that the date of 31st December 2005 is postponed to 31st December 2007. The Administrative Tribunal of Lombardia Region Brescia tried to limit the effects of law decree n. 273/05, stating that the new expiration date could not regard the contracts for which the local authorities had already acknowledged the previous due date. The State Council argued instead that the new law decree regards all the contracts. This decree also clarifies that the chances of increasing duration ex art. 15, comma 7, legislative decree n. 164/00, applies automatically, but it doesn't solve the interpretative problem concerning the possibility of adding up more than one of these chances. The article focuses on the problems of the public gas distribution after the reform of this sector with the implementation of directive n. 98/30/CE and it underlines that the various legislative measures of these years are indicative of the difficulty to allow a gradual transition towards a liberalized market. In this context, law decree n. 273/05 is the last legislative measure which tries to guarantee a balance between the rapid liberalization of the market, on one hand, and the interests of the firms which had contracts when the reform came into effect, on the other hand [it

  19. The importance of being subtle: small changes in calcium homeostasis control cognitive decline in normal aging

    Czech Academy of Sciences Publication Activity Database

    Toescu, E.C.; Verkhratsky, Alexei

    2007-01-01

    Roč. 6, - (2007), s. 267-273 ISSN 1474-9718 Institutional research plan: CEZ:AV0Z50390512 Keywords : Aging * Ca homeostasis * Cognitive decline Subject RIV: FH - Neurology Impact factor: 5.854, year: 2007

  20. sheltered creeks in Niger Delta, Nigeria

    African Journals Online (AJOL)

    user

    2015-03-18

    Mar 18, 2015 ... 273 and 115,000 barrels, respectively, making the delta. *Corresponding author. .... content was transferred to savillex digestion bombs and concen- trated hydrochloric ... metals (Zn, Pb and Cu) by flame atomic absorption.

  1. Analysis of cardiac myosin binding protein-C phosphorylation in human heart muscle.

    Science.gov (United States)

    Copeland, O'Neal; Sadayappan, Sakthivel; Messer, Andrew E; Steinen, Ger J M; van der Velden, Jolanda; Marston, Steven B

    2010-12-01

    A unique feature of MyBP-C in cardiac muscle is that it has multiple phosphorylation sites. MyBP-C phosphorylation, predominantly by PKA, plays an essential role in modulating contractility as part of the cellular response to β-adrenergic stimulation. In vitro studies indicate MyBP-C can be phosphorylated at Serine 273, 282, 302 and 307 (mouse sequence) but little is known about the level of MyBP-C phosphorylation or the sites phosphorylated in heart muscle. Since current methodologies are limited in specificity and are not quantitative we have investigated the use of phosphate affinity SDS-PAGE together with a total anti MyBP-C antibody and a range of phosphorylation site-specific antibodies for the main sites (Ser-273, -282 and -302). With these newly developed methods we have been able to make a detailed quantitative analysis of MyBP-C phosphorylation in heart tissue in situ. We have found that MyBP-C is highly phosphorylated in non-failing human (donor) heart or mouse heart; tris and tetra-phosphorylated species predominate and less than 10% of MyBP-C is unphosphorylated (0, 9.3 ± 1%: 1P, 13.4 ± 2.7%: 2P, 10.5 ± 3.3%: 3P, 28.7 ± 3.7%: 4P, 36.4 ± 2.7%, n=21). Total phosphorylation was 2.7 ± 0.07 mol Pi/mol MyBP-C. In contrast in failing heart and in myectomy samples from HCM patients the majority of MyBP-C was unphosphorylated. Total phosphorylation levels were 23% of normal in failing heart myofibrils (0, 60.1 ± 2.8%: 1P, 27.8 ± 2.8%: 2P, 4.8 ± 2.0%: 3P, 3.7 ± 1.2%: 4P, 2.8 ± 1.3%, n=19) and 39% of normal in myectomy samples. The site-specific antibodies showed a distinctive distribution pattern of phosphorylation sites in the multiple phosphorylation level species. We found that phosphorylated Ser-273, Ser-282 and Ser-302 were all present in the 4P band of MyBP-C but none of them were significant in the 1P band, indicating that there must be at least one other site of MyBP-C phosphorylation in human heart. The pattern of phosphorylation at the

  2. Character education in schools implementing national curriculum and international baccalaureate

    Directory of Open Access Journals (Sweden)

    Hotmaulina Sihotang

    2018-03-01

    Full Text Available The purpose of the study was to evaluate the implementation of the character education program of Junior and Senior High School Victory Plus School using the national curriculum and International Baccalaureate. The research method used is mix method. The result of data analysis showed that the average self-concept score was 2.65 (less good; self-management is 2.73 (good; and social services is 2.73 (good in the implementation of courageous, honest, active, mindful, innovative, open minded, and nobel (champion value. The value of champion is relevant to the value of the national curriculum character but the value of hard work, religion, democracy, the spirit of nationality, and the love of the homeland have not yet appeared. The balanced and reflective values in the learner profile are not yet visible.

  3. Light shines through the spindrift – Phylogeny of African torrent frogs (Amphibia, Anura, Petropedetidae)

    Czech Academy of Sciences Publication Activity Database

    Barej, M. F.; Rödel, M.-O.; Loader, S. P.; Menegon, M.; Gonwouo, N.L.; Penner, J.; Gvoždík, Václav; Günther, R.; Bell, R. C.; Nagel, B.; Schmitz, A.

    2014-01-01

    Roč. 71, č. 2 (2014), s. 261-273 ISSN 1055-7903 Institutional support: RVO:68081766 Keywords : Africa * Amphibians * Taxonomy * Arthroleptides * Petropedetes * Odontobatrachus gen. nov Subject RIV: EG - Zoology Impact factor: 3.916, year: 2014

  4. Financial Management: Existence of U.S. Army Corps of Engineers Buildings and Other Structures

    National Research Council Canada - National Science Library

    Granetto, Paul J; Pusey, Ryan W; Ventimiglia, Crmelo G; Zeh, William H; Bryant, Leon D; King, Calvin O; Kntor, Scott C; Kasseler, Trisha L

    2005-01-01

    ...) cost and the associated accumulated depreciation of the assets. As of September 30, 2003, USACE had about 40,000 structures located at about 1,273 field sites in the continental United States, Alaska, and Hawaii.

  5. V roce 2013 získal Abelovu cenu Pierre Deligne za fundamentální práce svazující algebru a geometrii

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Markl, Martin; Somer, L.

    2013-01-01

    Roč. 58, č. 4 (2013), s. 265-273 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : Abel prize * algebra and geomtery Subject RIV: BA - General Mathematics http://www.dml.cz/handle/10338.dmlcz/143720

  6. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... 800-273-8255 (Press 1) Text to 838255 Chat confidentially now If you are in crisis or having thoughts of suicide, visit VeteransCrisisLine.net for more resources. Close this modal

  7. Prevalence and risk factors for stillbirths in a tertiary hospital in Niger ...

    African Journals Online (AJOL)

    work is properly cited. Prevalence and risk ... women. There were 309(53.1%) male stillbirths and 273(46.9%) female stillbirths. Male foetuses ... Key words: Stillbirth, miscarriage, perinatal mortality, anaemia in pregnancy, obstructed labour ...

  8. an analysis of yam storage strategy to promote food security in asa

    African Journals Online (AJOL)

    Osondu

    2012-10-17

    Oct 17, 2012 ... plant materials (27.3%) were the common storage strategy used which are not capable of ensuring good storage for ... faced in marketing yam produce. .... characteristics. Frequency. Percentage. Gender. Male. Female. 80. 30.

  9. Mental Health Concerns: Veterans & Active Duty

    Science.gov (United States)

    ... dialing 1-800-273-8255 and pressing 1. Mental Health Concerns There are three primary mental health concerns ... care or call 911. How Will Asking for Mental Health Treatment Affect My Career? Military personnel have always ...

  10. 75 FR 25890 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... MNKD MannKind Corp... 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc.. 257 HK Petrohawk Energy Corp... Kinross Gold Corp. 213 MRVL Marvell 273 EP El Paso Corp. Technology Group Ltd. 215 XLP Consumer Staples...

  11. 75 FR 26312 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-05-11

    ... MannKind Corp. 255 TM Toyota Motor Corp. 171 MDVN Medivation Inc. 257 HK Petrohawk Energy Corp. 176... Gold Corp. 213 MRVL Marvell Technology 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274...

  12. African Zoology - Vol 11, No 2 (1976)

    African Journals Online (AJOL)

    Patterns in the Distribution of Southern African Terrestrial Tortoises (Cryptodira: Testudinidae) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. John Comrie Greig, Peter D. Burdett, 251-273 ...

  13. The immunomodulatory gene products of myxoma virus

    Indian Academy of Sciences (India)

    Unknown

    273. Keywords. Gene products; myxoma virus; Oryctolagus cuniculus; poxvirus; skin lesions ...... these data is that these viral proteins do not promote class .... Cudmore S, Reckmann I and Way M 1997 Viral manipulations of the actin ...

  14. Zircon in highly evolved hercynian Homolka granite, Moldanubian zone, Czech Republic: indicator of magma source and petrogenesis

    Czech Academy of Sciences Publication Activity Database

    Uher, P.; Breiter, K.; Klečka, M.; Pivec, Edvín

    1998-01-01

    Roč. 49, č. 3 (1998), s. 151-160 ISSN 0016-7738 Grant - others:SK(CZ) VEGA 4078 Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.273, year: 1998 http://www.geologicacarpathica.sk/src/main.php

  15. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  16. 77 FR 21578 - Agency Information Collection Activities: Guam-CNMI Visa Waiver Agreement

    Science.gov (United States)

    2012-04-10

    ... fine, pursuant to section 273 of the Immigration and Nationality Act (INA) (8 U.S.C. 1323), for...: http://forms.cbp.gov/pdf/CBP_Form_i760.pdf . Current Actions: CBP proposes to extend the expiration...

  17. Invaze netýkavky žláznaté v České republice

    Czech Academy of Sciences Publication Activity Database

    Skálová, Hana; Čuda, Jan

    2014-01-01

    Roč. 62, č. 2 (2014), s. 271-273 ISSN 0044-4812 R&D Projects: GA ČR GA206/07/0668 Institutional support: RVO:67985939 Keywords : plant species biology * reproduction * growth Subject RIV: EF - Botanics

  18. Screening of systemic fungicides and biochemicals against seed ...

    African Journals Online (AJOL)

    Jane

    2011-07-18

    Jul 18, 2011 ... Aspergillus flavus showed highest percentage that is, 27.3% followed by Rhizopus stolonifer 17.98%,. Alternaria .... characteristics were cultured on PDA medium. ..... Fungi of Rice (Oryzae sativa L) Variety Faro 15 In Vitro.

  19. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Website Site Map Content Inventory Accessibility Privacy and Security Updating of Web Site Web Site Policies Important ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  20. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Plans, Budget, & Performance VA Center for Innovation (VACI) Agency Financial Report (AFR) Budget Submission Recovery Act Resources ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  1. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Us: ncptsd@va.gov Also see: VA Mental Health Connect with us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  2. 75 FR 26299 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of Proposed Rule...

    Science.gov (United States)

    2010-05-11

    ... AMED Amedisys Inc. 255 TM Toyota Motor Corp. 257 HK Petrohawk Energy Corp. 258 ENER Energy Conversion... Kinross Gold Corp. 273 EP El Paso Corp. 274 SEED Origin Agritech Ltd. 275 WIN Windstream Corp. 279 DHI DR...

  3. Sexual conflict, sexual selection and sperm competition in the spawning decisions of bitterling, Rhodeus sericeus

    Czech Academy of Sciences Publication Activity Database

    Smith, C.; Douglas, A.; Jurajda, Pavel

    2002-01-01

    Roč. 51, č. 5 (2002), s. 433-439 ISSN 0340-5443 Institutional research plan: CEZ:AV0Z6093917 Keywords : Acheilognathinae * alternative mating tactics * mate choice Subject RIV: EG - Zoology Impact factor: 2.273, year: 2002

  4. A review of the distribution of Yellowhammer (Emberiza citrinella) dialects in Europe reveals the lack of a clear macrogeographic pattern

    Czech Academy of Sciences Publication Activity Database

    Petrusková, T.; Diblíková, L.; Pipek, P.; Frauendorf, E.; Procházka, Petr; Petrusek, A.

    2015-01-01

    Roč. 156, č. 1 (2015), s. 263-273 ISSN 0021-8375 Institutional support: RVO:68081766 Keywords : Emberiza citrinella * Song variation * Dialect nomenclature * Online sources * Macrogeographic patterns Subject RIV: EG - Zoology Impact factor: 1.419, year: 2015

  5. Fulltext PDF

    Indian Academy of Sciences (India)

    Prakash

    Variants in many genes have been found to be associated with CVD in ... involvement of multiple genes with variable effects from one family/population to another, limited .... The authors screened 6,273 individuals belonging to 107 ethnic.

  6. assessment of traffic flow on enugu highways using speed density

    African Journals Online (AJOL)

    HOD

    Corresponding author, tel: +234 – 806 – 435 – 0200 ... construction, maintenance and optimization of the highways using the ...... Research Part A: Policy and Practice 29(4), 273-281. 1995. ... relationships: Quality and Theory of Traffic Flow.

  7. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... and the Brain" (18.9 MB) Close Video Help Problems viewing videos in pop up windows? See ... DC 20420 Last updated April 16, 2018 Get help from Veterans Crisis Line Call 1-800-273- ...

  8. Usutu Virus in Blackbirds (Turdus merula), Czech Republic, 2011-2012

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Rudolf, Ivo; Čapek, Miroslav; Bakonyi, T.; Betášová, Lenka; Nowotny, N.

    2014-01-01

    Roč. 61, č. 3 (2014), s. 273-276 ISSN 1865-1674 Institutional support: RVO:68081766 Keywords : Usutu virus * blackbird * Turdus merula * Czechland Subject RIV: GJ - Animal Vermins ; Diseases , Veterinary Medicine Impact factor: 2.944, year: 2014

  9. Dovedně zvládnutá přítomnost přináší příjemnou budoucnost: Sociální reprezentace smrti na Srí Lance u Theravádových mnichů a jejich podpůrců

    Czech Academy of Sciences Publication Activity Database

    Hytych, Roman

    2006-01-01

    Roč. 50, č. 3 (2006), s. 273-284 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : social representations * death * cultural psychology Subject RIV: AN - Psychology Impact factor: 0.279, year: 2006

  10. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... PTSD Coach Online Tools to help you manage stress. Search Pilots Search PILOTS *, the largest citation database ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  11. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... List of All Measures Treatment Treatment Overview Early Intervention Veterans Cultural Considerations Women Children Older Adults Working ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  12. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Awareness About the Website Site Map Content Inventory Accessibility Privacy and Security Updating of Web Site Web ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  13. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  14. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Performance VA Plans, Budget, & Performance VA Center for Innovation (VACI) Agency Financial Report (AFR) Budget Submission Recovery ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required ...

  15. Letter to the Editor

    OpenAIRE

    Thomas K. Karikari

    2015-01-01

    This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2):273–274, 2013).

  16. Direct electrochemistry of hemoglobin entrapped in dextran film on ...

    Indian Academy of Sciences (India)

    Administrator

    28. Li et al used single- walled carbon nanotube (SWCNT) and 1-hexyl-3- ... Electrochemistry of dextran/hemoglobin/carbon ionic liquid electrode. 273. 2.4 Procedures ..... used for the construction of H2O2 biosensor. Acknowledgement.

  17. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower ...

  18. Morphological evaluation of the Pinus kesiya complex (Pinaceae)

    Czech Academy of Sciences Publication Activity Database

    Businský, R.; Frantík, Tomáš; Vít, Petr

    2014-01-01

    Roč. 300, č. 2 (2014), s. 273-285 ISSN 0378-2697 Institutional support: RVO:67985939 Keywords : morphological var iation * Pinus densata ssp. tibetica * Pinus kesiya complex Subject RIV: EF - Botanics Impact factor: 1.422, year: 2014

  19. CT findings of mediastinal lymph nodes in tuberculous lymphadenitis and metastasis of primary lung cancer

    International Nuclear Information System (INIS)

    Lee, Hae Ryeon; Hwang, Jung Won; Sung, Kyu Bo; Woo, Won Hyeong

    1989-01-01

    We analyzed pre and post enhanced CT scan of eight two pathologically proven patients among which forty nine cases were pulmonary tuberculosis and thirty three patients, primary lung cancer, who had mediastinal lymphadenopathy, with special attentions to nodal architectures, numbers and locations. The results were as follows: 1. Lymph nodes abnormality was found in its average number of 1.2 nodes in tuberculosis and 2.8 nodes in primary lung cancer. 2, The location of abnormal lymph nodes were 4R (17.5%), 10R (17.5%) and 5 (14.0%) in order of frequency in tuberculosis, and 4R (17.6%), 10R (14.3%) and 7 (14.3%) in order of frequency in primary lung cancer. 3. In the feature of post enhanced lymph nodes, the central low density type was the most frequent in tuberculosis (61.4%). The most frequent type in primary lung cancer was the homogenous type (79.1%). 4. The incidence of lymph node calcification were as twice in tuberculous (67.3%) than in primary lung cancer (39.4%). 5. In order findings, parenchymal mass density (78.8% in Ca/12.2% in Tb) and pleural effusion (27.3% in Ca/10.2% in Tb) were more frequent in primary lung cancer, but parenchymal calcification (27.3% in Ca/49.0% in Tb) was more frequent in tuberculosis. The cavity formation of primary lung cancer (27.3%) was found to be as the same frequency as in tuberculosis (20.4%)

  20. Design of glycopeptides used to investigate class II MHC binding and T-cell responses associated with autoimmune arthritis.

    Directory of Open Access Journals (Sweden)

    Ida E Andersson

    Full Text Available The glycopeptide fragment CII259-273 from type II collagen (CII binds to the murine A(q and human DR4 class II Major Histocompatibility Complex (MHC II proteins, which are associated with development of murine collagen-induced arthritis (CIA and rheumatoid arthritis (RA, respectively. It has been shown that CII259-273 can be used in therapeutic vaccination of CIA. This glycopeptide also elicits responses from T-cells obtained from RA patients, which indicates that it has an important role in RA as well. We now present a methodology for studies of (glycopeptide-receptor interactions based on a combination of structure-based virtual screening, ligand-based statistical molecular design and biological evaluations. This methodology included the design of a CII259-273 glycopeptide library in which two anchor positions crucial for binding in pockets of A(q and DR4 were varied. Synthesis and biological evaluation of the designed glycopeptides provided novel structure-activity relationship (SAR understanding of binding to A(q and DR4. Glycopeptides that retained high affinities for these MHC II proteins and induced strong responses in panels of T-cell hybridomas were also identified. An analysis of all the responses revealed groups of glycopeptides with different response patterns that are of high interest for vaccination studies in CIA. Moreover, the SAR understanding obtained in this study provides a platform for the design of second-generation glycopeptides with tuned MHC affinities and T-cell responses.

  1. Prehistoric dark soils/sediments of Central Sudan, case study from the Mesolithic landscape at the Sixth Nile Cataract

    Czech Academy of Sciences Publication Activity Database

    Lisá, Lenka; Bajer, A.; Pacina, J.; McCool, J-P.; Cílek, Václav; Rohovec, Jan; Matoušková, Šárka; Kallistová, Anna; Gottvald, Z.

    2017-01-01

    Roč. 149, č. 1 (2017), s. 273-282 ISSN 0341-8162 Institutional support: RVO:67985831 Keywords : climate change * micromorphology * sahel * saprolite * soil chemistry Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.191, year: 2016

  2. 75 FR 26301 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-11

    ... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  3. 75 FR 25895 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of a Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  4. Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

    Czech Academy of Sciences Publication Activity Database

    Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.

    2015-01-01

    Roč. 473, 1 January (2015), s. 267-273 ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.557, year: 2015

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 273 ... Vol 5, No 1 (2010), In vivo antitrypanosomal evaluation of some medicinal plant ... and polycyclic aromatic hydrocarbons (PAHs) compositional profile and ... Vol 10, No 3 (2015), An excel template for processing examination ...

  6. Structure of the motor subunit of type I restriction-modification complex EcoR124I

    Czech Academy of Sciences Publication Activity Database

    Lapkouski, Mikalai

    2009-01-01

    Roč. 1, č. 16 (2009), s. 94-95 ISSN 1545-9985 Institutional research plan: CEZ:AV0Z60870520 Keywords : SWI2/SNF2 ATPASE * DNA * ENDONUCLEASE Subject RIV: CE - Biochemistry Impact factor: 12.273, year: 2009

  7. Hemochromatosis C282Y gene mutation as a potential susceptibility ...

    African Journals Online (AJOL)

    G.M. Mokhtar

    2017-08-12

    Aug 12, 2017 ... ease (36.6%), delayed puberty (56.6%), primary (35.71%) and secondary amenorrhea (21.42%), short stature. (27.3%) .... guineous marriage (61.5%) and a high rate of positive family his- .... Safer food, better business.

  8. Modern analogues from the Southern Urals provide insights into biodiversity change in the early Holocene forests of Central Europe

    Czech Academy of Sciences Publication Activity Database

    Chytrý, M.; Danihelka, Jiří; Horsák, M.; Kočí, M.; Kubešová, S.; Lososová, Z.; Otýpková, Z.; Tichý, L.; Martynenko, V. B.; Baisheva, E. Z.

    2010-01-01

    Roč. 37, č. 4 (2010), s. 767-780 ISSN 0305-0270 Institutional research plan: CEZ:AV0Z60050516 Keywords : bryophytes * broad-leaved trees * mixed oak forests Subject RIV: EF - Botanics Impact factor: 4.273, year: 2010

  9. Recenzie: Oferta „diferenţei”: feminismul românesc interbelic (Book review: The Offer of ”Difference”: Romanian Interwar Feminism

    Directory of Open Access Journals (Sweden)

    Viorella MANOLACHE

    2015-09-01

    Full Text Available Anemari Monica Negru (editor, Alexandrina Cantacuzino și mişcarea feministă din anii interbelici, Vol. I, Editura Cetatea de Scaun, Târgovişte, 2014, 320 p., (ISBN 978-606-537-273-3.

  10. Measurement and correlation of vapour pressures of pyridine and thiophene with [EMIM][SCN] ionic liquid

    International Nuclear Information System (INIS)

    Khelassi-Sefaoui, Asma; Mutelet, Fabrice; Mokbel, Ilham; Jose, Jacques; Negadi, Latifa

    2014-01-01

    Highlights: • VLE of (pyridine + [EMIM][SCN]), or (thiophene + [EMIM][SCN]) binary mixtures were measured. • The investigated temperatures are 273 K to 363 K. • The PC-SAFT equation of state has been used to correlate the vapour pressures of the binary systems. - Abstract: In this work (vapour + liquid) equilibrium (VLE) measurements were performed on binary systems of the ionic liquid 1-ethyl-3-methylimidazolium thiocynate [EMIM][SCN] with thiophene or pyridine at pressures close to the atmospheric pressure using a static device at temperatures between 273 K and 363 K. Experimental data were correlated by the PC-SAFT EoS. The binary interaction parameters k ij were optimised on experimental VLE data. The results obtained for the two binary mixtures studied in this paper indicate that the PC-SAFT EoS can be used to represent systems containing ionic liquids

  11. Anti-cancer effects of blue-green alga Spirulina platensis, a natural source of bilirubin-like tetrapyrrolic compounds

    Czech Academy of Sciences Publication Activity Database

    Koníčková, R.; Vaňková, K.; Vaníková, J.; Váňová, K.; Muchová, L.; Subhanová, I.; Zadinová, M.; Zelenka, Jaroslav; Dvořák, Aleš; Kolář, Michal; Strnad, Hynek; Rimpelová, S.; Ruml, T.; Wong, R.J.; Vítek, L.

    2014-01-01

    Roč. 13, č. 2 (2014), s. 273-283 ISSN 1665-2681 Institutional support: RVO:67985823 ; RVO:68378050 Keywords : bilirubin * chlorophyll * heme oxygenase * phycocyanin * phycocyanobilin * Spirulina platensis * tetrapyrroles Subject RIV: FD - Oncology ; Hematology Impact factor: 2.065, year: 2014

  12. Direct, rapid quantitative analyses of BVOCs using SIFT-MS and PTR-MS obviating sample collection

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Španěl, Patrik

    2011-01-01

    Roč. 30, č. 7 (2011), s. 945-959 ISSN 0165-9936 Institutional research plan: CEZ:AV0Z40400503 Keywords : SIFT-MS * PTR-MS * Absolute quantification Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.273, year: 2011

  13. K problému univerzalistických pretenzí v etice. Formalismus a některé pokusy o založení hodnotové etiky

    Czech Academy of Sciences Publication Activity Database

    Hála, Vlastimil

    2007-01-01

    Roč. 62, č. 4 (2007), s. 273-281 ISSN 0046-385X R&D Projects: GA MŠk(CZ) LC06013 Institutional research plan: CEZ:AV0Z90090514 Keywords : ethics * values * universalism Subject RIV: AA - Philosophy ; Religion

  14. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    ... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...

  15. PERFORMANCE IN ART NATURE AND MEANING

    African Journals Online (AJOL)

    USER

    2012-04-25

    Apr 25, 2012 ... Unions and University Management in Nigeria. (Pp. 266-273) .... There is the need for an effective monitoring of the fund allocated to the sector. ... communication flow that may lead to difference in perceptions. Alibi (1999) ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 273 ... ... testicular ectopia: a case report and review of the literature, Abstract PDF ... breast in an infant successfully managed with intralesional bleomycin: a .... Vol 11, No 2 (2015), Giant juvenile xanthogranuloma of the tongue ...

  17. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... updated April 16, 2018 Get help from Veterans Crisis Line Call 1-800-273-8255 (Press 1) ... 838255 Chat confidentially now If you are in crisis or having thoughts of suicide, visit VeteransCrisisLine.net ...

  18. Evaluation of Genotoxicity of CSE1034 by Ames and In vitro ...

    African Journals Online (AJOL)

    NADPH) was obtained from Himedia (Mumbai, India). Ames test. The test was ..... W, Passarge E. Toxicity of antibiotics cultured human skin fibroblast. Humangenetik 1975; 28: 273-267. 15. McCann J, Choi E, Yamasaki E, Ames BN. Detection of.

  19. Newly isolated Nodularia phage influences cyanobacterial community dynamics

    Czech Academy of Sciences Publication Activity Database

    Coloma, S.E.; Dienstbier, Ana; Bamford, D.H.; Sivonen, K.; Roine, E.; Hiltunen, T.

    2017-01-01

    Roč. 19, č. 1 (2017), s. 273-286 ISSN 1462-2912 Institutional support: RVO:61388971 Keywords : Baltic sea cyanobacteria * Blue-green-algae * Nitrogen-fixation Subject RIV: EE - Microbiology , Virology OBOR OECD: Microbiology Impact factor: 5.395, year: 2016

  20. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  1. 77 FR 6137 - Agency Information Collection Activities: Guam-CNMI Visa Waiver Agreement

    Science.gov (United States)

    2012-02-07

    ... CFR 212.1(q). Carriers are liable and subject to fine, pursuant to section 273 of the Immigration and... on Form I-760. This form is accessible at http://forms.cbp.gov/pdf/CBP_Form_i760.pdf . Current...

  2. South African Journal of Animal Science - Vol 34, No 4 (2004)

    African Journals Online (AJOL)

    A genetic analysis of epistaxis as associated with EIPH in the Southern African Thoroughbred · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Weideman, SJ Schoeman, GF Jordaan, 265-273 ...

  3. On the anisotropy of martensitic transformations in Cu-based alloys

    Czech Academy of Sciences Publication Activity Database

    Novák, Václav; Šittner, Petr; Vokoun, D.; Zárubová, Niva

    273-275, - (1999), s. 280-285 ISSN 0921-5093 R&D Projects: GA AV ČR IAA1010621 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.943, year: 1999

  4. beyond the border war: new perspectives on southern africa's late ...

    African Journals Online (AJOL)

    hennie

    Price: R 265.00 (SA): R273.00 ; Euros: 34.00 ; (R578.00 through Kalahari.net) ... they viewed as necessary cross-border-, deep penetration and/or pre-emptive .... transgressions with long term consequences which will evoke international law.

  5. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Contact Us: ncptsd@va.gov Also see: VA Mental Health Connect with us return to top CONNECT Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button ...

  6. Dielectric spectroscopy of polymer nanocomposites based on tetrazol and KNO3

    International Nuclear Information System (INIS)

    Castro, R A; Lushin, E N

    2014-01-01

    For tetrazole polymers by dielectric spectroscopy the existence of three relaxation processes in the temperature range T=273-423 K is revealed, the values of relaxation and structural parameters are determined: activation energy E A and glass transition temperature T g

  7. Evaluation of interspecific DNA variability in poplars using AFLP and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... Both markers crearly separated two distinct clusters, one included Populus nigra and the other ... Species of Populus used to test SSR and AFLP primer pair utility. ..... cluster NS001 and NS002 were closely related to 0.273.

  8. Targeting the Checkpoint to Kill Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Benada, Jan; Macůrek, Libor

    2015-01-01

    Roč. 6, č. 3 (2015), s. 1912-1937 ISSN 2218-273X R&D Projects: GA ČR(CZ) GA14-34264S Institutional support: RVO:68378050 Keywords : checkpoint * DNA damage response * cancer Subject RIV: EB - Genetics ; Molecular Biology

  9. 49 CFR 192.150 - Passage of internal inspection devices.

    Science.gov (United States)

    2010-10-01

    ... HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY... transmission lines 103/4 inches (273 millimeters) or more in outside diameter on which construction begins... on investigation or experience, that there is no reasonably practical alternative under the design...

  10. Nové minerály uranu popsané v nedávné minulosti

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 25, č. 3 (2017), s. 261-273 ISSN 1213-0710 R&D Projects: GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : uranium minerals * Red Canyon area * Blue Lizard mine Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology

  11. Early Exposures to Ecogenomics: Effects of Priming and Web Site Interactivity Among Adolescents

    NARCIS (Netherlands)

    Bos, Mark J.W.; Koolstra, Cees M.; Willems, J.T.J.M.

    2010-01-01

    In the context of public introductions to emerging technologies, this study examined effects of priming and Web site interactivity on adolescents’ attitude development and information processing. In a four (priming) by three (interactivity levels) experiment, participants (N = 273) were required to

  12. Early exposures to ecogenomics: Effects of priming and website interactivity among adolescents

    NARCIS (Netherlands)

    Bos, M.J.W.; Koolstra, C.M.; Willems, J.T.J.M.

    2009-01-01

    In the context of public introductions to emerging technologies, this study examined effects of priming and Web site interactivity on adolescents' attitude development and information processing. In a four (priming) by three (interactivity levels) experiment, participants (N = 273) were required to

  13. Early exposures to ecogenomics: Effects of priming and web site interactivity among adolescents

    NARCIS (Netherlands)

    Bos, M.J.W.; Koolstra, C.M.; Willems, J.T.J.M.

    2010-01-01

    In the context of public introductions to emerging technologies, this study examined effects of priming and Web site interactivity on adolescents' attitude development and information processing. In a four (priming) by three (interactivity levels) experiment, participants (N = 273) were required to

  14. Sibship size, birth order, and personality.

    Science.gov (United States)

    Abdel-Khalek, Ahmed; Lester, David

    2005-10-01

    In a sample of 273 American college students who were administered seven personality tests, only death obsession scores were consistently associated with sibship size and birth order (not optimism, pessimism, anxiety, a Taoist orientation, suicidal ideation, or obsessive-compulsive tendencies).

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 273 ... L sold at vegetable farms in Katsina Metropolis, Abstract PDF ... of optimum maturity of maize using image processing and artificial neural networks ... Vol 9, No 1 (2014), Determination of entrance skin dose from diagnostic ...

  16. Liquid and Gas Permeation Studies on the Structure and Properties of Polyamide Thin-Film Composite Membranes

    KAUST Repository

    Duan, Jintang

    2014-01-01

    layer by gas adsorption and gas permeation measurements. Gas adsorption isotherms (N2 at 77K, CO2 at 273K) confirmed the microporous nature of PA in comparison with dense CTA and polysulfone materials. Gas permeation through the commercial PA

  17. Authors: G Ferreira and A Ferreira-Snyman

    African Journals Online (AJOL)

    10332324

    question the theoretical explanation for their recourse to international law. ... so as to build a united and democratic South Africa able to take its rightful ..... Minister of State for Immigration and Ethnic Affairs v Teoh [1995] 183 CLR 273 286-287.

  18. South African Journal of Geomatics - Vol 4, No 3 (2015)

    African Journals Online (AJOL)

    Geospatial subsidence hazard modelling at Sterkfontein Caves · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Ashraf, F Cawood, 273-284. http://dx.doi.org/10.4314/sajg.v4i3.8 ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 273 ... Vol 32 (2006):, Lead pollution in urban roadside environments of Dar es ... Vol 30 (2004): Special Issue on Lake Victoria, Levels of nitrate and ... of Tyrosine Hydroxylase Immunoreactive Cells in the Mouse Islets of ...

  20. Viděno vlastníma očima. Nález neznámého konceptu autobiografie Pavla Janáka

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2008-01-01

    Roč. 56, č. 3 (2008), s. 237-242, 273 ISSN 0049-5123 Institutional research plan: CEZ:AV0Z80330511 Keywords : Pavel Janák * Czech architecture of the 20th century * autobiography Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 273 ... Vol 34 (2008), Seed longevity of dominant plant species from degraded savanna ... Vol 28 (2002), Structural evolution of the Kilombero rift basin in central ... Vol 34 (2008), Survey of wind power potential for wind-based ...

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 273 ... Vol 43, No 1 (2017), Design of a Small Scale Wind Generator for Low ... Seeding and Seedling Treatments on Plant Species Recovery in Kondoa ... size structure and distribution in non-Trawlable areas of Lake Victoria ...

  3. Highly sensitive urea sensing with ion-irradiated polymer foils

    Czech Academy of Sciences Publication Activity Database

    Fink, Dietmar; Hernandez, G. M.; Alfonta, L.

    2012-01-01

    Roč. 273, č. 2 (2012), s. 164-170 ISSN 0168-583X Institutional research plan: CEZ:AV0Z10480505 Keywords : NANOPORES * BIOSENSOR * SAMPLES Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.266, year: 2012

  4. Vom work Book Journal 2011, 2010 4th Edition PDF

    African Journals Online (AJOL)

    USER

    affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.

  5. Letter to the Editor

    Directory of Open Access Journals (Sweden)

    Thomas K. Karikari

    2015-02-01

    Full Text Available This article is a reaction to a previously published article in the Journal of Microbiology & Biology Education, “Gamification of the Laboratory Experience to Encourage Student Engagement” by Kevin Drace (JMBE 14(2:273–274, 2013.

  6. Stress state effect on martensitic structures in shape memory alloys

    Czech Academy of Sciences Publication Activity Database

    Šittner, Petr; Novák, Václav; Zárubová, Niva; Studnička, Václav

    1999-01-01

    Roč. 273, - (1999), s. 370-374 ISSN 0921-5093 R&D Projects: GA AV ČR IAA1010806 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.943, year: 1999

  7. Generating Palladium Nanoclusters Inside Very Lipophilic Gel-Type Functional Resins: Preliminary Catalytic Tests in the Hydrogenation of 2-Ethyl-Anthraquinone to 2-Ethylanthrahydroquinone

    Czech Academy of Sciences Publication Activity Database

    Bombi, G.; Lora, S.; Zancato, M.; D'Archivio, A. A.; Jeřábek, Karel; Corain, B.

    2003-01-01

    Roč. 194, 1-2 (2003), s. 273-281 ISSN 1381-1169 Institutional research plan: CEZ:AV0Z4072921 Keywords : palladium nanoclusters * gel-type resins * catalyst Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.264, year: 2003

  8. What components of chronic care organisation relate to better primary care for coronary heart disease patients? An observational study.

    NARCIS (Netherlands)

    Lieshout, J. van; Frigola Capell, E.; Ludt, S.; Grol, R.P.T.M.; Wensing, M.J.P.

    2012-01-01

    OBJECTIVES: Cardiovascular risk management (CVRM) received by patients shows large variation across countries. In this study we explored the aspects of primary care organisation associated with key components of CVRM in coronary heart disease (CHD) patients. DESIGN: Observational study. SETTING: 273

  9. Classification of Spectra of Emission Line Stars Using Machine Learning Techniques

    Czech Academy of Sciences Publication Activity Database

    Bromová, P.; Škoda, Petr; Vážný, Jaroslav

    2014-01-01

    Roč. 11, č. 3 (2014), s. 265-273 ISSN 1476-8186 R&D Projects: GA ČR GA13-08195S Institutional support: RVO:67985815 Keywords : Be star * stellar spectrum * feature extraction Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  10. 76 FR 35031 - Notice of Quarterly Report (January 1, 2011-March 31, 2011)

    Science.gov (United States)

    2011-06-15

    ... trained in marketing and investment promotion. Number of people receiving information from Agricultural........... $68,273,380 Increase the $68,264,072 Number of program productivity and farmers harvesting high... $11,264,926 Productivity: Support Project. agricultural Horticulture, Paul production in watershed...

  11. 77 FR 13637 - Notice of Quarterly Report (October 1, 2011-December 31, 2011)

    Science.gov (United States)

    2012-03-07

    ... and investment promotion. Number of people receiving information from Agricultural Business Center........... $68,273,380 Increase the $68,264,510 Number of program productivity and farmers harvesting high... $11,602,406 Productivity: Support Project. agricultural Horticulture, Paul production in watershed...

  12. 78 FR 29359 - Commission Information Collection Activities (Ferc-604); Comment Request; Extension

    Science.gov (United States)

    2013-05-20

    ... Regulatory Commission (Commission or FERC) is soliciting public comment on FERC- 604, Cash Management... fax at (202) 273-0873. SUPPLEMENTARY INFORMATION: Title: FERC-604, Cash Management Agreements. OMB... requirements. Abstract: Cash management or ``money pool'' programs typically concentrate affiliates' cash...

  13. TMFunction data: 395 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... G391S;F392I ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  14. TMFunction data: 414 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available G386A;I395S ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  15. TMFunction data: 392 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... V388M;A389G ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  16. TMFunction data: 408 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Y382S;V397L ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  17. TMFunction data: 391 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... Y382F;I395V ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  18. TMFunction data: 409 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available L383M;F398L ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  19. TMFunction data: 407 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available A381S;S396F ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  20. TMFunction data: 389 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... A381G;V384W ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  1. TMFunction data: 417 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available S396A;F398L ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  2. TMFunction data: 397 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... L394F;I395S ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  3. TMFunction data: 412 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available L385R;L394F ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  4. TMFunction data: 406 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available A381V;L385K ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  5. TMFunction data: 418 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available F398I;T399K ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  6. TMFunction data: 410 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available L383Q;T399K ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  7. TMFunction data: 415 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available G391C;T393L ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  8. TMFunction data: 398 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... L394F;T399S ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  9. TMFunction data: 393 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available mease Escherichia coli ... Stewart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette mu... V388G;L394S ... NO lactose transport ( non toxic, retain activity) TM 12; Lactose per

  10. TMFunction data: 411 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available V384G;G391D ... yes LACTOSE UPTAKE (non toxic, reduced activity) TM 12; Lactose permease Escherichia coli ... Ste...wart C, Bailey J, Manoil C. J Biol Chem. 1998 Oct 23;273(43):28078-84 cassette muta

  11. 7 CFR 2.73 - Director, Office of Energy Policy and New Uses.

    Science.gov (United States)

    2010-01-01

    ... OF AGRICULTURE AND GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist... following delegations of authority are made by the Chief Economist to the Director, Office of Energy Policy... interagency agreements. (3) Representing the Chief Economist at conferences, meetings, and other contacts...

  12. Progress in Primary Acoustic Thermometry at NIST: 273 K to 505 K

    Science.gov (United States)

    Strouse, G. F.; Defibaugh, D. R.; Moldover, M. R.; Ripple, D. C.

    2003-09-01

    The NIST Acoustic Thermometer determines the thermodynamic temperature by measuring the speed of sound of argon in a spherical cavity. We obtained the thermodynamic temperature of three fixed points on the International Temperature Scale of 1990: the melting point of gallium [T(Ga) = 302.9146 K] and the freezing points of indium [T(In) = 429.7485 K] and tin [T(Sn) = 505.078 K]. The deviations of thermodynamic temperature from the ITS-90 defined temperatures are T - T90 = (4.7 ± 0.6) mK at T(Ga) , T - T90 = (8.8 ± 1.5) mK at T(In) , and T - T90 = (10.7 ± 3.0) mK at T(Sn) , where the uncertainties are for a coverage factor of k = 1. Our results at T(In) and T(Sn) reduce the uncertainty of T - T90 by a factor of two in this range. Both T - T90 at T(Ga) and the measured thermal expansion of the resonator between the triple point of water and T(Ga) are in excellent agreement with the 1992 determination at NIST. The dominant uncertainties in the present data come from frequency-dependent and time-dependent crosstalk between the electroacoustic transducers. We plan to reduce these uncertainties and extend this work to 800 K.

  13. SU-E-J-273: Simulation of the Radiation Response of Hypoxic Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Espinoza, I [Pontificia Universidad Catolica de Chile, Santiago (Chile); Peschke, P; Karger, C [German Cancer Research Center (DKFZ), Heidelberg (Germany)

    2014-06-01

    Purpose: In radiotherapy, it is important to predict the response of tumour to irradiation prior to the treatment. Mathematical modelling of tumour control probability (TCP) based on the dose distribution, medical imaging and other biological information may help to improve this prediction and to optimize the treatment plan. The aim of this work is to develop an image based 3D multiscale radiobiological model, which describes the growth and the response to radiotherapy of hypoxic tumors. Methods: The computer model is based on voxels, containing tumour, normal (including capillary) and dead cells. Killing of tumour cells due to irradiation is calculated by the Linear Quadratic Model (extended for hypoxia), and the proliferation and resorption of cells are modelled by exponential laws. The initial shape of the tumours is taken from CT images and the initial vascular and cell density information from PET and/or MR images. Including the fractionation regime and the physical dose distribution of the radiation treatment, the model simulates the spatial-temporal evolution of the tumor. Additionally, the dose distribution may be biologically optimized. Results: The model describes the appearance of hypoxia during tumour growth and the reoxygenation processes during radiotherapy. Among other parameters, the TCP is calculated for different dose distributions. The results are in accordance with published results. Conclusion: The simulation model may contribute to the understanding of the influence of biological parameters on tumor response during treatment, and specifically on TCP. It may be used to implement dose-painting approaches. Experimental and clinical validation is needed. This study is supported by a grant from the Ministry of Education of Chile, Programa Mece Educacion Superior (2)

  14. Characteristics of heterojunctions of amorphous LaAlO2.73 on Si

    International Nuclear Information System (INIS)

    Huang Yanhong; Zhao Kun; Lu Huibin; Jin Kuijuan; He Meng; Chen Zhenghao; Zhou Yueliang; Yang Guozhen

    2006-01-01

    High-quality heterojunctions consisting of n-type amorphous LaAlO 3- δ and p-type Si without Si interfacial layer were prepared using a thin film deposition system normally used for laser-molecular beam epitaxy. Good I-V rectifying property, ferroelectricity of interface enhancement and fast photovoltaic effect have been observed in the LaAlO 3- δ /Si p-n heterojunctions. We expect that the multifunctional properties of rectification, ferroelectricity and photovoltaic effect should open up new possibilities in device development and other applications

  15. SU-E-J-273: Simulation of the Radiation Response of Hypoxic Tumors

    International Nuclear Information System (INIS)

    Espinoza, I; Peschke, P; Karger, C

    2014-01-01

    Purpose: In radiotherapy, it is important to predict the response of tumour to irradiation prior to the treatment. Mathematical modelling of tumour control probability (TCP) based on the dose distribution, medical imaging and other biological information may help to improve this prediction and to optimize the treatment plan. The aim of this work is to develop an image based 3D multiscale radiobiological model, which describes the growth and the response to radiotherapy of hypoxic tumors. Methods: The computer model is based on voxels, containing tumour, normal (including capillary) and dead cells. Killing of tumour cells due to irradiation is calculated by the Linear Quadratic Model (extended for hypoxia), and the proliferation and resorption of cells are modelled by exponential laws. The initial shape of the tumours is taken from CT images and the initial vascular and cell density information from PET and/or MR images. Including the fractionation regime and the physical dose distribution of the radiation treatment, the model simulates the spatial-temporal evolution of the tumor. Additionally, the dose distribution may be biologically optimized. Results: The model describes the appearance of hypoxia during tumour growth and the reoxygenation processes during radiotherapy. Among other parameters, the TCP is calculated for different dose distributions. The results are in accordance with published results. Conclusion: The simulation model may contribute to the understanding of the influence of biological parameters on tumor response during treatment, and specifically on TCP. It may be used to implement dose-painting approaches. Experimental and clinical validation is needed. This study is supported by a grant from the Ministry of Education of Chile, Programa Mece Educacion Superior (2)

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 273 ... Vol 25, No 1 (2017), Amblyopia in rural Nigerian school children, Abstract ... Vol 11, No 2 (2003), Amblyopia: Types, Presentation And Treatment – A Review ... Vol 16, No 2 (2008), Causse of Adult Blindness at ECWA Eye ...

  17. Patients with physiological acid exposure and positive symptom association scores: a distinct group within the GORD spectrum

    NARCIS (Netherlands)

    de Vries, D. R.; van Herwaarden, M. A.; Smout, A. J. P. M.; Samsom, M.

    2009-01-01

    Studies comparing pH-metrically well-characterized gastro-oesophageal reflux disease (GORD) patients with physiological reflux to GORD patients with pathological reflux, with regard to clinical and epidemiological data, are lacking. We included 273 GORD patients with pathological 24-h pH-monitoring

  18. Maďarský matematik Endre Szemerédi získal Abelovu cenu za rok 2012

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Pudlák, Pavel; Somer, L.

    2012-01-01

    Roč. 57, č. 4 (2012), s. 265-273 ISSN 0032-2423 R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : Szemeredi theorem * chaos * upper asymptotic density Subject RIV: BA - General Mathematics http://dml.cz/dmlcz/402233

  19. Navigation Method for Autonomous Robots in a Dynamic Indoor Environment

    Czech Academy of Sciences Publication Activity Database

    Věchet, Stanislav; Chen, K.-S.; Krejsa, Jiří

    2013-01-01

    Roč. 3, č. 4 (2013), s. 273-277 ISSN 2223-9766 Institutional support: RVO:61388998 Keywords : particle filters * autonomous mobile robots * mixed potential fields Subject RIV: JD - Computer Applications, Robotics http://www.ausmt.org/index.php/AUSMT/article/view/214/239

  20. Pillai, Prof. Madhavan Radhakrishna

    Indian Academy of Sciences (India)

    Date of birth: 18 August 1960. Specialization: Tumour Biology, Tumour Virology Address: Director, Rajiv Gandhi Centre for Biotechnology, Jagathi, Thiruvananthapuram 695 014, Kerala Contact: Office: (0471) 234 7973, (0471) 234 1716. Residence: (0471) 273 3819. Mobile: 94471 45776. Fax: (0471) 234 9303

  1. A new [(1R,2R)-1,2-diaminocyclohexane]platinum(II) complex: formation by nitrate-acetonitrile ligand exchange

    Czech Academy of Sciences Publication Activity Database

    Pažout, R.; Housková, J.; Dušek, Michal; Maixner, J.; Cibulková, J.; Kačer, P.

    2010-01-01

    Roč. 66, Part 10 (2010), m273-m275 ISSN 0108-2701 Institutional research plan: CEZ:AV0Z10100521 Keywords : platinum complexes * structure analysis * disorder * cyclohexane * diamine Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.745, year: 2010

  2. Nucleoside Inhibitors of Zika Virus

    Czech Academy of Sciences Publication Activity Database

    Eyer, L.; Nencka, Radim; Huvarová, I.; Palus, Martin; Alves, M. J.; Gould, E. A.; De Clercq, E.; Růžek, Daniel

    2016-01-01

    Roč. 214, č. 5 (2016), s. 707-711 ISSN 0022-1899 Institutional support: RVO:61388963 ; RVO:60077344 Keywords : Zika virus * flavivirus * nucleoside analogue * antiviral * therapy Subject RIV: CC - Organic Chemistry; EE - Microbiology, Virology (BC-A) Impact factor: 6.273, year: 2016

  3. Download this PDF file

    African Journals Online (AJOL)

    Administrator

    was achieved in 45.5% of cases and 27.3% conceived during the follow up period. No change in menstrual ... screening tests for intra-uterine adhesions, hysteroscopy remains .... Although the sample size in this study is small, there is need to ...

  4. Market-Based Housing Finance Efficiency in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Sunega, Petr; Lux, Martin

    2007-01-01

    Roč. 7, č. 3 (2007), s. 241-273 ISSN 1461-6718 R&D Projects: GA ČR GA403/06/0915 Institutional research plan: CEZ:AV0Z70280505 Keywords : housing finance * transition economies * finance efficiency Subject RIV: AO - Sociology, Demography

  5. Herbal dietary supplements and knowledge of appropriate use ...

    African Journals Online (AJOL)

    %) and Aloe vera (32.2%). Fifty eight (71.6%) out of the 81 respondents on prescription drugs were using it alongside HDS. Respondents with poor, fair and good knowledge of appropriate use of HDS were 69.1%, 27.3% and 3.6% respectively.

  6. Improvement of dynamic absorber by means of weak stops

    Czech Academy of Sciences Publication Activity Database

    Půst, Ladislav

    2003-01-01

    Roč. 48, č. 48 (2003), s. 273-299 ISSN 0001-7043 R&D Projects: GA AV ČR IBS2076301 Institutional research plan: CEZ:AV0Z2076919 Keywords : damping of vibrations * 2DOF system * Hert's Impacts Subject RIV: BI - Acoustics

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 273 ... Vol 11, No 4 (2016), Numerical solutions of fifth order boundary ... F – statistic: an example of sales distribution of pharmaceutical drugs, Abstract PDF ... Vol 12, No 4 (2017), Optimization of traffic light control system of an ...

  8. Review of the Field-Data Base for Longshore Sediment Transport

    CSIR Research Space (South Africa)

    Schoonees, JS

    1993-02-01

    Full Text Available A literature search was undertaken to collect field data on longshore sediment transport. This yielded a large number of data sets (273 points for bulk transport rates) from a variety of sites around the world. Data are especially lacking...

  9. 76 FR 60536 - Notice of Quarterly Report (April 1, 2011-June 30, 2011)

    Science.gov (United States)

    2011-09-29

    ..., and Fishing (MAEP) agents trained in marketing and investment promotion. Number of people receiving... Rural Development Project..... $68,273,380 Increase the $68,264,510 Number of program productivity and...,603 Increase agricultural $11,602,406 Productivity: Support Project. production in three Horticulture...

  10. Spektrální radiometry pro měření světelných podmínek pro růst rostlin

    Czech Academy of Sciences Publication Activity Database

    Oupický, Pavel

    2006-01-01

    Roč. 51, č. 10 (2006), s. 270-273 ISSN 0447-6441 R&D Projects: GA AV ČR(CZ) 1QS100820502 Institutional research plan: CEZ:AV0Z20430508 Keywords : Radiometer * spectral * plant * growth Subject RIV: BH - Optics, Masers, Lasers

  11. Franco et al., Afr J Tradit Complement Altern Med. (2016) 13(3):44 ...

    African Journals Online (AJOL)

    As microorganisms can infect wounds and hamper the wound healing process, the aim of this study was to ... to alleviate infections caused by bacteria and fungi. ... A total of 273 fruits were collected from 2003 to 2005 (Avendaño et al., 2008).

  12. Calls for proposals for Indirect IDT Action within the specific (Euratom) Research and Training Programme on Nuclear Energy (2002-2006); Convocatorias de propuestas de accion indirecta de IDT dentro del progrma especifico (Euratom) de investigacion y formacion sobre energia nuclear (2002-2006)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The official diary of the European Union C 273 of 14 November, 2003, published the Calls for Indirect IDT Action for the Euratom Research and Training Programme on Nuclear Energy. The complete text of these Calls are reproduced in page 29. (Author)

  13. Analysis of points of dew and contents of humidity of gassy mixtures N2-H2 O and CH4 H2 O

    International Nuclear Information System (INIS)

    Bedoya M, D; Muller, C; Oellrich, L R

    1995-01-01

    The actual knowledge of the exact water content in saturated gas mixtures still is incomplete, especially in the high pressure and low temperature region. Hence, dew point measurements with nitrogen - water and methane-water mixtures were performed; at pressures of 3 and 6 MPa and temperatures from 258 K to 288 K. The dew points were determined with the dew point mirror method and the water content by means of the Karl-Fischer-titration. The experimental values were compared to correlations from the literature. The approach by Sharma-Campbell resulted in the best description of the system nitrogen - water. For temperatures below 273 K the assumption of ideal behavior proved to be sufficient for the system methane-water, whereas for temperatures above 273 K calculations with the two-parameter corresponding states principle in combination with a fugacity correction turned out to be the best

  14. Consumption of an adult Puma yagouaroundi (Felidae by the snake Boa constrictor (Boidae in Central Mexico Consumo de un jaguarundi adulto Puma yagouaroundi (Felidae por la serpiente Boa constrictor (Boidae en el centro de México

    Directory of Open Access Journals (Sweden)

    Octavio Monroy-Vilchis

    2011-03-01

    Full Text Available Few felids have been recorded as being preyed upon by the Boa constrictor snake (Boa constrictor. Documentation of predation on felids by reptiles is scarce, and natural predators of the adult jaguarundi (Puma yagouaroundi are poorly known. Here, we report for the first time an adult male jaguarundi being eaten by the snake Boa constrictor (of 273 cm snout-to-vent length at the Sierra Nanchititla Natural Reserve, Estado de México.Pocos depredadores han sido registrados como presas de la Boa constrictor (Boa constrictor. La depredación de felinos por reptiles es escasamente documentada y los depredadores naturales del jaguarundi (Puma yagouaroundi son pobremente conocidos. Aquí, nosotros informamos de un evento de depredación de un jaguarundi macho adulto que fue consumido por una B. constrictor (longitud hocico-cloaca: 273 cm en la Reserva Natural Sierra Nanchititla, Estado de México.

  15. Experimental determination of the isothermal (vapour + liquid) equilibria of binary aqueous solutions of sec-butylamine and cyclohexylamine at several temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Chiali-Baba Ahmed, Nouria [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, Post Office Box 119, Tlemcen 13000 (Algeria); Negadi, Latifa, E-mail: latifanegadi@yahoo.fr [LATA2M, Laboratoire de Thermodynamique Appliquee et Modelisation Moleculaire, University AbouBekr Belkaid of Tlemcen, Post Office Box 119, Tlemcen 13000 (Algeria); Mokbel, Ilham [LSA, Laboratoire des Sciences Analytiques, CNRS-UMR 5280, Universite Claude Bernard - Lyon I, 43, Bd du 11 Novembre 1918, Villeurbanne Cedex 69622 (France); Kaci, Ahmed Ait [Laboratoire de Thermodynamique et Modelisation Moleculaire, Universite des Sciences et de la Technologie Houari Boumediene, Post Office Box 32, El Alia 16111, Bab Ezzouar (Algeria); Jose, Jacques [LSA, Laboratoire des Sciences Analytiques, CNRS-UMR 5280, Universite Claude Bernard - Lyon I, 43, Bd du 11 Novembre 1918, Villeurbanne Cedex 69622 (France)

    2012-01-15

    Highlights: > Vapour pressures of sec-butylamine or cyclohexylamine and their aqueous solutions. > The investigated temperatures are 273 K and 363 K. > The (cyclohexylamine + water) mixture shows positive azeotropic behaviour. > The (sec-butylamine + water) or (cyclohexylamine + water) exhibit positive G{sup E}. - Abstract: The vapour pressures of (sec-butylamine + water), (cyclohexylamine + water) binary mixtures, and of pure sec-butylamine and cyclohexylamine components were measured by means of two static devices at temperatures between 293 (or 273) K and 363 K. The data were correlated with the Antoine equation. From these data, excess Gibbs functions (G{sup E}) were calculated for several constant temperatures and fitted to a fourth-order Redlich-Kister equation using the Barker's method. The (cyclohexylamine + water) system shows positive azeotropic behaviour for all investigated temperatures. The two binary mixtures exhibit positive deviations in G{sup E} for all investigated temperatures over the whole composition range.

  16. The influence of column temperature on the hydrogen isotopes separation performance of FDC

    International Nuclear Information System (INIS)

    Deng Xiaojun; Luo Deli; Qin Cheng; Yang Wan; Huang Guoqiang; Huang Zhiyong

    2014-01-01

    Frontal displacement chromatography (FDC) is a promising method for hydrogen isotopes separation with obvious advantages such as simple operation process, low tritium retention in system and easy to scale up, etc. We designed and constructed a FDC device using Pd-Al 2 O 3 as separation material in previous study, and the feasibility of FDC for hydrogen isotopes separation was confirmed. On the basis of the results, a series of experiments at different column temperatures were carried out to investigate the temperature influence to the separation performance, with the composition of (5 ± 0.1)% H 2 -(5 ± 0.1)% D 2 -(90 ± 0.1)% Ar of feed gas. Experiments were carried out at the temperature of 303K, 273K, 263K, 253K, 213K, at the gas flow rate of 15 mL (NTP)/min. The results indicated that lower temperature, higher enrichment factor while the feed gas composition and the gas flow rate are definite; lower temperature, shorter 'separation transition state', and then better separation efficiency. The deuterium enrichment factor became 65 from l.5 while the temperature decreased to 273K from 303K. It also showed that the deuterium recovery ratio and the deuterium abundance of product gas increases with the temperature decrease except for the case of 303K. At the temperature of 273K and below, the deuterium recovery ratio were all higher than 42%, deuterium abundance of product were all larger than 98%, and the maximum of deuterium abundance at 213K was 99.8%. (authors)

  17. Adsorption behavior of rice husk for the decontamination of chromium from industrial effluents

    International Nuclear Information System (INIS)

    Khalid, N.; Rahman, A.; Ahmad, S.; Toheed, A.; Ahmed, J.

    1999-01-01

    Rice husk, an agricultural waste product, was studied as a potential decontaminant for chromium in the effluents of leather tanning industries. Physico-chemical parameters such as selection of appropriate electrolyte, shaking time, concentration of absorbent and absorbate were studied to optimize the best conditions in which this material can be utilized on commercial scale for the decontamination of effluents. The radiotracer technique was used to determine the distribution of chromium. In certain cases atomic absorption spectrophotometry was also employed. Maximum adsorption was observed at 0.01 mol x dm -3 acid solutions (HNO 3 , HCl, H 2 SO 4 and HClO 4 ) using 3.0 g of absorbent for 2.73 x 10 -3 mol x dm -3 chromium concentration in five minutes equilibration time. Studies show that the adsorption decreases with the increase in the concentrations of all acids. The adsorption data follows the Freundlich isotherm over the range of 2.73 x 10 -3 to 2.73 x 10 -2 mol x dm -3 chromium concentration. The characteristic Freundlich constants, i.e., 1/n = 0.86 ± 0.06 and A = 2.35 ± 0.06 mmol x g -1 have been computed for the sorption system. Thermodynamic parameters, i.e., ΔG deg, ΔS deg and ΔH deg have also been calculated for the system. Application of the method to a test case of a medium size industry showed that 21 kg of rice husk was sufficient to maintain the NEQS limits of chromium for industrial effluents. (author)

  18. HIV-infected adolescents have low adherence to antiretroviral therapy: a cross-sectional study in Addis Ababa, Ethiopia.

    Science.gov (United States)

    Firdu, Naod; Enquselassie, Fikre; Jerene, Degu

    2017-01-01

    For antiretroviral therapy (ART) to work effectively, adherence is very crucial. However, most studies done on ART adherence are either on children or on adults. There is limited information on the level of adherence among adolescents. Using a cross-sectional study design, we interviewed 273 HIV-infected adolescents receiving ART from three hospitals in Addis Ababa. We used a structured questionnaire to measure adherence levels using patient self-reports. Bivariate and multivariate methods were used for analysis. We interviewed 273 adolescents aged 13 to 19 years, and 144 (52.7%) of the participants were girls. Their mean age was 15.4 years (SD± 1.75). The self-reported adherence rate of the respondents was 79.1% (216/273). On bivariate analysis, variables like WHO clinical stage, being on Cotrimoxazole Prophylactic Therapy (CPT), marital and living status of the parent, whether parent was on ART or not and having special instructions for ART medications were associated with optimum adherence. However of those, only WHO stage IV (adjusted OR, 12.874 95% CI, 2.079-79.706), being on CPT (adjusted OR, 0.339 95% CI, 0.124-0.97) and adolescents with widowed parent (adjusted OR, 0.087 with 95% CI, 0.021-0.359) were found to be significantly associated with optimum ART adherence. The level of self-reported ART adherence among HIV-infected adolescents at the three hospitals was below the recommended threshold. Though earlier presentation of adolescents to care should be encouraged, more targeted adherence support should be planned for those who present at an early stage of their illness.

  19. Upper Abdominal Ultra-Sonography Findings in HIV Patients at ...

    African Journals Online (AJOL)

    Design: A descriptive cross-sectional study. Setting: Kenyatta National Hospital and the Defence Forces Memorial Hospital, Nairobi, Kenya. Subjects: HIV infected patients referred for upper abdominal sonography within the study duration of eight months. Results: Two hundred and seventy three (273) patients were ...

  20. The efficacy of the skin delayed-type hypersensitivity using a brucellin prepared from a mucoid strain of Brucella abortus to detect brucellosis

    NARCIS (Netherlands)

    Bercovich, Z.; Muskens, J.A.M.

    1998-01-01

    Eight-hundred-and-ninety-six cattle belonging to herds officially designated Brucella-free, and 190 cattle belonging to infected herds were tested with the skin delayed-type hypersensitivity (SDTH) test, using brucellin (273) prepared from a rnucoid strain of Brucella abortus. An increase in

  1. Nonuniform Grain Boundary Corrosion and the Local Electrode Potential in Crevicing. Types and Models of Precipitation Induced Nonuniform Grain Boundary Corrosion. Investigation of Sensitization and Grain Boundary Corrosion in Ferritic Stainless Steel. The Local Electrode Potential in Cavities, Crevices and Cracks and Its Role in Causing Degradation of Structural Materials.

    Science.gov (United States)

    1987-02-01

    gratitude to the Instituto Universitario de Tecnologia - Regi6n Capital and to Consejo Nacional de Investigaciones Cientificas y Tecnologicas, both in...electrochemical and exposure pitting test with passive metals". Paper No. 273. CORROSION 66. National Association of Corrosion Engineers. 1986. 3D

  2. In Vitro Digestibility of Aluminum from Hibiscus sabdariffa Hot Watery Infusion and Its Concentration in Urine of Healthy Individuals

    Czech Academy of Sciences Publication Activity Database

    Frankova, A.; Malik, J.; Drabek, O.; Szakova, J.; Sperlingova, I.; Kloucek, P.; Novy, P.; Tejnecky, V.; Landa, Přemysl; Leuner, O.; Kokoska, L.

    2016-01-01

    Roč. 174, č. 2 (2016), s. 267-273 ISSN 0163-4984 Institutional support: RVO:61389030 Keywords : dialysis dementia * tea * bioavailability * speciation * toxicity * Aluminum * In vitro digestion * Hot watery infusion * Urine * Hibiscus sabdariffa L Subject RIV: EF - Botanics Impact factor: 2.399, year: 2016

  3. Assignment of the porcine SKI and GABRD genes to chromosome 6q22-q23

    Czech Academy of Sciences Publication Activity Database

    Stratil, Antonín; Knorr, C.; Knoll, Aleš; Kubíčková, S.; Musilová, P.; Van Poucke, M.; Rubeš, J.; Brenig, B.; Peelman, L. J.

    2005-01-01

    Roč. 36, - (2005), s. 272-273 ISSN 0268-9146 R&D Projects: GA ČR GA523/03/0858 Institutional research plan: CEZ:AV0Z50450515 Keywords : SKI gene * GABRD gene Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.437, year: 2005

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 3. General Relativity and the Accelerated Expansion of the Universe. Patrick Das Gupta. General Article Volume 17 Issue 3 March 2012 pp 254-273. Fulltext. Click here to view fulltext PDF. Permanent link:

  5. Wallstents for metastatic biliary obstruction

    NARCIS (Netherlands)

    van Berkel, A. M.; Bergman, J. J.; Waxman, I.; Andres, P.; Huibregtse, K.

    1996-01-01

    In patients with obstruction of the common bile duct caused by primary pancreaticoblliary tumors, Wallstents have been shown to remain patent for a median duration of 273 days (range: 14-363). However, in one study that included both patients with primary pancreaticobillary malignancies and patients

  6. A new species of Rhabdochona Railliet, 1916 (Nematoda: Rhabdochonidae) from cyprinid fishes in the Western Ghats Region, India

    Czech Academy of Sciences Publication Activity Database

    González-Solís, David; Chavan, S. P.; Kannewad, P.; Gyananath, G.

    2014-01-01

    Roč. 87, č. 3 (2014), s. 273-281 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : fresh water fishes * morphology * Thailand Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

  7. A Cross-Sectional Study in Addis Ababa

    African Journals Online (AJOL)

    abp

    2017-06-02

    Jun 2, 2017 ... design, we interviewed 273 HIV-infected adolescents receiving ART from three hospitals in Addis Ababa. ... Bivariate and multivariate methods were used for analysis. ... found to be significantly associated with optimum ART adherence. ... Though earlier presentation of adolescents to care should be.

  8. The Relationship among Transformational Teaching and Student Motivation and Learning

    Science.gov (United States)

    Noland, Aaron; Richards, Keith

    2014-01-01

    Transformational leadership is a well-documented and validated leadership perspective studied in management and organizational contexts that has recently been applied to the instructional context. The current study predicted a positive relationship between teacher transformational leadership and learning, and motivation. A population of 273

  9. Parturition difficulties in sheep

    NARCIS (Netherlands)

    Grommers, F. J.; Elving, L.; Eldik, P. van

    1985-01-01

    The incidence of difficult parturition was recorded in Texel Sheep lambs (224), Milk Sheep lambs (273) and various crossbreeds (1043) in ten spring lambing seasons. at lambing time the ewes were under 24-hour observation. Difficult parturition is defined as necessity for obstetrical assistance as

  10. Women's Issues and Epilepsy: A Look at Health Care Practitioners ...

    African Journals Online (AJOL)

    About thirty six percent of the respondents were neurologists, 27.3% were in Internal Medicine while the rest comprised of general practitioners, pediatric neurologists, neurosurgeons, neuroscience nurses and neurophysiologists. There was poor knowledge of the effect of sex hormones on seizure threshold during ...

  11. Performance of commercial laying hen genotypes on free range and organic farms in Switzerland, France and The Netherlands

    NARCIS (Netherlands)

    Leenstra, F.R.; Maurer, V.; Bestman, M.W.P.; Sambeek van, F.; Zeltner, E.; Reuvekamp, B.F.J.; Galea, F.; Niekerk, van T.G.C.M.

    2012-01-01

    1. A total of 257 farmers with free ranging laying hens (organic and conventional) in Switzerland, France and The Netherlands with 273 flocks were interviewed to determine the relationships between the genotype of the hens, management conditions and performance. 2. Almost 20 different genotypes

  12. 78 FR 2669 - Waste Import and Export; Inquiry To Learn Whether Businesses Assert Business Confidentiality Claims

    Science.gov (United States)

    2013-01-14

    ... definition of ``affected business,'' and are not covered by today's notice. They consist of any business that... waste'' is defined at 40 CFR 273.9. Certain businesses, however, do not meet the definition of...; Inquiry To Learn Whether Businesses Assert Business Confidentiality Claims AGENCY: Environmental...

  13. Degradation of natural toxins by phthalocyanines-example of cyanobacterial toxin, microcystin

    Czech Academy of Sciences Publication Activity Database

    Jančula, D.; Blahová, L.; Karásková, M.; Maršálek, Blahoslav

    2010-01-01

    Roč. 62, č. 2 (2010), s. 273-278 ISSN 0273-1223 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : microcystin * phthalocyanine * singled oxygen Subject RIV: EF - Botanics Impact factor: 1.056, year: 2010

  14. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... College Station, TX 77843. Present address: Barrens Consulting Co., 273 Pepe's Farm Road, Milford, CT 06470. Department of Physics, Sam Houston State University, Huntsville, TX 77341. Present address: SN4, NASA-JSC, Houston, TX 77858. Shell Development Corporation, P.O. Box 481, Houston, Texas 77001.

  15. Variation in genome composition of blue-aleurone wheat

    Czech Academy of Sciences Publication Activity Database

    Burešová, Veronika; Kopecký, David; Bartoš, Jan; Martinek, P.; Watanabe, N.; Vyhnánek, T.; Doležel, Jaroslav

    2015-01-01

    Roč. 128, č. 2 (2015), s. 273-282 ISSN 0040-5752 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : TRITICUM-AESTIVUM L * COMMON WHEAT * THINOPYRUM-PONTICUM Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.900, year: 2015

  16. 77 FR 24726 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2012-04-25

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Assistance Program Nos. 93.273, Alcohol Research Programs; 93.701, ARRA Related Biomedical Research and...

  17. 77 FR 43604 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2012-07-25

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... and the discussions could disclose confidential trade secrets or commercial property such as.... (Catalogue of Federal Domestic Assistance Program Nos. 93.273, Alcohol Research Programs; 93.701, ARRA...

  18. 78 FR 45541 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2013-07-29

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as.... (Catalogue of Federal Domestic Assistance Program Nos. 93.273, Alcohol Research Programs, National Institutes...

  19. Identifikační znaky samic čolků rodu Triturus podrodu Paleotriton, druhové skupiny vulgaris na území České republiky

    Czech Academy of Sciences Publication Activity Database

    Zavadil, V.; Piálek, Jaroslav

    2000-01-01

    Roč. 49, č. 3 (2000), s. 263-273 ISSN 0323-0627 R&D Projects: GA MŽP MR/610/1/96; GA MŠk VS97102 Institutional research plan: CEZ:AV0Z6093917 Keywords : genus Triturus * morphological traits Subject RIV: EG - Zoology

  20. Effect of exogenous stress on UCP2 level and apoptosis in neonatal rat cardiomyocytes

    Czech Academy of Sciences Publication Activity Database

    Modrianský, M.; Psotová, J.; Smolková, Katarína; Šantorová, Jitka; Ježek, Petr

    2006-01-01

    Roč. 273, č. S1 (2006), s. 163-163 ISSN 1474-3833. [FEBS Congress /31./. 24.06.2006-29.06.2006, Istanbul] R&D Projects: GA ČR(CZ) GA301/05/0221 Keywords : mitochondrial uncoupling proteins * apoptosis * antioxidant defence Subject RIV: CE - Biochemistry

  1. Exome Genotyping Identifies Pleiotropic Variants Associated with Red Blood Cell Traits

    NARCIS (Netherlands)

    Chami, N. (Nathalie); M.-H. Chen (Ming-Huei); Slater, A.J. (Andrew J.); Eicher, J.D. (John D.); E. Evangelou (Evangelos); Tajuddin, S.M. (Salman M.); Love-Gregory, L. (Latisha); T. Kacprowski (Tim); U.M. Schick (Ursula); Nomura, A. (Akihiro); Giri, A. (Ayush); Lessard, S. (Samuel); J. Brody (Jennifer); C. Schurmann (Claudia); V.S. Pankratz (Shane); L.R. Yanek (Lisa); A. Manichaikul (Ani); R. Pazoki (Raha); E. Mihailov (Evelin); W.D. Hill (W. David); Raffield, L.M. (Laura M.); A.D. Burt (Alastair); T.M. Bartz (Traci M.); D.M. Becker (Diane); L.C. Becker (Lewis); E.A. Boerwinkle (Eric); J. Bork-Jensen (Jette); E.P. Bottinger (Erwin); M.L. O'Donoghue (Michelle L.); D.R. Crosslin (David); de Denus, S. (Simon); Dubé, M.-P. (Marie-Pierre); P. Elliott (Paul); G. Engström; M. Evans (Michele); J. Floyd (James); M. Fornage (Myriam); Gao, H. (He); A. Greinacher (Andreas); V. Gudnason (Vilmundur); T. Hansen (T.); T.B. Harris (Tamara); C. Hayward (Caroline); Hernesniemi, J. (Jussi); H. Highland (Heather); J.N. Hirschhorn (Joel); Hofman, A. (Albert); Irvin, M.R. (Marguerite R.); M. Kähönen (Mika); E.M. Lange (Ethan); Launer, L.J. (Lenore J.); T. Lehtimäki (Terho); Li, J. (Jin); D.C. Liewald (David C.); A. Linneberg (Allan); Y. Liu (YongMei); Y. Lu (Yingchang); L.-P. Lyytikäinen (Leo-Pekka); R. Mägi (Reedik); J. Mathias (Jasmine); O. Melander (Olle); A. Metspalu (Andres); K. Mononen (Kari); M.A. Nalls (Michael); D.A. Nickerson (Deborah); K. Nikus (Kjell); C.J. O'Donnell (Christopher); M. Orho-Melander (Marju); O. Pedersen (Oluf); A. Petersmann (Astrid); Polfus, L. (Linda); B.M. Psaty (Bruce); O.T. Raitakari (Olli T.); Raitoharju, E. (Emma); Richard, M. (Melissa); K.M. Rice (Kenneth); F. Rivadeneira Ramirez (Fernando); Rotter, J.I. (Jerome I.); Schmidt, F. (Frank); A.V. Smith (Albert Vernon); J.M. Starr (John); K.D. Taylor (Kent); A. Teumer (Alexander); Thuesen, B.H. (Betina H.); Torstenson, E.S. (Eric S.); R.P. Tracy (Russell); I. Tzoulaki; N.A. Zakai (Neil); Vacchi-Suzzi, C. (Caterina); C.M. van Duijn (Cornelia); F.J.A. van Rooij (Frank); M. Cushman (Mary Ann); I.J. Deary (Ian J.); Velez Edwards, D.R. (Digna R.); Vergnaud, A.-C. (Anne-Claire); L.C. Wallentin (Lars); D. Waterworth (Dawn); White, H.D. (Harvey D.); J.F. Wilson (James); A.B. Zonderman; S. Kathiresan (Sekar); N. Grarup (Niels); T. Esko (Tõnu); R.J.F. Loos (Ruth); L.A. Lange (Leslie); Faraday, N. (Nauder); Abumrad, N.A. (Nada A.); T.L. Edwards (Todd L.); S.K. Ganesh (Santhi); P. Auer (Paul); A.D. Johnson (Andrew); A. Reiner (Alexander); G. Lettre (Guillaume)

    2016-01-01

    textabstractRed blood cell (RBC) traits are important heritable clinical biomarkers and modifiers of disease severity. To identify coding genetic variants associated with these traits, we conducted meta-analyses of seven RBC phenotypes in 130,273 multi-ethnic individuals from studies genotyped on an

  2. Removal of Carbon Dioxide from Gas Mixtures Using Ion-Exchanged Silicoaluminophosphates

    Science.gov (United States)

    Hernandez-Maldonado, Arturo J (Inventor); Rivera-Ramos, Milton E (Inventor); Arevalo-Hidalgo, Ana G (Inventor)

    2017-01-01

    Na+-SAPO-34 sorbents were ion-exchanged with several individual metal cations for CO2 absorption at different temperatures (273-348 K) and pressures (SAPO-34 sorbents are by far the best option for CO2 removal from CH4 mixtures, especially at low concentrations.

  3. TRAIL/APO2L inhibits myelodysplasia and myeloid leukemia progenitor growth while it does not affect normal progenitors in vitro and normal CD3+ cell repopulation in NOD/SCID mice

    Czech Academy of Sciences Publication Activity Database

    Plašilová, M.; Živný, J.; Jelínek, J.; Neuwirtová, R.; Čermák, J.; Nečas, E.; Anděra, Ladislav; Stopka, T.

    2001-01-01

    Roč. 98, č. 11 (2001), s. 3043 ISSN 0006-4971 R&D Projects: GA AV ČR IAA5052001 Institutional research plan: CEZ:AV0Z5052915 Keywords : TRAIL * leukemia * apoptosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.273, year: 2001

  4. Seasonal and diel changes in photosynthetic activity of the snow algae Chlamydomonas nivalis (Chlorophyceae) from Svalbard determined by PAM fluorometry

    Czech Academy of Sciences Publication Activity Database

    Stibal, Marek; Elster, Josef; Šabacká, Marie; Kaštovská, Klára

    2007-01-01

    Roč. 59, - (2007), s. 265-273 ISSN 0168-6496 R&D Projects: GA AV ČR KJB6005409 Institutional research plan: CEZ:AV0Z60050516 Keywords : Chlamydomonas nivalis * photosynthetic activity * PAM fluorometry Subject RIV: EF - Botanics Impact factor: 3.039, year: 2007

  5. Activity and mechanism of action of insect oostatic peptides in flesh fly

    Czech Academy of Sciences Publication Activity Database

    Slaninová, Jiřina; Bennettová, Blanka; Nazarov, Elšan; Šimek, Petr; Holík, Josef; Vlasáková, Věra; Hlaváček, Jan; Černý, B.; Tykva, Richard

    2004-01-01

    Roč. 32, - (2004), s. 263-273 ISSN 0045-2068 R&D Projects: GA ČR GA203/02/0247 Institutional research plan: CEZ:AV0Z4055905 Keywords : oostatic activity * binding experiments * degradation Subject RIV: CC - Organic Chemistry Impact factor: 1.240, year: 2004

  6. 78 FR 58296 - Commission Information Collection Activities (FERC-604); Comment Request

    Science.gov (United States)

    2013-09-23

    ... submitting the information collection FERC-604 (Cash Management Agreements) to the Office of Management and..., and by fax at (202) 273-0873. SUPPLEMENTARY INFORMATION: Title: FERC-604, Cash Management Agreements... collection requirements with no changes to the reporting requirements. Abstract: Cash management or ``money...

  7. Historik ve víru dějin a dlouhé století ve Víře v pokrok

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš

    2009-01-01

    Roč. 6, č. 2 (2009), s. 273-297 ISSN 1214-7249 R&D Projects: GA AV ČR KJB800630701 Institutional research plan: CEZ:AV0Z80630520 Keywords : Bedřich Loewenstein * faith in progress * 19th century Subject RIV: AB - History

  8. 75 FR 64692 - Green Technology Pilot Program

    Science.gov (United States)

    2010-10-20

    ... DEPARTMENT OF COMMERCE Patent and Trademark Office Green Technology Pilot Program ACTION: Proposed...- 0062 Green Technology Pilot Program comment'' in the subject line of the message. Fax: 571-273-0112... United States Patent and Trademark Office (USPTO) implemented a pilot program on December 8, 2009, that...

  9. Gclust Server: 103939 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 103939 PoTR_594761 Cluster Sequences Related Sequences(127) 273 eugene3.66280001 1 ...1.00e-60 14.29 0.0 0.0 0.0 0.0 0.0 Show 103939 Cluster ID 103939 Sequence ID PoTR_594761 Link to cluster seq

  10. Possible Suppression of Magnetorotational Instability by Rapid Radial Flow

    Czech Academy of Sciences Publication Activity Database

    Abramowicz, M. A.; Horák, Jiří; Kluzniak, W.

    2013-01-01

    Roč. 63, č. 2 (2013), s. 267-273 ISSN 0001-5237 R&D Projects: GA ČR(CZ) GAP209/11/2004 Institutional support: RVO:67985815 Keywords : accretion disks * magnetohydrodynamics * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.955, year: 2013

  11. Marine mammal surveys in Dutch waters in 2014

    NARCIS (Netherlands)

    Geelhoed, S.C.V.; Lagerveld, S.; Verdaat, J.P.; Scheidat, M.

    2014-01-01

    In July 2014 aerial surveys to estimate the abundance of Harbour porpoises Phocoena phocoena on the Dutch Continental Shelf were conducted. In total, 229 sightings of 273 individual Harbour Porpoises were collected. Porpoise densities varied between 0.37-3.08 animals/km² in the (four) different

  12. On the Consonant Structure of Rhyme in Czech Accentaul-Syllabic verse

    Czech Academy of Sciences Publication Activity Database

    Říha, Jakub

    2017-01-01

    Roč. 11, č. 2017 (2017), s. 273-277 ISSN 2311-150X R&D Projects: GA ČR GA15-19820S Institutional support: RVO:68378068 Keywords : Czech verse * rhyme * rhythm * sound * blank verse Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  13. Potential of the strain Raoultella sp KDF8 for removal of analgesics

    Czech Academy of Sciences Publication Activity Database

    Palyzová, Andrea; Zahradník, Jiří; Marešová, Helena; Sokolová, Lucie; Kyslíková, Eva; Grulich, Michal; Štěpánek, Václav; Řezanka, Tomáš; Kyslík, Pavel

    2018-01-01

    Roč. 63, č. 3 (2018), s. 273-282 ISSN 0015-5632 R&D Projects: GA TA ČR TH02030337 Institutional support: RVO:61388971 ; RVO:86652036 Keywords : Microbial degradation * Raoultella sp. * Analgesics Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.521, year: 2016

  14. Exploring the Impact of Historically Black Colleges in Promoting the Development of Undergraduates' Self-Concept.

    Science.gov (United States)

    Berger, Joseph B.; Milem, Jeffrey F.

    2000-01-01

    Study explores how institutional context affects the development of self-concept in a sample of 273 African American college students. Findings suggest that students attending church affiliated historically Black colleges develop significantly higher self-ratings in three domains of self-concept-psychosocial wellness, academic, and achievement…

  15. Alternative Schools. An Analysis of Their Impact on Administrators: Part II

    Science.gov (United States)

    Sachs, David; Codding, Judy

    1976-01-01

    Extensive interviews with school personnel of alternative programs reveal that it is in the process of defining their essence with regard to decision-making, admissions, policies, responsibility, freedom, calendars, and programs vs. school identity that planning problems arise. (A related document is EA 507 273.) (Author/MLF)

  16. African Zoology - Vol 39, No 2 (2004)

    African Journals Online (AJOL)

    Prey selection by a reintroduced lion population in the Greater Makalali Conservancy, South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Dave Druce, Heleen Genis, Jonathan Braak, Sophie Greatwood, Audrey Delsink, Ross Kettles, Luke Hunter, Rob Slotow, 273–284.

  17. Dicty_cDB: Contig-U13954-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 281 e-109 EU080331_1( EU080331 |pid:none) Phytophthora cuyabensis isolate PD... 294 e-109 EU079512_1( EU0795...D_0... 273 e-102 EU080357_1( EU080357 |pid:none) Phytophthora cuyabensis isolate PD... 271 e-102 CP000090_28

  18. The Mass Comm Type: Student Personality Traits, Motivations, and the Choice between News and Strategic Communication Majors

    Science.gov (United States)

    Crawford, Elizabeth Crisp; Fudge, Julie; Hubbard, Glenn T.; Filak, Vincent F.

    2013-01-01

    A study of news media and strategic communication majors (n = 273) revealed differences in regard to personality indices and impetuses for selecting to pursue degrees. Showing overall agreement in the importance of openness, agreeableness, and conscientiousness, strategic communication students were significantly higher in their ratings of…

  19. Effects of nutrient and water level changes on the composition and size structure of zooplankton communities in shallow lakes under different climatic conditions: a pan-European mesocosm experiment

    Czech Academy of Sciences Publication Activity Database

    Tavşanoglu, Ü.N.; Šorf, Michal; Stefanidis, K.; Brucet, S.; Turkan, S.; Agasild, H.; Baho, D.L.; Scharfenberger, U.; Hejzlar, Josef; Papastergiadou, E.; Adrian, R.; Angeler, D.G.; Zingel, P.; Çakiroglu, A.I.; Ozen, A.; Drakare, S.; Sondergaard, M.; Jeppesen, E.; Beklioglu, M.

    2017-01-01

    Roč. 51, č. 2 (2017), s. 257-273 ISSN 1386-2588 EU Projects: European Commission(XE) 244121 - REFRESH Institutional support: RVO:60077344 Keywords : climate change * water level change * zooplankton * size structure * mesocosms Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.500, year: 2016

  20. 78 FR 20932 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

    Science.gov (United States)

    2013-04-08

    ... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Assistance Program Nos. 93.273, Alcohol Research Programs, National Institutes of Health, HHS) Dated: April 2...

  1. Augmented Reality Mentor for Training Maintenance Procedures: Interim Assessment

    Science.gov (United States)

    2014-08-01

    21 APPENDICES APPENDIX A: OBSERVATION PROTOCOL ........................................................... A...to the Soldiers in that condition only (Appendix D). The observation protocol recorded the following performance data: time to complete three sub...2007). Event perception: a mind-brain perspective. Psychological Bulletin, 133(2), 273. 20 Appendix A: Observation Protocol OBSERVER

  2. Vital Signs-Preventing Teen Pregnancy

    Centers for Disease Control (CDC) Podcasts

    This podcast is based on the April 2015 CDC Vital Signs report. Teen births in the U.S. have declined, but still, more than 273,000 infants were born to teens ages 15 to 19 in 2013. Learn about the most effective types of birth control.

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 273 ... Vol 38, No 3 (2012), New Glucopyranosylglyceryl-N-Octenyl Adipate and Bioactivity of Retro and Condensed Chalcones from Toussaintia Orientalis ... Vol 38, No 3 (2012), Organochlorine Pesticides and Degradation Products in Soil around a Former Formulation Plant in Morogoro Municipality, ...

  4. Fulltext PDF

    Indian Academy of Sciences (India)

    user1

    A Status Report on the Thirty Meter. Telescope Adaptive Optics Program. 121. Eswar Reddy, B. India's Participation in the Thirty-. Meter Telescope Project. 87 see Subramanian, Smitha,. 175. Gillies, Kim see Subramanian, Smitha,. 175. Gopal-Krishna, see Goyal, Arti,. 273. Goyal, Arti. On the Photometric Error Calibration.

  5. Attosecond-controlled photoemission from metal nanowire tips in the few-electron regime

    KAUST Repository

    Ahn, B.; Schö tz, J.; Kang, M.; Okell, W. A.; Mitra, S.; Fö rg, B.; Zherebtsov, S.; Sü ß mann, F.; Burger, C.; Kü bel, M.; Liu, C.; Wirth, A.; Di Fabrizio, Enzo M.; Yanagisawa, H.; Kim, D.; Kim, B.; Kling, M. F.

    2017-01-01

    sources for microscopy. Here, we report the generation of high energy photoelectrons (up to 160 eV) in photoemission from single-crystalline nanowire tips in few-cycle, 750-nm laser fields at peak intensities of (2-7.3) × 1012 W/cm2. Recording the carrier

  6. Computer image analysis of seed shape and seed color for flax cultivar description

    Czech Academy of Sciences Publication Activity Database

    Wiesnerová, Dana; Wiesner, Ivo

    2008-01-01

    Roč. 61, č. 2 (2008), s. 126-135 ISSN 0168-1699 R&D Projects: GA ČR GA521/03/0019 Institutional research plan: CEZ:AV0Z50510513 Keywords : image analysis * cultivar description * flax Subject RIV: EA - Cell Biology Impact factor: 1.273, year: 2008

  7. Data of evolutionary structure change: 1PVDA-1ZPDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDB 1PVD 1ZPD A B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...>GLU CA 220 ALA CA 223 SER CA 273 1PVD... A 1PVDA AKLLQTPIDMSLKPN ...A 187 GLU CA 243 LEU CA 296 LYS CA 223 1PVD... A 1PVDA AKGYKPVAV

  8. The effects of nutrition rehabilitation at three Family Life Training Centres in Central Province, Kenya

    NARCIS (Netherlands)

    Hoorweg, J.C.; Niemeijer, R.

    1982-01-01

    During the course of 1978, the three Family Life Training Centres studied admitted 273 women accompanied by 674 children. Women with malnourished children (and their siblings) are admitted to these centres for a 3-week course consisting primarily of nutrition and health education, but also covering

  9. Using stable isotopes to trace resource acquisition and trophic position in four Afrotropical birds with different diets

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Reif, J.; Hořák, D.; Klvaňa, P.; Lee, R. W.; Yohannes, E.

    2010-01-01

    Roč. 81, č. 3 (2010), s. 273-275 ISSN 0030-6525 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : stable isotope analysis * diet ary niche * Cameroon Mountains Subject RIV: EG - Zoology Impact factor: 0.338, year: 2010

  10. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Veterans Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower Rights & Protections Site Index USA.gov White House Inspector ...

  11. Senior Law Faculty Attitudes toward Retirement.

    Science.gov (United States)

    Day, David S.; And Others

    1991-01-01

    This article examines the retirement plans and personal characteristics of 273 senior law school faculty, focusing on health status, income, job satisfaction, and preferred age of retirement. The study suggests that early retirement incentives and a "senior faculty" alternative to full retirement are positive institutional options. (DB)

  12. Adsorption purification of helium coolant of high-temperature gas-cooled reactors of carbon dioxide

    International Nuclear Information System (INIS)

    Varezhkin, A.V.; Zel'venskij, Ya.D.; Metlik, I.V.; Khrulev, A.A.; Fedoseenkin, A.N.

    1986-01-01

    A series experiments on adsorption purification of helium of CO 2 using national adsorbent under the conditions characteristic of HTGR type reactors cleanup system is performed. The experimnts have been conducted under the dynamic mode with immobile adsorbent layer (CaA zeolite) at gas flow rates from 0,02 to 0,055 m/s in the pressure range from 0,8 to 5 MPa at the temperature of 273 and 293 K. It is shown that the adsorption grows with the decrease of gas rate, i.e. with increase of contact time with adsorbent. The helium pressure, growth noticeably whereas the temperature decrease from 293 to 273 K results in adsorption 2,6 times increase. The conclusion is drawn that it is advisable drying and purification of helium of CO 2 to perform separately using different zeolites: NaA - for water. CaA - for CO 2 . Estimations of purification unit parameters are realized

  13. Histrionicotoxin alkaloids finally detected in an ant

    DEFF Research Database (Denmark)

    Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

    2012-01-01

    Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

  14. Babesia major: protection of intact calves against homologous challenge by the injection of irradiated piroplasms

    International Nuclear Information System (INIS)

    Purnell, R.E.; Lewis, D.; Brocklesby, D.W.

    1979-01-01

    Blood from a splenectomized calf infected with Babesia major was divided into 20 ml aliquots which were γ-irradiated at doses of 0, 23.3, 27.3, 31.4, 35.4 and 39.5 krad and then inoculated into groups of three intact calves. Animals receiving non-irradiated blood had typical mild B. major reactions, but those receiving blood irradiated at 23.3, 27.3 and 31.4 krad and 2 of 3 receiving blood irradiated at 35.4 krad had minimal reactions. The remaining 4 animals had no detectable parasitaemic reactions. When the calves were challenged with a similar number (6.0 x 10 9 ) of homologous parasites, they were all immune with the exception of the 4 animals which had not reacted initially. The immune status of individual cattle was reflected accurately in the results of the micro-ELISA test, which detected a significant rise in serum antibody titre of the 4 susceptible animals 7 days after challenge. (author)

  15. Babesia major: protection of intact calves against homologous challenge by the injection of irradiated piroplasms

    Energy Technology Data Exchange (ETDEWEB)

    Purnell, R E; Lewis, D; Brocklesby, D W [Agricultural Research Council, Compton (UK). Inst. for Research on Animal Diseases

    1979-02-01

    Blood from a splenectomized calf infected with Babesia major was divided into 20 ml aliquots which were ..gamma..-irradiated at doses of 0, 23.3, 27.3, 31.4, 35.4 and 39.5 krad and then inoculated into groups of three intact calves. Animals receiving non-irradiated blood had typical mild B. major reactions, but those receiving blood irradiated at 23.3, 27.3 and 31.4 krad and 2 of 3 receiving blood irradiated at 35.4 krad had minimal reactions. The remaining 4 animals had no detectable parasitaemic reactions. When the calves were challenged with a similar number (6.0 x 10/sup 9/) of homologous parasites, they were all immune with the exception of the 4 animals which had not reacted initially. The immune status of individual cattle was reflected accurately in the results of the micro-ELISA test, which detected a significant rise in serum antibody titre of the 4 susceptible animals 7 days after challenge.

  16. Echinococcus granulosus Prevalence in Dogs in Southwest Nigeria

    Directory of Open Access Journals (Sweden)

    Oyeduntan Adejoju Adediran

    2014-01-01

    Full Text Available Echinococcosis is a public health parasitic disease that is cosmopolitan (Echinococcus granulosus in its distribution. Domestic dogs (Canis familiaris have been recognised as the definitive host of the parasite. The present study was carried out to determine the prevalence of canine echinococcosis in Southwest Nigeria using direct enzyme linked immunosorbent assay (ELISA to detect sera antigen. Two hundred and seventy-three (273 canine sera were tested for the presence of Echinococcus antigen. Purpose of keeping (hunting or companion, age (young or adult, and sex of each dog were considered during sampling. Total prevalence recorded was 12.45% (34/273. There was significant difference (P0.05 between young and adult dogs. There was no association between sex and prevalence of canine echinococcosis. The result of this study established the presence of canine echinococcosis in Southwest Nigeria; thus there is the possibility of occurrence of zoonotic form of the disease (human cystic hydatid diseases in the region.

  17. Thermoluminescence dose response of quartz as a function of irradiation temperature

    International Nuclear Information System (INIS)

    Kitis, G.; Kaldoudi, E.; Charalambous, S.

    1990-01-01

    The thermoluminescence (TL) response of pure Norwegian quartz as a function of irradiation temperature (T irr ) and dose has been investigated. The TL response of the (150-230 o C) and (230-350 o C) glow curve intervals shows a strong dependence on T irr between 77 and 373 K in the dose range from 54 to 8.4 x 10 4 Gy. Both glow curve intervals also show temperature dependent dose response properties. The 150-230 o C interval is supralinear from the lowest dose (54 Gy). Its maximum supralinearity factor appears at T irr = 293 K. The 230-350 o C interval shows sublinear behaviour below T irr = + 193 K, while at T irr ≥ 273 K it shows the well known dose response curves. Its maximum supralinearity factor appears at T irr = 323 K. The linear response is extended up to 460 Gy at T irr = 273 K and falls to 80 Gy at T irr = 373 K. (author)

  18. Novel Bioactive Paulomycin Derivatives Produced by Streptomyces albus J1074

    Directory of Open Access Journals (Sweden)

    Jorge Fernández-De la Hoz

    2017-10-01

    Full Text Available Four novel paulomycin derivatives have been isolated from S. albus J1074 grown in MFE culture medium. These compounds are structural analogs of antibiotics 273a2α and 273a2β containing a thiazole moiety, probably originated through an intramolecular Michael addition. The novel, thiazole, moiety-containing paulomycins show a lower antibiotic activity than paulomycins A and B against Gram-positive bacteria. However, two of them show an improved activity against Gram-negative bacteria. In addition, the four novel compounds are more stable in culture than paulomycins A and B. Thus, the presence of an N-acetyl-l-cysteine moiety linked to the carbon atom of the paulic acid isothiocyanate moiety, via a thioester bond, and the subsequent intramolecular cyclization of the paulic acid to generate a thiazole heterocycle confer to paulomycins a higher structural stability that otherwise will conduce to paulomycin degradation and into inactive paulomenols.

  19. Utilisation of ISA Reverse Genetics and Large-Scale Random Codon Re-Encoding to Produce Attenuated Strains of Tick-Borne Encephalitis Virus within Days.

    Science.gov (United States)

    de Fabritus, Lauriane; Nougairède, Antoine; Aubry, Fabien; Gould, Ernest A; de Lamballerie, Xavier

    2016-01-01

    Large-scale codon re-encoding is a new method of attenuating RNA viruses. However, the use of infectious clones to generate attenuated viruses has inherent technical problems. We previously developed a bacterium-free reverse genetics protocol, designated ISA, and now combined it with large-scale random codon-re-encoding method to produce attenuated tick-borne encephalitis virus (TBEV), a pathogenic flavivirus which causes febrile illness and encephalitis in humans. We produced wild-type (WT) and two re-encoded TBEVs, containing 273 or 273+284 synonymous mutations in the NS5 and NS5+NS3 coding regions respectively. Both re-encoded viruses were attenuated when compared with WT virus using a laboratory mouse model and the relative level of attenuation increased with the degree of re-encoding. Moreover, all infected animals produced neutralizing antibodies. This novel, rapid and efficient approach to engineering attenuated viruses could potentially expedite the development of safe and effective new-generation live attenuated vaccines.

  20. Calibration of lung counter using a CT model of Torso phantom and Monte Carlo method

    International Nuclear Information System (INIS)

    Zhang Binquan; Ma Jizeng; Yang Duanjie; Liu Liye; Cheng Jianping

    2006-01-01

    Tomography image of a Torso phantom was obtained from CT-Scan. The Torso phantom represents the trunk of an adult man that is 170 cm high and weight of 65 kg. After these images were segmented, cropped, and resized, a 3-dimension voxel phantom was created. The voxel phantom includes more than 2 million voxels, which size was 2.73 mm x 2.73 mm x 3 mm. This model could be used for the calibration of lung counter with Monte Carlo method. On the assumption that radioactive material was homogeneously distributed throughout the lung, counting efficiencies of a HPGe detector in different positions were calculated as Adipose Mass fraction (AMF) was different in the soft tissue in chest. The results showed that counting efficiencies of the lung counter changed up to 67% for 17.5 keV γ ray and 20% for 25 keV γ ray when AMF changed from 0 to 40%. (authors)

  1. ORIGINAL ARTICLES Prevalence of drug-drug interactions of ...

    African Journals Online (AJOL)

    2008-02-02

    Feb 2, 2008 ... Table II. Frequency of level 2 interactions between ARVs and the other drugs. Interacting ARVs and other drugs. N. %*. Didanosine + ketoconazole. 1. 0.91. Didanosine + ofloxacin. 1. 0.91. Didanosine + ciprofloxacin. 2. 1.82. Didanosine + iraconazole. 3. 2.73. Didanosine + ketoconazole. 2. 1.82. Efavirenz ...

  2. Women's use of information and communication technology in ...

    African Journals Online (AJOL)

    Women's use of information and communication technology in accessing maternal and child health information in Nigeria. ... MCH information was accessed through mobile phones (76.0%), radio (66.9%), television (55.1%), the Internet (27.3%) and the public address system/projector (2.5%). The MCH information themes ...

  3. Descriptive survey of personal hygiene and knowledge of exposure ...

    African Journals Online (AJOL)

    Majority of the poultry workers have adequate personal hygiene while use of antiseptics as part of hand washing practices is relatively low. Forty-three percent of poultry workers have some knowledge of occupational exposure factors and 27.3% have some knowledge of non-occupational exposure factors to zoonotic ...

  4. Effects of learned flavour cues on short-term regulation of food intake in a realistic setting

    NARCIS (Netherlands)

    Zandstra, E.H.; Stubenitsky, K.; Graaf, de C.; Mela, D.J.

    2002-01-01

    The present study examined the effects of repeated midmorning consumption of novel-flavoured low- and high-energy yoghurt drinks on subsequent energy intake at lunch in 69 adults under actual use conditions. Subjects consumed 200 ml of low- and high-energy yoghurt drinks (67 and 273 kcal/200 ml,

  5. Auxin inhibits endocytosis and promotes its own efflux from cells

    Czech Academy of Sciences Publication Activity Database

    Paciorek, T.; Zažímalová, Eva; Ruthardt, N.; Petrášek, Jan; Stierhof, Y. D.; Kleine-Vehn, J.; Morris, David; Emans, N.; Jürgens, G.; Geldner, N.; Friml, J.

    2005-01-01

    Roč. 435, č. 7046 (2005), s. 1251-1256 ISSN 0028-0836 R&D Projects: GA AV ČR IAA6038303 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phytohormones * polar auxin transport * plasma membrane Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 29.273, year: 2005

  6. Soil salinity: Germination tolerance of alternative oilseed crops for soil health

    Science.gov (United States)

    World-wide, saline soils contribute to over US$27.3 billion in agricultural losses annually by reducing plant growth through osmotic imbalances and ion toxicity. Nearly 800,000 ha of salt affected land is located in the northern Great Plains. Limited information is available on the germination of al...

  7. A RhoGDP dissociation inhibitor spatially regulates growth in root hair cells

    Czech Academy of Sciences Publication Activity Database

    Carol, R.J.; Takeda, S.; Linstead, P.; Durrant, M.C.; Toupalová, Hana; Derbyshire, P.; Drea, S.; Žárský, Viktor; Dolan, L.

    2005-01-01

    Roč. 438, č. 7070 (2005), s. 1013-1016 ISSN 0028-0836 R&D Projects: GA ČR GA204/02/1461 Institutional research plan: CEZ:AV0Z50380511 Keywords : NADPH OXIDASE * MEDICAGO-TRUNCATULA * TIP GROWTH Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 29.273, year: 2005

  8. File list: Oth.ALL.50.Biotin.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.Biotin.AllCell mm9 TFs and others Biotin All cell types SRX477548,SRX273...57049,SRX1057045,SRX1057047,SRX019779,SRX1057043,SRX1057051 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.ALL.50.Biotin.AllCell.bed ...

  9. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    pp 254-273 General Article. Symmetries and Conservation Laws in Classical and Quantum Mechanics - Quantum Mechanics · K S Mallesh S Chaturvedi V Balakrishnan R Simon N Mukunda ... T Padmanabhan · More Details Fulltext PDF. pp 279-292 Reflections. Darshana Jolts - Sound: The Vehicle for Speech and Music.

  10. Modifiable risk factors of coronary heart disease in male first time ...

    African Journals Online (AJOL)

    The following parameters were recorded: personal details, health status, smoking habits, mass, height, body composition, blood pressure, total cholesterol, physical working capacity and predicted aerobic capacity. The majority of subjects (50.9 %) displayed two or more, 27.3 % three or more and 8.2 % four or more, risk ...

  11. Quantitative Determination of Telomerase Activity in Breast Cancer and Benign Breast Diseases

    Czech Academy of Sciences Publication Activity Database

    Šimíčková, M.; Nekulová, M.; Pecen, Ladislav; Černoch, M.; Vagundová, M.; Pačovský, Z.

    2001-01-01

    Roč. 48, č. 4 (2001), s. 267-273 ISSN 0028-2685 R&D Projects: GA MZd NM17 Institutional research plan: AV0Z1030915 Keywords : telomerase activity * quantitative analysis * breast cancer * benign breast diseases * prognisis Subject RIV: BA - General Mathematics Impact factor: 0.637, year: 2001

  12. Micro‐CT analyses of apical enlargement and molar root canal complexity

    DEFF Research Database (Denmark)

    Markvart, M.; Darvann, Tron Andre; Larsen, P.

    2012-01-01

    Markvart M, Darvann TA, Larsen P, Dalstra M, Kreiborg S, Bjørndal L. Micro‐CT analyses of apical enlargement and molar root canal complexity. International Endodontic Journal, 45, 273–281, 2012. Aim To compare the effectiveness of two rotary hybrid instrumentation techniques with focus on apical...

  13. A Biomathematical Model of the Restoring Effects of Caffeine on Cognitive Performance During Sleep Deprivation

    Science.gov (United States)

    2013-01-01

    Eddington, N.D., 2002. The rate of absorption and relative bioavailability of caffeine administered in chewing gum versus capsules to normal healthy...S., Dagan, Y., Shenkman, L., 2002. The effects of coffee consumption on sleep and melatonin secretion. Sleep Med. 3, 271–273. Syed, S.A., Kamimori

  14. Social Connectedness, Discrimination, and Social Status as Mediators of Acculturation/Enculturation and Well-Being

    Science.gov (United States)

    Yoon, Eunju; Hacker, Jason; Hewitt, Amber; Abrams, Matthew; Cleary, Sarah

    2012-01-01

    The present study proposed and tested a conceptual model of acculturation/enculturation and subjective well-being (SWB) by including social connectedness in mainstream society, social connectedness in the ethnic community, perceived discrimination, and expected social status as mediators. Survey data from 273 Asian American college students in the…

  15. A Plasmid Containing the Human Metallothionein II Gene Can Function as an Antibody-assisted Electrophoretic Biosensor for Heavy Metals

    Science.gov (United States)

    2015-01-16

    Biol. Chem. 273:7127–7133. Brugnera, E., Georgiev, O., Radtke , F., et al. 1994. Cloning, chromosomal mapping and characterization of the human metal...Signaling events for metallothionein induction. Mutat. Res. 533:211–226. Heuchel, R., Radtke , F., Georgiev, O., et al. 1994. The transcription factor MTF

  16. Cambodian Parental Involvement: The Role of Parental Beliefs, Social Networks, and Trust

    Science.gov (United States)

    Eng, Sothy; Szmodis, Whitney; Mulsow, Miriam

    2014-01-01

    The role of social capital (parental beliefs, social networks, and trust) as a predictor of parental involvement in Cambodian children's education was examined, controlling for human capital (family socioeconomic status). Parents of elementary students (n = 273) were interviewed face to face in Cambodia. Teacher contact scored highest, followed by…

  17. The Developmental Characteristics of Engagement in Service-Learning for Chinese College Students

    Science.gov (United States)

    Guo, Fangfang; Yao, Meilin; Zong, Xiaoli; Yan, Wenfan

    2016-01-01

    The purpose of this study was to investigate the development characteristics of Chinese college students' engagement during a service-learning project with a case study method: 273 reflective journals from 31 college students who participated in service-learning were analyzed. Results indicated that students' overall engagement showed 4…

  18. New observations on Micropleura australiensis (Nematoda, Dracunculoidea), a parasite of crocodiles in Australia

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Spratt, D. M.; Kay, W. R.

    2006-01-01

    Roč. 51, č. 4 (2006), s. 273-278 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170 Institutional research plan: CEZ:AV0Z60220518 Keywords : Micropleura * Crocodylus * Australia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.772, year: 2006

  19. Dysmenorrhea among female students at a teaching hospital in ...

    African Journals Online (AJOL)

    settings and Design: This is a cross‑sectional, observational study among female medical and nursing students at a tertiary ... Dysmenorrhea-related absenteeism occurs in 27.3% of sufferers in a Japanese study.[3] In Nigeria, a study from Eastern Nigeria reported a 25% prevalence of ... identifiable pathologic cause.

  20. Emotional Intelligence, Communication Competence, and Student Perceptions of Team Social Cohesion

    Science.gov (United States)

    Troth, Ashlea C.; Jordan, Peter J.; Lawrence, Sandra A.

    2012-01-01

    Students generally report poor experiences of group work in university settings. This study examines whether individual student perceptions of team social cohesion are determined by their level of emotional intelligence (EI) and whether this relationship is mediated by their communication skills. Business students (N = 273) completed the 16-item…

  1. Two new species of Philometra (Nematoda: Philometridae) from needlefishes (Belonidae) in Iraq, with a key to Philometra spp. parasitic in the host’s subcutaneous tissue, fins and musculature

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2005-01-01

    Roč. 52, č. 3 (2005), s. 267-273 ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005

  2. The functional interactions between CD98, beta 1-integrins, and CD147 in the induction of U937 homotypic aggregation

    Czech Academy of Sciences Publication Activity Database

    Cho, J. Y.; Fox, D. A.; Hořejší, Václav; Sagawa, K.; Skubitz, K. M.; Katz, D. R.; Chain, B.

    2001-01-01

    Roč. 98, č. 2 (2001), s. 374-382 ISSN 0006-4971 R&D Projects: GA ČR GA310/99/0349 Institutional research plan: CEZ:AV0Z5052915 Keywords : integrin * CD98 * CD147 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 9.273, year: 2001

  3. The EHDI and Early Intervention Connection

    Science.gov (United States)

    Nelson, Lauri; Bradham, Tamala S.; Houston, K. Todd

    2011-01-01

    State coordinators of early hearing detection and intervention (EHDI) programs completed a strengths, weaknesses, opportunities, and threats, or SWOT, analysis that examined 12 areas within state EHDI programs. For the early intervention focus question, 48 coordinators listed 273 items, and themes were identified within each SWOT category. A…

  4. Incremental Beliefs of Ability, Achievement Emotions and Learning of Singapore Students

    Science.gov (United States)

    Luo, Wenshu; Lee, Kerry; Ng, Pak Tee; Ong, Joanne Xiao Wei

    2014-01-01

    This study investigated the relationships of students' incremental beliefs of math ability to their achievement emotions, classroom engagement and math achievement. A sample of 273 secondary students in Singapore were administered measures of incremental beliefs of math ability, math enjoyment, pride, boredom and anxiety, as well as math classroom…

  5. Antibodies against aquaporin-4 in neuromyelitis optica: distinction between recurrent and monophasic patients

    NARCIS (Netherlands)

    Ketelslegers, I.A.; Modderman, P.W.; Vennegoor, A.; Killestein, J.; Hamann, D.; Hintzen, R.Q.

    2011-01-01

    The detection of antibodies against aquaporin-4 (AQP4) has improved the diagnosis of neuromyelitis optica (NMO). We evaluated a recently established cell-based anti-AQP4 assay in 273 patients with inflammatory CNS demyelination. The assay had a specificity of 99% and a sensitivity of 56% to detect

  6. PTSD: National Center for PTSD

    Medline Plus

    Full Text Available ... Crisis Line: 1-800-273-8255 (Press 1) Social Media Complete Directory EMAIL UPDATES Email Address Required Button to subscribe to email VA HOME Notices Privacy FOIA Regulations Web Policies No FEAR Act Whistleblower Rights & Protections Site Index USA.gov White House Inspector General QUICK ...

  7. An Organizational Culture Perspective of Strategic Leadership and Organizational Change: Shaping the Future of the Army

    Science.gov (United States)

    1991-04-02

    1989): 245-273; David M. Fetterman , Ethnography: Step by Step (Newbury Park, CA: Sage Publications Inc., 1989), 45-47; James P. Spradley, Participant...Denton, D. Keith, and Barry L. Wisdom. "Shared Vision." Business Horizons 32 (July-August 1989): 67-69. Fetterman , David M. Ethnography: Step by Step

  8. Expression and Activation of STAT Transcription Factors in Breast Cancer

    Science.gov (United States)

    1998-05-08

    clinicians. J~, 273: 577-585, 1995. 183 Hundertmark 5, Buhler H, Rudolf M, Weitzel HK, Ragosch V: Inhibition of 11 beta-hydroxysteroid dehydrogenase...activated protein kinase through a Jakl-dependent pathway. Mol. Cell. Bioi., 17:3833-40, 1997. Stewart JF, Rubens RO, King RJ, Minton MJ, Steiner R

  9. Benchmark calculations with correlated molecular wave functions. VII. Binding energy and structure of the HF dimer

    International Nuclear Information System (INIS)

    Peterson, K.A.; Dunning, T.H. Jr.

    1995-01-01

    The hydrogen bond energy and geometry of the HF dimer have been investigated using the series of correlation consistent basis sets from aug-cc-pVDZ to aug-cc-pVQZ and several theoretical methods including Moller--Plesset perturbation and coupled cluster theories. Estimates of the complete basis set (CBS) limit have been derived for the binding energy of (HF) 2 at each level of theory by utilizing the regular convergence characteristics of the correlation consistent basis sets. CBS limit hydrogen bond energies of 3.72, 4.53, 4.55, and 4.60 kcal/mol are estimated at the SCF, MP2, MP4, and CCSD(T) levels of theory, respectively. CBS limits for the intermolecular F--F distance are estimated to be 2.82, 2.74, 2.73, and 2.73 A, respectively, for the same correlation methods. The effects of basis set superposition error (BSSE) on both the binding energies and structures have also been investigated for each basis set using the standard function counterpoise (CP) method. While BSSE has a negligible effect on the intramolecular geometries, the CP-corrected F--F distance and binding energy differ significantly from the uncorrected values for the aug-cc-pVDZ basis set; these differences decrease regularly with increasing basis set size, yielding the same limits in the CBS limit. Best estimates for the equilibrium properties of the HF dimer from CCSD(T) calculations are D e =4.60 kcal/mol, R FF =2.73 A, r 1 =0.922 A, r 2 =0.920 A, Θ 1 =7 degree, and Θ 2 =111 degree

  10. Effect of a 188 Re-SSS lipiodol/131I-lipiodol mixture, 188 Re-SSS lipiodol alone or 131I-lipiodol alone on the survival of rats with hepatocellular carcinoma.

    Science.gov (United States)

    Garin, Elienne; Rakotonirina, Hervé; Lejeune, Florence; Denizot, Benoit; Roux, Jerome; Noiret, Nicolas; Mesbah, Habiba; Herry, Jean-Yues; Bourguet, Patrick; Lejeune, Jean-Jacques

    2006-04-01

    It has been shown that the use of a cocktail of isotopes of different ranges of action leads to an increase in the effectiveness of metabolic radiotherapy. The purpose of the present study was to compare with a control group the effectiveness of three different treatments in rats bearing hepatocellular carcinoma (HCC), using (1) a mixture of lipiodol labelled with both I and Re, (2) lipiodol labelled with I alone and (3) lipiodol labelled with Re alone. Four groups were made up, each containing 14 rats with the N1-S1 tumour cell line. Group 1 received a mixture composed of 22 MBq of Re-SSS lipiodol and 7 MBq I-lipiodol. Group 2 received 14 MBq I-lipiodol. Group 3 received 44 MBq of Re-SSS lipiodol and group 4 acted as the control. The survival of the various groups was compared by a non-parametric test of log-rank, after a follow-up of 60, 180 and 273 days. Compared with the controls, the rats treated with a mixture of Re-SSS lipiodol and I-lipiodol show an increase in survival, but only from day 60 onwards (P=0.05 at day 60 and 0.13 at days 180 and 273). For the rats treated with I-lipiodol, there was a highly significant increase in survival compared with the controls at day 60, day 180 and day 273 (P=0.03, 0.04 and 0.04, respectively). There is no significant increase in survival for the rats treated with Re-SSS lipiodol, irrespective of the follow-up duration (P=0.53 at day 60, 0.48 at day 180, and 0.59 at day 273). In this study, I-lipiodol is the most effective treatment in HCC-bearing rats, because this is the only method that leads to a prolonged improvement of survival. These results cannot necessarily be extrapolated to humans because of the relatively small size and unifocal nature of the lesions in this study. It appears necessary to carry out a study in humans with larger tumours in order to compare these three treatments, particularly with a view to replacing I-labelled lipiodol by Re-labelled lipiodol. However, this study clearly demonstrated that

  11. What Is Salvia?

    Science.gov (United States)

    ... 273-TALK (they don't just talk about suicide—they cover a lot of issues and will help put you in touch with someone close by) If you need information on drug treatment and where you can find it, the Substance Abuse and Mental Health Services Administration can help. Call ...

  12. Prescription Pain Medications (Opioids)

    Science.gov (United States)

    ... 273-TALK (they don't just talk about suicide—they cover a lot of issues and will help put you in touch with someone close by) If you need information on drug treatment and where you can find it, the Substance Abuse and Mental Health Services Administration can help. Call ...

  13. Heroin

    Science.gov (United States)

    ... 273-TALK (they don't just talk about suicide—they cover a lot of issues and will help put you in touch with someone close by) If you need information on drug treatment and where you can find it, the Substance Abuse and Mental Health Services Administration can help. Call ...

  14. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 121 Issue 2 April 2012 pp 273-285. Development of multimodel ensemble based district level medium range rainfall forecast system for Indian region .... 123 Issue 7 October 2014 pp 1637-1652. Forecasting of cyclone Viyaru and Phailin by NWP-based cyclone prediction system (CPS) of IMD – an evaluation.

  15. 40 CFR 262.58 - International agreements.

    Science.gov (United States)

    2010-07-01

    ... universal waste management standards of 40 CFR Part 273, or subject to State requirements analogous to 40... waste meets the Federal definition of hazardous waste in 40 CFR 261.3 and is subject to either the Federal RCRA manifesting requirements at 40 CFR part 262, subpart B, the universal waste management...

  16. Physical Education Pedagogy Faculty Perceptions of Journal Quality

    Science.gov (United States)

    Silverman, Stephen; Kulinna, Pamela Hodges; Phillips, Sharon R.

    2013-01-01

    This study examined perceived journal quality by physical education pedagogy faculty members. Participants (N = 273) were identified in three ways and recruited through e-mail. Based on research in other fields investigating journal quality and on publication patterns in physical education, a web-based survey was used to examine (a) whether…

  17. Revisiting the Model of Creative Destruction: St. Jacobs, Ontario, a Decade Later

    Science.gov (United States)

    Mitchell, Clare J. A.; de Waal, Sarah B.

    2009-01-01

    Ten years ago, the model of creative destruction was developed to predict the fate of communities that base their development on the commodification of rural heritage (Mitchell, C.J.A., 1998. Entrepreneurialism, commodification and creative destruction: a model of post-modern community development. Journal of Rural Studies 14, 273-286). Its…

  18. Affected in the nightclub

    DEFF Research Database (Denmark)

    Demant, Jakob Johan

    2013-01-01

    simultaneously with the affects of love, joy, sympathy and so on. Alcohol, illicit drugs, bouncers, music and other human or non-human actants are part of the place. It is within this heterogeneous assemblage that affects become embodied. The data consists of 273 cases from a large Copenhagen nightclub where...

  19. Eosinophils from patients with type 1 diabetes mellitus express high level of myeloid alpha-defensins and myeloperoxidase

    Czech Academy of Sciences Publication Activity Database

    Neuwirth, Aleš; Dobeš, Jan; Oujezdská, Jana; Ballek, Ondřej; Benešová, Martina; Sumnik, Z.; Včeláková, J.; Koloušková, S.; Obermannová, B.; Kolář, Michal; Štechová, K.; Filipp, Dominik

    2012-01-01

    Roč. 273, č. 2 (2012), s. 158-163 ISSN 0008-8749 R&D Projects: GA MŠk 2B08066 Institutional research plan: CEZ:AV0Z50520514 Keywords : type 1 diabetes * alpha-defensin * myeloperoxidase * granulocyte * eosinophil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.743, year: 2012

  20. Validity and reliability of questionnaires measuring physical activity self-efficacy, enjoyment, social support among Hong Kong Chinese children

    Science.gov (United States)

    Physical activity (PA) correlates have not been extensively studied in Hong Kong children. The aim of this study is to assess the validity and reliability of translated scales to measure PA related self-efficacy, enjoyment and social support in Hong Kong Chinese children. Sample 1 (n=273, aged 8–12 ...