29 CFR 1952.271 - Where the plan may be inspected.

Science.gov (United States)

2010-07-01

... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.271 Section 1952.271..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Vermont § 1952.271...

Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation.

Science.gov (United States)

Calabrese, Giovanna; Giuffrida, Raffaella; Lo Furno, Debora; Parrinello, Nunziatina Laura; Forte, Stefano; Gulino, Rosario; Colarossi, Cristina; Schinocca, Luciana Rita; Giuffrida, Rosario; Cardile, Venera; Memeo, Lorenzo

2015-07-09

The Low-Affinity Nerve Growth Factor Receptor (LNGFR), also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271- mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271- mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

Potential Effect of CD271 on Human Mesenchymal Stromal Cell Proliferation and Differentiation

Directory of Open Access Journals (Sweden)

Giovanna Calabrese

2015-07-01

Full Text Available The Low-Affinity Nerve Growth Factor Receptor (LNGFR, also known as CD271, is a member of the tumor necrosis factor receptor superfamily. The CD271 cell surface marker defines a subset of multipotential mesenchymal stromal cells and may be used to isolate and enrich cells derived from bone marrow aspirate. In this study, we compare the proliferative and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells. Mesenchymal stromal cells were isolated from bone marrow aspirate and adipose tissue by plastic adherence and positive selection. The proliferation and differentiation potentials of CD271+ and CD271− mesenchymal stromal cells were assessed by inducing osteogenic, adipogenic and chondrogenic in vitro differentiation. Compared to CD271+, CD271− mesenchymal stromal cells showed a lower proliferation rate and a decreased ability to give rise to osteocytes, adipocytes and chondrocytes. Furthermore, we observed that CD271+ mesenchymal stromal cells isolated from adipose tissue displayed a higher efficiency of proliferation and trilineage differentiation compared to CD271+ mesenchymal stromal cells isolated from bone marrow samples, although the CD271 expression levels were comparable. In conclusion, these data show that both the presence of CD271 antigen and the source of mesenchymal stromal cells represent important factors in determining the ability of the cells to proliferate and differentiate.

48 CFR 852.271-73 - Use and publication of counseling results.

Science.gov (United States)

2010-10-01

... counseling results. 852.271-73 Section 852.271-73 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-73 Use and publication of counseling results. As prescribed in 871.212, insert the following clause: Use and Publication of Counseling Results (JAN 2008) The contractor agrees that none of...

47 CFR 80.271 - Technical requirements for portable survival craft radiotelephone transceivers.

Science.gov (United States)

2010-10-01

... craft radiotelephone transceivers. 80.271 Section 80.271 Telecommunication FEDERAL COMMUNICATIONS... Authorization for Compulsory Ships § 80.271 Technical requirements for portable survival craft radiotelephone transceivers. (a) Portable survival craft radiotelephone transceivers must comply with the following: (1) The...

7 CFR 205.271 - Facility pest management practice standard.

Science.gov (United States)

2010-01-01

... 7 Agriculture 3 2010-01-01 2010-01-01 false Facility pest management practice standard. 205.271... Requirements § 205.271 Facility pest management practice standard. (a) The producer or handler of an organic facility must use management practices to prevent pests, including but not limited to: (1) Removal of pest...

49 CFR 192.271 - Scope.

Science.gov (United States)

2010-10-01

... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Joining of Materials Other Than by Welding § 192.271...

48 CFR 852.271-72 - Time spent by counselee in counseling process.

Science.gov (United States)

2010-10-01

... counseling process. 852.271-72 Section 852.271-72 Federal Acquisition Regulations System DEPARTMENT OF... Clauses 852.271-72 Time spent by counselee in counseling process. As prescribed in 871.212, insert the following clause: Time Spent by Counselee in Counseling Process (APR 1984) The contractor agrees that no...

14 CFR 271.1 - Purpose.

Science.gov (United States)

2010-01-01

... and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.1 Purpose... establishing the fair and reasonable amount of compensation needed to ensure the continuation of essential air...

14 CFR 271.2 - Definitions.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.2 Definitions... compensation under Subchapter II of Chapter 417 of the Statute. Essential air service is that air...

40 CFR 271.26 - Requirements for used oil management.

Science.gov (United States)

2010-07-01

... to EPA under § 271.5) EPA to allow the use of used oil (that is not mixed with hazardous waste and... part 271, state programs shall have standards for the marketing and burning of used oil for energy...) and (b) Sec. 279.66(b) Sec. 279.72(b) 1 Contains additional new definitions that were not included in...

12 CFR 271.2 - Definitions.

Science.gov (United States)

2010-01-01

... duplicating documents in response to a request made under § 271.5. (d) Duplication refers to the process of... Committee includes rules, statements, decisions, minutes, memoranda, letters, reports, transcripts, accounts... available for purchase or subscription by the general public. (3) “Freelance” journalists may be regarded as...

14 CFR 271.4 - Carrier costs.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.4 Carrier costs. (a) The reasonable costs projected for a carrier providing essential air service at an eligible...

14 CFR 271.6 - Profit element.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.6 Profit element. The reasonable return for a carrier for providing essential air service at an eligible place...

14 CFR 271.5 - Carrier revenues.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.5 Carrier revenues. (a) The projected passenger revenue for a carrier providing essential air service at an eligible...

14 CFR 271.8 - Rate period.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.8 Rate period... place essential air service level; or (5) The uncertainties of the market or other circumstances warrant...

34 CFR 271.10 - What types of projects may be funded?

Science.gov (United States)

2010-07-01

... 34 Education 1 2010-07-01 2010-07-01 false What types of projects may be funded? 271.10 Section... Activities Does the Secretary Assist Under This Program? § 271.10 What types of projects may be funded? The Secretary awards grants to SEAs for projects offering technical assistance (including training) to school...

48 CFR 1352.271-71 - Method of payment and invoicing instructions for ship repair.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Method of payment and invoicing instructions for ship repair. 1352.271-71 Section 1352.271-71 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.271-71 Method of...

40 CFR 271.1 - Purpose and scope.

Science.gov (United States)

2010-07-01

.... 21, 1990. Nov. 2, 1990 Petroleum refinery primary and secondary oil/water/solids separation sludge... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) REQUIREMENTS FOR AUTHORIZATION OF STATE HAZARDOUS WASTE PROGRAMS Requirements for Final Authorization § 271.1...

Gamma spectrometry on MANITU 271-01 gamma scan wires

International Nuclear Information System (INIS)

Dassel, G.; Buurveld, H.A.; Minkema, J.

1994-08-01

A series of irradiation experiments (271-series) is being performed of the sustain programme for material development and characterization of the NET (Next European Torus). In the framework of the first irradiation experiment 271-01, with irradiation up to 0.2 dpa, four gamma scan wires have been examined by gamma scanning. The purpose of the gamma scan wires (GSW) is to get information about the neutron fluence distribution in the capsules during irradiation. In the stainless steel wires the nuclides Co-58, Mu-54, Fe-59 and Co-60 are produced, are characteristic for fast and thermal neutron reactions. (orig./HP)

48 CFR 853.271 - Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Loan Guaranty, Education and Vocational Rehabilitation and Counseling Programs. 853.271 Section 853.271 Federal Acquisition... Guaranty, Education and Vocational Rehabilitation and Counseling Programs. ...

14 CFR 271.3 - Carrier subsidy need.

Science.gov (United States)

2010-01-01

... Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS GUIDELINES FOR SUBSIDIZING AIR CARRIERS PROVIDING ESSENTIAL AIR TRANSPORTATION § 271.3 Carrier subsidy need. In establishing the subsidy for an air carrier providing essential air service at an...

48 CFR 1352.271-82 - Department of Labor occupational safety and health standards for ship repair.

Science.gov (United States)

2010-10-01

... occupational safety and health standards for ship repair. 1352.271-82 Section 1352.271-82 Federal Acquisition... of Provisions and Clauses 1352.271-82 Department of Labor occupational safety and health standards... Occupational Safety and Health Standards for Ship Repair (APR 2010) The contractor, in performance of all work...

36 CFR 271.8 - Consultation with Association of State Foresters and the Advertising Council.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Consultation with Association of State Foresters and the Advertising Council. 271.8 Section 271.8 Parks, Forests, and Public... Association of State Foresters and the Advertising Council. These regulations in this part have been issued...

12 CFR 271.9 - Fee schedules; waiver of fees.

Science.gov (United States)

2010-01-01

... 271.9 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES... because it is likely to contribute significantly to public understanding of the operation or activities of... the subject of the records concerns the operations or activities of the government; (ii) Whether...

48 CFR 719.271-4 - Heads of contracting activities.

Science.gov (United States)

2010-10-01

... DEVELOPMENT SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.271-4 Heads of contracting activities. In order for the agency small business program to be effective, the active support of top management... made by SDB; (b) Consulting with SDB in establishing small business and minority business enterprise...

BKR 27(1) pp. 50-55 (Achuba et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... Biokemistri 27(1): 50–55. 54. Farombi, E.O. (2000) Mechanisms for the hepatoprotective action of kolaviron, studies on hepatic enzymes, microsomal lipids and peroxidation in carbon tetrachloride-treated rats. Pharmacological Research 42: 75–80. Farris MW (1991) Cadmium toxicity: Unique cytoprotective.

48 CFR 236.271 - Cost-plus-fixed-fee contracts.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... CONTRACTS Special Aspects of Contracting for Construction 236.271 Cost-plus-fixed-fee contracts. Annual military construction appropriations acts restrict the use of cost-plus-fixed-fee contracts (see 216.306(c...

12 CFR 27.1 - Scope and OMB control number.

Science.gov (United States)

2010-01-01

... Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR HOUSING HOME LOAN DATA SYSTEM § 27.1 Scope and OMB control number. (a) Scope. This part applies to the activities of national... information requirements contained in this part were approved by the Office of Management and Budget under OMB...

40 CFR 271.12 - Requirements for hazardous waste management facilities.

Science.gov (United States)

2010-07-01

... Requirements for Final Authorization § 271.12 Requirements for hazardous waste management facilities. The State shall have standards for hazardous waste management facilities which are equivalent to 40 CFR parts 264... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Requirements for hazardous waste...

14 CFR 135.271 - Helicopter hospital emergency medical evacuation service (HEMES).

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Helicopter hospital emergency medical....271 Helicopter hospital emergency medical evacuation service (HEMES). (a) No certificate holder may... certificate holder may assign a helicopter flight crewmember, and no flight crewmember may accept an...

20 CFR 404.271 - When automatic cost-of-living increases apply.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false When automatic cost-of-living increases apply... AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.271 When automatic cost-of-living increases apply. Besides increases in the primary insurance amounts...

Trehalose preincubation increases mesenchymal (CD271+ stem cells post-cryopreservation viability

Directory of Open Access Journals (Sweden)

Indra Kusuma

2016-10-01

Full Text Available Background: Dimethyl sulfoxide (Me2SO is a common cryoprotective agent widely used in cell preservation system. Me2SO is currently known to cause epigenetic changes which are  critical in stem cells development and cellular differentiation. Therefore, it is imperative to develop cryopreservation techniques that protect cellular functions and avert Me2SO adverse effect. Trehalose was able to protect organism in extreme condition such as dehydration and cold. This study aimed to verify the protective effect of trehalose preincubation procedure in cryopreservation.Methods: The study was conducted using experimental design. Thawed mesenchymal (CD271+ stem cells from YARSI biorepository were used for the experiment. Trehalose preincubation was performed for 1 hour, internalized trehalose was confirmed by FTIR-ATR measurement. Three groups consisted of (1 cryopreserved without trehalose preincubation, (2 cryopreserved with trehalose preincubation, and (3 did not undergo cryopreservation were evaluated after 24 hours in LN2 for viability in culture. The absorbance from each group was measured at 450 nm. The analysis performed using paired student t test.Results: Viability of thawed mesenchymal (CD271+ stem cells that undergo trehalose preincubation prior cryopreservation was significantly higher (p<0.05 compared to group without trehalose preincubation. Higher viability observed between group with trehalose preincubation compared with controlled group suggests protection to trypsinization. Mesenchymal (CD271+ stem cells incubated for 1 hour in 100 mM trehalose supplemented medium  results in 15%  trehalose loading efficiency.Conclusion: These findings confirm the protective effect of trehalose preincubation in cryopreservation. Future research should be directed to elucidate the trehalose internalization mechanism and eventually the protective mechanism of trehalose in mammalian cell cryopreservation.

12 CFR 271.5 - Records available to the public on request.

Science.gov (United States)

2010-01-01

....5 Section 271.5 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE... Committee's operations. (2) The request shall be submitted in writing to the Secretary of the Committee, Federal Open Market Committee, 20th & C Street, N.W., Washington, D.C. 20551; or sent by facsimile to the...

Examining the feasibility of clinical grade CD271+ enrichment of mesenchymal stromal cells for bone regeneration.

Directory of Open Access Journals (Sweden)

Richard J Cuthbert

Full Text Available Current clinical trials utilize mesenchymal stromal cells (MSCs expanded in culture, however these interventions carry considerable costs and concerns pertaining to culture-induced losses of potency. This study assessed the feasibility of new clinical-grade technology to obtain uncultured MSC isolates from three human intra-osseous tissue sources based on immunomagnetic selection for CD271-positive cells.MSCs were isolated from bone marrow (BM aspirates or surgical waste materials; enzymatically digested femoral heads (FHs and reamer irrigator aspirator (RIA waste fluids. Flow cytometry for the CD45-/lowCD73+CD271+ phenotype was used to evaluate uncultured MSCs before and after selection, and to measure MSC enrichment in parallel to colony forming-unit fibroblast assay. Trilineage differentiation assays and quantitative polymerase chain-reaction for key transcripts involved in bone regeneration was used to assess the functional utility of isolated cells for bone repair.Uncultured CD45-/lowCD271+ MSCs uniformly expressed CD73, CD90 and CD105 but showed variable expression of MSCA-1 and SUSD2 (BM>RIA>FH. MSCs were enriched over 150-fold from BM aspirates and RIA fluids, whereas the highest MSC purities were obtained from FH digests. Enriched fractions expressed increased levels of BMP-2, COL1A2, VEGFC, SPARC and CXCL12 transcripts (BM>RIA>FH, with the highest up-regulation detected for CXCL12 in BM (>1300-fold. Following culture expansion, CD271-selected MSCS were tri-potential and phenotypically identical to plastic adherence-selected MSCs.A CD271-based GMP-compliant immunomagnetic selection resulted in a substantial increase in MSC purity and elevated expression of transcripts involved in bone formation, vascularisation and chemo-attraction. Although this technology, particularly from RIA fluids, can be immediately applied by orthopaedic surgeons as autologous therapy, further improvements in MSC purities and pre-clinical testing of product

In vitro migration and proliferation ("wound healing") potential of mesenchymal stromal cells generated from human CD271(+) bone marrow mononuclear cells.

Science.gov (United States)

Latifi-Pupovci, Hatixhe; Kuçi, Zyrafete; Wehner, Sibylle; Bönig, Halvard; Lieberz, Ralf; Klingebiel, Thomas; Bader, Peter; Kuçi, Selim

2015-09-25

Emerging evidence indicates that mesenchymal stromal cells (MSCs) isolated from different tissue sources may be used in vivo as tissue restorative agents. To date, there is no evidence, however, on migration and proliferation ("wound healing") potential of different subsets of MSCs. The main goal of this study was therefore to compare the in vitro "wound healing" capacity of MSCs generated from positively selected CD271(+) bone marrow mononuclear cells (CD271-MSCs) and MSCs generated by plastic adherence (PA-MSCs). The in vitro model of wound healing (CytoSelect™ 24-Well Wound Healing Assay) was used in order to compare the migration and proliferation potential of CD271-MSCs and PA-MSCs of passage 2 and 4 cultured in presence or absence of growth factors or cytokines. CD271-MSCs of both passages when compared to PA-MSCs demonstrated a significantly higher potential to close the wound 12 and 24 h after initiation of the wound healing assay (P MSCs of second passage was significantly improved after stimulation with FGF-2 (P MSCs of P4 12 h after the treatment (P MSCs of both passages with growth factors or cytokines did not affect their migratory potential. Our in vitro data provide the first evidence that CD271-MSCs are significantly more potent in "wound healing" than their counterparts PA-MSCs.

α decay chains in 271-294115 superheavy nuclei

International Nuclear Information System (INIS)

Santhosh, K. P.; Priyanka, B.; Joseph, Jayesh George; Sahadevan, Sabina

2011-01-01

α decay of 271-294 115 superheavy nuclei is studied using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The predicted α half-lives of 287 115 and 288 115 nuclei and their decay products are in good agreement with experimental values. Comparison of α and spontaneous fission half-lives predicts four-α chains and three-α chains, respectively, from 287 115 and 288 115 nuclei and are in agreement with experimental observation. Our study predicts two-α chains from 273,274,289 115, three-α chains from 275 115, and four-α chains consistently from 284,285,286 115 nuclei. These observations will be useful for further experimental investigation in this region.

7 CFR 2.71 - Director, Office of Risk Assessment and Cost-Benefit Analysis.

Science.gov (United States)

2010-01-01

... Chief Economist § 2.71 Director, Office of Risk Assessment and Cost-Benefit Analysis. (a) Delegations. Pursuant to § 2.29(a)(2), the following delegations of authority are by the Chief Economist to the Director... reserved to the Chief Economist: Review all proposed decisions having substantial economic policy...

25 CFR 1000.271 - What other statutes and regulations apply to FTCA coverage?

Science.gov (United States)

2010-04-01

... OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Federal Tort Claims § 1000.271 What other statutes and... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to FTCA...

Lysine 271 but not lysine 210 of XRCC4 is required for the nuclear localization of XRCC4 and DNA ligase IV

Energy Technology Data Exchange (ETDEWEB)

Fukuchi, Mikoto; Wanotayan, Rujira; Liu, Sicheng; Imamichi, Shoji; Sharma, Mukesh Kumar; Matsumoto, Yoshihisa, E-mail: yoshim@nr.titech.ac.jp

2015-06-12

XRCC4 and DNA Ligase IV (LIG4) cooperate to join two DNA ends at the final step of DNA double-strand break (DSB) repair through non-homologous end-joining (NHEJ). However, it is not fully understood how these proteins are localized to the nucleus. Here we created XRCC4{sup K271R} mutant, as Lys271 lies within the putative nuclear localization signal (NLS), and XRCC4{sup K210R} mutant, as Lys210 was reported to undergo SUMOylation, implicated in the nuclear localization of XRCC4. Wild-type and mutated XRCC4 with EGFP tag were introduced into HeLa cell, in which endogenous XRCC4 had been knocked down using siRNA directed to 3′-untranslated region, and tested for the nuclear localization function by fluorescence microscopy. XRCC4{sup K271R} was defective in the nuclear localization of itself and LIG4, whereas XRCC4{sup K210R} was competent for the nuclear localization with LIG4. To examine DSB repair function, wild-type and mutated XRCC4 were introduced into XRCC4-deficient M10. M10-XRCC4{sup K271R}, but not M10-XRCC4{sup K210R}, showed significantly reduced surviving fraction after 2 Gy γ-ray irradiation as compared to M10-XRCC4{sup WT}. The number of γ-H2AX foci remaining 2 h after 2 Gy γ-ray irradiation was significantly greater in M10-XRCC4{sup K271R} than in M10-XRCC4{sup WT}, whereas it was only marginally increased in M10-XRCC4{sup K210R} as compared to M10-XRCC4{sup WT}. The present results collectively indicated that Lys271, but not Lys210, of XRCC4 is required for the nuclear localization of XRCC4 and LIG4 and that the nuclear localizing ability is essential for DSB repair function of XRCC4. - Highlights: • XRCC4{sup K271R} is defective in the nuclear localization of itself and LIG4. • XRCC4{sup K210R} is competent for the nuclear localization of itself and LIG4. • XRCC4{sup K271R} is deficient in DSB repair function. • XRCC4{sup K210R} is mostly normal in DSB repair function.

Saturation of the 2.71 µm laser output in erbium doped ZBLAN fibers

NARCIS (Netherlands)

Bedö, S.; Pollnau, Markus; Lüthy, W.; Weber, H.P.

1995-01-01

The saturation of the 2.71 μm laser output power has been investigated in an erbium doped ZBLAN single-mode fiber with an Er3+ concentration of 5000 ppm mol. The bleaching of the ground state, the absorption coefficient at the pump wavelength and the fluorescence intensities over a wide wavelength

Retrospective analysis of 271 arteriovenous fistulas as vascular access for hemodialysis

Directory of Open Access Journals (Sweden)

P Sahasrabudhe

2013-01-01

Full Text Available This report describes our experience of arteriovenous fistula (AVF creation as vascular access for hemodialysis (HD. Study has been carried out in Deenanath Mangeshkar Hospital, Pune from January 2004 to December 2009. A total of 271 AVFs were created in 249 patients. Maximum follow up was 7 years and minimum was 1 year. In this study of 271 cases of AVFs, there were 196 (72.3% successful cases and 75 (27.7% failures. Basilic vein was used in 77 (28.4% cases, cephalic vein in 186 (68.6%, and antecubital vein in 8 (3% cases. End (vein to side (artery anastomosis was done in 170 (63% cases. Side to side anastomosis was done in 100 (37% cases. On table bruit was present in 244 (90% and thrill in 232 (85.6% cases. During dialysis, flow rate >250 ml/min was obtained in 136 (50.4% cases. In complications, 16 (5.9% patients developed distal edema, 32 (11.8% developed steal phenomenon. Presence of on table thrill and bruit are indicators of successful AVF. If vein diameter is <2 mm, chances of AVF failure are high. During proximal side to side fistula between antecubital/basilic vein and brachial artery, breaking of first valve toward wrist helps to develop distal veins in forearm by retrograde flow. This technique avoids requirement of superficialization of basilic vein in arm.

Aggressive pituitary adenomas occurring in young patients in a large Polynesian kindred with a germline R271W mutation in the AIP gene.

OpenAIRE

Jennings, J. E.; Georgitsi, M.; Holdaway, I.; Daly, Adrian; Tichomirowa, M.; Beckers, Albert; Aaltonen, Lauri A; Karhu, A.; Cameron, F. J.

2009-01-01

OBJECTIVE: Mutations in the aryl hydrocarbon receptor-interacting protein (AIP) were recently shown to confer a pituitary adenoma predisposition in patients with familial isolated pituitary adenomas (FIPA). We report a large Samoan FIPA kindred from Australia/New Zealand with an R271W mutation that was associated with aggressive pituitary tumors. DESIGN AND METHODS: Case series with germline screening of AIP and haplotype analyses among R271W families. RESULTS: This previously unreported kind...

Antibody Therapy Targeting CD47 and CD271 Effectively Suppresses Melanoma Metastasis in Patient-Derived Xenografts

Directory of Open Access Journals (Sweden)

Michael Ngo

2016-08-01

Full Text Available The high rate of metastasis and recurrence among melanoma patients indicates the existence of cells within melanoma that have the ability to both initiate metastatic programs and bypass immune recognition. Here, we identify CD47 as a regulator of melanoma tumor metastasis and immune evasion. Protein and gene expression analysis of clinical melanoma samples reveals that CD47, an anti-phagocytic signal, correlates with melanoma metastasis. Antibody-mediated blockade of CD47 coupled with targeting of CD271+ melanoma cells strongly inhibits tumor metastasis in patient-derived xenografts. This therapeutic effect is mediated by drastic changes in the tumor and metastatic site immune microenvironments, both of whichwhich exhibit greatly increased density of differentiated macrophages and significantly fewer inflammatory monocytes, pro-metastatic macrophages (CCR2+/VEGFR1+, and neutrophils, all of which are associated with disease progression. Thus, antibody therapy that activates the innate immune response in combination with selective targeting of CD271+ melanoma cells represents a powerful therapeutic approach against metastatic melanoma.

Isolation, Screening, and Identification of Cellulolytic Bacteria from Natural Reserves in the Subtropical Region of China and Optimization of Cellulase Production by Paenibacillus terrae ME27-1

Directory of Open Access Journals (Sweden)

Yan-Ling Liang

2014-01-01

Full Text Available From different natural reserves in the subtropical region of China, a total of 245 aerobic bacterial strains were isolated on agar plates containing sugarcane bagasse pulp as the sole carbon source. Of the 245 strains, 22 showed hydrolyzing zones on agar plates containing carboxymethyl cellulose after Congo-red staining. Molecular identification showed that the 22 strains belonged to 10 different genera, with the Burkholderia genus exhibiting the highest strain diversity and accounting for 36.36% of all the 22 strains. Three isolates among the 22 strains showed higher carboxymethyl cellulase (CMCase activity, and isolate ME27-1 exhibited the highest CMCase activity in liquid culture. The strain ME27-1 was identified as Paenibacillus terrae on the basis of 16S rRNA gene sequence analysis as well as physiological and biochemical properties. The optimum pH and temperature for CMCase activity produced by the strain ME27-1 were 5.5 and 50°C, respectively, and the enzyme was stable at a wide pH range of 5.0–9.5. A 12-fold improvement in the CMCase activity (2.08 U/mL of ME27-1 was obtained under optimal conditions for CMCase production. Thus, this study provided further information about the diversity of cellulose-degrading bacteria in the subtropical region of China and found P. terrae ME27-1 to be highly cellulolytic.

Handbook of Accelerator Physics and Engineering (sections 2.7.1 - 2.7.5 and 7.6.2)

Energy Technology Data Exchange (ETDEWEB)

Roser, T.

1999-04-19

The sections written by this author are: 2.7.1- Thomas - BMT equation; 2.2.2- Spinor Algebra; 2.7.3- Spin Rotators and Siberian Snakes; 2.7.4- Ring with Spin Rotator and Siberian Snakes; 2.7.5- Depolarizing Resonances and Spin Flippers; & 7.6.2- Proton Beam Polarimeters

The -271 G>A polymorphism of kinase insert domain-containing receptor gene regulates its transcription level in patients with non-small cell lung cancer

International Nuclear Information System (INIS)

An, She-Juan; Chen, Zhi-Hong; Lin, Qiu-Xiong; Su, Jian; Chen, Hua-Jun; Lin, Jia-Ying; Wu, Yi-Long

2009-01-01

Kinase insert domain-containing receptor (KDR) plays a critical role in the metastasis of cancer and is used as a molecular target in cancer therapy. We investigated the characteristics of the -271 G>A polymorphism of the KDR gene to gain information that may benefit the development of individualized therapies for patients with non-small cell lung cancer (NSCLC). The -271 G>A polymorphism of the KDR gene in 106 lung cancer patients and 203 healthy control individuals was analyzed by polymerase chain reaction (PCR) and DNA sequencing methods. Real-time quantitative PCR and immunohistochemical methods were used to evaluate KDR mRNA and protein expression levels, respectively, in frozen tumor specimens. The -271 G>A polymorphism was associated with the mRNA expression level of the KDR gene in tumor tissues (t = 2.178, P = 0.032, independent samples t-test). Compared with the AG/GG genotype, the AA genotype was associated with higher KDR mRNA expression in tumor tissues. We found no relationship between the genotype and the KDR protein expression level and no significant difference in the distribution of the KDR gene polymorphism genotypes between lung cancer patients and the control group (χ 2 = 1.269, P = 0.264, Fisher's exact test). This study is the first to show that the -271 G>A polymorphism of the KDR gene may be a functional polymorphism related to the regulation of gene transcription. These findings may have important implications for therapies targeting KDR in patients with NSCLC

In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

Directory of Open Access Journals (Sweden)

C H J Albers-Wolthers

Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

Fulltext PDF

Indian Academy of Sciences (India)

the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.

Three-dimensional structure of phosphoribosyl pyrophosphate synthetase from E. coli at 2.71 Å resolution

Energy Technology Data Exchange (ETDEWEB)

Timofeev, V. I., E-mail: inna@ns.crys.ras.ru, E-mail: tostars@mail.ru, E-mail: ugama@yandex.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Abramchik, Yu. A. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Zhukhlistova, N. E. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation); Muravieva, T. I.; Esipov, R. S. [Russian Academy of Sciences, Shemyakin–Ovchinnikov Institute of Bioorganic Chemistry (Russian Federation); Kuranova, I. P. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

2016-01-15

Phosphoribosyl pyrophosphate synthetase from Escherichia coli was cloned, purified, and crystallized. Single crystals of the enzyme were grown under microgravity. The X-ray diffraction data set was collected at the Spring-8 synchrotron facility and used to determine the three-dimensional structure of the enzyme by the molecular-replacement method at 2.71 Å resolution. The active and regulatory sites in the molecule of E. coli phosphoribosyl pyrophosphate synthetase were revealed by comparison with the homologous protein from Bacillus subtilis, the structure of which was determined in a complex with functional ligands. The conformations of polypeptide-chain fragments surrounding and composing the active and regulatory sites were shown to be identical in both proteins.

[A study on genotype of 271 mycobacterium tuberculosis isolates in 6 prefectures in Yunnan Province].

Science.gov (United States)

Chen, L Y; Yang, X; Ru, H H; Yang, H J; Yan, S Q; Ma, L; Chen, J O; Yang, R; Xu, L

2018-01-06

Objective: To understand the characteristics of genotypes of Mycobacterium tuberculosis isolates in Yunnan province, and provide the molecular epidemiological evidence for prevention and control of tuberculosis in Yunnan Province. Methods: Mycobacterium Tuberculosis isolates were collected from 6 prefectures of Yunnan province in 2014 and their Genetypes of Mycobacterium tuberculosis isolates were obtained using spoligotyping and multiple locus variable numbers of tandem repeats analysis (MLVA). The results of spoligotyping were entered into the SITVITWEB database to obtain the Spoligotyping International Type (SIT) patterns and the sublineages of MTB isolates. The genoyping patterns were clustered with BioNumerics (version 5.0). Results: A total of 271 MTB isolates represented patients were collected from six prefectures in Yunnan province. Out of these patients, 196 (72.3%) were male. The mean age of the patients was (41.9±15.1) years. The most MTB isolates were from Puer, totally 94 iusolates(34.69%). Spoligotyping analysis revealed that 151 (55.72%) MTB isolates belonged to the Beijing genotype, while the other 120 (44.28%) were from non-Beijing genotype; 40 genotypes were consisted of 24 unique genotypes and 16 clusters. The 271 isolates were differentiated into 30 clusters (2 to 17 isolates per cluster) and 177 unique genotypes, showing a clustering rate of 23.62%. Beijing genotype strains showed higher clustering rate than non-Beijing genotype strains (29.14% vs 16.67%). The HGI of 12-locus VNTR in total MTB strains, Beijing genotype strains and non-Beijing genotype was 0.993, 0.982 and 0.995 respectively. Conclusion: The Beijing genotype was the predominant genotype in Yunnan Province, the characteristics of Mycobacterium tuberculosis showed high genetic diversity. The genotyping data reflect the potential recent ongoing transmission in some area, which highlights the urgent need for early diagnosis and treatment of the infectious TB cases, to cut off the

Crystal Growth in Al72.9Ge27.1 Alloy Melt under Acoustic Levitation Conditions

International Nuclear Information System (INIS)

Yan Na; Dai Fu-Ping; Wang Wei-Li; Wei Bing-Bo

2011-01-01

The nonequilibrium solidification of liquid Al 72.9 Ge 27.1 hypoeutectic alloy is accomplished by using single-axis acoustic levitation. A maximum undercooling of 112K (0.16T L ) is obtained for the alloy melt at a cooling rate of 50 K/s. The primary (Al) phase displays a morphological transition from coarse dendrite under a normal conditions to equiaxed grain under acoustic levitation. In the (Al)+(Ge) eutectic, the (Ge) phase exhibits a conspicuous branched growth morphology. Both the primary (Al) dendrites and (Al)+(Ge) eutectics are well refined and the solute content of the primary (Al) phase is extended under acoustic levitation. The calculated and experimental results indicate that the solute trapping effect becomes more intensive with the enhancement of bulk undercooling. (cross-disciplinary physics and related areas of science and technology)

Synthesis and detection of a seaborgium carbonyl complex

NARCIS (Netherlands)

Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.

2014-01-01

Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been

Chemistry of the heaviest elements--one atom at a time

International Nuclear Information System (INIS)

Hoffman, Darleane C.; Lee, Diana M.

2000-01-01

In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

Identification of tetrapeptides from a mixture based positional scanning library that can restore nM full agonist function of the L106P, I69T, I102S, A219V, C271Y, and C271R human melanocortin-4 polymorphic receptors (hMC4Rs).

Science.gov (United States)

Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie

2014-06-12

Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.

From COST 271 to 296 EU actions on ionospheric monitoring and modelling for terrestrial and Earth space radio systems

Science.gov (United States)

Zolesi, B.; Cander, Lj. R.; Altadill, D.

The ionospheric community has long been aware that co-operative research on an international basis is essential to deal with temporal and spatial changes in the ionosphere that influence the performance of terrestrial and Earth-space radio systems. The EU COST (Co-operation in the field of Scientific and Technical Research) 271 Action on "Effects of the Upper Atmosphere on Terrestrial and Earth-space Communications" has had during the period of October 2000-August 2004 the following main objectives: (1) to evaluate the influence of upper atmospheric conditions on terrestrial and Earth-space communications, (2) to develop methods and techniques to improve ionospheric models over Europe for telecommunication and navigation applications and (3) to transfer the results to the appropriate radiocommunication study groups of the International Telecommunication Union (ITU-R) and other national and international organizations dealing with the modern communication systems. At the beginning of 2005 the new 296 Action in the COST Telecommunications, Information Science and Technology domain on "Mitigation of Ionospheric Effects on Radio Systems (MIERS)" was approved for the period 2005-2009. The main objectives of the MIERS are: (a) to support and enhanced the existing European facilities for historical and real-time digital ionospheric data collection and exchange; (b) to develop an integrated approach to ionospheric modelling, create the mechanism needed to ingest processed data into models, extend and develop suitable mitigation models and define the protocols needed to link models together; and (c) to strengthen the areas of expertise that already exist by stimulating closer cooperation between scientists and users, focusing the scope of all the previous COST ionospheric related studies to the mitigation of ionospheric effects on radio systems. This paper summarises briefly how the major objectives of the COST271 Action have been achieved and what are the most important

Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

International Nuclear Information System (INIS)

2002-01-01

This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

Corrective Action Decision Document for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada, Rev. 0

Energy Technology Data Exchange (ETDEWEB)

NNSA/NV

2002-09-16

This corrective action decision document (CADD) identifies and rationalizes the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 271, Areas 25, 26, and 27 Septic Systems, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order (FFACO). Located on the NTS approximately 65 miles northwest of Las Vegas, CAU 271 consists of fifteen Corrective Action Sites (CASs). The CASs consist of 13 septic systems, a radioactive leachfield, and a contaminated reservoir. The purpose of this CADD is to identify and provide a rationale for the selection of a recommended CAA for each CAS within CAU 271. Corrective action investigation (CAI) activities were performed from October 29, 2001, through February 22, 2002, and April 29, 2002, through June 25, 2002. Analytes detected during the CAI were evaluated against preliminary action levels and regulatory disposal limits to determine contaminants of concern (COC) for each CAS. It was determined that contaminants of concern included hydrocarbon-contaminated media, polychlorinated biphenyls, and radiologically-contaminated media. Three corrective action objectives were identified for these CASs, and subsequently three CAAs developed for consideration based on a review of existing data, future use, and current operations in Areas 25, 26, and 27 of the NTS. These CAAs were: Alternative 1 - No Further Action, Alternative 2 - Clean Closure, and Alternative 3 - Closure in Place with Administrative Controls. Alternative 2, Clean Closure, was chosen as the preferred CAA for all but two of the CASs (25-04-04 and 27-05-02) because Nevada Administrative Control 444.818 requires clean closure of the septic tanks involved with these CASs. Alternative 3, Closure in Place, was chosen for the final two CASs because the short-term risks of

Nuclear structure studies in the seaborgium region at SHIP

Energy Technology Data Exchange (ETDEWEB)

Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

2015-10-15

New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

International Nuclear Information System (INIS)

Burgess, P.H.; Iles, W.J.

1978-06-01

The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the appropriate Recommendations of the International Electrotechnical Commission. The radiations in the tests are, in general, selected from the range of reference radiations for instrument calibration being drawn up by the International Standards Organisation. Normally, each report deals with the capabilities and limitations of one model of instrument and no direct comparison with other instruments intended for similar purposes is made, since the significance of particular performance characteristics largely depends on the radiations and environmental conditions in which the instrument is to be used. The results quoted here have all been obtained from tests on instruments in routine production, with the appropriate measurements being made by the NRPB. This report deals with the ESI Nuclear Model 271 C; a general purpose contamination monitor, comprising a GM tube connected by a coiled extensible cable to a ratemeter

The central star candidate of the planetary nebula Sh2-71: photometric and spectroscopic variability

Science.gov (United States)

Močnik, T.; Lloyd, M.; Pollacco, D.; Street, R. A.

2015-07-01

We present the analysis of several newly obtained and archived photometric and spectroscopic data sets of the intriguing and yet poorly understood 13.5 mag central star candidate of the bipolar planetary nebula Sh2-71. Photometric observations confirmed the previously determined quasi-sinusoidal light curve with a period of 68 d and also indicated periodic sharp brightness dips, possibly eclipses, with a period of 17.2 d. In addition, the comparison between U and V light curves revealed that the 68 d brightness variations are accompanied by a variable reddening effect of ΔE(U - V) = 0.38. Spectroscopic data sets demonstrated pronounced variations in spectral profiles of Balmer, helium and singly ionized metal lines and indicated that these variations occur on a time-scale of a few days. The most accurate verification to date revealed that spectral variability is not correlated with the 68 d brightness variations. The mean radial velocity of the observed star was measured to be ˜26 km s-1 with an amplitude of ±40 km s-1. The spectral type was determined to be B8V through spectral comparison with synthetic and standard spectra. The newly proposed model for the central star candidate is a Be binary with a misaligned precessing disc.

Closure Report for Corrective Action Unit 271: Areas 25, 26, and 27 Septic Systems, Nevada Test Site, Nevada with Errata Sheet, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Mark Krauss

2004-08-01

The purpose of this CR is to document that closure activities have met the approved closure standards detailed in the NDEP-approved CAP for CAU 271. The purpose of the Errata Sheet is as follows: In Appendix G, Use Restriction (UR) Documentation, the UR form and drawing of the UR area do not reflect the correct coordinates. Since the original UR was put into place, the UR Form has been updated to include additional information that was not on the original form. This Errata Sheet replaces the original UR Form and drawing. In place of the drawing of the UR area, an aerial photograph is included which reflects the UR area and the correct coordinates for the UR area.

Comparison of referral and non-referral hypertensive disorders during pregnancy: an analysis of 271 consecutive cases at a tertiary hospital.

Science.gov (United States)

Liu, Ching-Ming; Chang, Shuenn-Dyh; Cheng, Po-Jen

2005-05-01

This retrospective cohort study analyzed the clinical manifestations in patients with preeclampsia and eclampsia, assessed the risk factors compared to the severity of hypertensive disorders on maternal and perinatal morbidity, and mortality between the referral and non-referral patients. 271 pregnant women with preeclampsia and eclampsia were assessed (1993 to 1997). Chi-square analysis was used for the comparison of categorical variables, and the comparison of the two independent variables of proportions in estimation of confidence intervals and calculated odds ratio of the referral and non-referral groups. Multivariate logistic regression was used for adjusting potential confounding risk factors. Of the 271 patients included in this study, 71 (26.2%) patients were referrals from other hospitals. Most of the 62 (87.3%) referral patients were transferred during the period 21 and 37 weeks of gestation. Univariate analysis revealed that referral patients with hypertensive disorder were significantly associated with SBP > or =180, DBP > or =105, severe preclampsia, haemolysis, elevated liver enzymes, low platelets (HELLP), emergency C/S, maternal complications, and low birth weight babies, as well as poor Apgar score. Multivariate logistic regression analyses revealed that the risk factors identified to be significantly associated with increased risk of referral patients included: diastolic blood pressure above 105 mmHg (adjusted odds ratio, 2.09; 95 percent confidence interval, 1.06 to 4.13; P = 0.034), severe preeclampsia (adjusted odds ratio, 3.46; 95 percent confidence interval, 1.76 to 6.81; P < 0.001), eclampsia (adjusted odds ratio, 2.77; 95 percent confidence interval, 0.92 to 8.35; P = 0.071), HELLP syndrome (adjusted odds ratio, 18.81; 95 percent confidence interval, 2.14 to 164.99; P = 0.008). The significant factors associated with the referral patients with hypertensive disorders were severe preeclampsia, HELLP, and eclampsia. Lack of prenatal care was

Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] in a Pregnant Thai Woman.

Science.gov (United States)

Panyasai, Sitthichai; Thongsuk, Pollawat; Pornprasert, Sakorn

2016-01-01

Hb Agenogi [β90(F6)Glu→Lys (GAG>AAG) HBB: c.271G>A)] is a very rare β-globin chain variant. We report for the first time this hemoglobinopathy in a pregnant 20-year-old Thai woman. She was seen by an obstetrician at her 14th week of gestation. She was pale and had an inflammatory lesion of her lower left leg. The hemoglobin (Hb) analysis by high performance liquid chromatography (HPLC) and low pressure liquid chromatography (LPLC) showed a peak of abnormal Hb at the C window. On capillary electrophoresis (CE), the abnormal Hb peak was observed at electrophoretic zone 4 that corresponded to the Hb E (HBB: c.79G>A) peak. Direct DNA sequencing revealed a GAG>AAG mutation at codon 90 of the β-globin gene. Thus, even though Hb Agenogi is very rare, it can be found in Thai people. The knowledge and understanding of this hemoglobinopathy will be used to assist in diagnosis, management and counseling for patients.

G:\\Potentiel 27(1)\\PMKER 27(1)\\

African Journals Online (AJOL)

AISA

Changes in the pH of solutions of incubated soil-organic waste mixtures over time. ɱ ..... and environmental aspects. Soil Biology ... externalities of intensive use of organic wastes on two tropical ... climate change and advance food security.

G:\\Potentiel 27(1)\\PMKER 27(1)\\

African Journals Online (AJOL)

AISA

alimentaires ont changé. Si la banane plantain et le manioc .... bien développée entraînant un bon drainage interne. Sur deux horizons (0 - 20 et. 20 - 40 cm), le taux d'argile passe de 10 % en surface à 25 % en profondeur. Le taux de sable ... fumure de couverture est assurée par l'apport d'urée à la dose de 100 kg/ha en ...

Characterization of endo-β-mannanase from Enterobacter ludwigii MY271 and application in pulp industry.

Science.gov (United States)

Yang, Miao; Cai, Jun; Wang, Changgao; Du, Xin; Lin, Jianguo

2017-01-01

β-Mannanases are the second most important enzymes for the hydrolysis of hemicelluloses. An endo-β-mannanase from Enterobacter ludwigii MY271 was purified at 11.7 ± 0.2-fold to homogeneity with a final recovery of 15.2 ± 0.2 %. Using purified β-mannanase protein and SDS-PAGE, the molecular mass was found to be 43.16 kDa. The optimal pH and temperature of the enzyme was found to be 7.0 and 55 °C, respectively. The β-mannanase activity was stable over a broad pH range of pH 2.0-10.0. In addition, the purified enzyme was highly activated by several metal ions and chemical reagents, such as Mg 2+ , L-cysteine, glutathione (GSH) and β-mercaptoethanol. Whereas the enzyme was strongly inhibited by Hg 2+ , Cu 2+ , N-bromosuccinimide (NBS), 1-ethyl-3-(3-dimethyl-amino-propyl)-carbodiimide (EDC), phenylmethanesulfonyl fluoride (PMSF), and sodium dodecyl sulfate (SDS). The β-mannanase was highly active towards glucomannan, and showed endo-activity by producing a mixture of oligosaccharides. Moreover, the enzyme displayed a classical endo-type mode on mannooligosaccharides. The β-mannanase coupled with xylanase significantly improved the brightness of kraft pulp, whereas it has no remarkable effect on the tensile strength of the pulp. Our functional studies of the purified β-mannanase indicate that the enzyme is beneficial to industrial applications, in particular, biotechnological processes, such as food, feed and pulp industry.

Performance Characterization of Loctite (Registered Trademark) 242 and 271 Liquid Locking Compounds (LLCs) as a Secondary Locking Feature for International Space Station (ISS) Fasteners

Science.gov (United States)

Dube, Michael J.; Gamwell, Wayne R.

2011-01-01

Several International Space Station (ISS) hardware components use Loctite (and other polymer based liquid locking compounds (LLCs)) as a means of meeting the secondary (redundant) locking feature requirement for fasteners. The primary locking method is the fastener preload, with the application of the Loctite compound which when cured is intended to resist preload reduction. The reliability of these compounds has been questioned due to a number of failures during ground testing. The ISS Program Manager requested the NASA Engineering and Safety Center (NESC) to characterize and quantify sensitivities of Loctite being used as a secondary locking feature. The findings and recommendations provided in this investigation apply to the anaerobic LLCs Loctite 242 and 271. No other anaerobic LLCs were evaluated for this investigation. This document contains the findings and recommendations of the NESC investigation

Percutaneous transluminal forceps biopsy in patients suspected of having malignant biliary obstruction: factors influencing the outcomes of 271 patients

Energy Technology Data Exchange (ETDEWEB)

Park, Jung Gu; Jung, Gyoo-Sik; Yun, Jong Hyouk [Kosin University College of Medicine, Department of Radiology, Seo-gu, Busan (Korea, Republic of); Yun, Byung Chul; Lee, Sang Uk; Han, Byung Hoon [Kosin University College of Medicine, Department of Internal Medicine, Busan (Korea, Republic of); Ko, Ji Ho [Busan Medical Center, Department of Radiology, Busan (Korea, Republic of)

2017-10-15

To evaluate predictive factors for false-negative diagnosis of percutaneous forceps biopsies in patients suspected of having a malignant biliary obstruction Two hundred seventy one consecutive patients with obstructive jaundice underwent percutaneous forceps biopsy. In each patient, three to five specimens (mean, 3.5 specimens) were collected from the lesion. The final diagnosis for each patient was confirmed with pathologic findings at surgery, additional histocytologic data, or clinical and radiologic follow-up. Univariate and multivariate logistic regression analysis was used to identify risk factors associated with false-negative diagnosis. One hundred ninety four of 271 biopsies resulted in correct diagnoses of malignancy, while 20 biopsy diagnoses were proved to be true-negative. There were 57 false-negative diagnoses and no false-positive diagnoses. The diagnostic performance of transluminal forceps biopsy in malignant biliary obstructions was as follows: sensitivity, 77.2%; specificity, 100%; and accuracy, 78.9%; positive predictive value, 100%, negative predictive value; 25.9%. Periampullary segment of common bile duct, intrahepatic bile duct and metastatic disease were the significant risk factors of false-negative diagnosis. Percutaneous forceps biopsy provides relatively high accuracy in the diagnosis of malignant biliary obstructions. The predictive factors of false-negative biopsy were determined to be biopsy site and origin of primary tumour. (orig.)

Paternity testing with VNTR DNA systems. II. Evaluation of 271 cases of disputed paternity with the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11

DEFF Research Database (Denmark)

Hansen, Hanna Elsebeth; Morling, N

1993-01-01

Paternity testing was carried out in 271 cases of disputed paternity using the 5 VNTR systems D2S44 (YNH24), D5S43 (MS8), D7S21 (MS31), D7S22 (g3), and D12S11 (MS43a), and 10-15 conventional marker systems including the HLA-A,B system. By means of the matching criteria for the VNTR systems...

Studies on some agronomic and quality characteristics of 271 induced early mutants of rice (Oryza sativa L. cv. Nizersail)

International Nuclear Information System (INIS)

Rahman, Mostafizur; Miah, A.J.; Mansur, M.A.; Kaul, A.K.

1980-01-01

Nizersail, the most popular, recommended rice variety in Bangladesh, was subjected to gamma-irradiation (10 - 25 kR) or ethyl methane sulfonate (EMS) (0.75 - 1.50%) treatments to obtain the mutants with stiff straw and early maturity. In the M 2 generation, 29 gamma-ray- and 8 EMS-induced mutants were selected mainly for short culm length and earliness. Further selections were made in the segregating M 3 and M 4 populations, and finally 400 plants with short culm length were obtained. These 400 selections were grown in M 5 lines, and 271 of these lines were analyzed for several characters. Heading time had singificantly shifted towards earliness in 40 lines. Yield per plant, 1,000-kernel weight, the length/breadth ratio of kernels, alkali spreading index value (indicator of amylose content) and dye-binding capacity (indicator of protein content) were significantly higher than those in the mother variety in 10 - 30% of the lines examined. However, no positive correlation among these characters was observed. Significant negative correlations were observed between heading time and 1,000-kernel weight, and between yield per plant and dye-binding capacity. These results suggest that the early heading plants may produce fewer tillers with bolder seeds, and that high yielding types may not simultaneously show high protein content. (Kaihara, S.)

The Role of Neurotrophin Signaling in Gliomagenesis: A Focus on the p75 Neurotrophin Receptor (p75NTR/CD271).

Science.gov (United States)

Alshehri, M M; Robbins, S M; Senger, D L

2017-01-01

The p75 neurotrophin receptor (p75 NTR , a.k.a. CD271), a transmembrane glycoprotein and a member of the tumor necrosis family (TNF) of receptors, was originally identified as a nerve growth factor receptor in the mid-1980s. While p75 NTR is recognized to have important roles during neural development, its presence in both neural and nonneural tissues clearly supports the potential to mediate a broad range of functions depending on cellular context. Using an unbiased in vivo selection paradigm for genes underlying the invasive behavior of glioma, a critical characteristic that contributes to poor clinical outcome for glioma patients, we identified p75 NTR as a central regulator of glioma invasion. Herein we review the expanding role that p75 NTR plays in glioma progression with an emphasis on how p75 NTR may contribute to the treatment refractory nature of glioma. Based on the observation that p75 NTR is expressed and functional in two critical glioma disease reservoirs, namely, the highly infiltrative cells that evade surgical resection, and the radiation- and chemotherapy-resistant brain tumor-initiating cells (also referred to as brain tumor stem cells), we propose that p75 NTR and its myriad of downstream signaling effectors represent rationale therapeutic targets for this devastating disease. Lastly, we provide the provocative hypothesis that, in addition to the well-documented cell autonomous signaling functions, the neurotrophins, and their respective receptors, contribute in a cell nonautonomous manner to drive the complex cellular and molecular composition of the brain tumor microenvironment, an environment that fuels tumorigenesis. © 2017 Elsevier Inc. All rights reserved.

Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table

International Nuclear Information System (INIS)

Hobart, David E.

2012-01-01

In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table

Energy Technology Data Exchange (ETDEWEB)

Hobart, David E. [Los Alamos National Laboratory

2012-08-17

In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

Skin-resident stem cells and wound healing.

Science.gov (United States)

Iwata, Yohei; Akamatsu, Hirohiko; Hasebe, Yuichi; Hasegawa, Seiji; Sugiura, Kazumitsu

2017-01-01

CD271 is common stem cell marker for the epidermis and dermis. We assessed a kinetic movement of epidermal and dermal CD271 + cells in the wound healing process to elucidate the possible involvement with chronic skin ulcers. Epidermal CD271 + cells were proliferated and migrated from 3 days after wounding. Purified epidermal CD271 + cells expressed higher TGFβ2 and VEGFα transcripts than CD271 - cells. Delayed wound healing was observed in the aged mice compared with young mice. During the wound healing process, the peak of dermal CD271 + cell accumulation was delayed in aged mice compared with young mice. The expression levels of collagen-1, -3, -5, F4-80, EGF, FGF2, TGFβ1, and IL-1α were significantly increased in young mice compared with aged mice. Furthermore, purified dermal CD271 + cells expressed higher FGF2, EGF, PDGFB, and TGFβ1 gene transcripts than CD271 - cells. These results suggested that epidermal and dermal CD271 + cells were closely associated with wound healing process by producing various growth factors. Epidermal and dermal CD271 + cells in chronic skin ulcer patients were significantly reduced compared with healthy controls. Thus, both epidermal and dermal stem cells can play an important role in wound healing process.

Assessment of adherence to the CONSORT statement for quality of reports on randomized controlled trial abstracts from four high-impact general medical journals.

Science.gov (United States)

Ghimire, Saurav; Kyung, Eunjung; Kang, Wonku; Kim, Eunyoung

2012-06-07

The extended Consolidated Standards of Reporting Trials (CONSORT) Statement for Abstracts was developed to improve the quality of reports of randomized controlled trials (RCTs) because readers often base their assessment of a trial solely on the abstract. To date, few data exist regarding whether it has achieved this goal. We evaluated the extent of adherence to the CONSORT for Abstract statement for quality of reports on RCT abstracts by four high-impact general medical journals. A descriptive analysis of published RCT abstracts in The New England Journal of Medicine (NEJM), The Lancet, The Journal of American Medical Association (JAMA), and the British Medical Journal (BMJ) in the year 2010 was conducted by two reviewers, independently extracting data from a MEDLINE/PubMed search. We identified 271 potential RCT abstracts meeting our inclusion criteria. More than half of the abstracts identified the study as randomized in the title (58.7%; 159/271), reported the specific objective/hypothesis (72.7%; 197/271), described participant eligibility criteria with settings for data collection (60.9%; 165/271), detailed the interventions for both groups (90.8%; 246/271), and clearly defined the primary outcome (94.8%; 257/271). However, the methodological quality domains were inadequately reported: allocation concealment (11.8%; 32/271) and details of blinding (21.0%; 57/271). Reporting the primary outcome results for each group was done in 84.1% (228/271). Almost all of the abstracts reported trial registration (99.3%; 269/271), whereas reports of funding and of harm or side effects from the interventions were found in only 47.6% (129/271) and 42.8% (116/271) of the abstracts, respectively. These findings show inconsistencies and non-adherence to the CONSORT for abstract guidelines, especially in the methodological quality domains. Improvements in the quality of RCT reports can be expected by adhering to existing standards and guidelines as expressed by the CONSORT group.

40 CFR 271.4 - Consistency.

Science.gov (United States)

2010-07-01

... waste in the State may be deemed inconsistent. (c) If the State manifest system does not meet the requirements of this part, the State program shall be deemed inconsistent. [48 FR 14248, Apr. 1, 1983; 48 FR... facilities authorized to operate under the Federal or an approved State program shall be deemed inconsistent...

40 CFR 60.271 - Definitions.

Science.gov (United States)

2010-07-01

... EAF begins to pour molten steel and ending either three minutes after steel ceases to flow from an EAF, or six minutes after steel begins to flow, whichever is longer. (i) Meltdown and refining means that... intermediate charging periods and times when power to the EAF is off. (k) Shop opacity means the arithmetic...

7 CFR 271.2 - Definitions.

Science.gov (United States)

2010-01-01

... security income (SSI) recipients, and their spouses, a public or private nonprofit establishment (eating or... gross retail sales in hot and/or cold prepared, ready-to-eat foods that are intended for immediate... and cheese, multi-ingredient soup, or frozen dinners, shall only be counted as one staple food item...

Theoretical predictions of properties and gas-phase chromatography behaviour of carbonyl complexes of group-6 elements Cr, Mo, W, and element 106, Sg.

Science.gov (United States)

Pershina, V; Anton, J

2013-05-07

Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.

Chemistry of superheavy elements

International Nuclear Information System (INIS)

Schaedel, M.

2012-01-01

The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

44_271 - 276_Dawaki et al

African Journals Online (AJOL)

user pc

2017-12-02

Dec 2, 2017 ... July-October, 2014 rainy season to estimates mean squares for general combining ability (GCA), ..... Table 2: Format of analysis of variance (ANOVA) for combining ability of maize inbred .... Genetic variability, heritability and.

Publications | Page 271 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Through books, articles, research publications, and studies, we aim to widen the ... Journal articles ... Potato farmers in the province of Carchi in northern Ecuador suffer from decreased mental capacity caused by high exposure to chemical ...

40 CFR 60.271a - Definitions.

Science.gov (United States)

2010-07-01

..., dampers, etc.) used to capture or transport particulate matter generated by an electric arc furnace or AOD... PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Steel Plants: Electric Arc Furnaces and... materials into the top of an electric arc furnace or the addition of molten steel or other materials into...

Publications | Page 271 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local ... Brendan Baker can be called many things: an engineer, an international ... Profile of IDRC's Environment and Natural Resource Management (ENRM) program area. ... Businesses in a smattering of Latin American cities now enjoy a quick and ...

12 CFR 271.3 - Published information.

Science.gov (United States)

2010-01-01

... preceding year upon all matters of policy relating to open market operations, showing the reasons underlying... information relating to open market operations of the Federal Reserve Banks is published in the Federal... Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE RULES REGARDING...

Transuranium elements: Past, present, and future

International Nuclear Information System (INIS)

Seaborg, G.T.

1995-01-01

In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

Aqueous chemistry of transactinides

International Nuclear Information System (INIS)

Schaedel, M.

2001-01-01

The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

Logical analysis of biological systems

DEFF Research Database (Denmark)

Mardare, Radu Iulian

2005-01-01

R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005.......R. Mardare, Logical analysis of biological systems. Fundamenta Informaticae, N 64:271-285, 2005....

78 FR 59752 - Notice of a Record of Decision

Science.gov (United States)

2013-09-27

... ROD may be viewed online or during regular business hours at the following locations: 1. Online at www.... Grey may be contacted during business hours at (907) 271-5453 (telephone) and (907) 271-2851 (fax), or...

Fresh water influx and particle flux variability in the Bay of Bengal

Digital Repository Service at National Institute of Oceanography (India)

Schafer, P.; Ittekkot, V.; Bartsch, M.; Nair, R.R.; Tiemann, J.

stream_size 22 stream_content_type text/plain stream_name Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt stream_source_info Particle_Flux_Ocean_Chapter_15_1996_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

Oriented stochastic data envelopment models: ranking comparison to stochastic frontier approach

Czech Academy of Sciences Publication Activity Database

Brázdik, František

-, č. 271 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : stochastic data envelopment analysis * linear programming * rice farm Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp271.pdf

Use of acoustic systems for underwater archaeology

Digital Repository Service at National Institute of Oceanography (India)

Vora, K.H.

stream_size 2 stream_content_type text/plain stream_name J_Mar_Archaeol_2_71.pdf.txt stream_source_info J_Mar_Archaeol_2_71.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

Disease: H01995 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available undborg disease (ULD), also known as progressive myoclonic epilepsy type 1 (EPM1), is an autosomal recessive...tatin B in progressive myoclonus epilepsy (EPM1) ... JOURNAL ... Science 271:1731-4 (1996) DOI:10.1126/science.271.5256.1731 ...

ESI nuclear model 271 C contamination monitor

International Nuclear Information System (INIS)

Burgess, P.H.; Iles, W.J.

1978-06-01

This instrument is a general purpose contamination monitor, comprising a GM tube connected by a coiled extensible cable to a ratemeter. The scale is marked quasi-logarithmically from 0 to 600 in 'counts per second'. The report falls under the headings: general description, facilities and controls, radiation performance, electrical characteristics, environmental characteristics, mechanical characteristics, summary of performance, conclusions. (U.K.)

38 CFR 3.271 - Computation of income.

Science.gov (United States)

2010-07-01

... period (e.g., an inheritance). Pension computations of income will include nonrecurring income for a full... amount of a person's earnings or wages before any deductions are made for such things as taxes, insurance... goods sold, or expenditures for rent, taxes, and upkeep, or costs of repairs or replacements. The value...

48 CFR 536.271 - Project labor agreements.

Science.gov (United States)

2010-10-01

... is subordinate to a national or international labor organization (42 U.S.C. 2000e(d)). Large and...) The use of a PLA is not intended to create any right or benefit, substantive or procedural enforceable... reliable source of skilled, experienced building trades workers in all crafts needed on the job site for...

Moulting and moult quality in eye-stalk ablated penaeid prawn, Metapenaeus monoceros (Fabricius)

Digital Repository Service at National Institute of Oceanography (India)

Venkitaraman, P.R.; Sivadas, P.

stream_size 3 stream_content_type text/plain stream_name 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt stream_source_info 4_Kerala_Sci_Cong_Proc_1992_271.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

Search Results | Page 672 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 6711 - 6720 of 9602 ... ... Middle East (271) Apply Middle East filter · West Indies (271) Apply .... This problem highlights the linkages between the environmental, economic, ... Health Enterprise Architecture Laboratory (HEAL) ... The health informatics researcher is the architect responsible for ensuring that they do so.

Mapping selected general literature of international nursing.

Science.gov (United States)

Shams, Marie-Lise Antoun; Dixon, Lana S

2007-01-01

This study, part of a wider project to map the literature of nursing, identifies core journals cited in non-US nursing journals and determines the extent of their coverage by indexing services. Four general English-language journals were analyzed for format types and publication dates. Core titles were identified and nine bibliographic databases were scanned for indexing coverage. Findings show that 57.5% (13,391/23,271) of the cited references from the 4 core journals were to journal articles, 27.8% (6,471/23,271) to books, 9.5% (2,208/23,271) to government documents, 4.9% (1,131/23,271) to miscellaneous sources, and less than 1% (70/23,271) to Internet resources. Eleven journals produced one-third of the citations; the next third included 146 journals, followed by a dispersion of 1,622 titles. PubMed received the best database coverage scores, followed by CINAHL and Science Citation Index. None of the databases provided complete coverage of all 11 core titles. The four source journals contain a diverse group of cited references. The currency of citations to government documents makes these journals a good source for regulatory and legislative awareness. Nurses consult nursing and biomedical journals and must search both nursing and biomedical databases to cover the literature.

Histrionicotoxin alkaloids finally detected in an ant

DEFF Research Database (Denmark)

Jones, Tappey H.; Adams, Rachelle Martha Marie; Spande, Thomas F.

2012-01-01

Workers of the ant Carebarella bicolor collected in Panama were found to have two major poison-frog alkaloids, cis- and trans-fused decahydroquinolines (DHQs) of the 269AB type, four minor 269AB isomers, two minor 269B isomers, and three isomers of DHQ 271D. For the first time in an ant, however......) sp., were found to have a very similar DHQ complex but failed to show HTXs. Several new DHQ alkaloids of MW 271 (named in the frog as 271G) are reported from the above ants that have both m/z 202 and 204 as major fragment ions, unlike the spectrum seen for the poison-frog alkaloid 271D, which has...... only an m/z 204 base peak. Found also for the first time in skin extracts from the comparison frog Oophaga granulifera of Costa Rica is a trace DHQ of MW 273. It is coded as 273F in the frog; a different isomer is found in the ant....

Eielson AFB, Alaska. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

Science.gov (United States)

1987-12-01

26/ 609 111 301 13/ 369 13O 271 1 301 281 60 j I :7T 239 259 9/ 309 1lt 271 41 299 29 309 26/ 231 26/ 311 26/ 229 261 281 29O 629 271 61 271 6 ?I I ISO ... 27001 90.9 93. 9 98.8 95.2 96.8 96.9 96.1 96.3 96.6 96.6 96.6 96.6 96.6 96.6 96.6 96.6 b E 1803o 91.1 94.2 95.1 95.8 96.6 96.6 96.8 97.0 97.2 97.2...91.9 91.6 91.6 91.6 91.9 91.9 91.9 92.0 92.0 92.0 92.0 2.0 92.0 92.0 6E 27001 67.0 92.0 92.6 92.9 93.3 93.3 93.3 93.3 93.3 93.0 93.9 91.4 93.0 93.4

Alzheimer's Disease in Social Media: Content Analysis of YouTube Videos.

Science.gov (United States)

Tang, Weizhou; Olscamp, Kate; Choi, Seul Ki; Friedman, Daniela B

2017-10-19

Approximately 5.5 million Americans are living with Alzheimer's disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Videos uploaded to YouTube from 2013 to 2015 were searched with the term "Alzheimer's disease" on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher's exact tests. Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current study highlight a potential gap between available information

Alzheimer’s Disease in Social Media: Content Analysis of YouTube Videos

Science.gov (United States)

Tang, Weizhou; Olscamp, Kate; Friedman, Daniela B

2017-01-01

Background Approximately 5.5 million Americans are living with Alzheimer’s disease (AD) in 2017. YouTube is a popular platform for disseminating health information; however, little is known about messages specifically regarding AD that are being communicated through YouTube. Objective This study aims to examine video characteristics, content, speaker characteristics, and mobilizing information (cues to action) of YouTube videos focused on AD. Methods Videos uploaded to YouTube from 2013 to 2015 were searched with the term “Alzheimer’s disease” on April 30th, 2016. Two coders viewed the videos and coded video characteristics (the date when a video was posted, Uniform Resource Locator, video length, audience engagement, format, author), content, speaker characteristics (sex, race, age), and mobilizing information. Descriptive statistics were used to examine video characteristics, content, audience engagement (number of views), speaker appearances in the video, and mobilizing information. Associations between variables were examined using Chi-square and Fisher’s exact tests. Results Among the 271 videos retrieved, 25.5% (69/271) were posted by nonprofit organizations or universities. Informal presentations comprised 25.8% (70/271) of all videos. Although AD symptoms (83/271, 30.6%), causes of AD (80/271, 29.5%), and treatment (76/271, 28.0%) were commonly addressed, quality of life of people with AD (34/271, 12.5%) had more views than those more commonly-covered content areas. Most videos featured white speakers (168/187, 89.8%) who were adults aged 20 years to their early 60s (164/187, 87.7%). Only 36.9% (100/271) of videos included mobilizing information. Videos about AD symptoms were significantly less likely to include mobilizing information compared to videos without AD symptoms (23/83, 27.7% vs 77/188, 41.0% respectively; P=.03). Conclusions This study contributes new knowledge regarding AD messages delivered through YouTube. Findings of the current

Age-related prodiabetogenic effects of transgenic resistin in spontaneously hypertensive rats

Czech Academy of Sciences Publication Activity Database

Pravenec, Michal; Zídek, Václav; Landa, Vladimír; Kazdová, L.; Kurtz, T.

2006-01-01

Roč. 23, Suppl. 4 (2006), s. 271-271 ISSN 0742-3071. [World Diabetes Congress /19./. 03.12.2006-07.12.2006, Cape Town] R&D Projects: GA ČR(CZ) GA301/06/0028 Institutional research plan: CEZ:AV0Z50110509 Keywords : resistin * autocrine effects * transgenic Subject RIV: ED - Physiology

Evaluation of acetone vapors toxicity on Plodia interpunctella (Hubner) (Lepidoptera: Pyralidae) eggs.

Science.gov (United States)

Pourmirza, Ali Asghr; Nasab, Fershteh Sadeghi; Zadeh, Abas Hossein

2007-08-01

The efficacy of acetone vapors against carefully aged eggs of Plodia interpunctella (Hubner) at 17+/-1 and 27+/-1 degrees C at different dosage levels of acetone over various exposure times was determined. Acetone was found to be toxic to Indian meal moth eggs. Considerable variation in the susceptibility of different age groups of eggs was apparent in the fiducial limits of the LD50 values. An inverse relationship between LD50 values and exposure times was observed in age groups of tested eggs. At 27+/-1 degrees C and 24 h exposure period, eggs aged 1-2 day-old were more tolerant to acetone than other age groups, followed by 0-1 day-old, 2-3 day-old and 3-4 day-old eggs. A similar pattern of susceptibility of eggs was observed at 72 h exposure. In all bioassays, eggs exposed to higher dosages of acetone developed at smaller rate. This was significant for the eggs, which were exposed to the highest dosage for 24 h. Increasing the temperature from 17+/-1 to 27+/-1 degrees C greatly increased the efficacy of acetone. At 27+/-1 degrees C eggs of P. interpunctella were killed by less than one-third of the dosage required for control at 17+/-1 degrees C. Acetone achieved 50% mortality with a dosage of 82.76 mg L(-1) in 1-2 day-old eggs at 27+/-1 degrees C. At this temperature hatching was retarded and greatly diminished when eggs aged 1-2 day-old were exposed to 80 mg L(-1) of acetone for the 24 h exposure period. There was no evidence of a hatch delay longer than the time spent under vapors for eggs exposed at 17+/-1 or 27+/-1 degrees C, indicating that some development must have occurred under fumigation.

Differences between flocculating yeast and regular industrial yeast in transcription and metabolite profiling during ethanol fermentation

Directory of Open Access Journals (Sweden)

Lili Li

2017-03-01

Full Text Available Objectives: To improve ethanolic fermentation performance of self-flocculating yeast, difference between a flocculating yeast strain and a regular industrial yeast strain was analyzed by transcriptional and metabolic approaches. Results: The number of down-regulated (industrial yeast YIC10 vs. flocculating yeast GIM2.71 and up-regulated genes were 4503 and 228, respectively. It is the economic regulation for YIC10 that non-essential genes were down-regulated, and cells put more “energy” into growth and ethanol production. Hexose transport and phosphorylation were not the limiting-steps in ethanol fermentation for GIM2.71 compared to YIC10, whereas the reaction of 1,3-disphosphoglycerate to 3-phosphoglycerate, the decarboxylation of pyruvate to acetaldehyde and its subsequent reduction to ethanol were the most limiting steps. GIM2.71 had stronger stress response than non-flocculating yeast and much more carbohydrate was distributed to other bypass, such as glycerol, acetate and trehalose synthesis. Conclusions: Differences between flocculating yeast and regular industrial yeast in transcription and metabolite profiling will provide clues for improving the fermentation performance of GIM2.71.

Immunophenotyping reveals the diversity of human dental pulp mesenchymal stromal cells in vivo and their evolution upon in vitro amplification

Directory of Open Access Journals (Sweden)

Maxime DUCRET

2016-11-01

Full Text Available Mesenchymal stromal/stem cells (MSCs from human dental pulp (DP can be expanded in vitro for cell-based and regenerative dentistry therapeutic purposes. However, their heterogeneity may be a hurdle to the achievement of reproducible and predictable therapeutic outcomes. To get a better knowledge about this heterogeneity, we designed a flow cytometric strategy to analyze the phenotype of DP cells in vivo and upon in vitro expansion with stem cell markers. We focused on the CD31- cell population to exclude endothelial and leukocytic cells. Results showed that the in vivo CD31- DP cell population contained 1.4% of CD56+, 1.5% of CD146+, 2.4% of CD271+ and 6.3% of MSCA-1+ cells but very few Stro-1+ cells (≤1%. CD56+, CD146+, CD271+ and MSCA-1+ cell subpopulations expressed various levels of these markers. CD146+MSCA-1+, CD271+MSCA-1+ and CD146+CD271+ cells were the most abundant DP-MSC populations. Analysis of DP-MSCs expanded in vitro with a medicinal manufacturing approach showed that CD146 was expressed by about 50% of CD56+, CD271+, MSCA-1+ and Stro-1+ cells, and MSCA-1 by 15-30% of CD56+, CD146+, CD271+ and Stro-1+ cells. These ratios remained stable with passages. CD271 and Stro-1 were expressed by less than 1% of the expanded cell populations. Interestingly, the percentage of CD56+ cells strongly increased from P1 (25% to P4 (80% both in all sub-populations studied. CD146+CD56+, MSCA-1+CD56+ and CD146+MSCA-1+ cells were the most abundant DP-MSCs at the end of P4. These results established that DP-MSCs constitute a heterogeneous mixture of cells in pulp tissue in vivo and in culture, and that their phenotype is modified upon in vitro expansion. Further studies are needed to determine whether co-expression of specific MSC markers confers DP cells specific properties that could be used for the regeneration of human tissues, including the dental pulp, with standardized cell-based medicinal products.

Protein Engineering and Homologous Expression of Serratia marcescens Lipase for Efficient Synthesis of a Pharmaceutically Relevant Chiral Epoxyester.

Science.gov (United States)

Chen, Ke-Cai; Zheng, Ming-Min; Pan, Jiang; Li, Chun-Xiu; Xu, Jian-He

2017-10-01

The lipase isolated from Serratia marcescens (LipA) is a useful biocatalyst for kinetic resolution of a pharmaceutically relevant epoxyester, (±)-3-(4'-methoxyphenyl) glycidic acid methyl ester [(±)-MPGM], to afford optically pure (-)-MPGM, a key intermediate for the synthesis of diltiazem hydrochloride. Two mutants, LipA L315S and LipA S271F , were identified from the combinatorial saturation mutation library of 14 amino acid residues lining the substrate-binding pocket. LipA L315S , LipA S271F , and their combination LipA L315S/S271F showed 2.6-, 2.2-, and 4.6-fold improvements in their specific activities towards para-nitrophenyl butyrate (pNPB), respectively. Among these positive mutants, LipA S271F displayed a 3.5-fold higher specific activity towards the pharmaco substrate (±)-MPGM. Kinetic study showed that the improvement in catalytic efficiency of LipA S271F against (±)-MPGM was mainly resulted from the enhanced affinity between substrate and enzyme, as indicated by the decrease of K m . Furthermore, to address the insoluble expression issue in Escherichia coli, the homologous expression of LipA gene in S. marcescens was achieved by introducing it into an expression vector pUC18, resulting in ca. 20-fold higher lipase production. The significantly improved volumeric production and specific activity of S. marcescens lipase make it very attractive as a new-generation biocatalyst for more efficient and economical manufacturing of (-)-MPGM.

27 CFR 46.271 - Entry, examination and testimony.

Science.gov (United States)

2010-04-01

... are open. Appropriate TTB officers may audit and examine all articles, inventory records, books.... Appropriate TTB officers, in performing official duties, may enter any premises to examine articles subject to...

48 CFR 1352.271-79 - Liability and insurance.

Science.gov (United States)

2010-10-01

... Insurance (APR 2010) (a) The contractor shall exercise reasonable care and use its best efforts to prevent accidents, injury or damage to all employees, persons and property, in and about the work, and to the vessel... at the plant or elsewhere, arising or growing out of the performance of the work, except where the...

48 CFR 719.271-3 - USAID contracting officers.

Science.gov (United States)

2010-10-01

... components of end items or services be purchased separately so small firms may compete; (f) Making a... procurement process which may prevent small business participation in the competitive process are modified to... final decision on a proposed non-competitive procurement action, and as part of his/her findings and...

Translations on Narcotics and Dangerous Drugs No. 271

Science.gov (United States)

1976-11-11

Worth 25,000 Kyats Seized in Rangoon (MYANMA ALIN, 18 Oct 76) 10 Marihuana Burned in Okto (MYANMA ALIN, 2 Oct 76) 11 MALAYSIA American... Marihuana , Cocaine Pushers, Addicts Arrested (EL TIEMPO, 23 Sep 76) 29 Briefs Drug Ring Smashed 31 Drug Hauls and Arrests 31 Drug Traffickers Arrested...lead of the Labor Governments in New South Wales and South Australia in moves to legalise marihuana ," he said. A submission by the Australian

7 CFR 271.1 - General purpose and scope.

Science.gov (United States)

2010-01-01

... agricultural economy, as well as result in more orderly marketing and distribution of foods. To alleviate such... households to obtain a more nutritious diet through normal channels of trade by increasing food purchasing...

48 CFR 1352.271-81 - Discharge of liens.

Science.gov (United States)

2010-10-01

...) The contractor shall immediately discharge or cause to be discharged any lien or right in rem of any... done or materials furnished under the contract. If any such lien or right in rem is not immediately discharged, the Government may discharge or cause to be discharged such lien or right at the expense of the...

Dicty_cDB: VHE271 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available -21 (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 3e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

Dicty_cDB: SHL271 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available *tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kds...*stfkeflyhrtclglkl hrsydq**r*tl*eiksnrc*sfiih**wlcnwfglylkiirsk*rfrfsslvrsysiem *n*skenvg*skckryqrgsksfsn*kd

Chemistry of the superheavy elements.

Science.gov (United States)

Schädel, Matthias

2015-03-13

The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

An Overview of Production Systems

Science.gov (United States)

1975-10-01

DISTRIBUTED BY: Matonal Tochnica! Infonu srice U. S. DEPARTMENT OF COMMERCE 028143 Stanford Artificil Inteligence Laboratory October 1975 Memo AIM-271...ORGANIZATION NAMEL AND ADDRESS 18. PROGRAM ELEMENT. PROJECT. TASK Artificial Intelligence Laboratory AE OKUI UBR Stanford University ARPA Order 249...014-64011I j SEC-jRITY CLASSIFICATION OF THIS PAGE (When, Data bHISP011 A Stanford Artificial ktteligncs Laboratory October 1975 Memo AIM-271 Computer

Long-term trends in the ionosphere and upper atmosphere parameters

Czech Academy of Sciences Publication Activity Database

Bremer, J.; Alfonsi, L.; Pal, B.; Laštovička, Jan; Mikhailov, A. V.; Rogers, N.

47 /suppl./, 2/3 (2004), s. 1009-1029 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : long-term trends * ionosphere * upper atmosphere Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

A questionnaire study about gonadal shield use of urologists

OpenAIRE

Ahmet Ali Sancaktutar; Tevfik Ziypak; Şenol Adanur; Haluk Söylemez; Cihat Hamidi; Yaşar Bozkurt; Murat Atar; Mehmet Nuri Bodakçi

2012-01-01

Objectives: Our aim is to reflect routines, awareness,and consciousness level of urologists about usage of gonadalshield (GS) in Turkey.Materials and methods: Because of this objective aquestionnaire which includes 15 questions was prepared.The questionnaire was delivered to urologists in a TurkishUrology congress. Data derived from 271 urologists byface to face interview were evaluated.Results: Participant were urologists (n=271), consistedof professors (n=33), associate professors (n= 36), ...

Ürologların gonad kalkanı kullanımı hakkında bir anket çalışması

OpenAIRE

Sancaktutar, Ahmet Ali; Ziypak, Tevfik; Adanur, Şenol; Söylemez, Haluk; Hamidi, Cihat; Bozkurt, Yaşar; Atar, Murat; Bodakçi, Mehmet Nuri

2015-01-01

Objectives: Our aim is to reflect routines, awareness, and consciousness level of urologists about usage of gonadal shield (GS) in Turkey. Materials and methods: Because of this objective a questionnaire which includes 15 questions was prepared. The questionnaire was delivered to urologists in a Turkish Urology congress. Data derived from 271 urologists by face to face interview were evaluated. Results: Participant were urologists (n=271), consisted of professors (n=33), associate profe...

Carboxylesterase-mediated insecticide resistance: Quantitative increase induces broader metabolic resistance than qualitative change.

Science.gov (United States)

Cui, Feng; Li, Mei-Xia; Chang, Hai-Jing; Mao, Yun; Zhang, Han-Ying; Lu, Li-Xia; Yan, Shuai-Guo; Lang, Ming-Lin; Liu, Li; Qiao, Chuan-Ling

2015-06-01

Carboxylesterases are mainly involved in the mediation of metabolic resistance of many insects to organophosphate (OP) insecticides. Carboxylesterases underwent two divergent evolutionary events: (1) quantitative mechanism characterized by the overproduction of carboxylesterase protein; and (2) qualitative mechanism caused by changes in enzymatic properties because of mutation from glycine/alanine to aspartate at the 151 site (G/A151D) or from tryptophan to leucine at the 271 site (W271L), following the numbering of Drosophila melanogaster AChE. Qualitative mechanism has been observed in few species. However, whether this carboxylesterase mutation mechanism is prevalent in insects remains unclear. In this study, wild-type, G/A151D and W271L mutant carboxylesterases from Culex pipiens and Aphis gossypii were subjected to germline transformation and then transferred to D. melanogaster. These germlines were ubiquitously expressed as induced by tub-Gal4. In carboxylesterase activity assay, the introduced mutant carboxylesterase did not enhance the overall carboxylesterase activity of flies. This result indicated that G/A151D or W271L mutation disrupted the original activities of the enzyme. Less than 1.5-fold OP resistance was only observed in flies expressing A. gossypii mutant carboxylesterases compared with those expressing A. gossypii wild-type carboxylesterase. However, transgenic flies universally showed low resistance to OP insecticides compared with non-transgenic flies. The flies expressing A. gossypii W271L mutant esterase exhibited 1.5-fold resistance to deltamethrin, a pyrethroid insecticide compared with non-transgenic flies. The present transgenic Drosophila system potentially showed that a quantitative increase in carboxylesterases induced broader resistance of insects to insecticides than a qualitative change. Copyright © 2014 Elsevier Inc. All rights reserved.

Worldwide Report, Telecommunications Policy, Research and Development, No. 271

Science.gov (United States)

1983-05-17

and not as educational or cultural instru- ments is the fact that the director of Radio Educacion is now appointed by the Govern- ment Secretariat...Journalists, Froyland Rascon of Radio Educacion , Jose Alvarez Icaza of Cencos [National Mass Media Center]; Leopoldo de Gyves, the mayor of Juchitan...board, especially for the new television station. Programmes of a political nature would also take up air-time but if South Africa objected to

BKR 27(1) pp. 39-43 (Ibrahim et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... Pharmacy Practice, University Of Ilorin Nigeria. 3Department of Pharmacognosy and ... one generation to the other verbally, however in the 21st century there is need that such knowledge must be evaluated and documented ...

BKR 27(1) pp. xx-xx (Dick et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... Antibiotic sensitivity profiles of the bacteria (Escherichia coli, Vibrio sp. and Salmonella sp.) ..... of Vibrio parahaemolyticus isolated from cockles in Padang, ... potentially pathogenic Halophilic Vibrios isolated from seafood.

BKR 27(1) pp. 22-25 (Ufelle et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... Groups A to D were administered orally with graded-doses of crude methanolic extract ... macrophylla (Ugba in Igbo language) is consumed by an estimated 15 ... herbal remedy may lead to either bone marrow stimulation for.

BKR 27(1) pp. 44-49 (Achuba et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... ... hydrocarbon petroleum products. (gasoline and kerosene) were evaluated in this study. ..... Journal of Nutrition 23: 581. Ita, S. O. and Udofia,A.U. (2011) Comparative study of some. Haematological Parameters in Rat following ingestion of crude oil. (Nigeria Bonny Light), gasoline, kerosene and diesel.

40 CFR 52.271 - Malfunction, startup, and shutdown regulations.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Malfunction, startup, and shutdown..., startup, and shutdown regulations. (a) The following regulations are disapproved because they would permit... malfunctions and/or fail to sufficiently limit startup and shutdown exemptions to those periods where it is...

BKR 27(1) pp. 33-38 (Egwim et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... polymers via simple sugars to biofuels like ethanol, butanol, or biodiesel, or to chemicals ... such as pyrolysis (thermolysis), chemical oxidation, hydrogenolysis ..... Review of Thermochemical Methods.Chem Engin Technol ...

BKR 27(1) pp. 8-13 (Falodun et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... importance after tomatoes among the vegetables in Nigeria. Aliyu et al., (2008) ... due to low organic matter content (Amans et al., 1996). The rain forest ... the effects of fertilizer application and spacing on onion performance ...

BKR 27(1) pp. 1-7 (Akinloye et al)

African Journals Online (AJOL)

Femi J. Olorunniji

2015-03-31

Mar 31, 2015 ... ozone used as disinfectant in drinking water, because ozonation of ..... The micronuclei assay is developed for detection of in vivo chromosomal ... cell integrity accompanied by leakage of cellular content from the damaged ...

All projects related to | Page 271 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Topic: SCIENCE AND TECHNOLOGY POLICY, INNOVATIONS, COMMUNICATION TECHNOLOGY, POVERTY MITIGATION, SOCIAL INEQUALITY, COOPERATION BETWEEN ORGANIZATIONS. Region: Brazil, South America, China, Far East Asia, India, Uruguay, South Africa, South of Sahara, North and Central America, ...

Beryllium doped p-type GaN grown by metal-organic chemical vapor depostion

International Nuclear Information System (INIS)

Al-Tahtamouni, T.M.; Sedhain, A.; Lin, J.Y.; Jiang, H.X.

2010-01-01

The authors report on the growth of Be-doped p-type GaN epilayers by metal-organic chmical vapor deposition (MOCVD). The electrical and optical properties of the Be-doped GaN epilayers were studied by Hall-effect measurements and photoluminescence (PL) spectroscopy. The PL spectra of Be-doped GaN epilayers ethibited two emission lines at 3.36 and 2.71 eV, which were obsent in undoped epilayers. The transition at 3.36 eV was at 3.36 and 2.71eV, which were absent in undoped epilayers. The transition at 3.36 eV was assigned to the transition of free electrons to the neutral Be acceptor Be d eg.. The transition at 2.71 eV was assigned to the transition of electrons bound to deep level donors to the Be d eg. acceptors. Three independent measurements: (a) resistivity vs. temperature, (b) PL peak positions between Be doped and undoped GaN and (c) activation energy of 2.71 eV transition all indicate that the Be energy level is between 120 and 140 meV above the valence band. This is about 20-40 meV shallower than the Mg energy level (160 meV) in GaN. It is thus concluded that Be could be an excellent acceptor dopant in nitride materials. (authors).

Superheavy element chemistry. Achievements and perspectives

International Nuclear Information System (INIS)

Schaedel, M.

2007-01-01

Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

Behaviour of the F1-region, and Es and spread-F phenomena at European middle latitudes

Czech Academy of Sciences Publication Activity Database

Pal, B.; Burešová, Dalia; Laštovička, Jan; Marcz, F.

2004-01-01

Roč. 47, 2/3 (2004), s. 1131-1143 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA AV ČR IAA3042102; GA MŠk OC 271.10 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere-radio propagation * F1 region * ionospheric irregularities Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

Planetary and gravity wave signatures in the F region ionosphere with impact on radio propagation predictions and variability

Czech Academy of Sciences Publication Activity Database

Altadill, D.; Apostolov, E. M.; Boška, Josef; Laštovička, Jan; Šauli, Petra

2004-01-01

Roč. 47, 2/3 (2004), s. 1109-1119 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA ČR GA205/01/1071; GA ČR GP205/02/P077 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionosphere * planetary waves * gravity waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004

Ionospheric effects on terrestrial communications: Working Group 3 overview

Czech Academy of Sciences Publication Activity Database

Laštovička, Jan; Bourdillon, A.

2004-01-01

Roč. 47, 2/3 (2004), s. 1269-1277 ISSN 1593-5213. [Final Meeting COST271 Action. Effects of the upper atmosphere on terrestrial and Earth-space communications (EACOS). Abingdon, 26.08.2004-27.08.2004] R&D Projects: GA MŠk OC 271.10; GA AV ČR IBS3012007 Institutional research plan: CEZ:AV0Z3042911 Keywords : ionospheric reflection * telecommunications * gravity waves * planetary waves Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.413, year: 2004 http://www.annalsofgeophysics.eu/index.php/annals/article/view/3299/3345

Active site of Zn2+-dependent sn-glycerol-1-phosphate dehydrogenase from Aeropyrum pernix K1

Directory of Open Access Journals (Sweden)

Jin-Suk Han

2005-01-01

Full Text Available The enzyme sn-glycerol-1-phosphate dehydrogenase (Gro1PDH, EC 1.1.1.261 is key to the formation of the enantiomeric configuration of the glycerophosphate backbone (sn-glycerol-1-phosphate of archaeal ether lipids. This enzyme catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate. To date, no information about the active site and catalytic mechanism of this enzyme has been reported. Using the sequence and structural information for glycerol dehydrogenase, we constructed six mutants (D144N, D144A, D191N, H271A, H287A and D191N/H271A of Gro1PDH from Aeropyrum pernix K1 and examined their characteristics to clarify the active site of this enzyme. The enzyme was found to be a zinc-dependent metalloenzyme, containing one zinc ion for every monomer protein that was essential for activity. Site-directed mutagenesis of D144 increased the activity of the enzyme. Mutants D144N and D144A exhibited low affinity for the substrates and higher activity than the wild type, but their affinity for the zinc ion was the same as that of the wild type. Mutants D191N, H271A and H287A had a low affinity for the zinc ion and a low activity compared with the wild type. The double mutation, D191N/ H271A, had no enzyme activity and bound no zinc. From these results, it was clarified that residues D191, H271 and H287 participate in the catalytic activity of the enzyme by binding the zinc ion, and that D144 has an effect on substrate binding. The structure of the active site of Gro1PDH from A. pernix K1 seems to be similar to that of glycerol dehydrogenase, despite the differences in substrate specificity and biological role.

ORF Alignment: NT_033777 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available AGPDAPGNQGLKDQVLALKWVRDNIAAFGGDPNQVTIFGESAGASSVQLLLLSSQAKGLF 210 ... Query: 241 TITAEDQRNNIGLPFVPV...VEGYWNQDSQEEQFYEEPFLTQHPSDMYHSQNFNSDVAYMTG 300 ... TITAEDQRNNIGLPFVPVVEGYWNQDSQEEQFYEE...PFLTQHPSDMYHSQNFNSDVAYMTG Sbjct: 271 TITAEDQRNNIGLPFVPVVEGYWNQDSQEEQFYEEPFLTQHPSDMYHSQNFNSDVAYMTG 330 ... Query

A single site for N-linked glycosylation in the envelope glycoprotein of feline immunodeficiency virus modulates the virus-receptor interaction

Directory of Open Access Journals (Sweden)

Samman Ayman

2008-08-01

Full Text Available Abstract Feline immunodeficiency virus (FIV targets helper T cells by attachment of the envelope glycoprotein (Env to CD134, a subsequent interaction with CXCR4 then facilitating the process of viral entry. As the CXCR4 binding site is not exposed until CD134-binding has occurred then the virus is protected from neutralising antibodies targeting the CXCR4-binding site on Env. Prototypic FIV vaccines based on the FL4 strain of FIV contain a cell culture-adapted strain of FIV Petaluma, a CD134-independent strain of FIV that interacts directly with CXCR4. In addition to a characteristic increase in charge in the V3 loop homologue of FIVFL4, we identified two mutations in potential sites for N-linked glycosylation in the region of FIV Env analogous to the V1–V2 region of HIV and SIV Env, T271I and N342Y. When these mutations were introduced into the primary GL8 and CPG41 strains of FIV, the T271I mutation was found to alter the nature of the virus-CD134 interaction; primary viruses carrying the T271I mutation no longer required determinants in cysteine-rich domain (CRD 2 of CD134 for viral entry. The T271I mutation did not confer CD134-independent infection upon GL8 or CPG41, nor did it increase the affinity of the CXCR4 interaction, suggesting that the principal effect was targeted at reducing the complexity of the Env-CD134 interaction.

ORF Alignment: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available QSMPYHVDHTTGLIDYDNLQVLAKAFRPKVIVAGT Sbjct: 121 PDGGHLSHGYQLKSGTPISFISKYFQSMPYHVDHTTGLIDYDNLQVLAKAFRPKVIVAGT 180 ... Query: 271 RGAMIF...FRKGIKSVTKKGKEIPYELEKKINFSVFPGHQGGPHNHTIGAMAVALKQAMSPE 330 ... RGAMIFFRKGIKSVTK...KGKEIPYELEKKINFSVFPGHQGGPHNHTIGAMAVALKQAMSPE Sbjct: 241 RGAMIFFRKGIKSVTKKGKEIPYEL

77 FR 271 - Privacy Act of 1974; System of Records

Science.gov (United States)

2012-01-04

... Liaison Officer, Department of Defense. HDTRA 007 System name: Security Services (December 4, 2009, 74 FR... manager.'' * * * * * HDTRA 007 System name: Security Services. System location(s): Primary location... date; badge number; vehicle ID and decal number; special intelligence access; expiration date, agency...

IAEA Newsbriefs. V. 11, no. 2(71). Apr-May 1996

International Nuclear Information System (INIS)

1996-01-01

This issue gives brief information on the following topics: Chernobyl Conference sums up Scientific Understanding, International Forum on the Safety of RBMK Reactors, IAEA Board of Governors, Radiological Study of the Mururoa and Fangataufa Atolls, Safeguards Support, Workshop on Modelling Methods for Water Systems, Uranium Market Trends, Security Council Resolution on Iraq, South East Asian NWFZ, Radioactive Waste Management, Nuclear Seminar in Poland, and other short information

26 CFR 1.271-1 - Debts owed by political parties.

Science.gov (United States)

2010-04-01

... has been active in the party no bad debt deduction will be allowed with respect to the loan. (b...), no deduction shall be allowed under section 166 (relating to bad debts) or section 165(g) (relating... appears that the bad debt was incurred to or purchased by, or the worthless security was acquired by, the...

Book Review: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War

DEFF Research Database (Denmark)

Taudal Poulsen, René

2016-01-01

Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk).......Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk)....

Substratos alternativos ao xaxim na produção de bromélia ornamental Alternative substrates to fern tree fiber in the production of ornamental bromeliad

Directory of Open Access Journals (Sweden)

Shoey Kanashiro

2008-10-01

Full Text Available O objetivo deste trabalho foi avaliar substratos alternativos para o cultivo da bromélia Aechmea fasciata (Lindley Baker, para substituir com eficiência as misturas formuladas com o xaxim Dicksonia sellowiana (Presl. Hook. Foram testados os substratos: casca de Pinus, casca de Eucalyptus, coxim, fibra de coco e xaxim, misturados com turfa e perlita, nas proporções 2:7:1, 5:4:1 e 8:1:1. O experimento foi realizado em condições de estufa com cobertura de polietileno, sombreada com tela a 70%. As bromélias foram cultivadas durante 435 dias, até o início do florescimento - estádio de comercialização. As variáveis analisadas foram as massas de matéria seca de: folhas, raiz, inflorescência, escapo floral e caule; além da massa de matéria seca total e a qualidade comercial. Os substratos formulados com xaxim ou casca de Pinus, nas proporções 2:7:1, 5:4:1 e 8:1:1, e com casca de Eucalyptus, fibra de coco ou coxim, na proporção 2:7:1, foram as misturas que apresentaram os melhores resultados. Os substratos formulados com casca de Eucalyptus, fibra de coco ou coxim, com 10% de turfa e 10% de perlita, na proporção 8:1:1, apresentaram os piores resultados.The objective of this study was to evaluate alternative substrates for the cultivation of the bromeliad Aechmea fasciata (Lindley Baker, to substitute the formulated mixtures with fern tree fiber from Dicksonia sellowiana (Presl. Hook. Tested substrates were: Pinus bark, Eucalyptus bark, coxim (made of coconut fiber, coir or fern tree fiber, mixed with peat and perlite, in the proportions 2:7:1, 5:4:1 and 8:1:1. The experiment was conducted in a greenhouse covered with polyethylene and shaded with shade cloth 70%. The bromeliads were cultivated during 435 days, until the beginning of the flowering, when they were suitable for commercialization. The evaluated parameters were dry masses of leaf, root, inflorescence, floral scape, and stem, besides total dry mass and the commercial

Structural analysis of an HLA-B27 functional variant, B27d detected in American blacks

International Nuclear Information System (INIS)

Rojo, S.; Aparicio, P.; Hansen, J.A.; Choo, S.Y.; Lopez de Castro, J.A.

1987-01-01

The structure of a new functional variant B27d has been established by comparative peptide mapping and radiochemical sequencing. This analysis complete the structural characterization of the six know histocompatibility leukocyte antigen (HLA)-B27 subtypes. The only detected amino acid change between the main HLA-B27.1 subtype and B27d is that of Try 59 to His 59 . Position 59 has not been previously found to vary among class I HLA or H-2 antigens. Such substitution accounts for the reported isoelectric focusing pattern of this variant. HLA-B27d is the only B27 variant found to differ from other subtypes by a single amino acid replacement. The nature of the change is compatible with its origin by a point mutation from HLB-B27.1. Because B27d was found only American blacks and in no other ethnic groups, it is suggested that this variant originated as a result of a mutation of the B27.1 gene that occurred within the black population. Structural analysis of B27d was done by comparative mapping. Radiochemical sequencing was carried out with 14 C-labeled and 3 H-labeled amino acids

ORF Alignment: NC_004668 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s ... faecalis V583] ... Length = 156 ... Query: 151 NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKS...SLRMAAPSSMRLSVLG 210 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMA...APSSMRLSVLG Sbjct: 1 ... NIVNTRIDERLIHGQVAGIWSTSLSTQRIIVANDEAATDPLQKSSLRMAAPSSMRLSVLG 60 ... Query: 271 VLPEEEQIF

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available reonine protein kinase KKIALRE (EC 2.7.1.-) ... [Cryptosporidium hominis] ... Length = 361 ... Query: 10 ... LNRYKTICE...IGEGAFGVVFKCMDLVTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN 69 ... LNRYKTICEIGEGAFGVVFKCMDL...VTNEIVALKEFKTIYSDENENSYVTKNSANGKVNTN Sbjct: 1 ... LNRYKTICEIGEGAFGVVFKCMDLVTNEIVALK

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LKNKTALITGGNGGIGLATAKLFVAEGAKVVITGRNKETLAAAAKELGPNALAVVADAT 60 ... Query: 146 LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMA...SELSPRGIRVNVVAPGA 205 ... LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMASELSPRGIRVNVVAPGA Sbjc...t: 121 LPHLNDNASIILNGSVISVLGIPGYSAYGAAKAGVRAMARIMASELSPRGIRVNVVAPGA 180 ... Query: 266 DGGAVA 271 ... DGGAVA Sbjct: 241 DGGAVA 246

Variability of blood pressure and blood glucose during perioperative period for patients with secondary neovascular glaucoma after silicone oil removed in PDR

Directory of Open Access Journals (Sweden)

Fu-Lin Gao

2015-06-01

Full Text Available AIM:To research blood pressure and blood glucose variability during peroperative period for patients with secondary neovasular glaucoma(NVGafter silicone oil removed in proliferative diabetic retinaopathy(PDR.METHODS: Totally, 271 patients(271 eyesundergone surgery of vitrectomy and silicon-oil tamponade combined with cataract were respective analyzed. Fourteen patients(14 eyeswith secondary NVG after silicon oil removed and randomly controlled group of no NVG according with ages, operation method in the same time were studied. The blood pressure and blood glucose variability during peroperative period was analyzed, and did comparison after excluded contralateral eye. The complications of 271 patients were surveyed in following-up period 1～12mo. The incidence of NVG, the time, blood pressure, blood glucose and glycated hemoglobin(Hbc%variability during peroperative period was statisticed and compared by software of SPSS 11.0.RESULTS: Fourteen eyes(5.2%of 271 cases was with secondary NVG(female: 4 eyes, 28.6%; male: 10 eyes, 71.4%, average ages was 57.07 years(49～68 years. NVG presented in the 107～ 135d after vitrectomy and 7～45d(average 31.78dafter silicon-oil removed. Diabetes mellitus was 10～15(average 13.2a. In NVG group, the variability of blood glucose was 4.0～10.2mmol/L(mean 8.52±3.24mmol/L, variable coefficient was 0.48. In NNVG group, the variability of blood glucose was 5.0～8.2mmol/L(mean 7.22±0.24mmol/L, variable coefficient was 0.43. It was significantly difference in comparison in variable coefficient(PPPPCONCLUSION: There are significant variability on fasting blood glucose, daytime SBP and night DBP during perioperative in PDR patients with secondary NVG. It might be occurred 1wk after silicone oil removal surgery.

Molecular cloning and biological characterization of the human excision repair gene ERCC-3

International Nuclear Information System (INIS)

Weeda, G.; van Ham, R.C.; Masurel, R.; Westerveld, A.; Odijk, H.; de Wit, J.; Bootsma, D.; van der Eb, A.J.; Hoeijmakers, J.H.

1990-01-01

In this report we present the cloning, partial characterization, and preliminary studies of the biological activity of a human gene, designated ERCC-3, involved in early steps of the nucleotide excision repair pathway. The gene was cloned after genomic DNA transfection of human (HeLa) chromosomal DNA together with dominant marker pSV3gptH to the UV-sensitive, incision-defective Chinese hamster ovary (CHO) mutant 27-1. This mutant belongs to complementation group 3 of repair-deficient rodent mutants. After selection of UV-resistant primary and secondary 27-1 transformants, human sequences associated with the induced UV resistance were rescued in cosmids from the DNA of a secondary transformant by using a linked dominant marker copy and human repetitive DNA as probes. From coinheritance analysis of the ERCC-3 region in independent transformants, we deduce that the gene has a size of 35 to 45 kilobases, of which one essential segment has so far been refractory to cloning. Conserved unique human sequences hybridizing to a 3.0-kilobase mRNA were used to isolate apparently full-length cDNA clones. Upon transfection to 27-1 cells, the ERCC-3 cDNA, inserted in a mammalian expression vector, induced specific and (virtually) complete correction of the UV sensitivity and unscheduled DNA synthesis of mutants of complementation group 3 with very high efficiency. Mutant 27-1 is, unlike other mutants of complementation group 3, also very sensitive toward small alkylating agents. This unique property of the mutant is not corrected by introduction of the ERCC-3 cDNA, indicating that it may be caused by an independent second mutation in another repair function. By hybridization to DNA of a human x rodent hybrid cell panel, the ERCC-3 gene was assigned to chromosome 2, in agreement with data based on cell fusion

76 FR 4686 - Product Cancellation Order for Certain Pesticide Registrations

Science.gov (United States)

2011-01-26

.... 004822-00533 Raid Reach & Kill Tetramethrin Outdoor Ant & Roach Permethrin. Killer. 008112-00001 Lion.... Tetramethrin Permethrin. 004822-00271 271 Raid Tetramethrin Roach & Ant Killer Permethrin. and Treatment...

Sud du Sahara | Page 271 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

Instrument evaluation no. 11. ESI nuclear model 271 C contamination monitor

CERN Document Server

Burgess, P H

1978-01-01

The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to he carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the a...

: tous les projets | Page 271 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Date de début : 1 mars 2011. End Date: 1 mars 2016. Région: North and Central America, South America, Brazil, Chile, Colombia, Canada. Financement total : CA$ 2,500,000.00. Changements climatiques et santé des autochtones. Projet. Les populations autochtones figurent parmi celles qui sont les plus touchées par les ...

People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

Energy Technology Data Exchange (ETDEWEB)

Anon.

1987-01-15

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September.

People and things. CERN Courier, Jan-Feb 1987, v. 27(1)

International Nuclear Information System (INIS)

Anon.

1987-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The search goes on for gravitational radiation, the existence of such waves was implied by the first formulations of general relativity some sixty years ago, but their detection has taxed the ingenuity of experimenters. Any signals would be easily screened by seismic noise, etc. In an effort to eliminate this background, a network of three highly sensitive cryogenic detectors was set up – one at CERN, used by a Rome group, another at Stanford and a third at Louisiana State. The 1987 JINR-CERN School of Physics is the tenth in a series organized by the Joint Institute for Nuclear Research (JINR, Dubna, USSR) and CERN. The aim is to teach various aspects of high energy physics, especially theoretical, to young experimentalists with at least one year's research experience, coming mainly from Member States of JINR and CERN. The fourth workshop to discuss physics at CERN's LEAR Low Energy Antiproton Ring will be held at Villars-sur-Ollon, Switzerland, from 6-13 September

40 CFR 271.23 - Procedures for withdrawing approval of State programs.

Science.gov (United States)

2010-07-01

... number/gender); (ii) Section 22.04(c)—(authorities of Presiding Officer); (iii) Section 22.06—(filing... by making an oral or written statement of his/her position on the issues within such limits and on... Presiding Officer's recommended decision, the Administrator shall review the record before him and issue his...

48 CFR 1352.271-72 - Additional Item Requirements (AIR)-growth work

Science.gov (United States)

2010-10-01

... direct material purchases and subcontractor handling. The estimated quantity of labor hours and handling... performance period. All growth work shall be paid at the prices stated in the Schedule. (b) The contractor... Government's intention to award any growth work identified during the repair to the contractor, if a fair and...

271 Dislodging the “University of Nkwo Nnewi” through Open and ...

African Journals Online (AJOL)

First Lady

2013-01-28

Jan 28, 2013 ... face more problems in business than their forebears because information ... but there is need advocacy campaigns through town unions, market ..... therefore produces new breed managers who understand the emerging.

48 CFR 1352.271-70 - Inspection and manner of doing work.

Science.gov (United States)

2010-10-01

... and test at all times during the contractor's performance of the work to determine their quality and... application, filler material type, position of welding, and welding process involved in the work being... necessary as required by good marine practice or by current Occupational Safety and Health Administration...

S. A{r. Tldskr. Veek. 4, 271-274 (1974) NWTSTE ONTWIKKELINGE ...

African Journals Online (AJOL)

teen 'n toonemende tempo geihtensifiseer en ook in die voerkrale kan mineraalversorgingen mineraalmetabolisme ... vulling teen 150 mg 7-nldag by die didte van norrnale jmg mans, die tempo van wondgenesing ... knowns in zinc nutrition, especially with ruminants, than there are established facts. Ttre fact that a severe ...

CD146 expression on primary nonhematopoietic bone marrow stem cells is correlated with in situ localization

Science.gov (United States)

Tormin, Ariane; Li, Ou; Brune, Jan Claas; Walsh, Stuart; Schütz, Birgit; Ehinger, Mats; Ditzel, Nicholas; Kassem, Moustapha

2011-01-01

Nonhematopoietic bone marrow mesenchymal stem cells (BM-MSCs) are of central importance for bone marrow stroma and the hematopoietic environment. However, the exact phenotype and anatomical distribution of specified MSC populations in the marrow are unknown. We characterized the phenotype of primary human BM-MSCs and found that all assayable colony-forming units-fibroblast (CFU-Fs) were highly and exclusively enriched not only in the lin−/CD271+/CD45−/CD146+ stem-cell fraction, but also in lin−/CD271+/CD45−/CD146−/low cells. Both populations, regardless of CD146 expression, shared a similar phenotype and genotype, gave rise to typical cultured stromal cells, and formed bone and hematopoietic stroma in vivo. Interestingly, CD146 was up-regulated in normoxia and down-regulated in hypoxia. This was correlated with in situ localization differences, with CD146 coexpressing reticular cells located in perivascular regions, whereas bone-lining MSCs expressed CD271 alone. In both regions, CD34+ hematopoietic stem/progenitor cells were located in close proximity to MSCs. These novel findings show that the expression of CD146 differentiates between perivascular versus endosteal localization of non-hematopoietic BM-MSC populations, which may be useful for the study of the hematopoietic environment. PMID:21415267

Nuclear Science Division 1994 annual report

International Nuclear Information System (INIS)

Myers, W.D.

1995-06-01

This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium

Nuclear Science Division 1994 annual report

Energy Technology Data Exchange (ETDEWEB)

Myers, W.D. [ed.

1995-06-01

This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.

Neurological and Neurophysiological Findings in Workers with Chronic 2,3,7,8-Tetrachlorodibenzo-p-Dioxin Intoxication 50 Years After Exposure

Czech Academy of Sciences Publication Activity Database

Pelclová, D.; Urban, P.; Fenclová, Z.; Vlčková, Š.; Ridzoň, P.; Kupka, K.; Mecková, Z.; Bezdíček, O.; Navrátil, Tomáš; Rosmus, J.; Zakharov, S.

Č. 122 (2), s. 271-277 ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : neurological findings * intoxication * TCDD Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8494 ... ... DETERMINANTS OF HEALTH HEALTH HUMAN RESOURCES ... Perspectives ... of senior and middle-management positions are held by women. ... urban violence reduction theories, strategies, and interventions.

Prevalence of hepatitis B and C and relationship to liver damage in ...

African Journals Online (AJOL)

Immunology laboratory Uganda Case Western Reserve University Research Collaboration. 2. ... Makerere University Colleges of Veterinary Medicine, Animal Resources and Biosecurity. 5. .... The mean age was 27.1 years, while standard.

Measurements of seismic vibrations induced by Quarry blasts at the Mostecká basin

Czech Academy of Sciences Publication Activity Database

Kaláb, Zdeněk

-, č. 271 (2006), s. 49-58 ISSN 0372-9508 Institutional research plan: CEZ:AV0Z30860518 Keywords : seismic vibration * slope stability * quarry blast Subject RIV: DC - Siesmology, Volcanology, Earth Structure

Non vidi nec fas. Afrodita Knidská v antické textové a obrazové tradici

Czech Academy of Sciences Publication Activity Database

Bažant, Jan

-, č. 11 (2016), s. 28-40 ISSN 2453-7284 Institutional support: RVO:67985955 Keywords : Aphrodite * Praxiteles * legends Subject RIV: AB - History http://fff.truni.sk/index.php?mod=publication&detail=271

Replication of recently identified systemic lupus erythematosus genetic associations: a case-control study

Czech Academy of Sciences Publication Activity Database

Suarez-Gestal, M.; Calaza, M.; Endreffy, E.; Pullmann, R.; Ordi-Ros, J.; Sebastiani, D.G.; Růžičková, Šárka; Santos, J.M.; Papasteriades, C.; Marchini, M.; Skopouli, F.N.; Suarez, A.; Blanco, F.J.; D'Alfonso, S.; Bijl, M.; Carreira, P.; Witte, T.; Migliaresi, S.; Gomez-Reino, J.J.; Gonzalez, A.

2009-01-01

Roč. 11, č. 3 (2009), R69 ISSN 1478-6362 Keywords : Single nucleotide polymorphism susceptibility * sytemic lupus erythematosus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.271, year: 2009

The combined effects of gamma radiation and low-temperature for the disinfestation of the Oriental fruit fly, Dacus dorsalis Hendel in mango and banana

International Nuclear Information System (INIS)

Loaharanu, S.; Ugsunantwiwat, A.; Sutantawong, M.

1971-01-01

The Numdocmai mango and Homtong banana containing the 22-24-hour old eggs of the Oriental fruit fly were subjected to gamma rays at 2-20 krads. After irradiation, the infested fruits were stored at 27+-1 0 C, 20 0 C and 17 0 C with 80-90% relative humidity. The percentages of eggs failed to develop into larvae were calculated. When the storage temperature was 27+-1 0 C or 20 0 C, the LD 50 and LD 99 for eggs in mango was 5.9 and 29 krads respectively, in banana was 3.4 and 12 krads respectively. While the storage temperature was 17 0 C, the LD 50 and LD 99 for eggs in mango was 4.1 and 20 krads respectively; in banana was 3 and 10 krads respectively. The 8-day-old and 3-day-old pupae were also exposed to gamma rays and stored at different temperatures. The mortality of the irradiated pupae stored at 17 0 C was higher than when stored at 27+-1 0 C or 20 0 C. The storage temperature of 17 0 C led to higher mortality in the irradiated immature stages of the fruit fly. Studies would also be extended to investigate the effect of low-temperature in addition to radiation for the disinfestation of the Oriental fruit fly in other fruits

Occurrence of Hepatozoon canis and Cercopithifilaria bainae in an off-host population of Rhipicephalus sanguineus sensu lato ticks.

Science.gov (United States)

Ramos, Rafael Antonio Nascimento; Giannelli, Alessio; Carbone, Domenico; Baneth, Gad; Dantas-Torres, Filipe; Otranto, Domenico

2014-04-01

Hepatozoon canis (Eucoccidiorida, Hepatozoidae) and the filarioid Cercopithifilaria bainae (Spirurida, Onchocercidae) are tick-transmitted infectious agents of dogs, highly prevalent in the Mediterranean basin in association with Rhipicephalus sanguineus sensu lato. Ticks were collected from the environment every 25±2 days in a confined location in southern Italy where a community of dogs lives, from August 2012 to July 2013. In order to study the occurrence of H. canis and C. bainae, 1091 tick specimens (770 adults; 271 nymphs, and 50 larvae) were dissected, and oocysts of H. canis and larvae of C. bainae were morphologically identified. Out of 1091 dissected ticks, 13.47% (n=147) were positive for H. canis, with the highest prevalence recorded in unfed adults (16.4%; 126/770), followed by nymphs collected as larvae and allowed to moult (14%; 7/50), unfed nymphs dissected immediately after collection (3%; 8/271), and adults collected as nymphs and allowed to moult (2%; 6/271). The highest number of H. canis-positive ticks (35.5%; 43/121; Pcanis and C. bainae infections in the study area seem to be dependent on the seasonality of vector tick populations. Hence, dogs living in these areas are more exposed to both pathogens during the warmer months. These findings provide new insights into the ecology of both H. canis and C. bainae. Copyright © 2014 Elsevier GmbH. All rights reserved.

Multiple viral/self immunological cross-reactivity in liver kidney microsomal antibody positive hepatitis C virus infected patients is associated with the possession of HLA B51.

Science.gov (United States)

Bogdanos, D-P; Lenzi, M; Okamoto, M; Rigopoulou, E I; Muratori, P; Ma, Y; Muratori, L; Tsantoulas, D; Mieli- Vergani, G; Bianchi, F B; Vergani, D

2004-01-01

Liver Kidney Microsomal autoantibody type 1(LKM1) directed to cytochrome P4502D6 (CYP2D6) characterises autoimmune hepatitis type-2 (AIH-2), but is also found in a proportion of chronic hepatitis C virus (HCV) infected patients, CYP2D6252-271 being a major B- cell autoepitope. Molecular mimicry and immunological cross-reactivity between CYP2D6252-271, HCV polyprotein and the infected cell protein 4 (ICP4) of herpes simplex virus type 1 (HSV-1) have been suggested as triggers for the induction of LKM1, but reactivity and cross-reactivity to the relevant sequences have not been investigated experimentally. CYP2D6252-271 and its viral homologues were constructed and tested by ELISA in the sera of 46 chronically infected HCV patients, 23 of whom were LKM1 positive. Reactivity to the E1 HCV and ICP4 HSV1 mimics was frequently found in HCV infected patients irrespectively of their LKM1 status; viral/self cross-reactivity (as indicated by inhibition studies), however, was present in the only 2 of the 23 LKM1 seropositive HCV patients, who possessed the HLA allotype B51. Our results indicate that in HCV infected patients virus/self cross-reactivity is dependent on a specific immunogenetic background, a finding awaiting confirmation by studies in larger series of patients.

Effect of 2-Mercaptopropionyl-Glycine on the hemoglobin of rats exposed to low doses of fast neutrons

International Nuclear Information System (INIS)

Selim, N.S.; Ashry, H.A.

2001-01-01

Adult male rats weighing 150± 10 gm, were divided into six groups: one group was kept untreated as normal control, one group received single administration of 20 mg/kg body weight 2-mercapto-propionyl glycine, commercially called thiola, the remaining four groups were injected with thiola and exposed to different doses of fast neutrons (4.32, 36, 70 and 140 mSv) 30 minutes after injection. The analysis of the hemoglobin molecule was performed 24 hours after irradiation. The UV-visible spectrum of the hemoglobin was recorded from 200 to nm using CECIL-3041 UV-Vis spectrophotometer. The following parameters were calculated for the evaluation of the hemoglobin spectrum: 1- The maximum absorbance at 271, 340, 410, 540 and 574 nm, 2- The full width at half maximum of each peak (FWHM), 3-evaluation of the ratio between different peaks as follows: a) A 41 0/A 271 (iron to globin ratio) c) A 574 / A 271 : (heme to globin ratio), d)- A 574 /A 540 (spin state of the iron) and 4- recording the appearance of new peaks or the disappearance of normally occurring peaks. The injection of thiola, only, was found to affect the spatial distribution of the hemoglobin molecule. Also, it was shown to minimize the damaging effects of fast neutrons on the hemoglobin and decreased environmental perturbations

Roubované polymerní kartáče

Czech Academy of Sciences Publication Activity Database

Riedel, Tomáš; Rodriguez-Emmenegger, Cesar; Pop-Georgievski, Ognen

2015-01-01

Roč. 94, č. 10 (2015), s. 580-582 ISSN 0042-4544 Institutional support: RVO:61389013 Keywords : polymer brushes * biosensors Subject RIV: CD - Macromolecular Chemistry http://casopis.vesmir.cz/clanky/cislo/cislo/271

77 FR 27030 - North Pacific Fishery Management Council; Notice of Public Meetings

Science.gov (United States)

2012-05-08

... physically accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at 907-271-2809 at least 7 working days prior to the...

78 FR 59657 - North Pacific Fishery Management Council; Public Meeting

Science.gov (United States)

2013-09-27

... Accommodations These meetings are physically accessible to people with disabilities. Requests for sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271-2809 at least 7 working...

78 FR 4391 - North Pacific Fishery Management Council; Public Meetings

Science.gov (United States)

2013-01-22

... Guard (USCG) Report (Report on Aleutian Island Risk Assessment) United States Fish & Wildlife Service... interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271-2809 at least 7 working...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 374 ... Helpdesk for Spanish Speaking Telecentre Communities in Peru and Latin America ... Gender Dimension in Solid Waste Management in Urban and ... of Advances and Challenges in the Reconciliation Process.

13 CFR 143.50 - Closeout.

Science.gov (United States)

2010-01-01

... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

10 CFR 600.250 - Closeout.

Science.gov (United States)

2010-01-01

... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

15 CFR 24.50 - Closeout.

Science.gov (United States)

2010-01-01

... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

14 CFR 1273.50 - Closeout.

Science.gov (United States)

2010-01-01

... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8491 ... Una Hakika: Scaling Digital Solutions for Conflict Management in Kenya and Burma ... Adaptation Finance: Linking Research, Policy, and Business ... availability, marketing, and consumption of ultra-processed food ...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 1130 ... Expanding Business Opportunities for African Youth in Agricultural Value ... As agriculture becomes more strategically important in the world, ... good for human health by improving food security, nutrition and income.

MILITARY BASE CLOSURES: Questions Concerning the Proposed Sale of Housing at Mather Air Force Base

National Research Council Canada - National Science Library

1998-01-01

This report responds to your request that we review the proposed negotiated sale of 1,271 surplus family housing units at Mather Air Force Base, California, to the Sacramento Housing and Redevelopment Agency (SHRA...

The Schenley Experiment: A Social History of Pittsburgh’s First Public High School

OpenAIRE

Gabrion, Laura

2018-01-01

Jake Oresick, The Schenley Experiment: A Social History of Pittsburgh’s First Public High School. University Park, PA: Pennsylvania State University Press, 2017. 222 pp. ISBN 978-0-271-07833-5. $19.95 (paperback).

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2009-01-01

Results 271 - 280 of 1368 ... Enough foreign direct investment quickens economic growth everywhere ... to bank the unbanked. Published date. January 1, 2009. Papers ... The middle income trap is economic stagnation, recession or slow ...

Hemolytic uremic syndrome (HUS) secondary to cobalamin C (cblC) disorder.

Science.gov (United States)

Sharma, Ajay P; Greenberg, Cheryl R; Prasad, Asuri N; Prasad, Chitra

2007-12-01

Diarrhea-positive hemolytic uremic syndrome (HUS) is a common cause of acute renal failure in children. Diarrhea-negative (D-), or atypical HUS, is etiologically distinct. A Medline search identified seven previously reported D- cases of HUS secondary to cobalamin C (cblC) disease presenting in infancy. An infantile presentation is reported to be associated with a high mortality rate (6/7 cases). We describe the results of a 5-year longitudinal follow-up in a child diagnosed with D- HUS secondary to cblC disease in infancy. Mutation analysis in this patient identified homozygosity for the 271 dupA mutation (c.271 dupA) in the cblC MMACHC gene. We briefly review the published experience in cblC-associated HUS to highlight the clinical characteristics of this uncommon, but potentially treatable, condition.

Brief Report: Autistic Features in Children and Adolescents with Gender Dysphoria.

Science.gov (United States)

Skagerberg, Elin; Di Ceglie, Domenico; Carmichael, Polly

2015-08-01

This paper looks at the association between gender dysphoria (GD), scores on the Social Responsiveness Scale (SRS), and reported diagnoses of autism spectrum disorder (ASD). Parents of 166 young people presenting with GD (Mean age = 14.26, SD = 2.68) completed the SRS. Information concerning an ASD diagnosis was also extracted from the patient files. 45.8% fell within the normal range on the SRS and of those 2.8% had an ASD diagnosis. 27.1% fell within the mild/moderate range and of those 15.6% had an ASD diagnosis and 6.7% an ASD query. 27.1% fell within the severe range and of those 24.4% had an ASD diagnosis and 26.7% an ASD query. No difference was found in autistic features between the natal females and males.

Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen

Science.gov (United States)

James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands

1996-01-01

We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8491 ... Bangladesh is undergoing a rapid demographic and epidemiological ... diseases and other chronic health conditions. ... This project will help prepare youth in East and Southern Africa for economic opportunities, and ...

Československo-jugoslávské vztahy v přelomovém roce 1929

Czech Academy of Sciences Publication Activity Database

Škerlová, Jana

2014-01-01

Roč. 100, č. 2 (2014), s. 271-296 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : political relations * Czechoslovakia * Kingdom of Serbs * Croats and Slovenes * Kingdom of Yugoslavia * Royal Dictatorship Subject RIV: AB - History

Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

Czech Academy of Sciences Publication Activity Database

Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

2015-01-01

Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

77 FR 22806 - Proposed Extension of Existing Collection; Comment Request

Science.gov (United States)

2012-04-17

... annually. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $45,979... (Section 8(f) Payments) 1,425 ESA-100 (20 SFR 702.201) 840 LS-271 (Self Insurance Application) 60 LS-274...

Krajanská lidová léčba a ritualizované praktiky u Čechů z Ukrajiny a Kazachstánu přesídlených do České republiky

Czech Academy of Sciences Publication Activity Database

Beranská, Veronika

2013-01-01

Roč. 23, č. 4 (2013), s. 264-271 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Ukraine * Kazakhstan * Czech Republic * migration * folk medicine * ethno-medicine * complementary medicine * compatriots Subject RIV: AC - Archeology, Anthropology, Ethnology

Comparison of five tests for identification of Staphylococcus aureus from clinical samples

NARCIS (Netherlands)

A. Luijendijk (Ad); A.F. van Belkum (Alex); J.A.J.W. Kluytmans (Jan); H.A. Verbrugh (Henri)

1996-01-01

textabstractFive different laboratory tests for the identification of Staphylococcus aureus were compared. Analyses of 271 presumptive S. aureus strains, supplemented with 59 well-defined methicillin-resistant S. aureus (MRSA) isolates, were performed. Only the

Sankcionovat

Czech Academy of Sciences Publication Activity Database

Černá, Anna

2016-01-01

Roč. 99, č. 5 (2016), s. 271-275 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : sanction * origin * different meanings * dictionary Subject RIV: AI - Linguistics

Křehká víla z bahna rybníků - puchýřka útlá

Czech Academy of Sciences Publication Activity Database

Šumberová, Kateřina; Ducháček, M.

2014-01-01

Roč. 61, č. 6 (2014), s. 265-271 ISSN 0044-4812 R&D Projects: GA AV ČR KJB600050803 Institutional support: RVO:67985939 Keywords : threatened species * wetlands * fishpond management Subject RIV: EF - Botanics

Genomic evidence for divergence with gene flow in host races of the larch budmoth

Czech Academy of Sciences Publication Activity Database

Emelianov, I.; Marec, František; Mallet, J.

2003-01-01

Roč. 271, - (2003), s. 97-105 ISSN 0962-8452 Institutional research plan: CEZ:AV0Z5007907 Keywords : speciation * gene flow * selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.544, year: 2003

Confirmation of a theory: reconstruction of an alluvial plain development in a flume experiment

Czech Academy of Sciences Publication Activity Database

Bertalan, L.; Tóth, C. A.; Szabó, G.; Nagy, G.; Kuda, František; Szabó, S.

2016-01-01

Roč. 70, č. 3 (2016), s. 271-285 ISSN 0014-0015 Institutional support: RVO:68145535 Keywords : fluvial geomorphology * flume experiment * avulsion Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.923, year: 2016

The mitochondrial genome and ribosomal operon of Brachycladium goliath (Digenea: Brachycladiidae) recovered from a stranded minke whale

Czech Academy of Sciences Publication Activity Database

Briscoe, A.G.; Bray, R. A.; Brabec, Jan; Littlewood, D. T. J.

2016-01-01

Roč. 65, č. 3 (2016), s. 271-275 ISSN 1383-5769 Institutional support: RVO:60077344 Keywords : Digenea * Balaenoptera acutorostrata * Cetacea * Hologenophore * NGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.744, year: 2016

78 FR 47048 - Notice of Availability of Final Environmental Impact Statement (Final EIS)

Science.gov (United States)

2013-08-02

... may be viewed online or during regular business hours at the following locations: 1. Online at www..., Anchorage, AK 99513. Ms. Grey may be contacted during business hours at (907) 271-5453 (telephone) and (907...

Structure and Bonding in Binuclear Metal Carbonyls. Classical Paradigms vs. Insights from Modern Theoretical Calculations

Czech Academy of Sciences Publication Activity Database

Ponec, Robert

2015-01-01

Roč. 1053, SI (2015), s. 195-213 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015

COSTECH - HURIA JOURNAL VOL. 24 (2) COSTECH FINAL_NEW

African Journals Online (AJOL)

Prof Kigadye

consecutive days; finally 6 animals were randomly picked from each treatment and slaughtered ... Organoleptic test was conducted and samples of the mutton, goat meat and ..... Asian-Australasian Journal of Animal Sciences 27(1): 55 –. 60.

GLDAS Noah Land Surface Model L4 3 Hourly 1.0 x 1.0 degree Subsetted V001

Data.gov (United States)

National Aeronautics and Space Administration — This data set contains a series of land surface parameters simulated from the Noah 2.7.1 model in the Global Land Data Assimilation System (GLDAS). The data are in...

Invaze netýkavky žláznaté v České republice

Czech Academy of Sciences Publication Activity Database

Skálová, Hana; Čuda, Jan

2014-01-01

Roč. 62, č. 2 (2014), s. 271-273 ISSN 0044-4812 R&D Projects: GA ČR GA206/07/0668 Institutional support: RVO:67985939 Keywords : plant species biology * reproduction * growth Subject RIV: EF - Botanics

Publications | Page 28 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 6333 ... ... institutions to build local capacity through funding, knowledge sharing, and training. ... Large-scale land deals can bring benefits such as jobs, ... and the Revolutionary Armed Forces of Colombia (FARC) progress, ...

The phosphatase activity of the isolated H4-H5 loop of Na+/K+ ATPase resides outside its ATP binding site

Czech Academy of Sciences Publication Activity Database

Ettrich, Rüdiger

2004-01-01

Roč. 271, č. 19 (2004), s. 3923-3939 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5011922; MSM113100003 Keywords : phosphatase Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.260, year: 2004

Mechanical properties of weldings by electron beams on alloy 8090 (CP 271)

International Nuclear Information System (INIS)

Le Poac, P.; Nomine, A.M.; Miannay, D.

1987-06-01

Weldings by electron beams got on rings in alloy 8090 in the T4 and T6 state are mechanically tested in traction in the original state of welding or after a thermal processing of 12 hours at 210 0 C [fr

Development of the Ethmoidal Structures of the Endocranium in Discoglossus pictus (Anura: Discoglossidae)

Czech Academy of Sciences Publication Activity Database

Královec, K.; Roček, Zbyněk; Žáková, P.; Mužáková, V.

2010-01-01

Roč. 271, č. 9 (2010), s. 1078-1093 ISSN 0362-2525 Institutional research plan: CEZ:AV0Z30130516 Keywords : Anura * Discoglossidae * Discoglossus * development * cranium Subject RIV: EA - Cell Biology Impact factor: 1.773, year: 2010

Crystal structure of vanadite: Refinement of anisotropic displacement parameters

Czech Academy of Sciences Publication Activity Database

Laufek, F.; Skála, Roman; Haloda, J.; Císařová, I.

2006-01-01

Roč. 51, 3-4 (2006), s. 271-275 ISSN 1210-8197 Institutional research plan: CEZ:AV0Z30130516 Keywords : anisotropic displacement parameter * crystal structure * single-crystal X-ray refinement * vanadinite Subject RIV: DB - Geology ; Mineralogy

Zápis rumunských vlastních jmen s monofunkčním písmenem e v koncové slabice

Czech Academy of Sciences Publication Activity Database

Beneš, Martin

2012-01-01

Roč. 95, č. 5 (2012), s. 265-271 ISSN 0027-8203 Institutional support: RVO:68378092 Keywords : czech spelling * geographical proper names of Romain origin * orthography * personal proper names of Romain origin * pronunciation Subject RIV: AI - Linguistics

FACTORS INFLUENCING THE SELECTION OF DENTAL NURSING ...

African Journals Online (AJOL)

drclement

to 85 dental nursing students from 3. Colleges ... products of mixed school. Teaching was the commonest job among 27.1% .... Social Science (SPSS version 15.0) ... Frequency Percent. Educational status. Father. Informal. 6. 7.1. Primary. 10.

The Lyman Alpha Reference Sample: Extended Lyman Alpha Halos Produced at Low Dust Content

Czech Academy of Sciences Publication Activity Database

Hayes, M.; Oestlin, G.; Schaerer, D.; Verhamme, A.; Mas-Hesse, J. M.; Adamo, A.; Atek, H.; Cannon, J.M.; Duval, F.; Guaita, L.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Melinder, J.; Orlitová, Ivana; Oti-Floranes, H.; Sandberg, A.

2013-01-01

Roč. 765, č. 2 (2013), L27/1-L27/6 ISSN 2041-8205 Institutional support: RVO:67985815 Keywords : cosmology observations * galaxies * evolution Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.602, year: 2013

Download this PDF file

African Journals Online (AJOL)

USER

2015-03-23

Mar 23, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 264 – 271, 2015. ... Federal University of Technology Minna, Niger State, Nigeria ... on the provision and delivery of healthcare to all, the spatial distribution of ...

77 FR 14012 - Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I

Science.gov (United States)

2012-03-08

...; DA 12-271] Eligible Telecommunications Carrier Designation for Participation in Mobility Fund Phase I... Wireless Telecommunications and Wireline Competition Bureaus describe the process and requirements for applicants seeking Eligible Telecommunications Carrier (ETC) Designation from the Commission for...

78 FR 57416 - Division of Longshore and Harbor Workers' Compensation Proposed Revision of Existing Collection...

Science.gov (United States)

2013-09-18

... annually. Total Burden Cost (capital/startup): $0. Total Burden Cost (operating/maintenance): $46,866...) 9,498 20 CFR 702.321 (Section 8(f) Payments) 1,425 ESA-100 (20 CFR 702.111, 702.201) 840 LS-271...

Publications | Page 28 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 6341 ... IDRC works with developing-country researchers and ... food and nutrition security for low- and middle-income households in Kenya and Uganda. ... of the work IDRC's Rural Poverty and Environment program has ...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 1323 ... Increasing awareness of zoonotic diseases among health ... were manadated to be reserved for women in local level politics. ... this percentage is inverted for Indian Muslims, with most living in ... All rights reserved.

Hypolipidemic effect of beer proteins in experiment on rats

Czech Academy of Sciences Publication Activity Database

Gorinstein, S.; Leontowicz, H.; Lojek, Antonín; Leontowicz, M.; Číž, Milan; Stager, M. A. G.; Montes, J. M. B.; Toledo, F.; Arancibia-Avila, P.; Trakhtenberg, S.

2002-01-01

Roč. 35, č. 3 (2002), s. 265-271 ISSN 0023-6438 Institutional research plan: CEZ:AV0Z5004920 Keywords : lyophilized polyphenol-free beer * proteins * lipids Subject RIV: BO - Biophysics Impact factor: 0.746, year: 2002

Rarotonga Sr/Ca and SST Reconstruction Data for 1726 to 1997

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — A 271 year record of Sr/Ca variability in a coral from Rarotonga in the South Pacific gyre. Calibration with monthly sea surface temperature (SST) from satellite and...

The Tomato Hoffman's Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures.

Science.gov (United States)

Qiu, Zhengkun; Wang, Xiaoxuan; Gao, Jianchang; Guo, Yanmei; Huang, Zejun; Du, Yongchen

2016-01-01

Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF) gene, which corresponds to the ah (Hoffman's anthocyaninless) locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses.

The Tomato Hoffman's Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures.

Directory of Open Access Journals (Sweden)

Zhengkun Qiu

Full Text Available Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF gene, which corresponds to the ah (Hoffman's anthocyaninless locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses.

The Tomato Hoffman’s Anthocyaninless Gene Encodes a bHLH Transcription Factor Involved in Anthocyanin Biosynthesis That Is Developmentally Regulated and Induced by Low Temperatures

Science.gov (United States)

Gao, Jianchang; Guo, Yanmei; Huang, Zejun; Du, Yongchen

2016-01-01

Anthocyanin pigments play many roles in plants, including providing protection against biotic and abiotic stresses. Many of the genes that mediate anthocyanin accumulation have been identified through studies of flowers and fruits; however, the mechanisms of genes involved in anthocyanin regulation in seedlings under low-temperature stimulus are less well understood. Genetic characterization of a tomato inbred line, FMTT271, which showed no anthocyanin pigmentation, revealed a mutation in a bHLH transcription factor (TF) gene, which corresponds to the ah (Hoffman's anthocyaninless) locus, and so the gene in FMTT271 at that locus was named ah. Overexpression of the wild type allele of AH in FMTT271 resulted in greater anthocyanin accumulation and increased expression of several genes in the anthocyanin biosynthetic pathway. The expression of AH and anthocyanin accumulation in seedlings was shown to be developmentally regulated and induced by low-temperature stress. Additionally, transcriptome analyses of hypocotyls and leaves from the near-isogenic lines seedlings revealed that AH not only influences the expression of anthocyanin biosynthetic genes, but also genes associated with responses to abiotic stress. Furthermore, the ah mutation was shown to cause accumulation of reactive oxidative species and the constitutive activation of defense responses under cold conditions. These results suggest that AH regulates anthocyanin biosynthesis, thereby playing a protective role, and that this function is particularly important in young seedlings that are particularly vulnerable to abiotic stresses. PMID:26943362

Arctic Dinoflagellate Migration Marks the Oligocene Glacial Maximum: Implications for the Rupelian-Chattian Boundary

Science.gov (United States)

van Simaeys, S.; Brinkhuis, H.; Pross, J.; Williams, G. L.; Zachos, J. C.

2004-12-01

Various geochemical and biotic climate proxies, and notably deep-sea benthic foraminiferal δ 18O records indicate that the Eocene 'greenhouse' state of the Earth gradually evolved towards an earliest Oligocene 'icehouse' state, eventually triggering the abrupt appearance of large continental ice-sheets on Antarctic at ˜33.3 Ma (Oi-1 event). This, however, was only the first of two major glacial events in the Oligocene. Benthic foraminiferal δ 18O records show a second positive excursion in the mid Oligocene, consistent with a significant ice-sheet expansion and/or cooling at 27.1 Ma (Oi-2b) coincident with magnetosubchron C9n. Here, we report on a mid Oligocene, globally synchronous, Arctic dinoflagellate migration event, calibrated against the upper half of C9n. A sudden appearance, and abundance increases of the Arctic taxon Svalbardella at lower-middle latitudes coincides with the so-called Oi-2b benthic δ 18O event, dated at ˜27.1 Ma. This phenomenon is taken to indicate significant high-latitude surface water cooling, concomitant Antarctic ice-sheet growth, and sea level lowering. The duration of the Svalbardella migrations, and the episode of profound cooling is estimated as ˜500 ka, and is here termed the Oligocene Glacial Maximum (OGM). Our records suggest a close link between the OGM, sea-level fall, and the classic Rupelian-Chattian boundary, magnetostratigraphically dating this boundary as ˜27.1 Ma.

The 7B-1 mutation in tomato (Solanum lycopersicum L.) confers a blue light-specific lower sensitivity to coronatine, a toxin produced by Pseudomonas syringae pv. tomato

Czech Academy of Sciences Publication Activity Database

Bergougnoux, V.; Hlaváčková, V.; Plotzová, R.; Novák, Ondřej; Fellner, Martin

2009-01-01

Roč. 60, č. 4 (2009), s. 1219-1230 ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blue light-specific response * COI1 * coronatine Subject RIV: EF - Botanics Impact factor: 4.271, year: 2009

Injury Severity Score coding: Data analyst v. emerging m-health ...

African Journals Online (AJOL)

benchmarking and quality improvement initiatives in the trauma ... We hypothesised that emerging mobile health (mhealth) technology could offer a costeffective alternative to the .... 33.98), including a mortality rate of 4.6% (95% CI 2.71 7.57).

Cytokinin oxidase/dehydrogenase genes in barley and wheat. Cloning and heterologous expression

Czech Academy of Sciences Publication Activity Database

Galuszka, P.; Frébortová, Jitka; Werner, T.; Yamada, M.; Strnad, Miroslav; Schmülling, T.; Frébort, I.

2004-01-01

Roč. 271, č. 20 (2004), s. 3990-4002 ISSN 0014-2956 Institutional research plan: CEZ:AV0Z5038910 Keywords : cereals * cloning * cytokinin oxidase/dehydrogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.260, year: 2004

evaluation of the environmental noise levels in abuja municipality

African Journals Online (AJOL)

ABSTRACT. Background: Noise remains a nuisance which impacts negatively on the ..... Furthermore, Erikson et al postulated that a persistent noise level .... Hessel PA, Sluis-Cremer G K. Hearing loss in ... Ear & Hearing 2006; 27(1): 1-19. 13.

Highlights of the 30th International Conference on Antiviral Research

Czech Academy of Sciences Publication Activity Database

Andrei, G.; Carter, K.; Janeba, Zlatko; Sampath, A.; Schang, L. M.; Tarbet, E. B.; Vere Hodge, R. A.; Bray, M.; Esté, J. A.

2017-01-01

Roč. 145, Sep (2017), s. 184-196 ISSN 0166-3542 Institutional support: RVO:61388963 Keywords : chronic hepatitis C * dengue virus * in vitro Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

Technical progress report. Private sector initiatives between the United States and Japan. January 1992 - December 1992

International Nuclear Information System (INIS)

1993-01-01

OAK A271 This annual report for calendar year 1992 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...

hca: an Arabidopsis mutant exhibiting unusual cambial activity and altered vascular patterning

Czech Academy of Sciences Publication Activity Database

Pineau, C.; Amandine, F.; Ranocha, P.; Jauneau, A.; Turner, S.; Lemonnier, G.; Renou, J.P.; Tarkowski, Petr; Sandberg, G.; Jouanin, L.; Sundberg, B.; Boudet, A.M.; Goffner, D.; Pichon, M.

2005-01-01

Roč. 44, č. 2 (2005), s. 271-289 ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis thaliana * cambium * secondary xylem Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.969, year: 2005

Influence of continuous light and darkness on the secretory ...

Indian Academy of Sciences (India)

Unknown

rent phases of the secretory process were demonstrated. (Srivastava 1999). ..... in the pineal supportive cells of deep sea fish, Nezumia liolepis (McNulty 1976) and .... factors as light and temperature. Melatonin and ... Brain Res. 52 271–296.

Copepoda: Pandaridae

African Journals Online (AJOL)

1991-03-04

,27(1) finely striated marginal membrane is present along the anterior and lateral margins of the cephalothorax of D. latifolia (Figure 1 & 4c), which no doubt fonns an effective seal against the host tissue. Posteriorly, however ...

Technical progress report. Private sector initiatives between the United States and Japan. January 1990 - December 1990

International Nuclear Information System (INIS)

1993-01-01

OAK A271 This annual report for calendar year 1990 describes the efforts performed under the Private Sector Initiatives contract. The report also describes those efforts that have continued with private funding after being initiated under this contract

Low/Negative Expression of PDGFR-α Identifies the Candidate Primary Mesenchymal Stromal Cells in Adult Human Bone Marrow

DEFF Research Database (Denmark)

Li, Hongzhe; Ghazanfari, Roshanak; Zacharaki, Dimitra

2014-01-01

Human bone marrow (BM) contains a rare population of nonhematopoietic mesenchymal stromal cells (MSCs), which are of central importance for the hematopoietic microenvironment. However, the precise phenotypic definition of these cells in adult BM has not yet been reported. In this study, we show...... exhibited high levels of genes associated with mesenchymal lineages and HSC supportive function. Moreover, lin(-)/CD45(-)/CD271(+)/CD140a(low/-) cells effectively mediated the ex vivo expansion of transplantable CD34(+) hematopoietic stem cells. Taken together, these data indicate that CD140a is a key...... that low/negative expression of CD140a (PDGFR-α) on lin(-)/CD45(-)/CD271(+) BM cells identified a cell population with very high MSC activity, measured as fibroblastic colony-forming unit frequency and typical in vitro and in vivo stroma formation and differentiation capacities. Furthermore, these cells...

Assessment of space plasma effectsfor satellite applications:Working Group 2 overview

Directory of Open Access Journals (Sweden)

N. Jakowski

2004-06-01

Full Text Available An important part of the tasks of Working Group 2 of the COST Action 271 «Assessment of space plasma effect for satellites applications» is the assessment of novel data sources for information about the state of ionisation of the ionosphere. This report deals with those aspects which are not represented adequately in the scientific papers in this issue. Here emphasis is given to the product aspect (data and model collections, descriptions of methods and algorithms, availability of products, expected future developments and the links between the past COST Actions 238 and 251 with the present Action 271 and with possible future cooperations. Working Group 2 was leading in the transionospheric propagation aspects of possible products for the International Telecommunication Union?s Radiocommunication (ITU-R Study Group 3. This report gives a short overview emphasizing future developments.

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8487 ... Strengthening response capacity to African infectious disease outbreaks. The 2014 Ebola outbreak in West Africa claimed the lives of tens of thousands ... of a global health institute in the Middle East and North Africa.

77 FR 15273 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

Science.gov (United States)

2012-03-15

...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 282 ... Filter by type .... Moreover, conflict in one country tends to affect its neighbours, mainly through the flow of refugees and ... Cost of Conflicts in the Common Market for Eastern and Southern Africa (COMESA) Region.

Magnetic fabric and modeled strain distribution in the head of a nested granite diapir, the Melechov pluton, Bohemian Massif

Czech Academy of Sciences Publication Activity Database

Trubač, Jakub; Žák, J.; Chlupáčová, M.; Janoušek, V.

2014-01-01

Roč. 66, September (2014), s. 271-283 ISSN 0191-8141 Institutional support: RVO:67985831 Keywords : anisotropy of magnetic susceptibility (AMS) * diapir * emplecement * fabric * granite * strain Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.884, year: 2014

Pollution of agricultural crops with lanthanides, thorium and uranium studied

Czech Academy of Sciences Publication Activity Database

Kučera, Jan; Mizera, Jiří; Řanda, Zdeněk; Vávrová, M.

2007-01-01

Roč. 271, č. 3 (2007), s. 581-587 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : thorium, uranium * agricultural crops * neutron activation analysis Subject RIV: BE - Theoretical Physics Impact factor: 0.499, year: 2007

La temperatura alcanzada es casi un grado más frio que el universo, informó el centro de investigaciones CERN

CERN Multimedia

2007-01-01

The first section of what will be the biggest particle accelerator in the world, the LHC, near Geneva, reached the temperature in which it will work: -271 degre Celsius, about one degree colder than the Universe. (1/2 page)

From Otherworldliness and a Two-World Scheme to "Heterocosmica" : A Visit to a Museum with Cortázar and Nabokov

Czech Academy of Sciences Publication Activity Database

Jedličková, Alice

2006-01-01

Roč. 40, č. 3 (2006), s. 258-271 ISSN 0039-4238 R&D Projects: GA ČR GA405/04/1095 Institutional research plan: CEZ:AV0Z90560517 Keywords : narratology Subject RIV: AJ - Letters, Mass-media, Audiovision

Přechylování příjmení v češtině jako případ jazykového managementu

Czech Academy of Sciences Publication Activity Database

Kopecký, Jakub

2014-01-01

Roč. 75, č. 4 (2014), s. 271-293 ISSN 0037-7031 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : language management * feminine * derivation * surname Subject RIV: AI - Linguistics Impact factor: 0.375, year: 2014

Comparison of individuals opting for BRCA1/2 or HNPCC genetic susceptibility testing with regard to coping, illness perceptions, illness experiences, family system characteristics and hereditary cancer distress

NARCIS (Netherlands)

van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Tibben, Aad

Objective: To study differences between individuals opting for genetic cancer susceptibility testing of a known familial BRCA1/2 and HNPCC related germline mutation. Methods: Coping, illness perceptions, experiences with cancer in relatives and family system characteristics were assessed in 271

Browse Title Index

African Journals Online (AJOL)

Items 201 - 250 of 271 ... Vol 9, No 2 (2011), Prevalence of Cysticercus tenuicollis cysts in sheep slaughtered at ... breviflora Roberty fruit pulp and seeds on isolated rabbit ileum .... Vol 15, No 2 (2017), Swine farm infestation with Culicoides ...

On reliability of system composed from parallel units subject to increasing load

Czech Academy of Sciences Publication Activity Database

Volf, Petr; Linka, A.

2000-01-01

Roč. 7, č. 4 (2000), s. 271-284 ISSN 0218-5393 R&D Projects: GA MŠk VS97084 Institutional research plan: AV0Z1075907 Keywords : reliability * mathematical statistics * parallel system Subject RIV: BB - Applied Statistics, Operational Research

76 FR 18927 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

Science.gov (United States)

2011-04-06

...: Final Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental... hazardous waste management program. We authorized the following revisions: Oklahoma received authorization... accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management Act (``OHWMA'') provides the ODEQ with...

76 FR 58472 - North Pacific Fishery Management Council; Public Meeting

Science.gov (United States)

2011-09-21

... North Pacific Fishery Management Council's (Council) Pacific Northwest Crab Industry Advisory Committee. SUMMARY: The Pacific Northwest Crab Industry Advisory Committee will meet October 13, 2011 at the Leif...: (907) 271-2809. SUPPLEMENTARY INFORMATION: Agenda--Alaska Department of Fish & Game/ NMFS scientists...

Method for phenotypic detection of extended-spectrum beta-lactamases in enterobacter species in the routine clinical setting

NARCIS (Netherlands)

Stuart, J.C.; Diederen, B.; Al Naiemi, N.; Fluit, A.; Arents, N.; Thijsen, S.; Vlaminckx, B.; Mouton, J.W.; Leverstein-van Hall, M.

2011-01-01

In 271 Enterobacter blood culture isolates from 12 hospitals, extended-spectrum beta-lactamase (ESBL) prevalence varied between 0% and 30% per hospital. High prevalence was associated with dissemination, indicating the potential relevance of infection control measures. Screening with cefepime or

Zoonotic mosquito-borne flaviviruses: worldwide presence of agents with proven pathogenicity and potential candidates of future emerging diseases

Czech Academy of Sciences Publication Activity Database

Weissenböck, H.; Hubálek, Zdeněk; Bakonyi, T.; Nowotny, N.

2010-01-01

Roč. 140, 3-4 (2010), s. 271-280 ISSN 0378-1135 Institutional research plan: CEZ:AV0Z60930519 Keywords : Flaviviridae * mosquitoes * Culicidae * zoonoses * arboviruses Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.256, year: 2010

76 FR 65530 - Alaska Native Claims Selection

Science.gov (United States)

2011-10-21

... 26; Secs. 33, 35, and 36. Containing 3,689 acres. T. 21 N., R. 47 W., Sec. 34. Containing 457.50.... FOR FURTHER INFORMATION CONTACT: The BLM by phone at 907-271-5960 or by e-mail at ak.blm.conveyance...

75 FR 13297 - Alaska Native Claims Selection

Science.gov (United States)

2010-03-19

... for 118.47 acres, located southeast of the Native village of Hughes, Alaska. Notice of the decision...: The Bureau of Land Management by phone at 907-271-5960, or by e-mail at ak[email protected]ak.blm.gov...

morphological characteristics and classification of soils derived

African Journals Online (AJOL)

Prof. Ekwueme

MORPHOLOGICAL CHARACTERISTICS AND CLASSIFICATION OF. SOILS DERIVED FROM DIVERSE PARENT MATERIALS IN CENTRAL. CROSS RIVER STATE, NIGERIA. 271. M. E. NSOR and I. J. IBANGA. (Received 5 October 2007; Revision Accepted 5 December 2007). ABSTRACT. Variation in soil characteristics ...

Marie Kovářová a výzkum tradičních svateb na Podblanicku

Czech Academy of Sciences Publication Activity Database

Petráňová, Lydia

2010-01-01

Roč. 50, č. 2 (2010), s. 271-284, 457 ISSN 0487-5648 Institutional research plan: CEZ:AV0Z90580513 Keywords : Podblanicko region * Benešov district * wedding rituals * wedding officers * wedding pastry Subject RIV: AC - Archeology, Anthropology, Ethnology

Morbidities, concordance, and predictors of preterm premature ...

African Journals Online (AJOL)

2015-12-05

Dec 5, 2015 ... Background: Preterm premature rupture of membranes (PPROM) is a challenging complication of ... PROM (P < 0.000), latency period (P < 0.000), and birth weight (P < 0.001). ..... J Obstet Gynecol 2000;183:271‑6. 25. Mercer ...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 1804 ... The prices of mobile phones and netbooks have plummeted, even as their penetration ... products, the tobacco industry still benefits from strong institutional support. ... Learning, Transparency and Relationship Building: Ethiopian Women Parliamentarians and Young Female University Students.

Tropical Trametes lactinea is widely distributed in the eastern USA

Czech Academy of Sciences Publication Activity Database

Vlasák, Josef; Kout, J.

2011-01-01

Roč. 115, č. 1 (2011), s. 271-279 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z50510513 Keywords : Basidiomycota, USA new record, taxonomy * USA new record * taxonomy Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

CPAP Tips

Medline Plus

Full Text Available ... 4:26 Philips Respironics Dream Station CPAP Machine Review - Duration: 8:29. The CPAP Shop 271,568 ... Philips Respironics Wisp Nasal CPAP Bilevel Mask Fitting Review Demonstration FreeCPAPAdvice com - Duration: 7:36. TheLankyLefty27 102, ...

Vom work Book Journal 2011, 2010 4th Edition PDF

African Journals Online (AJOL)

USER

affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.

SAMJ

African Journals Online (AJOL)

admissions, with the most expensive 5% accounting for. 27.1 % of total variable ... value-for-money and cost-effectiveness being raised in both the private and the .... management and added doctor anXiety, but does not generate the same ...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 439 ... The Alternative Water Systems Project seeks to develop a point-of-use safe ... simple sari cloth filtration and chlorine disinfection for the control of ... Both the social science literature and policymakers tend to take for ...

Why is the Bond Multiplicity in C2 so Elusive?

Czech Academy of Sciences Publication Activity Database

Cooper, D.L.; Penotti, F.E.; Ponec, Robert

2015-01-01

Roč. 1053, SI (2015), s. 189-194 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : bond multiplicity in C2 * spin correlation matrices * full GVB and spin-coupled Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015

Prathap, Dr Gangan

Indian Academy of Sciences (India)

Date of birth: 6 June 1951. Specialization: Structural Mechanics, Finite Element Method, Information Science and Composite Materials Address: Honorary Professor, APJ Abdul Kalam Tech University, CET Campus, Thiruvananthapuram 695 016, Kerala Contact: Office: (0471) 278 5627. Residence: (0471) 271 1956

Mobile technologies and geographic information systems to improve health care systems: a literature review.

Science.gov (United States)

Nhavoto, José António; Grönlund, Ake

2014-05-08

A growing body of research has employed mobile technologies and geographic information systems (GIS) for enhancing health care and health information systems, but there is yet a lack of studies of how these two types of systems are integrated together into the information infrastructure of an organization so as to provide a basis for data analysis and decision support. Integration of data and technical systems across the organization is necessary for efficient large-scale implementation. The aim of this paper is to identify how mobile technologies and GIS applications have been used, independently as well as in combination, for improving health care. The electronic databases PubMed, BioMed Central, Wiley Online Library, Scopus, Science Direct, and Web of Science were searched to retrieve English language articles published in international academic journals after 2005. Only articles addressing the use of mobile or GIS technologies and that met a prespecified keyword strategy were selected for review. A total of 271 articles were selected, among which 220 concerned mobile technologies and 51 GIS. Most articles concern developed countries (198/271, 73.1%), and in particular the United States (81/271, 29.9%), United Kingdom (31/271, 11.4%), and Canada (14/271, 5.2%). Applications of mobile technologies can be categorized by six themes: treatment and disease management, data collection and disease surveillance, health support systems, health promotion and disease prevention, communication between patients and health care providers or among providers, and medical education. GIS applications can be categorized by four themes: disease surveillance, health support systems, health promotion and disease prevention, and communication to or between health care providers. Mobile applications typically focus on using text messaging (short message service, SMS) for communication between patients and health care providers, most prominently reminders and advice to patients. These

Friends Also Matter: Examining Friendship Adjustment Indices as Moderators of Anxious-Withdrawal and Trajectories of Change in Psychological Maladjustment

Science.gov (United States)

Markovic, Andrea; Bowker, Julie C.

2017-01-01

The present study evaluated whether 3 indices of friendship adjustment (mutual friendship involvement, friendship stability, friendship quality) are important, but overlooked, moderators of the impact of anxious-withdrawal on trajectories of psychological maladjustment during early adolescence. Participants included 271 young adolescents (51%…

78 FR 32161 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revision

Science.gov (United States)

2013-05-29

... Authorization of State Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA... waste management program. We authorized the following revisions: Oklahoma received authorization for... authorization of its program revision in accordance with 40 CFR 271.21. The Oklahoma Hazardous Waste Management...

SEREN - a new SPH code for star and planet formation simulations Algorithms and tests

Czech Academy of Sciences Publication Activity Database

Hubber, D.A.; Batty, C.P.; McLeod, Andrew; Whitworth, A.

2011-01-01

Roč. 529, May (2011), A27/1-A27/28 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : hydrodynamics * numerical methods * star s formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.587, year: 2011

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8491 ... Filter by type ... Gender 1310 Apply Gender filter · INFORMATION .... and account for close to two-thirds of strokes and one-half of heart disease ... born after 2010 are expected to suffer from diabetes over their lifetime.

Novedades en el diccionario (New Additions to the Dictionary)

Science.gov (United States)

Carnicer, Ramon

1975-01-01

A total of 271 items--words, phrases and affixes--were added to the common Spanish dictionary in the period between October and December 1974. This article lists the principal additions, each organized within a larger semantic category. (Text is in Spanish.) (TL)

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 875 ... This publication presents results of the research project "Avoiding Conflict Relapse through Inclusive Political Settlements and Statebuilding after Intra-State War: Opportunities, Approaches and Lessons ... Digital divide in Latin America : broadband price, quality and affordability in the region.

76 FR 14663 - Notice of Public Information Collection(s) Being Reviewed by the Federal Communications...

Science.gov (United States)

2011-03-17

....209, 53.211, and 53.213, Accounting Safeguards and Sections 260 and 271-276 of the Communications Act... reporting requirements, third party disclosure requirement, and recordkeeping requirement. Obligation to... party disclosure requirements). There is no change in the Commission's burden estimates. A Bell...

Control of Hypertension in STULONG - Twenty Years Lasting Primary Preventive Study

Czech Academy of Sciences Publication Activity Database

Tomečková, Marie; Stanovská, Zuzana; Boudík, F.; Zvárová, Jana

22 Suppl. 2, - (2004), s. 271 ISSN 0263-6352. [European Meeting on Hypertension /14./. 13.06.2004-17.06.2004, Paris] R&D Projects: GA MŠk LN00B107 Keywords : hypertension * primary preventive study Subject RIV: BB - Applied Statistics, Operational Research

75 FR 69457 - Alaska Native Claims Selection

Science.gov (United States)

2010-11-12

..., AA-8102-30, AA-8102-31, AA-8102-32, AA-8102-33, AA-8102-34, AA-8102-47; LLAK965000-L14100000-KC0000-P... at 907-271-5960, by e-mail at ak[email protected] , or by telecommunication device (TTD...

76 FR 75899 - Alaska Native Claims Selection

Science.gov (United States)

2011-12-05

...., Tracts C, D and E; Sec. 36. Containing approximately 2,327 acres. T. 47 S., R. 60 W., Sec. 4, lots 1 to 4... phone at (907) 271-5960 or by email at ak[email protected] . Persons who use a Telecommunications...

Species richness and above-ground biomass of poor and calcareous spring fens in the flysch West Carpatians, and their relationships to water and soil chemistry

Czech Academy of Sciences Publication Activity Database

Hájková, Petra; Hájek, Michal

2003-01-01

Roč. 75, - (2003), s. 271-287 ISSN 0032-7786 R&D Projects: GA ČR GA206/99/1240; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : bryophytes * Central Europe * diversity Subject RIV: EF - Botanics

Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment

Science.gov (United States)

D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands

1999-01-01

Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

78 FR 29098 - Endangered and Threatened Wildlife; 90-Day Finding on a Petition To List Iliamna Lake Seals as a...

Science.gov (United States)

2013-05-17

... information (e.g., name, address, etc.), confidential business information, or otherwise sensitive information... Region, (907) 271-1332; Jon Kurland, NMFS Alaska Region, (907) 586-7638; or Lisa Manning, NMFS Office of..., abundance, reproductive success, age structure, distribution and population connectivity, habitat selection...

African Journal of AIDS Research - Vol 7, No 3 (2008)

African Journals Online (AJOL)

Bridging the gap between VCT and HIV/AIDS treatment uptake: perspectives from a mining-sector workplace in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Anil Bhagwanjee, Inge Petersen, Olagoke Akintola, Gavin George, 271-279.

THE EFFECTS OF RARE EARTHS ON ACTIVITY AND SURFACE ...

African Journals Online (AJOL)

and the key step in H2 production by reforming of hydrocarbons for fuel cells. ... iron-chromium WGSR catalysts do not work well at low steam-to-gas ratios and ... The rate of hydrogen consumption was measured by a TCD. .... 2003, 215,. 271.

Crystal structure, spectroscopic and theoretical studies on two Schiff base compounds of 2,6-dichlorobenzylidene-2,4-dichloroaniline and 2,4-dichlorobenzylidene-2,4-dichloroaniline

Czech Academy of Sciences Publication Activity Database

Soltani, A.; Ghari, F.; Khalaji, A.D.; Lemeski, E.T.; Fejfarová, Karla; Dušek, Michal; Shikhi, M.

2015-01-01

Roč. 139, Mar (2015), s. 271-278 ISSN 1386-1425 Grant - others:AV ČR(CZ) Praemium Academiae Keywords : Schiff base * single crystal structure analysis * DFT * Electronic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.653, year: 2015

Reaction enthalpies of Osingle bondH bonds splitting-off in flavonoids: The role of non-polar and polar solvent

Czech Academy of Sciences Publication Activity Database

Vagánek, A.; Rimarčík, J.; Dropková, K.; Lengyel, Jozef; Klein, E.

2014-01-01

Roč. 1050, DEC 2014 (2014), s. 31-38 ISSN 2210-271X R&D Projects: GA ČR GA14-14082S Institutional support: RVO:61388955 Keywords : flavonoids * polyphenols * antioxidants Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

"Životní cyklus" mlecích nástrojů z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

Czech Academy of Sciences Publication Activity Database

Řídký, Jaroslav; Půlpán, M.; Šreinová, B.; Šrein, V.; Drnovský, V.; Květina, Petr

2014-01-01

Roč. 66, č. 2 (2014), s. 271-309 ISSN 0323-1267 R&D Projects: GA ČR(CZ) GAP405/11/1590 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * stone tools * grinding stones Subject RIV: AC - Archeology, Anthropology, Ethnology

O modálních predikativech slovesného původu typu To přende, (se) patří... zbórat

Czech Academy of Sciences Publication Activity Database

Šipková, Milena

2017-01-01

Roč. 100, č. 4 (2017), s. 265-271 ISSN 0027-8203 R&D Projects: GA ČR(CZ) GA16-04648S Keywords : dialect * verbal modal predicatives * modal verbs * modalization * Dictionary of Czech Dialects Subject RIV: AI - Linguistics OBOR OECD: Linguistics

77 FR 67633 - North Pacific Fishery Management Council; Public Meetings

Science.gov (United States)

2012-11-13

... subsistence) NOAA Enforcement Report United States Coast Guard (USCG) Report (including Aleutian Island Risk Assessment) United State Fish & Wildlife (USFWL) Report International Pacific Halibut Commission (IPHC... sign language interpretation or other auxiliary aids should be directed to Gail Bendixen at (907) 271...

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 369 ... ... Perspectives 1 Apply Perspectives filter · Training materials 1 Apply .... Alternative Public Service Delivery Models in Health, Water and ... Responsible and Sustainable Tourism : Strengthening Small-Scale Enterprise in Costa Rica ... Ethnic Relations in Guatemala : a New Educational Strategy.

Additional observations on Philometra spp. (Nematoda: Philometridae) in marine fishes off Iraq, with the description of two new species

Czech Academy of Sciences Publication Activity Database

Moravec, František; Ali, A. H.

2014-01-01

Roč. 87, č. 3 (2014), s. 259-271 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

The validity and reliability study of Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory

Directory of Open Access Journals (Sweden)

Mevlude Karadag

2016-06-01

Conclusion: The adaptation of translated and ldquo;Hand Hygiene Belief Scale and Hand Hygiene Practices Inventory and rdquo; in Turkey is found to be reliable and valid to evaluate hand hygiene belief and practices. [Cukurova Med J 2016; 41(2.000: 271-284

46 CFR 504.4 - Categorical exclusions.

Science.gov (United States)

2010-10-01

... FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS PROCEDURES FOR ENVIRONMENTAL POLICY ANALYSIS § 504.4 Categorical exclusions. (a) No environmental analyses need be undertaken or environmental... foreign country. (19) Action taken on special docket applications pursuant to § 502.271 of this chapter...

IN SEARCH OF THE ORIGINAL TEXT IN MARK 9:38

African Journals Online (AJOL)

“Teacher, we saw someone in your name driving out demons and we tried .... Luke.” Maybe Lagrange and Taylor and Cranfield deserve more attention. 5. ..... Justin). In the Revue Biblique (Hendriks 2007:266-271) I divided Mark 8:26 into five ...

Cytoplasmic organelles determine complexity and specificity of calcium signalling in adrenal chromaffin cells

Czech Academy of Sciences Publication Activity Database

Garsia-Sancho, J.; Verkhratsky, Alexei

2008-01-01

Roč. 192, č. 2 (2008), s. 263-271 ISSN 1748-1708 Institutional research plan: CEZ:AV0Z50390512 Keywords : Ca2+ signalling * calcium microdomains * chromaffin cells Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 2.455, year: 2008

48 CFR 1371.107 - Performance.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance. 1371.107 Section 1371.107 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL... Performance. Insert clause 1352.271-76, Performance, in all solicitations and contracts for ship construction...

Changing compositon of human capital: the Czech Republic, Hungary and Poland

Czech Academy of Sciences Publication Activity Database

Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav

2008-01-01

Roč. 16, č. 2 (2008), s. 247-271 ISSN 0967-0750 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * occupation * education Subject RIV: AH - Economics Impact factor: 0.614, year: 2008

Knowledge of diabetes and hypertension among members of ...

African Journals Online (AJOL)

hypertension prevalence of 28.6-31.5% among women and 27.1% to 32.2% ... of the world showed that there is lack of awareness and knowledge of various risk .... of diabetes has also been reported among diabetic patients in India, more so.

Effect of cyanobacterial peptides and proteins on coagulation of kaolinite

Czech Academy of Sciences Publication Activity Database

Novotná, Kateřina; Barešová, Magdalena; Čermáková, Lenka; Načeradská, Jana; Pivokonský, Martin

2016-01-01

Roč. 6, č. 2 (2016), s. 83-89 ISSN 1805-0174 Institutional support: RVO:67985874 Keywords : cellular organic matter * coagulation * complex formation * Microcystis aeruginosa * water treatment Subject RIV: DA - Hydrology ; Limnology http://www.ejes.cz/index.php/ejes/article/view/271/123

The new 1.8-litre 4-cylinder petrol engine with direct injection and turbocharging for all passenger cars with standard drivetrains from Mercedes-Benz; Der neue 1,81 4-Zylinder Turbo-Direkteinspritz-Ottomotor fuer alle PKW mit Standardantrieb von Mercedes-Benz

Energy Technology Data Exchange (ETDEWEB)

Lueckert, Peter; Kreitmann, Fritz; Merdes, Norbert; Weller, Ralph; Rehberger, Andreas; Bruchner, Klaus; Schwedler, Klaus; Ottenbacher, Hermann; Keller, Thomas [Daimler AG, Stuttgart (Germany)

2009-07-01

In the past years, the 4-cylinder gasoline engine from Mercedes-Benz (Stuttgart, Federal Republic of Germany) with the internal designation M 271 worked in the best way in the vehicles of the C, E and SLK class. The 4-cylinder engine M 271 evo introduced here represents the consistent advancement for many years of downsizing concepts in series. The emphasis was the conversion of consumption-reducing measures. At the same time also the power ratings and torque values were increased. Substantial properties of change are the conversion of the suction tube channel injection to a homogeneous direct injection procedure as well as the disappearance of the compressor and the substitution by a single-step Wastegate supercharger. The configuration of the basic engine with 1.8 L capacity was maintained. Thus, in opposite to the precursor engine a distinct improvement in the fuel consumption could be achieved in the balance.

Water quality control of combined sewer overflows. The <> procedure; Il controllo qualitativo delle immissioni fognarie nei corpi idrici. La procedura <>

Energy Technology Data Exchange (ETDEWEB)

Artina, S.; Maglionico, M. [Bologna Univ., Bologna (Italy). Dipt. di Ingegneria delle Strutture, dei Trasporti, delle Acque, del Rilevamento, del Territorio; Lo Greco, P. [HR Wallingford, Wallingford Oxfordshire (United Kingdom)

2000-05-01

The EEC Directive 91/271 endorse has brought to attention the pollution problem caused in the receiving waters by Combined Sewer Overflows (CSOs). This paper describes a procedure, set up in England, called UPM (Urban Pollution Management), meant to environmentally protect receiving waters. The UPM Procedure is merely a methodology to evaluate the impact of pollutants discharged from sewer overflows during rainfall events. [Italian] Il recepimento della direttiva CEE 91/271 ha portato ancora una volta in primo piano il problema dell'inquinamento dei corpi idrici causato dalle immissioni fognarie. Il presente articolo descrive una procedura messa a punto in Inghilterra, denominata UPM (Urban Pollution Management), destinata al controllo qualitativo dei corsi d'acqua ricettori di scarichi fognari. L'UPM non costituisce una normativa bensi una metodologia intesa a valutare l'impatto degli scarichi fognari sui ricettori durante gli eenti meteorici.

4-Chloropropofol enhances chloride currents in human hyperekplexic and artificial mutated glycine receptors

Directory of Open Access Journals (Sweden)

de la Roche Jeanne

2012-09-01

Full Text Available Abstract Background The mammalian neurological disorder hereditary hyperekplexia can be attributed to various mutations of strychnine sensitive glycine receptors. The clinical symptoms of “startle disease” predominantly occur in the newborn leading to convulsive hypertonia and an exaggerated startle response to unexpected mild stimuli. Amongst others, point mutations R271Q and R271L in the α1-subunit of strychnine sensitive glycine receptors show reduced glycine sensitivity and cause the clinical symptoms of hyperekplexia. Halogenation has been shown to be a crucial structural determinant for the potency of a phenolic compound to positively modulate glycine receptor function. The aim of this in vitro study was to characterize the effects of 4-chloropropofol (4-chloro-2,6-dimethylphenol at four glycine receptor mutations. Methods Glycine receptor subunits were expressed in HEK 293 cells and experiments were performed using the whole-cell patch-clamp technique. Results 4-chloropropofol exerted a positive allosteric modulatory effect in a low sub-nanomolar concentration range at the wild type receptor (EC50 value of 0.08 ± 0.02 nM and in a micromolar concentration range at the mutations (1.3 ± 0.6 μM, 0.1 ± 0.2 μM, 6.0 ± 2.3 μM and 55 ± 28 μM for R271Q, L, K and S267I, respectively. Conclusions 4-chloropropofol might be an effective compound for the activation of mutated glycine receptors in experimental models of startle disease.

Downregulation of heat shock protein B8 decreases osteogenic differentiation potential of dental pulp stem cells during in vitro proliferation.

Science.gov (United States)

Flanagan, M; Li, C; Dietrich, M A; Richard, M; Yao, S

2018-04-01

Tissue-derived stem cells, such as dental pulp stem cells (DPSCs), reduce differentiation capability during in vitro culture. We found that cultured DPSCs reduce expression of heat shock protein B8 (HspB8) and GIPC PDZ domain containing family member 2 (Gipc2). Our objectives were to evaluate the changes in DPSC composition during in vitro proliferation and to determine whether HspB8 and Gipc2 have function in differentiation potential of DPSCs. Different passages of rat DPSCs were evaluated for changes in CD90+ and/or CD271+ stem cells and changes in osteogenic potential. Real-time RT-PCR and immunostaining were conducted to determine expression of HspB8 and Gipc2. Expression of the genes in DPSCs was knocked down by siRNA, followed by osteogenic induction to evaluate the function of the genes. About 90% of cells in the DPSC cultures were CD90+ and/or CD271+ cells without dramatic change during in vitro proliferation. The DPSCs at passages 3 to 5 (P3 to P5) possess strong osteogenic potential, but such potential was greatly reduced at later passages. Expression of HspB8 and Gipc2 was significantly reduced at P11 versus P3. Knock-down of HspB8 expression abolished osteogenic potential of the DPSCs, but knock-down of Gipc2 had no effect. CD90+ and CD271+ cells are the major components of DPSCs in in vitro culture. High-level expression of HspB8 was critical for maintaining differentiation potential of DPSCs. © 2017 John Wiley & Sons Ltd.

41 CFR 101-27.101 - General.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true General. 101-27.101 Section 101-27.101 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock...

Experience of parental cancer in childhood is a risk factor for psychological distress during genetic cancer susceptibility testing

NARCIS (Netherlands)

van Oostrom, I.; Meijers-Heijboer, H.; Duivenvoorden, H. J.; Bröcker-Vriends, A. H. J. T.; van Asperen, C. J.; Sijmons, R. H.; Seynaeve, C.; van Gool, A. R.; Klijn, J. G. M.; Tibben, A.

2006-01-01

This study explores the effect of age at the time of parental cancer diagnosis or death on psychological distress and cancer risk perception in individuals undergoing genetic testing for a specific cancer susceptibility. Cancer-related distress, worry and risk perception were assessed in 271

78 FR 43842 - State of Kansas; Authorization of State Hazardous Waste Management Program

Science.gov (United States)

2013-07-22

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R07-RCRA-2013-0447; FRL-9833-6] State of Kansas; Authorization of State Hazardous Waste Management Program AGENCY: Environmental Protection Agency... its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA proposes to...

78 FR 70255 - West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2013-11-25

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2013-0571; FRL-9903-07-Region 3] West Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY... final authorization of revisions to its hazardous waste program under the Resource Conservation and...

Perceptions of vocational interest : Self- and other-reports in student-parent dyads

NARCIS (Netherlands)

Holtrop, Djurre; Born, Marise Ph.; de Vries, Reinout Everhard

2017-01-01

The current study investigated how self- and other-ratings of vocational interests converge among student–parent dyads. Using the Personal Globe Inventory–Short, we obtained data from a pooled sample of 271 (high school senior and university) student–parent dyads. Participants rated their own

Perceptions of vocational interest: Self- and other-reports in student-parent dyads

NARCIS (Netherlands)

Holtrop, Djurre; Born, Marise Ph; de Vries, Reinout E.

The current study investigated how self- and other-ratings of vocational interests converge among student–parent dyads. Using the Personal Globe Inventory–Short, we obtained data from a pooled sample of 271 (high school senior and university) student–parent dyads. Participants rated their own

Download this PDF file

African Journals Online (AJOL)

Rita Wilkinson

It is concluded that environmental pollution with heavy metals arising from various ... plastic food packaging to foodstuff may be categorized into three different, but inter-related, ..... Determination of Cadmium and Lead in different cigarette brands ... Chemistry-marine environmental modelling and analysis, Pp 271-277.

Morphological traits in nitrogen fixing heterocytous cyanobacteria: possible links between morphology and eco-physiology.

Czech Academy of Sciences Publication Activity Database

Pinto, P. D.; Kust, Andreja; Devercelli, M.; Kozlíková-Zapomělová, Eliška

2016-01-01

Roč. 764, č. 1 (2016), s. 271-281 ISSN 0018-8158 R&D Projects: GA ČR(CZ) GA14-18067S Institutional support: RVO:60077344 Keywords : traits * heterocyte * akinete * shape * size * phytoplankton Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.056, year: 2016

Integration of Multi-Tension Permeametry and Photogrammetric Textural Segmentation for Estimating Directional Permeability

Science.gov (United States)

2010-04-01

conditions. Direct push optical methods could easily provide real-time high- resolution images useful for differentiating soil characteristics based on...Kozeny J. 1927. Uber Kapillare Leitung Des Wassers Im Boden. Sitz. Akad. Wissensh, 136:271–306. Lowry, W, N. Mason, And D. Merewether. 1999

Forms of vibration and structural changes in liquid state

Czech Academy of Sciences Publication Activity Database

Hlaváček, B.; Šesták, Jaroslav; Koudelka, L.; Mošner, P.; Mareš, Jiří J.

2005-01-01

Roč. 80, - (2005), s. 271-283 ISSN 1388-6150 Institutional research plan: CEZ:AV0Z10100521 Keywords : crossover temperature * deterministic chaos * glass transition * non-linear oscillators * solid-liquid transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.425, year: 2005

Terrestrial gamma ray radiation in Cornwall

International Nuclear Information System (INIS)

Grainger, C.R.

1986-01-01

A report is given of an airborne survey of Cornwall using a scintillation counter to measure the natural radioactivity. This showed 271 sources of abnormal (much higher than national mean) levels of radioactivity. The effects of these on the population are discussed. (U.K.)

Chimeric Antigen Receptors to CD276 for Treating Cancer | NCI Technology Transfer Center | TTC

Science.gov (United States)

This licensing opportunity from the National Cancer Institute concerns the development of CARs comprising an antigen-binding fragment derived from the MGA271 antibody. The resulting CARs can be used in adoptive cell therapy treatment for neuroblastoma and other tumors that express CD276.

77 FR 47797 - Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2012-08-10

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9713-2] Arkansas: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

76 FR 19004 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2011-04-06

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9290-9] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

78 FR 32223 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2013-05-29

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0821; 9817-5] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental Protection Agency (EPA... changes to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA). EPA...

77 FR 38566 - Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2012-06-28

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA--R06-RCRA-2012-0367; FRL-9692-6] Louisiana: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

78 FR 54200 - Virginia: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2013-09-03

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R03-RCRA-2012-0294; FRL-9900-37-Region3] Virginia: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... of revisions to its hazardous waste program under the Resource Conservation and Recovery Act (RCRA...

76 FR 37048 - Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2011-06-24

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2010-0307; FRL-9323-8] Louisiana; Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

77 FR 15343 - Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2012-03-15

... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R06-RCRA-2012-0054; FRL-9647-8] Oklahoma: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental... authorization of the changes to its hazardous waste program under the Resource Conservation and Recovery Act...

Automated analysis of aircraft configurations for safe separation enabled by quantitative grading of results; presentation

CSIR Research Space (South Africa)

Jamison, Kevin

2012-09-01

Full Text Available perturbations of: • store mass and physical properties • ejector rack performance • aircraft release flight conditions • stations on aircraft • neighbouring stores – MIL-HDBK 1763: 271.4 – Results in a very large analysis matrix! From: Tutty, M...

Investigation of oxidation attack sites in sterols: Thermodynamics of hydrogen atom transfer

Czech Academy of Sciences Publication Activity Database

Škorňa, P.; Lengyel, Jozef; Rimarčík, J.; Klein, E.

2014-01-01

Roč. 1038, JUN 2014 (2014), s. 26-32 ISSN 2210-271X R&D Projects: GA ČR(CZ) GA14-27047S Institutional support: RVO:61388955 Keywords : sterol * steroid * oxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.545, year: 2014

Molecular characterization of Danish Cryptosporidium parvum isolates

DEFF Research Database (Denmark)

Enemark, Heidi L.; Ahrens, Peter; Juel, Cynthia Dawn

2002-01-01

The genetic polymorphism among 271 Danish Cryptosporidium isolates of human and animal origin was studied by partial amplification and sequencing of the Cryptosporidium oocyst wall protein (COWP) gene, the 18S rDNA, and a microsatellite locus.dagger Furthermore, the microsatellite locus was studi...

Perspectives on halogen bonding and other sigma-hole interactions: Lex parsimoniae (Occam's Razor)

Czech Academy of Sciences Publication Activity Database

Politzer, P.; Riley, Kevin Eugene; Bulat, F. A.; Murray, J. S.

2012-01-01

Roč. 998, SI (2012), s. 2-8 ISSN 2210-271X Institutional research plan: CEZ:AV0Z40550506 Keywords : halogen bonding * alpha-Hole bonding * hydrogen bonding * electrostatics /polarization * dispersion * electrostatic potentials Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.139, year: 2012

Crystal structure and magnetic properties of UO.sub.2./sub./permalloy thin films

Czech Academy of Sciences Publication Activity Database

Tereshina, Evgeniya; Daniš, S.; Springell, R.; Bao, Z.; Havela, L.; Caciuffo, R.

2015-01-01

Roč. 591, Sep (2015), s. 271-275 ISSN 0040-6090 R&D Projects: GA ČR GP13-25866P Institutional support: RVO:68378271 Keywords : exchange bias * permalloy * uranium dioxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.761, year: 2015

Effect of a N, N’-disubstituted phenylenediamine stabilizer and SB/EPDM compatibilizer on toughness and morphology of blends of pre-aged polyethylene with high-impact polystyrene

Czech Academy of Sciences Publication Activity Database

Michálková, Danuše; Pospíšil, Jan; Fortelný, Ivan; Šlouf, Miroslav; Kruliš, Zdeněk

2006-01-01

Roč. 12, č. 22 (2006), s. 58-65 ISSN 0193-7197 R&D Projects: GA AV ČR IBS4050008 Institutional research plan: CEZ:AV0Z40500505 Keywords : recycling * compatibilization * stabilization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.271, year: 2005

A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

NARCIS (Netherlands)

van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Brocker-Vriends, Annette H. J. T.; van Asperen, Chhstl J.; Sijmons, Rolf H.; Seynaeve, Caroline; Van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad

This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N = 271) rated the

A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships

NARCIS (Netherlands)

van Oostrom, Iris; Meijers-Heijboer, Hanne; Duivenvoorden, Hugo J.; Bröcker-Vriends, Annette H. J. T.; van Asperen, Christi J.; Sijmons, Rolf H.; Seynaeve, Caroline; van Gool, Arthur R.; Klijn, Jan G. M.; Riedijk, Samantha R.; van Dooren, Silvia; Tibben, Aad

2007-01-01

This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

A prospective study of the impact of genetic susceptibility testing for BRCA1/2 or HNPCC on family relationships.

NARCIS (Netherlands)

Oostrom, I.I.H. van; Meijers-Heijboer, H.; Duivenvoorden, H.J.; Brocker-Vriends, A.H.; Asperen, C.J. van; Sijmons, R.H.; Seynaeve, C.; Gool, A.R. van; Klijn, J.G.M.; Riedijk, S.R.; Dooren, S. van; Tibben, A.

2007-01-01

This study assessed the impact of genetic testing for cancer susceptibility on family relationships and determinants of adverse consequences for family relationships. Applicants for genetic testing of a known familial pathogenic mutation in BRCA1/2 or a HNPCC related gene (N=271) rated the

Sporophytes of polysporangiate land plants from the early Silurian period may have been photosynthetically autonomous

Czech Academy of Sciences Publication Activity Database

Libertín, M.; Kvaček, J.; Bek, Jiří; Žárský, V.; Štorch, Petr

2018-01-01

Roč. 4, 30 April 2018 (2018), s. 269-271 ISSN 2055-026X Institutional support: RVO:67985831 Keywords : earliest vascular plant s * in situ spores * Silurian * polysporangiate plant s Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 10.300, year: 2016

76 FR 78015 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

Science.gov (United States)

2011-12-15

... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... . (Catalogue of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

75 FR 80511 - National Institute on Alcohol Abuse And Alcoholism; Notice of Closed Meeting

Science.gov (United States)

2010-12-22

... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Domestic Assistance Program Nos.: 93.271, Alcohol Research Career Development Awards for Scientists and...

76 FR 39406 - National Institute on Alcohol Abuse and Alcoholism; Notice of Meeting

Science.gov (United States)

2011-07-06

... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as.... (Catalogue of Federal Domestic Assistance Program Nos. 93.271, Alcohol Research Career Development Awards for...

75 FR 47819 - National Institute on Alcohol Abuse and Alcoholism; Notice of Closed Meeting

Science.gov (United States)

2010-08-09

... attendance limited to space available. Individuals who plan to attend and need special assistance, such as... applications and the discussions could disclose confidential trade secrets or commercial property such as... Domestic Assistance Program Nos.: 93.271, Alcohol Research Career Development Awards for Scientists and...

36 CFR 1207.50 - Closeout.

Science.gov (United States)

2010-07-01

... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

32 CFR 33.50 - Closeout.

Science.gov (United States)

2010-07-01

..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

38 CFR 43.50 - Closeout.

Science.gov (United States)

2010-07-01

..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

29 CFR 97.50 - Closeout.

Science.gov (United States)

2010-07-01

... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

40 CFR 31.50 - Closeout.

Science.gov (United States)

2010-07-01

..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

44 CFR 13.50 - Closeout.

Science.gov (United States)

2010-10-01

... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

41 CFR 105-71.150 - Closeout.

Science.gov (United States)

2010-07-01

... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

Fast-track surgery for bilateral total knee replacement

DEFF Research Database (Denmark)

Husted, H; Troelsen, A; Otte, K S

2011-01-01

Bilateral simultaneous total knee replacement (TKR) has been considered by some to be associated with increased morbidity and mortality. Our study analysed the outcome of 150 consecutive, but selected, bilateral simultaneous TKRs and compared them with that of 271 unilateral TKRs in a standardised...

76 FR 19148 - Entergy Nuclear Operations, Inc., Entergy Nuclear Vermont Yankee, LLC, Vermont Yankee Nuclear...

Science.gov (United States)

2011-04-06

... NUCLEAR REGULATORY COMMISSION [Docket No. 50-271; License No. DPR-28; NRC-2011-0074] Entergy Nuclear Operations, Inc., Entergy Nuclear Vermont Yankee, LLC, Vermont Yankee Nuclear Power Station..., ``Requests for Action under this Subpart,'' the U.S. Nuclear Regulatory Commission (NRC) take action with...

75 FR 14227 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Order Approving Proposed Rule Change...

Science.gov (United States)

2010-03-24

... Commission has considered the proposed rule's impact on efficiency, competition, and capital formation. See... its rules governing NOM, the Securities Industry and Financial Markets Association (``SIFMA... security.''). See also Newton v. Merrill, Lynch, Pierce, Fenner & Smith, Inc., 135 F.3d 266, at 271, 274...

A remark on the modal interpretation of algebraic quantum field theory

International Nuclear Information System (INIS)

Kitajima, Yuichiro

2004-01-01

Clifton determined the maximal beable algebra for each faithful normal state in a local algebra [Phys. Lett. A 271 (2000) 167, Proposition 1]. In the present Letter we will determine the maximal beable algebra for any normal state under the same conditions as Clifton's

Vacuum-assisted biopsy and steroid therapy for granulomatous lobular mastitis: report of three cases.

OpenAIRE

Kuba, Sayaka; Yamaguchi, Junzo; Ohtani, Hiroshi; Shimokawa, Isao; Maeda, Shigeto; Kanematsu, Takashi

2009-01-01

We report the cases of three patients with granulomatous lobular mastitis (GLM), who were treated successfully with low-dose steroid therapy. Furthermore, the findings of our review of 271 patients reported in the literature suggest that steroid therapy is the treatment of choice for GLM.

34 CFR 271.20 - What conditions must an applicant meet to obtain funding?

Science.gov (United States)

2010-07-01

... ensure its success; (k) The applicant, as part of its nondiscriminatory employment practices, shall ensure that its personnel are selected for employment without regard to race, color, national origin, gender, age or handicapping condition. (l) The project must have an adequate budget to support the...

Dickson et al., Afr J Tradit Complement Altern Med. (2012) 9(2):271 ...

African Journals Online (AJOL)

AJTCAM

*R.A. Dickson, Department of Pharmacognosy, Faculty of Pharmacy and ... Chronic inflammatory disorders: chronic non-healing ulcers, rheumatoid arthritis, chronic .... have been suggested to contribute to the mechanism of inflammation .... may be generated as by products of biological reactions or from exogenous factors.

271 A New Approach in the Social Field – Law No. 62/2011

Directory of Open Access Journals (Sweden)

Radu Răzvan Popescu

2012-05-01

Full Text Available Law no. 62/2011 of social dialogue, as it was regulated by the lawmaker, comes and reuniteswithin it a series of fundamental institutions in social matters, such as: social dialogue (trade unions,employees’ representatives, owners’ associations, the Economic and Social Council, the collectiveemployment contract, labour conflicts and, not lastly, a series of elements pertaining to labour jurisdiction. Itthus abrogates the old regulations in the matter: Law no. 54/2003 with respect to trade unions, Law no.356/2001 regarding owners’ associations, Law no. 109/1997 regarding the organizing and functioning of theEconomic and Social Council, Law no. 130/1996 with respect to the collective employment contracts, Lawno. 168/1999 regarding the settling of labour conflicts and Government Decision (G.D. no. 369/2009regarding the establishment and functioning of the social dialogue commissions at the level of the centralpublic administration and at the territorial level.

41 CFR 101-27.102-1 - Applicability.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...

Phenolic acid content and radical scavenging activity of extracts from medlar (Mespilus germanica L.) fruit at different stages of ripening

Czech Academy of Sciences Publication Activity Database

Grúz, Jiří; Ayaz, F. A.; Torun, H.; Strnad, Miroslav

2011-01-01

Roč. 124, č. 1 (2011), s. 271-277 ISSN 0308-8146 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : Phenolic acids * HPLC * Mass spectrometry * Fruit * Ripening Subject RIV: EF - Botanics Impact factor: 3.655, year: 2011

78 FR 54149 - Airworthiness Directives; Rolls-Royce plc (RR) Turbofan Engines

Science.gov (United States)

2013-09-03

... Airworthiness Directives; Rolls-Royce plc (RR) Turbofan Engines AGENCY: Federal Aviation Administration (FAA... service information identified in this AD, contact Rolls-Royce plc, Corporate Communications, P.O. Box 31... per hour. Replacement parts are estimated to cost about $2,271 per engine. Based on these figures, we...

Environmental, Health, and Safety Research Needs for Engineered Nanoscale Materials

Science.gov (United States)

2006-09-01

tubes ), the report addresses concerns over potential environmental and health risks of nanomaterials. Following the publication of the RS... microfine titanium dioxide as physical UV filter, Int. J. Cosmetic Sci. 22(4), 271–283 (2000). J. Brant, H. Lecoanet, M. Hotze, M. Wiesner, Comparison of

Biophysical properties and cellular toxicity of covalent crosslinked oligomers of α-synuclein formed by photoinduced side-chain tyrosyl radicals

Czech Academy of Sciences Publication Activity Database

Borsarelli, C.D.; Falomir-Lockhart, L.J.; Ostatná, Veronika; Fauerbach, J.A.; Hsiao, H.-H.; Urlaub, H.; Paleček, Emil; Jares-Erijman, E.A.; Jovin, T.M.

2012-01-01

Roč. 53, č. 4 (2012), s. 1004-1015 ISSN 0891-5849 R&D Projects: GA AV ČR(CZ) KJB100040901 Institutional research plan: CEZ:AV0Z50040702 Keywords : Parkinson's disease * neurodegeneration * oxidative stress Subject RIV: BO - Biophysics Impact factor: 5.271, year: 2012

The Relationship between Spirituality and the Use of Self-Regulation Strategies by Hospitalized Adult Oncology Patients

Science.gov (United States)

1991-01-01

Titlebaum, 1988. Stoyva, 1977; Vines, 1988; Wood & Pesut, 1981; Zahourek , 1988). However, any behavior an individual uses to consciously modify a...Journal of Nursing Research, 3, 263-271. Zahourek , K. (1987). Clinical hypnosis in holistic healing. Holistic Nursing Practice, 2(1), 15-24. 76 APPENDIX A

Securing the Aviation Transportation System

Science.gov (United States)

2007-12-01

additional 100,000 airport workers who perform duties in sterile areas (the indoor gate area past the security check point).197 These same...containing thirteen handguns, an assault rifle and eight pounds of marijuana .270 However, two Federal Air Marshals were also onboard the aircraft.271

Daphnia diversity in water bodies of the Po River Basin

Czech Academy of Sciences Publication Activity Database

Marková, Silvia; Maurone, C.; Racchetti, E.; Bartoli, M.; Rossi, V.

2017-01-01

Roč. 76, č. 2 (2017), s. 261-271 ISSN 1129-5767 Institutional support: RVO:67985904 Keywords : genetic diagnostic markers * invasive species * genetic differentiation Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 1.451, year: 2016

The Use of Atmospheric Pressure Chemical Ionization Mass Spectrometry with High Performance Liquid Chromatography and Other Separation Techniques for Identification of Triacylglycerols

Czech Academy of Sciences Publication Activity Database

Řezanka, Tomáš; Sigler, Karel

2007-01-01

Roč. 3, - (2007), s. 252-271 ISSN 1573-4110 R&D Projects: GA ČR GA203/06/0219 Institutional research plan: CEZ:AV0Z50200510 Keywords : triacylglycerols * atmospheric presssure chemical ionization * mass spectrometry Subject RIV: EE - Microbiology, Virology Impact factor: 1.815, year: 2007

Reassessing Spin-Coupled (Full Generalized Valence Bond) Descriptions of Ozone Using Three-Center Bond Indices.

Czech Academy of Sciences Publication Activity Database

Cooper, D.L.; Penotti, F.E.; Ponec, Robert

2017-01-01

Roč. 1116, Sl (2017), s. 40-49 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : full GVB and spin-coupled * PI-system in O3 * domain-averaged fermi holes Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 1.549, year: 2016

Serotonin and dopamine in the parabrachial nucleus of rats during conditioned taste aversion learning

Czech Academy of Sciences Publication Activity Database

Zach, P.; Křivánek, Jiří; Valeš, Karel

2006-01-01

Roč. 170, č. 2 (2006), s. 271-276 ISSN 0166-4328 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z5011922 Keywords : taste aversion * microdialysis * parabrachial nucleus Subject RIV: FH - Neurology Impact factor: 2.591, year: 2006

Investigations of the 1 KHZ Sound Absorption in Sea Water.

Science.gov (United States)

1983-01-15

York, 465 pages. Seward, T. M. (1974) Determination of the first ionization constant of silicic acid from quartz solubility in borate buffer...attenuation coefficient. J. Acoust. Soc. Am. 42, 270-271. Uppstrom, L (1968) A modified method for the determination of boron with curcumin and a simplified

Dicty_cDB: Contig-U13954-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 281 e-109 EU080331_1( EU080331 |pid:none) Phytophthora cuyabensis isolate PD... 294 e-109 EU079512_1( EU0795...D_0... 273 e-102 EU080357_1( EU080357 |pid:none) Phytophthora cuyabensis isolate PD... 271 e-102 CP000090_28

78 FR 54466 - Federal Open Market Committee; Domestic Policy Directive of July 30-31, 2013

Science.gov (United States)

2013-09-04

... percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of July 30-31... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

78 FR 70945 - Federal Open Market Committee; Domestic Policy Directive of October 29-30, 2013

Science.gov (United States)

2013-11-27

...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of October 29-30... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

78 FR 13673 - Federal Open Market Committee; Domestic Policy Directive of January 29-30, 2013

Science.gov (United States)

2013-02-28

... percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of January 29-30... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

78 FR 22880 - Federal Open Market Committee; Domestic Policy Directive of March 19-20, 2013

Science.gov (United States)

2013-04-17

...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of March 19-20... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

78 FR 43883 - Federal Open Market Committee; Domestic Policy Directive of June 18-19, 2013

Science.gov (United States)

2013-07-22

...\\ percent. The Committee directs the Desk to undertake open market operations as necessary to maintain such... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of June 18-19... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

Koncept polyfokálních sídel na příkladu vývoje obce Opařany na Táborsku

Czech Academy of Sciences Publication Activity Database

Dohnal, Martin

2012-01-01

Roč. 38, č. 2 (2012), s. 271-298 ISSN 0323-0988 R&D Projects: GA ČR(CZ) GAP410/11/1287 Keywords : urbanism * medieval settlement * Early Modern settlement * polyfocal settlement * 1400-1900 * Opařany (district of Tábor) Subject RIV: AC - Archeology, Anthropology, Ethnology

Characterisation of microsatellite loci in two species of lice, Polyplax serrata (Phthiraptera: Anoplura: Polyplacidae) and/nMyrsidea nesomimi (Phthiraptera: Amblycera: Menoponidae)

Czech Academy of Sciences Publication Activity Database

Martinů, Jana; Roubová, V.; Nováková, M.; Smith, V. S.; Hypša, Václav; Štefka, Jan

2015-01-01

Roč. 62, FEB 13 2015 (2015), 016 ISSN 1803-6465 R&D Projects: GA ČR GPP506/12/P529 Institutional support: RVO:60077344 Keywords : ectoparasite * population genetics * coevolution * Polypax * Myrsidea * evolution * Europe * Galapagos Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

78 FR 15338 - New York: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2013-03-11

... authorization of changes to its hazardous waste program under the Solid Waste Disposal Act, as amended, commonly... ENVIRONMENTAL PROTECTION AGENCY 40 CFR Part 271 [EPA-R02-RCRA-2013-0144; FRL-9693-3] New York: Final Authorization of State Hazardous Waste Management Program Revisions AGENCY: Environmental...

Lipothymia and Syncope—Aetiology and Outcome in a Prehospital Setting: A Retrospective Study

DEFF Research Database (Denmark)

Zwisler, Stine Thorhauge; Mikkelsen, Søren

2012-01-01

MECU runs registered, 678 were assignments in which the patients were diagnosed with lipothymia or syncope (3.8%). 578 patients (85%) were admitted to hospital. 278 of the patients were discharged directly from the emergency department, while 271 were admitted to a ward. 112 patients refused treatment...

Associations between witnessing parental violence and ...

African Journals Online (AJOL)

information concerning witnessing parental violence as a child, symptoms of depression during the current academic year. Logistic regression procedures were used to estimate odds ratios (OR) and 95% confidence intervals (95% CI). Results: Approximately 22.7% female students and 27.1% of the male students reported ...

48 CFR 1371.101 - Inspection and manner of doing work.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Inspection and manner of... DEPARTMENT SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.101 Inspection and manner of doing work. Insert clause 1352.271-70, Inspection and Manner of...

48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.

Science.gov (United States)

2010-10-01

... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...

Participants in School-Sponsored and Independent Sports: Perceptions of Self and Family.

Science.gov (United States)

Browne, Beverly A.; Francis, Sally K.

1993-01-01

Examined perceptions of social competence and family dynamics among adolescent participants in school-sponsored and independent sports (baseball and skateboarding). Findings from 271 adolescents revealed that perceptions of social competence were differentially related to degree of sports involvement and perceived skill but were not related to…

7 CFR 3016.50 - Closeout.

Science.gov (United States)

2010-01-01

... are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

45 CFR 2541.500 - Closeout.

Science.gov (United States)

2010-10-01

..., Federal agencies may extend this time frame. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable); (3) Final request for payment (SF-270) (if applicable); (4) Invention disclosure (if applicable); (5) Federally-owned property report. In accordance...

78 FR 34255 - Regulated Navigation Area; Vessel Traffic in Vicinity of Marseilles Dam; Illinois River

Science.gov (United States)

2013-06-07

... of Proposed Rulemaking TFR Temporary Final Rule RNA Regulated Navigation Area A. Regulatory History... Navigation Area (RNA) on the Illinois River. This Temporary Final Rule stipulates operational requirements... Mile Marker 240.0 to Mile Marker 271.4. This RNA is necessary to protect the general public, vessels...

Stesys software for computer-assisted stereology

Czech Academy of Sciences Publication Activity Database

Karen, Petr; Kubínová, Lucie; Krekule, Ivan

1998-01-01

Roč. 47, č. 4 (1998), s. 271-278 ISSN 0862-8408 R&D Projects: GA ČR GA304/97/0420; GA AV ČR IAA5011504; GA AV ČR IAA5011810 Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.616, year: 1998

Detection of Biological False Positive Syphilis Serum Reactions ...

African Journals Online (AJOL)

A comparative evaluation of reagin tests (Wassermann, VDRL, RPR) and fluorescent treponema antibody absorption tests (FTA-ABS) performed on blood specimens from 5 271 persons (2 493 pregnant women, 1 130 apparently healthy prospective employees, 1 345 newborn babies and 303 leprosy patients) showed that ...

Professional Development Urban Schools: What Do Teachers Say?

Science.gov (United States)

Green, Tanya R.; Allen, Mishaleen

2015-01-01

This quantitative causal-comparative study compared perceptions of professional development opportunities between high-achieving and low-achieving elementary-middle school teachers in an urban school district using the Standards Assessment Inventory (SAI). A total of 271 teachers participated including 134 (n = 134) teachers from high-achieving…

Restoration of hay meadows on ex-arable land: commercial seed mixtures vs. spontaneous succession

Czech Academy of Sciences Publication Activity Database

Lencová, K.; Prach, Karel

2011-01-01

Roč. 66, č. 2 (2011), s. 265-271 ISSN 0142-5242 R&D Projects: GA AV ČR IAA600050702 Institutional research plan: CEZ:AV0Z60050516 Keywords : grassland * rate of succession * species pool Subject RIV: EF - Botanics Impact factor: 1.099, year: 2011

Pramana – Journal of Physics | Indian Academy of Sciences

Indian Academy of Sciences (India)

Complex impedance spectroscopy indicates the existence of grain and grain boundary as two separate elements. pp 199-205 .... pp 271-276 Contributed Papers : Small-angle neutron scattering. Small-angle neutron and dynamic light scattering study of gelatin coacervates · B Mohanty ..... Lattice dynamics of lithium oxide.

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8531 ... ... INDIA (300) Apply INDIA filter · Governance (291) Apply Governance filter .... In much of the developing world, women unnecessarily suffer higher rates of ... of sickness or death affecting mothers and infants are easily preventable. ... the links between urban violence, poverty, and inequality.

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8531 ... ... INDIA (300) Apply INDIA filter · Governance (289) Apply Governance filter .... In much of the developing world, women unnecessarily suffer higher rates of ... of sickness or death affecting mothers and infants are easily preventable. ... the links between urban violence, poverty, and inequality.

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 8528 ... ... INDIA (300) Apply INDIA filter · Governance (292) Apply Governance filter .... In much of the developing world, women unnecessarily suffer higher rates of ... of sickness or death affecting mothers and infants are easily preventable. ... the links between urban violence, poverty, and inequality.

78 FR 20097 - Energy Savings Performance Contracts

Science.gov (United States)

2013-04-03

... procedures, scope definition, Measurement and Verification (M&V), financing procurement, and definition of... government. More than $2.71 billion has been invested in Federal energy efficiency and renewable energy... more than $7.18 billion of cumulative energy cost savings for the Federal Government. While FEMP has...

Trends in anthropogenic mercury emissions estimated for South Africa during 2000-2006

CSIR Research Space (South Africa)

Masekoameng, KE

2010-08-01

Full Text Available and general waste from each activity; using South Africa specific and toolkit based emission factors. In both atmospheric and solid waste releases, coal-fired power plants were estimated to be the largest contributors of Hg emissions, viz. 27.1 to 38.9 tonnes...

Mesophyll conductance to CO2 transport estimated by two independent methods: effect of variable CO2 concentration and abscisic acid

Czech Academy of Sciences Publication Activity Database

Vrábl, D.; Vašková, M.; Hronková, Marie; Flexas, J.; Šantrůček, Jiří

2009-01-01

Roč. 60, č. 8 (2009), s. 2315-2323 ISSN 0022-0957 R&D Projects: GA AV ČR(CZ) IAA601410505 Institutional research plan: CEZ:AV0Z50510513 Keywords : Carbon dioxide * mesophyll conductance * Helianthus annuus Subject RIV: ED - Physiology Impact factor: 4.271, year: 2009

Enzymatic production of human milk oligosaccharides

DEFF Research Database (Denmark)

Guo, Yao

. A recombinant Pasteurella multocida sialyltransferase (EC 2.4.99.-), namely PmST, exhibiting promiscuous trans-sialidase activities was examined. The enzyme catalysed α-2,3- and α-2,6- sialylation of lactose using either 2- O -(p-nitrophenyl)-α- D - N -acetylneuraminic acid or casein glycomacropeptide...... galactooligosaccharides with use of galactooligosaccharides as acceptors. Secondly, we examined the regioselectivity of five designed mutants of PmST catalysing synthesis of 3'- and 6'-sialyllactoses using casein glycomacropeptide and lactose as substrates. The mutants PmST E271F , PmST R313Y and PmST E271F/R313Y...... was almost abolished. The k cat / K m value for PmST P34H catalysing 6'-sialyllactose synthesis using 3'-sialyllactose as donor was 31.2 M -1 s -1 . Moreover, both the wild type enzyme and PmST P34H were capable of catalysing the hydrolysis and transfer of α-2,6 bound sialic acid....

Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

Czech Academy of Sciences Publication Activity Database

Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo

2009-01-01

Roč. 135, 3-4 (2009), s. 267-271 ISSN 0378-1135 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

41 CFR 109-27.102-50 - Systems contracting.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...

41 CFR 109-27.102-1 - Applicability.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...

41 CFR 109-27.102-51 - Policy.

Science.gov (United States)

2010-07-01

...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...

Obnova jezuitské koleje v Kutné Hoře

Czech Academy of Sciences Publication Activity Database

Frolík, Jan; Krejčík, J.; Muková, J.

2011-01-01

Roč. 71, č. 4 (2011), s. 266-271 ISSN 1210-5538 Institutional research plan: CEZ:AV0Z80020508 Keywords : Middle Ages * Kutná Hora * Jesuits Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.npu.cz/download/1321956876/11-11-21-ZPP-04-11-Frolik-Krejcik-Mukova.pdf

Work and Rest Patterns and Psychomotor Vigilance Performance of Crewmemebers of the USS Jason Dunham: A Comparison of the 3/9 and 6/6 Watchstanding Schedules

Science.gov (United States)

2014-12-31

4, 257–271. Albertsen, K., Rafnsdóttir, G. L., Grimsmo, A., Tómasson, K., & Kauppinen, K. (2008). Workhours and worklife balance . Scandinavian...consequences on balancing work and home life. Scientific evidence suggests that shift work has a negative influence on children’s well-being and on

Tangible and Intangible Rewards and Employee Creativity: The Mediating Role of Situational Extrinsic Motivation

Science.gov (United States)

Yoon, Hye Jung; Sung, Sun Young; Choi, Jin Nam; Lee, Kyungmook; Kim, Seongsu

2015-01-01

This study examined the effects of tangible and intangible forms of creativity-contingent rewards on employee creativity. Situation-specific intrinsic and extrinsic motivations were proposed as mediators of the reward-creativity link. Based on data collected from 271 employees and their supervisors, results revealed the following: (a) intangible…

76 FR 40118 - Spring 2011 Regulatory Agenda

Science.gov (United States)

2011-07-07

... way the economy, a sector of the economy, productivity, competition, jobs, the environment, [email protected] . Steve Fruh, Environmental Protection Agency, Air and Radiation, D243-02, RTP, NC 27711, Phone: 919 541-2837, Fax: 919 541-3207, E-mail: fruh.steve@epa.gov . RIN: 2060-AP69 271...

Annals of Medical and Health Sciences Research - Vol 4, No 2 (2014)

African Journals Online (AJOL)

Reservoir Complete Denture in a Patient with Xerostomia Secondary to Radiotherapy for Oral Carcinoma: A Case Report and Review of Literature · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Ladda, VO Kasat, SA Gangadhar, S Baheti, AJ Bhandari, 271-275.

Some Diophantine equations from finite group theory: $\\Phi_m (x) = 2p^n -1$

NARCIS (Netherlands)

Luca, F.; Moree, P.; Weger, de B.M.M.

2009-01-01

We show that the equation in the title (with Fn the nth cyclotomic polynomial) has no integer solution with n = 1 in the cases (m, p) = (15, 41), (15, 5581), (10, 271). These equations arise in a recent group theoretical investigation by Z. Akhlaghi, M. Khatami and B. Khosravi.

Some Diophantine equations from finite group theory: $\\Phi_m (x) = 2p^n -1$

NARCIS (Netherlands)

Luca, F.; Moree, P.; Weger, de B.M.M.

2011-01-01

We show that the equation in the title (with $\\Psi_m$ the $m$th cyclotomic polynomial) has no integer solution with $n \\geq 1$ in the cases (m,p) = (15,41), (15,5581), (10,271). These equations arise in a recent group theoretical investigation by Akhlaghi, Khosravi and Khatami.

Ultrastructure of the anterior organ and posterior funnel-shaped canal of Gyrocotyle urna Wagener, 1852 (Cestoda: Gyrocotylidea)

Czech Academy of Sciences Publication Activity Database

Poddubnaya, L. G.; Kuchta, Roman; Bristow, G.A.; Scholz, Tomáš

2015-01-01

Roč. 62, 2015 May 22 (2015), 027 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : scanning electron microscopy * transmission electron microscopy * basal cestodes * ultrastructural characters * phylogeny Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

Developing College Students' Civic Identity: The Role of Social Perspective Taking and Sociocultural Issues Discussions

Science.gov (United States)

Johnson, Matthew

2015-01-01

The development of college students' civic identity is understudied, but worthy of attention because of its salience to many students and higher education's commitment to fostering an engaged citizenry. Using 45,271 participants from the 2009 Multi-Institutional Study of Leadership, this study uses structural equation modeling to explore…

41 CFR 101-27.102 - Economic order quantity principle.

Science.gov (United States)

2010-07-01

... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order quantity (EOQ) principle is a means for achieving economical inventory management. Application of the EOQ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity...

41 CFR 109-27.102 - Economic order quantity principle.

Science.gov (United States)

2010-07-01

... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...

Long-range pseudorapidity dihadron correlations in d plus Au collisions at root S-NN=200 GeV

Czech Academy of Sciences Publication Activity Database

Adamczyk, L.; Bielčík, J.; Bielčíková, Jana; Chaloupka, P.; Federič, Pavol; Rusňák, Jan; Rusňáková, O.; Šimko, Miroslav; Šumbera, Michal; Tlustý, David; Trzeciak, B. A.; Vértési, Robert

2015-01-01

Roč. 747, JUL (2015), s. 265-271 ISSN 0370-2693 R&D Projects: GA ČR GA13-20841S Institutional support: RVO:61389005 Keywords : STAR collaboration * heavy ion collisions * time projection chamber Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.787, year: 2015

78 FR 33841 - Federal Open Market Committee; Domestic Policy Directive of April 30-May 1, 2013

Science.gov (United States)

2013-06-05

... from 0 to \\1/4\\ percent. The Committee directs the Desk to undertake open market operations as... FEDERAL RESERVE SYSTEM Federal Open Market Committee; Domestic Policy Directive of April 30-May 1... 271), there is set forth below the domestic policy directive issued by the Federal Open Market...

76 FR 13536 - Airworthiness Directives; Bombardier, Inc. Model CL-600-2C10 (Regional Jet Series 700, 701, & 702...

Science.gov (United States)

2011-03-14

...., Monday through Friday, except Federal holidays. For service information identified in this proposed AD...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory..., 135, 139, 142, 145, 146, 266, 268, 271, 274, 276, 277, 280, 282 through 285 inclusive, 290, 292, 294...

Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study

Czech Academy of Sciences Publication Activity Database

Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.

2003-01-01

Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003

A Biomathematical Model of the Restoring Effects of Caffeine on Cognitive Performance During Sleep Deprivation

Science.gov (United States)

2013-01-01

Eddington, N.D., 2002. The rate of absorption and relative bioavailability of caffeine administered in chewing gum versus capsules to normal healthy...S., Dagan, Y., Shenkman, L., 2002. The effects of coffee consumption on sleep and melatonin secretion. Sleep Med. 3, 271–273. Syed, S.A., Kamimori

6Li MAS NMR Study of Lithium Insertion into Hydrothermally Prepared Li-Ti-O Spinel

Czech Academy of Sciences Publication Activity Database

Krtil, Petr; Dědeček, Jiří; Kostlánová, Tereza; Brus, Jiří

2004-01-01

Roč. 7, č. 7 (2004), A163-A166 ISSN 1099-0062 R&D Projects: GA ČR GA203/03/0823 Institutional research plan: CEZ:AV0Z4040901 Keywords : lithium insertion * spinel * NMR Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.271, year: 2004

High-Frequency Network Activity, Global Increase in Neuronal Activity, and Synchrony Expansion Precede Epileptic Seizures in Vitro

Czech Academy of Sciences Publication Activity Database

Jiruška, P.; Csicsvari, J.; Powell, A.V.; Fox, J.E.; Chang, W.C.; Vreugdenhil, M.; Li, X.; Paluš, Milan; Bujan, A.F.; Dearden, R.W.; Jefferys, J. G. R.

2010-01-01

Roč. 30, č. 16 (2010), s. 5690-5701 ISSN 0270-6474 Institutional research plan: CEZ:AV0Z10300504 Keywords : mammalian hippocampus invitro * temporal - lobe epilepsy * nonsynaptic epileptogenesis * spatiotemporal dynamics * after-discharges * pyramidal cells * oscillations * rat * calcium * slice Subject RIV: FH - Neurology Impact factor: 7.271, year: 2010

Hospital centralization and performance in Denmark - ten years on

DEFF Research Database (Denmark)

Christiansen, Terkel; Vrangbæk, Karsten

2018-01-01

Denmark implemented a major reform of the administrative and political structure in 2007 when the previous 13 counties were merged into five new regions and the number of municipalities was reduced from 271 to 98. A main objective was to create administrative units that were large enough to suppo...

Hospital centralization and performanced in Denmark - ten years on

DEFF Research Database (Denmark)

Christiansen, Terkel; Vrangbæk, Karsten

2017-01-01

Denmark implemented a major reform of the administrative and political structure in 2007 when the previous 13 counties were merged into five new regions and the number of municipalities was reduced from 271 to 98. A main objective was to create administrative units that were large enough to suppo...

Capillary electrochromatography of proteins and peptides (2006–2015)

Czech Academy of Sciences Publication Activity Database

Mikšík, Ivan

2017-01-01

Roč. 40, č. 1 (2017), s. 251-271 ISSN 1615-9306 R&D Projects: GA ČR(CZ) GA15-01948S Institutional support: RVO:67985823 Keywords : capillary electrochromatography * peptides * proteins Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 2.557, year: 2016

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 420 ... Home Politics Abroad : Role of Lebanese Diaspora in Conflict, ... Gender and Work in the Middle East and North Africa : Research ... the mismatch between the abundance of qualified women in the ... Son Preference in China and India : Policy Interventions to address Discrimination against Girls.

On the penetration of aqueous solutions into pristine and radiation damaged polymers

Czech Academy of Sciences Publication Activity Database

Ghosh, S.; Klett, R.; Fink, D.; Dwivedi, K. K.; Vacík, Jiří; Hnatowicz, Vladimír; Červená, Jarmila

1999-01-01

Roč. 55, - (1999), s. 271-284 ISSN 0969-806X R&D Projects: GA ČR GA203/99/1626; GA ČR GA202/96/0077; GA AV ČR KSK1010601 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.512, year: 1999

Biochemical evidence for the activation of distinct subsets of mitogen-activated protein kinases by voltage and defense-related stimuli

Czech Academy of Sciences Publication Activity Database

Link, V.; Hofmann, M.; Sinha, A.; Ehness, R.; Strnad, Miroslav; Roitsch, T.

2002-01-01

Roč. 128, č. 1 (2002), s. 271-281 ISSN 0032-0889 R&D Projects: GA MŠk OC 844.10 Institutional research plan: CEZ:AV0Z5038910 Keywords : TOBACCO SUSPENSION CULTURE * CYCLIN DEPENDENT KINASES * CYTOSOLIC CALCIUM ION Subject RIV: CE - Biochemistry Impact factor: 5.800, year: 2002

Application of capillary electrochromatography using macroporous polyacrylamide columns for the analysis of lignans from seeds of Schisandra chinensis

Czech Academy of Sciences Publication Activity Database

Kvasničková, L.; Glatz, O.; Štěrbová, H.; Kahle, Vladislav; Slanina, J.; Musil, P.

2001-01-01

Roč. 916, 1-2 (2001), s. 265-271 ISSN 0021-9673 R&D Projects: GA ČR GA303/00/D062 Institutional research plan: CEZ:AV0Z4031919 Keywords : electrochromatography * Schisandra chinensis * plant materials Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.793, year: 2001

File list: InP.CDV.05.AllAg.HUVEC [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available InP.CDV.05.AllAg.HUVEC hg19 Input control Cardiovascular HUVEC SRX220065,SRX294968,...271,SRX425273,SRX220068,SRX425270,SRX190192,SRX220067 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.CDV.05.AllAg.HUVEC.bed ...

29 CFR 1470.50 - Closeout.

Science.gov (United States)

2010-07-01

... agencies may extend this timeframe. These may include but are not limited to: (1) Final performance or... Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance with § 1470.32(f...

41 CFR 109-27.102-52 - Implementation.

Science.gov (United States)

2010-07-01

... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...

Adoption of Integrated Pest Management among Cocoa Farmers in ...

African Journals Online (AJOL)

The determinants of adoption of IPM among cocoa farmers were investigated in Cross Rivers State, 271 trained cocoa farmers were systematically selected out of 2704 while in Osun State 107 were selected out of 1070. Structured questionnaire was used to obtain data on respondents' socio-economic characteristics, ...

Statistical interpretation of WEBNET seismograms by artificial neural nets

Czech Academy of Sciences Publication Activity Database

Plešinger, Axel; Růžek, Bohuslav; Boušková, Alena

2000-01-01

Roč. 44, č. 2 (2000), s. 251-271 ISSN 0039-3169 R&D Projects: GA AV ČR IAA312104; GA ČR GA205/99/0907 Institutional research plan: CEZ:AV0Z3012916 Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.761, year: 2000

Succinobucol induces apoptosis in vascular smooth muscle cells

Czech Academy of Sciences Publication Activity Database

Midwinter, R.G.; Maghzal, G.; Dennis, J.M.; Wu, B.J.; Cai, H.; Kapralov, A.A.; Belikova, N.A.; Tyurina, Y.Y.; Dong, L. F.; Khachigian, L.; Neužil, Jiří; Kagan, V.E.; Stocker, R.

2012-01-01

Roč. 52, č. 5 (2012), s. 871-879 ISSN 0891-5849 R&D Projects: GA ČR(CZ) GAP301/10/1937 Institutional research plan: CEZ:AV0Z50520701 Keywords : reactive oxygen species * free radicals * apoptosis Subject RIV: EA - Cell Biology Impact factor: 5.271, year: 2012

Thoracic wall lipoblastoma: a rare case with rare presentation

African Journals Online (AJOL)

Sama Savli Road, 390024 Vadodara, Gujarat. Tel: +919879609195; e-mail: muleyprasad@yahoo.com. Received 14 December 2011 accepted 16 January .... lipoblastoma involving the right common iliac artery and vein. Eur J Pediatr. Surg 2003; 13:268–271. 6 Lorenzen JC, Godballe C, Kerndrup GB. Lipoblastoma of the ...

Distinct conformational changes in activated agonist-bound and agonist-free glycine receptor subunits

DEFF Research Database (Denmark)

Pless, Stephan Alexander; Lynch, Joseph W

2009-01-01

Ligand binding to Cys-loop receptors produces either global conformational changes that lead to activation or local conformational changes that do not. We found that the fluorescence of a fluorophore tethered to R271C in the extracellular M2 region of the alpha1 glycine receptor increases during ...

48 CFR 1371.117 - Lay days.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Lay days. 1371.117 Section... REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.117 Lay days. Insert clause 1352.271-86, Lay Days, in all solicitations and contracts for ship repair. ...

Epidemiological studies of the incidence of pathogenic ...

African Journals Online (AJOL)

STORAGESEVER

2008-08-18

Aug 18, 2008 ... animals from the rural zone and two (2)(7.1%) were positive for ... The trend of infection by Campylobacter as exemplified in this study was pig, ... pattern of infectious diseases. ... lethally damaged by exposure to low temperatures hence ..... identification to species level, and fingerprinting of Campylobacter.

Assessment set for evaluation of clinical outcomes in multiple sclerosis: psychometric properties

Czech Academy of Sciences Publication Activity Database

Řasová, K.; Martinková, Patrícia; Vyškovská, J.; Šedová, Michaela

-, č. 3 (2012), s. 59-70 ISSN 1179-271X R&D Projects: GA MŠk(CZ) 1M06014 Grant - others:GA MZd(CZ) 1A8628 Institutional support: RVO:67985807 Keywords : outcome assessment * reproducibility of results * psychometric properties * test–retest reliability * internal consistency Subject RIV: FP - Other Medical Disciplines

Studies on ascaridid, oxyurid and enoplid nematodes (Nematoda) from fishes of the Okavango River, Botswana

Czech Academy of Sciences Publication Activity Database

Moravec, František; Van As, L. L.

2015-01-01

Roč. 62, JUL 22 2015 (2015), s. 039 ISSN 1803-6465 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : helminth parasites, * taxonomy * new species, * Cucullanus * Cithariniella * Synodontisia * Galeiceps * freshwater fish * Africa Subject RIV: EG - Zoology Impact factor: 1.271, year: 2015

78 FR 14697 - Final Flood Elevation Determinations

Science.gov (United States)

2013-03-07

... Communities affected elevation above ground [caret] Elevation in meters (MSL) Modified Cecil County, Maryland... 1 to Stone Run At the Stone Run +271 Town of Rising Sun, confluence. Unincorporated Areas of Cecil County. Approximately 460 feet +359 downstream of Pierce Road. Tributary 2 to Stone Run At the Stone Run...

Resonance – Journal of Science Education | News

Indian Academy of Sciences (India)

The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

molluscum contagiosum virus infection amongst plwha in ibadan

African Journals Online (AJOL)

boaz

inflammatory genital infections diagnosed were; genital warts-(35.0%), bacterial vaginosis (27.1%), trichomoniasis (10.0 %) and tinea cruris (0.5%). MC patients had higher viral load, low CD4count. (mean-85 cells/mm3) and more likely to be treatment experienced. TABLE 1: ODD RATIO FOR TREATMENT STATUS AND ...

Ipeaiyeda et al (15)

African Journals Online (AJOL)

DELL

have deleterious effect on human health on account of SO concentration. A strong positive ... proper management of the total environment, it is thoughtful to .... of solar radiation on the earth's surface. ... It is likely that cloud water that accumulates in this sampling .... Environment Modelling and Softwares. 27(1): 35 – 42.

Adenosine triphosphate analogs can efficiently inhibit the Zika virus RNA-dependent RNA polymerase

Czech Academy of Sciences Publication Activity Database

Hercík, Kamil; Kozák, Jaroslav; Šála, Michal; Dejmek, Milan; Hřebabecký, Hubert; Zborníková, Eva; Smola, Miroslav; Růžek, Daniel; Nencka, Radim; Bouřa, Evžen

2017-01-01

Roč. 137, Jan (2017), s. 131-133 ISSN 0166-3542 R&D Projects: GA ČR GA15-09310S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : hepatitis C virus * borne encephalitis virus * crystal structure Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 4.271, year: 2016

The National Benchmark Test of quantitative literacy: Does it ...

African Journals Online (AJOL)

Windows User

A total of 263,464 of these learners wrote this examination at the end of that year. On the .... it requires the activation of a range of enabling knowledge .... English. 197. 5.74. 708. 56.46. 821. 54.73 42 95.45 131 100 1,899. Xhosa. 1,271 37.01.

Teachers' Mastery Goals: Using a Self-Report Survey to Study the Relations between Teaching Practices and Students' Motivation for Science Learning

Science.gov (United States)

Vedder-Weiss, Dana; Fortus, David

2018-01-01

Employing achievement goal theory (Ames "Journal of Educational psychology," 84(3), 261-271, 1992), we explored science teachers' instruction and its relation to students' motivation for science learning and school culture. Based on the TARGETS framework (Patrick et al. "The Elementary School Journal," 102(1), 35-58, 2001) and…

Measurement of the cosmic background radiation temperature at 6.3 cm

International Nuclear Information System (INIS)

Mandolesi, N.; Calzolari, P.; Cortiglioni, S.; Morigi, G.

1984-01-01

We present results of a measurement of the cosmic background radiation temperature at a wavelength of 6.3 cm. We obtained the value T/sub CBR/ = 2.71 +- 0.20 K. This is in good agreement with, and has a smaller error than, any previous measurement at equal or longer wavelengths

Better Men? Gendered Culturalized Citizenship in Male Emancipation Projects in the Netherlands

NARCIS (Netherlands)

Huis, I.B. van; Gelfer, J.

2014-01-01

After a focus on migrant women’s emancipation (Roggeband & Verloo. Social Policy & Administration, 41(3), 271–288, 2007), migrant men have become a specific target group of culturalized citizenship politics as well. In the Netherlands, men are targeted on a national level as well as on the level of

How many species of whipworms do we share? Whipworms from man and other primates form two phylogenetic lineages

Czech Academy of Sciences Publication Activity Database

Doležalová, J.; Oborník, M.; Hajdušková, E.; Jirků, M.; Petrželková, Klára Judita; Bolechová, P.; Cutillas, C.; Callejon, R.; Jaroš, J.; Beránková, Z.; Modrý, D.

2015-01-01

Roč. 62, č. 063 (2015) ISSN 0015-5683 R&D Projects: GA ČR GA524/06/0264; GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : Trichuris * phylogeny * diversity * zoonotic potential * humans Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.271, year: 2015

Single-Molecule Manipulation of Double-Stranded DNA Using Optical Tweezers: Interaction Studies of DNA with RecA and YOYO-1

NARCIS (Netherlands)

Bennink, Martin L.; Scharer, Orlando D.; Kanaar, Ronald; Sakata-Sogawa, Kumiko; Schins, J.M.; Kanger, Johannes S.; de Grooth, B.G.; Greve, Jan

1999-01-01

By using optical tweezers and a specially designed flow cell with an integrated glass micropipette, we constructed a setup similar to that of Smith et al. (Science 271:795-799, 1996) in which an individual double-stranded DNA (dsDNA) molecule can be captured between two polystyrene beads. The first

On some singular limits in damped radiation hydrodynamics

Czech Academy of Sciences Publication Activity Database

Blanc, X.; Ducomet, B.; Nečasová, Šárka

2016-01-01

Roč. 13, č. 2 (2016), s. 249-271 ISSN 0219-8916 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible * Euler * damping Subject RIV: BA - General Mathematics Impact factor: 0.940, year: 2016 http://www.worldscientific.com/doi/10.1142/S0219891616500089

Gclust Server: 85869 [Gclust Server

Lifescience Database Archive (English)

Full Text Available equence length 496 Representative annotation D-lactate dehydrogenase, part of the retrograde regulon which c...rograde regulon which consists of genes whose expression is stimulated by damage to...85869 SCE_YEL071W=DLD3 Cluster Sequences Related Sequences(271) 496 D-lactate dehydrogenase, part of the ret

Same- and Other-Sex Popularity and Preference during Early Adolescence

Science.gov (United States)

Bowker, Julie C.; Adams, Ryan E.; Bowker, Matthew H.; Fisher, Carrie; Spencer, Sarah V.

2016-01-01

This study examined the longitudinal and bidirectional relations between same-sex (SS) and other-sex (OS) popularity and preference across one school year. Participants were 271 sixth-grade students who completed peer nomination measures at three time points in their schools. Tests of cross-lagged autoregressive models indicated that SS popularity…

Application of a chlorophyll index derived from satellite data to ...

African Journals Online (AJOL)

Application of a chlorophyll index derived from satellite data to investigate the variability of phytoplankton in the Benguela ecosystem. H Demarcq, R Barlow, L Hutchings. Abstract. No Abstract. African Journal of Marine Science Vol.29(2) 2007: pp. 271-282. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD ...

Time to give in

DEFF Research Database (Denmark)

Agger Nielsen, Jeppe; Andersen, Kim Normann; Medaglia, Rony

2009-01-01

This paper presents the results of a survey on the opinions of Danish local government managers on the future use of IT after the merger of 271 municipalities into 100. Findings show that the highest expectations on the outcome of IT implementation are related to increased efficiency and to new a...

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Earth System Science. C S Jha. Articles written in Journal of Earth System Science. Volume 122 Issue 2 April 2013 pp 271-281. Landscape level assessment of critically endangered vegetation of Lakshadweep islands using geo-spatial techniques · C Sudhakar Reddy Bijan Debnath P Hari ...

38 CFR 17.802 - Application provisions.

Science.gov (United States)

2010-07-01

..., (D) Names of at least two references of government or community groups whom the organization has... operating policies addressing structure for democratic self-government, expulsion policies for nonpayment... plans for use of the loan proceeds. (Authority: Sec. 8 of Pub. L. 102-54, 105 Stat. 271, 38 U.S.C. 501) ...

International Conference on Rehabilitation Engineering: Proceedings (2nd, Ottawa, Canada, June 17-22, 1984). Combined with RESNA 7th Annual Conference. Volume 4 = Conference internationale sur la technologie de reeducation fonctionnelle: compet rendu (2nd, Ottawa, Canada, Juin 17-22, 1984). Tenue parallelement a la RESNA 7e conference annuelle.

Science.gov (United States)

Rehabilitation Engineering Society of North America, Washington, DC.

These proceedings contain 271 papers in English and 15 in French, representing research and development efforts in 19 countries. On the topic of wheelchairs, 28 papers address their design, performance, evaluation, and fabrication. The field of prosthetics and orthotics is represented by 33 papers discussing devices for upper extremities, lower…

DNA modifications by platinum antitumor drugs and its recognition by DNA-binding proteins

Czech Academy of Sciences Publication Activity Database

Brabec, Viktor

2004-01-01

Roč. 271, Suppl. 1 (2004), s. 90 ISSN 0014-2956. [Meeting of the Federation of the European Biochemical Societies /29./. 26.06.2004-01.07.2004, Warsaw] R&D Projects: GA ČR GA305/02/1552 Keywords : platinum drugs * DNA-protein interaction * NF-kappaB Subject RIV: BO - Biophysics

Water SA - Vol 28, No 3 (2002)

African Journals Online (AJOL)

The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. http://dx.doi.org/10.4314/wsa.v28i3.4894 ...

Stress And Strain Analysis of The Hip Joint Using FEM

Czech Academy of Sciences Publication Activity Database

Vaverka, M.; Návrat, Tomáš; Vrbka, M.; Florian, Z.; Fuis, Vladimír

2006-01-01

Roč. 14, 4-5 (2006), s. 271-279 ISSN 0928-7329 R&D Projects: GA ČR GA101/05/0136 Institutional research plan: CEZ:AV0Z20760514 Keywords : hip FEM surgace replacement pathological contact pressure stress * hip FEM surgace replacement pathological contact pressure stress Subject RIV: BO - Biophysics

The Relations between Teasing and Bullying and Middle School Standardized Exam Performance

Science.gov (United States)

Lacey, Anna; Cornell, Dewey; Konold, Timothy

2017-01-01

This study examined the relations between the schoolwide prevalence of teasing and bullying (PTB) and schoolwide academic performance in a sample of 271 Virginia middle schools. In addition, the study examined the mediating effects of student engagement. A three-step sequence of path models investigated associations between schoolwide PTB and…

45 CFR 92.50 - Closeout.

Science.gov (United States)

2010-10-01

... agencies may extend this timeframe. These may include but are not limited to: (1) Final performance or... Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance with § 92.32(f), a...

45 CFR 602.50 - Closeout.

Science.gov (United States)

2010-10-01

... agencies may extend this timeframe. These may include but are not limited to: (1) Final performance or... Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance with § 602.32(f), a...

Publications | Page 28 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 6389 ... Reducing poverty in Atlas Mountains. Wood is a scarce resource across North Africa, yet it is commonly used in rural areas as fuel for baking bread in traditional ovens. Rural households can burn through more than one tonne of firewood a year, threatening to deplete forests.

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Home; Journals; Journal of Biosciences. Girish J Kotwal. Articles written in Journal of Biosciences. Volume 28 Issue 3 April 2003 pp 265-271 Articles. Vaccinia complement control protein: Multi-functional protein and a potential wonder drug · Purushottam Jha Girish J Kotwal · More Details Abstract Fulltext PDF. Vaccinia ...

Impact of Supernova and Cosmic-Ray Driving on the Surface Brightness of the Galactic Halo in Soft X-Rays

Czech Academy of Sciences Publication Activity Database

Thomas, P.; Girichidis, P.; Gatto, A.; Naab, T.; Walch, S.; Wünsch, Richard; Glover, S.C.O.; Clark, P.C.; Klessen, R.S.; Baczynski, C.

2015-01-01

Roč. 813, č. 2 (2015), L27/1-L27/7 ISSN 2041-8205 R&D Projects: GA ČR GAP209/12/1795 Institutional support: RVO:67985815 Keywords : galaxy halo * ISM kinematics and dynamics * stars formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.487, year: 2015

Parental Employment and Child Behaviors: Do Parenting Practices Underlie These Relationships?

Science.gov (United States)

Hadzic, Renata; Magee, Christopher A.; Robinson, Laura

2013-01-01

This study examined whether hours of parental employment were associated with child behaviors via parenting practices. The sample included 2,271 Australian children aged 4-5 years at baseline. Two-wave panel mediation models tested whether parenting practices that were warm, hostile, or characterized by inductive reasoning linked parent's hours of…

Distribution of elements among minerals of a single (muscovite-) biotite granite sample – an optimal approach and general implications

Czech Academy of Sciences Publication Activity Database

Janoušek, V.; Navrátil, Tomáš; Trubač, J.; Strnad, J.; Laufek, F.; Minařík, Luděk

2014-01-01

Roč. 65, č. 4 (2014), s. 257-271 ISSN 1335-0552 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : modal analyses * trace-element residence * ICP -MS * Central Bohemian Plutonic Complex * Říčany granite Subject RIV: DD - Geochemistry Impact factor: 0.761, year: 2014

Localization of the xeroderma pigmentosum group B-correcting gene ERCC-3 to human chromosome 2q21.

NARCIS (Netherlands)

G. Weeda (Geert); J. Wiegant; M. van der Ploeg; A.H.M. Geurts van Kessel (Ad); A.J. van der Eb; J.H.J. Hoeijmakers (Jan)

1991-01-01

textabstractThe human excision-repair gene ERCC3 was cloned after DNA-mediated gene transfer to the uv-sensitive Chinese hamster ovary mutant cell line 27-1, a member of complementation group 3 of the excision-defective rodent cell lines. The ERCC3 gene specifically corrects the DNA repair defect of

Impairment of mitochondrial function of rat hepatocytes by high fat diet and oxidative stress

Czech Academy of Sciences Publication Activity Database

Garnol, T.; Endlicher, R.; Kučera, O.; Drahota, Zdeněk; Červinková, Z.

2014-01-01

Roč. 63, č. 2 (2014), s. 271-274 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LL1204 Grant - others:Univerzita Karlova(CZ) PRVOUK P37/02 Institutional support: RVO:67985823 Keywords : hepatocytes * high fat diet * mitochondrial activities * ROS Subject RIV: ED - Physiology Impact factor: 1.293, year: 2014

EROI and the Icelandic society

DEFF Research Database (Denmark)

Atlason, Reynir Smari

2018-01-01

In this paper, the societal Energy Return on Investment (EROIsoc) is estimated for Iceland between 1960 and the present. The results indicate that the overall EROIsoc was around 27:1 in the early 1960s, and was volatile for a period of time before stabilizing at around 45:1 in 1974 after establis...

77 FR 53214 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year...

Science.gov (United States)

2012-08-31

...,104 Center, Inc. Center. AZ Casa Sierra Vista, Casa Sierra Vista.... 600-A E 25th St...... Yuma 30 190........... 246 176,271 Senior Citizens Avenue. Housing, LTD. NM New Mexico-American La Resolana 1025 Chelwood... Corporation. OH CRS, Ltd (Stern Hendy Clifton Place........ 900 Rue De La Paix... Cincinnati 183 375,387...

Modulation of Phospholipase A2 Activity by Actin and Myosin.

Science.gov (United States)

1987-04-15

cord vein. Thromb. Res. 18:787-795. 11. Knull. H.R.. W.F. Taylor. and W.W. Wells. 1974. Insulin effects on brain energy metabolism and the related...cells. Nature 271:549-551. I 14. Martin. T.W.. R.B. Wysolmerski. and D. Lagunoff. 1987. Phosphatidylcholine metabolism in endothelial cells: evidence for

Socio-Demographic and Maternal Factors in Anaemia in Pregnancy ...

African Journals Online (AJOL)

Low educational attainment [Adjusted Odds Ratio (AOR)=2.13], being single or divorced [AOR=2.02], high parity [AOR=2.06], late booking [AOR=2.71] and short intervals between pregnancies [AOR=2.37] were significant predictors of anaemia in pregnancy. The high prevalence of anaemia in pregnancy related to low ...

Balones que inspiran

Directory of Open Access Journals (Sweden)

Daniel Samper Pizano

2005-09-01

Full Text Available Unión Magdalena "el fervor de un pueblo". Varios Autores. Universidad del Magdalena, Santa Marta, 2004, 271 págs., il. Rey de corazones. El Medellín, una pasión crónica. Varios autores. Medellín, Pregón Ediciones, 2004, 162 págs.

75 FR 53321 - Prospective Grant of a Co-Exclusive License: Natural Plant Extracts From Incense Cedar as Pest...

Science.gov (United States)

2010-08-31

... Grant of a Co-Exclusive License: Natural Plant Extracts From Incense Cedar as Pest Control Agents and...,629,387, ``Compounds for Pest Control and Methods for Their Use,'' issued December 8, 2009; and U.S. Pat. No. 7,129,271, ``Compounds for Pest Control and Methods for Their Use,'' issued October 31, 2006...

Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

Czech Academy of Sciences Publication Activity Database

Vávra, Jiří; Becnel, J. J.

2007-01-01

Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

Suitability of food plants for Oxycarenus lavaterae (Heteroptera: Lygaeidae), a mediterranean bug invasive in Central and South-East Europe

Czech Academy of Sciences Publication Activity Database

Kalushkov, P.; Nedvěd, Oldřich

2010-01-01

Roč. 63, č. 2 (2010), s. 271-276 ISSN 1310-1331 Grant - others:Bulgarian National Science Fund, Ministry of Education and Science(BG) B-1508 Institutional research plan: CEZ:AV0Z50070508 Keywords : Oxycarenus lavaterae * host plant specificity * fecundity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.219, year: 2010

Spectrum of neurosurgical complications following medical tourism ...

African Journals Online (AJOL)

Background and objectives: The cost of medical care and availability of resources (human and facilities) which .... All the patients travelled by air lasting at least 6 hours, ... commercial airlines even for that had emergent clinical .... 5. Whittaker A: Pleasure and pain: Medical travel in. Asia. Glob Public Health 2008; 3:271. 6.

Discrimination, Mastery, and Depressive Symptoms among African American Men

Science.gov (United States)

Watkins, Daphne C.; Hudson, Darrell L.; Caldwell, Cleopatra Howard; Siefert, Kristine; Jackson, James S.

2011-01-01

Purpose: This study examines the influence of discrimination and mastery on depressive symptoms for African American men at young (18-34), middle (35-54), and late (55+) adulthood. Method: Analyses are based on responses from 1,271 African American men from the National Survey of American Life (NSAL). Results: Discrimination was significantly…

77 FR 35104 - Notice of Request To Release Airport Property at Merrill Field Airport, Anchorage, AK

Science.gov (United States)

2012-06-12

... delivered to: Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041 B Street, Anchorage, AK 99503...- 271-3665, email [email protected] or Michelle Colby, Real Estate Services Manager, DOWL HKM, 4041... Section 6.13 of the State of Alaska Right of Way Manual. This purchase offer was predicated on DOT&PF's...

SINET: Ethiopian Journal of Science - Vol 22, No 2 (1999)

African Journals Online (AJOL)

... evaluation of Phytomyza orobanchia (Diptera: Agromyzidae) as a controller of Orobanche spp in Ethiopia, EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A E M Elzein, J Kroschel, Assefa Admasu, Masresha Fetene, 271-282. http://dx.doi.org/10.4314/sinet.v22i2.

Geochemical characteristics and petrogenesis of phonolites and trachytic rocks from the České Středohoří Volcanic Complex, the Ohře Rift, Bohemian Massif

Czech Academy of Sciences Publication Activity Database

Ackerman, Lukáš; Ulrych, Jaromír; Řanda, Zdeněk; Erban, V.; Hegner, E.; Magna, T.; Balogh, K.; Frána, Jaroslav; Lang, Miloš; Novák, Jiří Karel

224/225, May (2015), s. 256-271 ISSN 0024-4937 R&D Projects: GA AV ČR IAA3048201 Institutional support: RVO:67985831 ; RVO:61389005 Keywords : phonolite * trachyte * Sr–Nd–Li isotopes * Cenozoic alkaline volcanism * Ohře (Eger) Rift * Bohemian Massif Subject RIV: DD - Geochemistry Impact factor: 3.723, year: 2015