WorldWideScience

Sample records for seaborgium 270

  1. First thermochemical property of Seaborgium determined

    Energy Technology Data Exchange (ETDEWEB)

    Tuerler, A. for a LBNL Berkeley - Univ. Bern - FLNR Dubna -GSI Darmstadt - TU Dresden - Chalmers Univ. of Technology Goeteborg - GH Kassel - ITS and LLNL Livermore - Univ. Mainz - Univ. Oslo - FZ Rossendorf - JAERI Tokai - PSI Villigen collaboration

    1997-09-01

    The chemical properties of SgO{sub 2}Cl{sub 2} (element 106 = Seaborgium, Sg) were successfully studied using the On-line Gas Chromatography Apparatus (OLGA III). After chemical separation of Sg the nuclides {sup 265}Sg and {sup 266}Sg were unambiguously identified and their half-lives were determined for the first time. The Sg nuclides were produced from the {sup 248}Cm({sup 22}Ne,4,5n){sup 266,265}Sg reaction at the GSI Darmstadt UNILAC accelerator. Simultaneously, short-lived W nuclides were produced from a small admixture of {sup 152}Gd to the Cm target material. As predicted by relativistic calculations and by extrapolations of chemical properties, it was demonstrated that Sg oxychlorides are indeed less volatile than their lighter homologue Mo- and equally or less volatile than W-oxychlorides. (author) 1 fig., 1 tab., 4 refs.

  2. Sorption behaviour of W, Hf, Lu, U, and Th on ion exchangers from HCl/H2O2 solutions. Model experiments for chemical studies of seaborgium (Sg)

    International Nuclear Information System (INIS)

    Schumann, D.; Andrassy, M.; Nitsche, H.; Misiak, R.; Schaedel, M.; Bruechle, W.; Schausten, B.; Kratz, J.V.

    1997-08-01

    In model experiments with W, Hf, Th, and U radionuclides, a chemical system was developed for the separation of seaborgium from element 104 and heavy actinides, i.e., cation exchange on DOWEX 50 x 8 from solutions containing 0.1-1.0 M HCl and 0.5-2.0 vol.% H 2 O 2 . The system should be suitable for fast on-line experiments if seaborgium exibits a non-uranium-like behaviour. Adding hydrogen peroxide to mixed HCl/HF solutions suppresses the partial sorption of W and, presumably seaborgium, on the cation exchanger. This way, the elution volume can be minimized. Prospects for anion exchange separations of group 6 from 4 elements are also briefly discussed. (orig.)

  3. First aqueous chemistry with Seaborgium (element 106)

    International Nuclear Information System (INIS)

    Schaedel, M.; Bruechle, W.; Schausten, B.; Schimpf, E.; Jaeger, E.; Wirth, G.; Guenther, R.; Gregorich, K.E.; Hoffman, D.C.; Lee, D.M.; Sylwester, E.R.; Nagame, Y.; Oura, Y.

    1996-11-01

    For the first time, chemical separations of element 106 (Seaborgium, Sg) were performed in aqueous solutions. The isotopes 265 Sg and 266 Sg were produced in the 248 Cm+ 22 Ne reaction at a beam energy of 121 MeV. The reaction products were continuously transported by a He(KCl)-jet to the computer-controlled liquid chromatography system ARCA. In 0.1 M HNO 3 /5 x 10 -4 M HF, Sg was found to be eluted within 10 s from 1.6 x 8 mm cation-exchange columns (Aminex A6, 17.5±2 μm) together with the hexavalent Mo- and W-ions, while hexavalent U-ions and tetravalent Zr-, Hf-, and element 104 ions were strongly retained on the column. Element 106 was detected by measuring correlated α-decays of the daughter isotopes 78-s 261 104 and 26-s 257 102. For the isotope 266 Sg, we have evidence for a spontaneous fission branch. It yields a partial spontaneous-fission half-life which is in agreement with recent theoretical predictions. The chemical results show that the most stable oxidation state of Sg in aqueous solution is +6, and that like its homologs Mo and W, Sg forms neutral or anionic oxo- or oxohalide-compounds under the present condition. In these first experiments, Sg exhibits properties very characteristic of group 6 elements, and does not show U-like properties. (orig.)

  4. 30 CFR 270.6 - Process.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Process. 270.6 Section 270.6 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.6 Process. Whenever a Regional Director determines on the basis of any information...

  5. 8 CFR 270.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Definitions. 270.1 Section 270.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.1 Definitions. For the purpose of this part— Document means an instrument on which is recorded, by means of...

  6. 8 CFR 270.3 - Penalties.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Penalties. 270.3 Section 270.3 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.3 Penalties. (a) Criminal penalties. Nothing in section 274C of the Act shall be construed to diminish or...

  7. 12 CFR 270.1 - Authority.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Authority. 270.1 Section 270.1 Banks and... RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.1 Authority. This part is issued by the Federal Open Market Committee (the “Committee”) pursuant to authority...

  8. 30 CFR 270.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Discrimination prohibited. 270.4 Section 270.4 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE NONDISCRIMINATION IN THE OUTER CONTINENTAL SHELF § 270.4 Discrimination prohibited. No contract or subcontract to which...

  9. 48 CFR 942.270-2 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 942.270-2 Section 942.270-2 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract Administration Services 942.270-2 Contract clause. The clause at 952...

  10. 31 CFR 270.4 - Fees for services.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fees for services. 270.4 Section 270.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE AVAILABILITY OF RECORDS § 270.4 Fees for services...

  11. 32 CFR 270.5 - Staff.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Staff. 270.5 Section 270.5 National Defense... Staff. (a) The Commission will have a support staff, which will include staff members sufficient to expeditiously and efficiently process the applications for payments under this part. All members of the staff...

  12. 18 CFR 270.506 - Confidentiality.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Confidentiality. 270.506 Section 270.506 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION...) through (9) of 5 U.S.C. 552(b). (b) Upon receipt of a request for disclosure of information treated as...

  13. 7 CFR 2.70 - Deputy Chief Economist.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Deputy Chief Economist. 2.70 Section 2.70 Agriculture... GENERAL OFFICERS OF THE DEPARTMENT Delegations of Authority by the Chief Economist § 2.70 Deputy Chief Economist. Pursuant to § 2.29, the following delegation of authority is made by the Chief Economist to the...

  14. 50 CFR 270.21 - Petition of objection.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Petition of objection. 270.21 Section 270... § 270.21 Petition of objection. (a) Filing a petition. Any person issued a notice of assessment under... promotion plan by filing a written petition of objection with NMFS. Petitions of objection may be filed: (1...

  15. 32 CFR 270.19 - Reports to Congress.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Reports to Congress. 270.19 Section 270.19... Reports to Congress § 270.19 Reports to Congress. Not later than September 23, 1998, the Commission will prepare and the Secretary will submit to Congress a report on the payment of claims under this part...

  16. 50 CFR 270.13 - Books, records and reports.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Books, records and reports. 270.13 Section 270.13 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... § 270.13 Books, records and reports. (a) The Council must submit to NMFS the following documents...

  17. 24 CFR 990.270 - Asset management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Asset management. 990.270 Section... THE PUBLIC HOUSING OPERATING FUND PROGRAM Asset Management § 990.270 Asset management. As owners, PHAs have asset management responsibilities that are above and beyond property management activities. These...

  18. 15 CFR 270.105 - Duties of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Duties of a Team. 270.105 Section 270... OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.105 Duties of a Team. (a) A Team's Lead...

  19. 12 CFR 270.3 - Governing principles.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Governing principles. 270.3 Section 270.3 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF... Governing principles. As required by section 12A of the Federal Reserve Act, the time, character, and volume...

  20. 48 CFR 1336.270 - Special requirements for ship construction

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Special requirements for ship construction 1336.270 Section 1336.270 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 1336.270 Special...

  1. 48 CFR 209.270 - Aviation and ship critical safety items.

    Science.gov (United States)

    2010-10-01

    ... Requirements 209.270 Aviation and ship critical safety items. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Aviation and ship critical safety items. 209.270 Section 209.270 Federal Acquisition Regulations System DEFENSE ACQUISITION...

  2. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

  3. 18 CFR 270.501 - Publication of notice from jurisdictional agency.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Publication of notice from jurisdictional agency. 270.501 Section 270.501 Conservation of Power and Water Resources FEDERAL... to the extent the material is treated as confidential under § 270.506, at the offices of the...

  4. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    International Nuclear Information System (INIS)

    Kajdič, P.; Reipurth, B.; Walawender, J.; Raga, A. C.; Bally, J.

    2012-01-01

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the Hα and [S II] emission lines and the HST observations are made in the Hα line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  5. PROPER MOTIONS OF THE HH 110/270 SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Kajdic, P. [Instituto de Astronomia, UNAM, Mexico D.F. (Mexico); Reipurth, B.; Walawender, J. [Institute for Astronomy, University of Hawaii at Manoa, 640 N. A' ohoku Place, Hilo, HI 96720 (United States); Raga, A. C. [Instituto de Ciencias Nucleares, UNAM, Mexico D.F. (Mexico); Bally, J., E-mail: primoz@geofisica.unam.mx, E-mail: reipurth@IfA.Hawaii.Edu, E-mail: raga@nucleares.unam.mx, E-mail: John.Bally@casa.colorado.edu, E-mail: joshw@ifa.hawaii.edu [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States)

    2012-05-15

    We present a study of the HH 110/270 system based on three sets of optical images obtained with the ESO New Technology Telescope, the Subaru Telescope, and the Hubble Space Telescope (HST). The ground-based observations are made in the H{alpha} and [S II] emission lines and the HST observations are made in the H{alpha} line only. Ground-based observations reveal the existence of nine knots, which have not been previously discussed and offer some important insight into the HH 110/270 history. We perform a kinematic study of the HH 110/270 system and an analysis of its emission properties. We measure proper motions of all the knots in the system. Four of the newly identified knots belong to the HH 270 jet. Their positions indicate that the jet's axis changed its direction in the past. We speculate that similar changes may have occurred many times in the past and this could be part of the reason for the unusual structure of the HH 110 jet. The HST observations allow us to resolve individual knots into their substructures and to measure their proper motions. These measurements show that the knots are highly turbulent structures. Finally, we report the discovery of four new Herbig-Haro (HH) objects located near the HH 110/270 system.

  6. 48 CFR 809.270 - Qualified products for convenience/labor-saving foods.

    Science.gov (United States)

    2010-10-01

    ... convenience/labor-saving foods. 809.270 Section 809.270 Federal Acquisition Regulations System DEPARTMENT OF... 809.270 Qualified products for convenience/labor-saving foods. (a) Each VISN Nutrition and Food Service representative is authorized to establish a common VISN QPL for convenience and labor-saving foods...

  7. 17 CFR 270.3a-1 - Certain prima facie investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain prima facie investment companies. 270.3a-1 Section 270.3a-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-1 Certain prima facie investment...

  8. A270 Demo Schokgolfdemping

    NARCIS (Netherlands)

    Netten, B.D.; Broek, T.H.A. van den; Blom, G.

    2010-01-01

    In februari 2010 zijn een aantal grootschalige experimenten uitgevoerd op de A270 tussen Helmond en Eindhoven. Het doel van deze experimenten is om de potentie van coöperatieve systemen te demonstreren voor het dempen van schokgolven en daarmee de mobiliteit op de Nederlandse snelwegen te kunnen

  9. 40 CFR 52.270 - Significant deterioration of air quality.

    Science.gov (United States)

    2010-07-01

    ... quality. 52.270 Section 52.270 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... deterioration of air quality. (a) With the exception of the areas listed in paragraph (b) of this section: (1... plan does not include approvable procedures for preventing the significant deterioration of air quality...

  10. 38 CFR 3.270 - Applicability of various dependency, income and estate regulations.

    Science.gov (United States)

    2010-07-01

    ... dependency, income and estate regulations. 3.270 Section 3.270 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUDICATION Pension, Compensation, and Dependency and Indemnity Compensation Dependency, Income and Estate § 3.270 Applicability of various dependency, income and estate regulations. (a...

  11. 15 CFR 270.2 - Definitions used in this part.

    Science.gov (United States)

    2010-01-01

    ... members, other NIST employees participating in the investigation, private sector experts, university... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions used in this part. 270.2... CONSTRUCTION SAFETY TEAMS General § 270.2 Definitions used in this part. The following definitions are...

  12. 15 CFR 270.102 - Conditions for establishment and deployment of a Team.

    Science.gov (United States)

    2010-01-01

    ... deployment of a Team. 270.102 Section 270.102 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.102 Conditions for establishment and deployment of a Team. (a) The Director may establish a Team for deployment...

  13. 21 CFR 137.270 - Self-rising white corn meal.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Self-rising white corn meal. 137.270 Section 137... Cereal Flours and Related Products § 137.270 Self-rising white corn meal. (a) Self-rising white corn meal is an intimate mixture of white corn meal, sodium bicarbonate, and one or both of the acid-reacting...

  14. 15 CFR 270.104 - Size and composition of a Team.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Size and composition of a Team. 270... NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE NATIONAL CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.104 Size and composition of...

  15. Introduction and feasibility study of the HD-270 MLC

    International Nuclear Information System (INIS)

    Kim, Dae Young; Kim Won Taek; Lee, Hwa Jung; Lee, Kang Hyeok

    2003-01-01

    The multileaf collimator(MLC) has many advantages, but use of the MLC increased effective penumbra and isodose undulation in dose distribution compared with that of an alloy block. In this work, we introduced the HD-270 MLC, which can improve the above disadvantages of MLC, and reported its feasibility study. The HD-270 MLC is a technique which combines the use of the existing Siemens multileaf collimator(3D MLC) with patient translation perpendicular to the leaf plane. The technique produces a smoothed isodose distribution with the reduced isodose undulation and effective penumbra. To assess the efficacy of the HD-270 technique and determine the appropriate resolution, a polygonal shaped MLC field was made to produce field edge angles from 0 degree to 75 degree with a step of 15 degree. Each HD-270 group was generated according to the allowed resolution, i. e., 5, 3, and 2 mm. The experiment was carried out on Primus, a Siemens linear accelerator configured with HD-270 MLC. The total 60 MU of 6 MV photon beam was delivered to X-Omat film (Kodak, USA) at a SAD of 100 cm and 1.5 cm depth in solid water phantom. Exposed films were scanned by Lumiscan75(LUMISYS) and analyzed using RIT113 software (Radiological Imaging Technology Inc., USA). To test the mechanical accuracy of table movement, the transverse, longitudinal, and vertical positions were controlled by a consol with ±5 mm, ±4 mm, ±3 mm, and ±2 mm steps, and then measured using a dial gauge with an accuracy of 0.001 inch. During the experiments, the table loaded with about 50 Kg human phantom to simulate the real treatment situation. The effective penumbra and isodose undulation became larger with increase the resolution and field edge angle. The accuracy of the table movement on each direction is good within the ±1 mm. Clinical use of the MLC can be increased by using of the HD-270 MLC which complements to the disadvantages of the MLC.

  16. 12 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Banking FEDERAL RESERVE SYSTEM (CONTINUED) FEDERAL OPEN MARKET COMMITTEE OPEN MARKET OPERATIONS OF FEDERAL RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks § 270.2 Definitions... as to principal and interest by, any agency of the United States. (d) The term System Open Market...

  17. 15 CFR 270.106 - Conflicts of interest related to service on a Team.

    Science.gov (United States)

    2010-01-01

    ... service on a Team. 270.106 Section 270.106 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.106 Conflicts of interest related to service on a Team. (a) Team members who are not Federal employees will be...

  18. 17 CFR 270.22e-3 - Exemption for liquidation of money market funds.

    Science.gov (United States)

    2010-04-01

    ... money market funds. 270.22e-3 Section 270.22e-3 Commodity and Securities Exchanges SECURITIES AND... for liquidation of money market funds. (a) Exemption. A registered open-end management investment company or series thereof (“fund”) that is regulated as a money market fund under § 270.2a-7 is exempt...

  19. 18 CFR 284.270 - Reporting requirements.

    Science.gov (United States)

    2010-04-01

    ... AUTHORITIES Emergency Natural Gas Sale, Transportation, and Exchange Transactions § 284.270 Reporting... transportation (excluding exchanges). Within 48 hours after deliveries commence in an emergency natural gas... natural gas commences, the initial recipient of the exchange volumes must notify the Commission by...

  20. 18 CFR 270.302 - Occluded natural gas produced from coal seams.

    Science.gov (United States)

    2010-04-01

    ... produced from coal seams. 270.302 Section 270.302 Conservation of Power and Water Resources FEDERAL ENERGY... produced from coal seams. A person seeking a determination that natural gas is occluded natural gas produced from coal seams must file an application with the jurisdictional agency which contains the...

  1. 17 CFR 270.24b-2 - Filing copies of sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

  2. 48 CFR 552.270-27 - Integrated Agreement.

    Science.gov (United States)

    2010-10-01

    ... agreement, express or implied, shall be admissible to contradict the provisions of the Lease. (End of clause) ... CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-27...

  3. 8 CFR 270.2 - Enforcement procedures.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PENALTIES FOR DOCUMENT FRAUD § 270.2 Enforcement procedures. (a) Procedures for the filing of complaints. Any person or entity... charges for document fraud committed by refugees at the time of entry. The Service shall not issue a...

  4. Reflux and Belching After 270 Degree Versus 360 Degree Laparoscopic Posterior Fundoplication

    NARCIS (Netherlands)

    Broeders, Joris A.; Bredenoord, Albert J.; Hazebroek, Eric J.; Broeders, Ivo A.; Gooszen, Hein G.; Smout, André J.

    2012-01-01

    Objective: To investigate differences in effects of 270 degrees (270 degrees LPF) and 360 degrees laparoscopic posterior fundoplication (360 degrees LPF) on reflux characteristics and belching. Background: Three hundred sixty degrees LPF greatly reduces the ability of the stomach to vent ingested

  5. 40 CFR 158.270 - Experimental use permit data requirements for residue chemistry.

    Science.gov (United States)

    2010-07-01

    ... requirements for residue chemistry. 158.270 Section 158.270 Protection of Environment ENVIRONMENTAL PROTECTION... Experimental use permit data requirements for residue chemistry. All residue chemistry data, as described in... section 408(r) is sought. Residue chemistry data are not required for an experimental use permit issued on...

  6. 17 CFR 270.22c-1 - Pricing of redeemable securities for distribution, redemption and repurchase.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redeemable securities for distribution, redemption and repurchase. 270.22c-1 Section 270.22c-1 Commodity and Securities... 1940 § 270.22c-1 Pricing of redeemable securities for distribution, redemption and repurchase. (a) No...

  7. 17 CFR 270.3c-2 - Definition of beneficial ownership in small business investment companies.

    Science.gov (United States)

    2010-04-01

    ... 1940 § 270.3c-2 Definition of beneficial ownership in small business investment companies. For the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial ownership in small business investment companies. 270.3c-2 Section 270.3c-2 Commodity and Securities...

  8. 17 CFR 270.6b-1 - Exemption of employees' securities company pending determination of application.

    Science.gov (United States)

    2010-04-01

    ...' securities company pending determination of application. 270.6b-1 Section 270.6b-1 Commodity and Securities... 1940 § 270.6b-1 Exemption of employees' securities company pending determination of application. Any... Act (54 Stat. 801; 15 U.S.C. 80a-6) shall be exempt, pending final determination of such application...

  9. 48 CFR 514.270-7 - Guidelines for using the price list method.

    Science.gov (United States)

    2010-10-01

    ... on knowledge of the supplies or services and previous contract prices. (d) First time use for an item... price list method. 514.270-7 Section 514.270-7 Federal Acquisition Regulations System GENERAL SERVICES... for using the price list method. (a) General. The price list method helps avoid unbalanced bidding...

  10. 48 CFR 352.270-2 - Indian preference.

    Science.gov (United States)

    2010-10-01

    ...-2 Section 352.270-2 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND... regulations), sex, religion, or Tribal affiliation. To the extent feasible and consistent with the efficient... to existing laws and regulations), sex, religion, or Tribal affiliation. The Contractor also agrees...

  11. 17 CFR 270.17g-1 - Bonding of officers and employees of registered management investment companies.

    Science.gov (United States)

    2010-04-01

    ... employees of registered management investment companies. 270.17g-1 Section 270.17g-1 Commodity and... ACT OF 1940 § 270.17g-1 Bonding of officers and employees of registered management investment companies. (a) Each registered management investment company shall provide and maintain a bond which shall...

  12. Event-related potential N270 as an index of social information conflict in explicit processing.

    Science.gov (United States)

    Wang, Pei; Tan, Chen-Hao; Li, Yu; Zhang, Qin; Wang, Yi-Bo; Luo, Jun-Long

    2018-01-01

    As N270 has been widely shown to be sensitive to nonsocial information conflict, the present study investigated whether social information conflict can elicit increased N270 in either explicit or implicit processing conditions. Gender stereotype-related picture-word pairs and picture-word pairs in specific colors were used as social and nonsocial information, respectively. Participants performed an explicit task based on the S1-S2 paradigm in Study 1, and both social and nonsocial information conditions elicited larger N270 than the no-conflict condition. In Study 2, participants performed a word judgment task that was modified from the S1-S2 paradigm of Study 1. However, neither social information nor nonsocial information elicited larger N270 within the conflict condition. Social trials generally elicited a more negative ERP waveform than nonsocial trials overall. These findings suggest that N270 may reflect the processing of social information conflict only in explicit conditions and also that the cognitive basis of N270 is thus a general but explicit processing of working memory representation conflict. Copyright © 2017. Published by Elsevier B.V.

  13. 20 CFR 404.270 - Cost-of-living increases.

    Science.gov (United States)

    2010-04-01

    ... INSURANCE (1950- ) Computing Primary Insurance Amounts Cost-Of-Living Increases § 404.270 Cost-of-living... rises in the cost of living. These automatic increases also apply to other benefit amounts, as described...

  14. 17 CFR 270.12b-1 - Distribution of shares by registered open-end management investment company.

    Science.gov (United States)

    2010-04-01

    ... registered open-end management investment company. 270.12b-1 Section 270.12b-1 Commodity and Securities... 1940 § 270.12b-1 Distribution of shares by registered open-end management investment company. (a)(1... the printing and mailing of sales literature; (b) A registered, open-end management investment company...

  15. 50 CFR 270.11 - Responsibilities of NMFS.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... part 270 and other applicable law, and approve or disapprove, marketing and promotion plans and budgets... disapproval of a marketing and promotion plan or budget, together with reasons for such disapproval; (3) Issue...

  16. 48 CFR 719.270 - Small business policies.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business policies... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 719.270 Small business policies. (a) In keeping with... United States small business to participate equitably in the furnishing of supplies and services for...

  17. 48 CFR 536.270 - Exercise of options.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Exercise of options. 536... Construction 536.270 Exercise of options. (a) If exercising an option, notify the contractor, in writing, within the time period specified in the contract. (b) Exercise options only after determining that all...

  18. 50 CFR 270.16 - Deposit of funds.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS § 270.16... approved marketing plan and budget, funds collected through assessments authorized by the Act must be deposited in any interest-bearing account or certificate of deposit of a bank that is a member of the...

  19. 48 CFR 552.270-26 - No Waiver.

    Science.gov (United States)

    2010-10-01

    ... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.270-26 No Waiver... remedy consequent upon a breach thereof, and no acceptance of full or partial rent or other performance by either party during the continuance of any such breach shall constitute a waiver of any such...

  20. Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

  1. 17 CFR 270.17f-2 - Custody of investments by registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... registered management investment company. 270.17f-2 Section 270.17f-2 Commodity and Securities Exchanges....17f-2 Custody of investments by registered management investment company. (a) The securities and similar investments of a registered management investment company may be maintained in the custody of such...

  2. 17 CFR 270.0-11 - Customer identification programs.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer identification... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.0-11 Customer identification programs... implementing regulation at 31 CFR 103.131, which requires a customer identification program to be implemented...

  3. 40 CFR 270.62 - Hazardous waste incinerator permits.

    Science.gov (United States)

    2010-07-01

    ... WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM Special Forms of Permits § 270.62 Hazardous waste incinerator permits. When an owner or operator of a hazardous waste... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Hazardous waste incinerator permits...

  4. 48 CFR 2852.102-270 - Incorporation in full text.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Incorporation in full text... 2852.102-270 Incorporation in full text. JAR provisions or clauses shall be incorporated in solicitations and contracts in full text. ...

  5. 40 CFR 270.3 - Considerations under Federal law.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Considerations under Federal law. 270... Considerations under Federal law. The following is a list of Federal laws that may apply to the issuance of... applicable law requires consideration or adoption of particular permit conditions or requires the denial of a...

  6. 17 CFR 270.30b1-1 - Semi-annual report for registered management investment companies.

    Science.gov (United States)

    2010-04-01

    ... registered management investment companies. 270.30b1-1 Section 270.30b1-1 Commodity and Securities Exchanges....30b1-1 Semi-annual report for registered management investment companies. Every registered management... management investment company that has filed a registration statement with the Commission registering its...

  7. 17 CFR 270.6c-10 - Exemption for certain open-end management investment companies to impose deferred sales loads.

    Science.gov (United States)

    2010-04-01

    ... management investment companies to impose deferred sales loads. 270.6c-10 Section 270.6c-10 Commodity and... ACT OF 1940 § 270.6c-10 Exemption for certain open-end management investment companies to impose... purposes of this section: (1) Company means a registered open-end management investment company, other than...

  8. 40 CFR 270.65 - Research, development, and demonstration permits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Research, development, and... Special Forms of Permits § 270.65 Research, development, and demonstration permits. (a) The Administrator may issue a research, development, and demonstration permit for any hazardous waste treatment facility...

  9. 48 CFR 218.270 - Head of contracting activity determinations.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 218.270 Head of contracting activity determinations. For contract... contracting activity,” as defined in FAR 2.101, in the following locations: (a) FAR 2.101: (1) Definition of...

  10. 17 CFR 270.19a-1 - Written statement to accompany dividend payments by management companies.

    Science.gov (United States)

    2010-04-01

    ... that an open-end company may treat as a separate source its net profits from such sales during its... specify the sources from which the remainder was paid. Every company which in any fiscal year elects to... dividend payments by management companies. 270.19a-1 Section 270.19a-1 Commodity and Securities Exchanges...

  11. 40 CFR 270.22 - Specific part B information requirements for boilers and industrial furnaces burning hazardous...

    Science.gov (United States)

    2010-07-01

    ... requirements for boilers and industrial furnaces burning hazardous waste. 270.22 Section 270.22 Protection of... requirements for boilers and industrial furnaces burning hazardous waste. When an owner or operator of a cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric acid...

  12. Oral administration of type-II collagen peptide 250-270 suppresses specific cellular and humoral immune response in collagen-induced arthritis.

    Science.gov (United States)

    Zhu, Ping; Li, Xiao-Yan; Wang, Hong-Kun; Jia, Jun-Feng; Zheng, Zhao-Hui; Ding, Jin; Fan, Chun-Mei

    2007-01-01

    Oral antigen is an attractive approach for the treatment of autoimmune and inflammatory diseases. Establishment of immune markers and methods in evaluating the effects of antigen-specific cellular and humoral immune responses will help the application of oral tolerance in the treatment of human diseases. The present article observed the effects of chicken collagen II (CII), the recombinant polymerized human collagen II 250-270 (rhCII 250-270) peptide and synthesized human CII 250-270 (syCII 250-270) peptide on the induction of antigen-specific autoimmune response in rheumatoid arthritis (RA) peripheral blood mononuclear cells (PBMC) and on the specific cellular and humoral immune response in collagen-induced arthritis (CIA) and mice fed with CII (250-270) prior to immunization with CII. In the study, proliferation, activation and intracellular cytokine production of antigen-specific T lymphocytes were simultaneously analyzed by bromodeoxyuridine (BrdU) incorporation and flow cytometry at the single-cell level. The antigen-specific antibody and antibody-forming cells were detected by ELISA and ELISPOT, respectively. CII (250-270) was found to have stimulated the response of specific lymphocytes in PBMC from RA patients, including the increase expression of surface activation antigen marker CD69 and CD25, and DNA synthesis. Mice, fed with CII (250-270) before CII immunization, had significantly lower arthritic scores than the mice immunized with CII alone, and the body weight of the former increased during the study period. Furthermore, the specific T cell activity, proliferation and secretion of interferon (IFN)-gamma in spleen cells were actively suppressed in CII (250-270)-fed mice, and the serum anti-CII, anti-CII (250-270) antibody activities and the frequency of specific antibody-forming spleen cells were significantly lower in CII (250-270)-fed mice than in mice immunized with CII alone. These observations suggest that oral administration of CII (250-270) can

  13. 17 CFR 270.3a-2 - Transient investment companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Transient investment companies... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-2 Transient investment companies... which an issuer owns or proposes to acquire investment securities (as defined in section 3(a) of the Act...

  14. 40 CFR 270.21 - Specific part B information requirements for landfills.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... and post-closure plans submitted under § 270.14(b)(13). (f) If ignitable or reactive wastes will be...

  15. 48 CFR 538.270 - Evaluation of multiple award schedule (MAS) offers.

    Science.gov (United States)

    2010-10-01

    ... SERVICES ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING FEDERAL SUPPLY SCHEDULE CONTRACTING Establishing and Administering Federal Supply Schedules 538.270 Evaluation of multiple award schedule (MAS) offers... determining the Government's price negotiation objectives, consider the following factors: (1) Aggregate...

  16. 18 CFR 270.303 - Natural gas produced from Devonian shale.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Natural gas produced... DETERMINATION PROCEDURES Requirements for Filings With Jurisdictional Agencies § 270.303 Natural gas produced from Devonian shale. A person seeking a determination that natural gas is produced from Devonian shale...

  17. 17 CFR 270.24b-3 - Sales literature deemed filed.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales literature deemed filed... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.24b-3 Sales literature deemed filed. Any advertisement, pamphlet, circular, form letter or other sales literature addressed to or intended...

  18. N270 sensitivity to conflict strength and working memory: A combined ERP and sLORETA study.

    Science.gov (United States)

    Scannella, Sébastien; Pariente, Jérémie; De Boissezon, Xavier; Castel-Lacanal, Evelyne; Chauveau, Nicolas; Causse, Mickaël; Dehais, Frédéric; Pastor, Josette

    2016-01-15

    The event-related potential N270 component is known to be an electrophysiological marker of the supramodal conflict processing. However little is know about the factors that may modulate its amplitude. In particular, among all studies that have investigated the N270, little or no control of the conflict strength and of the load in working memory have been done leaving a lack in the understanding of this component. We designed a spatial audiovisual conflict task with simultaneous target and cross-modal distractor to evaluate the N270 sensitivity to the conflict strength (i.e., visual target with auditory distractor or auditory target with visual distractor) and the load in working memory (goal task maintenance with frequent change in the target modality). In a first session, participants had to focus on one modality for the target position to be considered (left-hand or right-hand) while the distractor could be at the same side (compatible) or at opposite side (incompatible). In a second session, we used the same set of stimuli as in the first session with an additional distinct auditory signal that clued the participants to frequently switch between the auditory and the visual targets. We found that (1) reaction times and N270 amplitudes for conflicting situations were larger within the auditory target condition compared to the visual one, (2) the increase in target maintenance effort led to equivalent increase of both reaction times and N270 amplitudes within all conditions and (3) the right dorsolateral prefrontal cortex current density was higher for both conflicting and active maintenance of the target situations. These results provide new evidence that the N270 component is an electrophysiological marker of the supramodal conflict processing that is sensitive to the conflict strength and that conflict processing and active maintenance of the task goal are two functions of a common executive attention system. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. 20 CFR 645.270 - What procedures are there to ensure that currently employed workers may file grievances regarding...

    Science.gov (United States)

    2010-04-01

    ... gender discrimination? 645.270 Section 645.270 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... regarding displacement, health and safety standards and gender discrimination? (a) The State shall establish...) Participants alleging gender discrimination by WtW programs that are not part of the One-Stop system may file a...

  20. 17 CFR 270.17a-8 - Mergers of affiliated companies.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Mergers of affiliated... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.17a-8 Mergers of affiliated companies. (a) Exemption of affiliated mergers. A Merger of a registered investment company (or a series thereof...

  1. 17 CFR 270.8b-16 - Amendments to registration statement.

    Science.gov (United States)

    2010-04-01

    ... company's investment objectives or policies (described in Item 8.2 of Form N-2) that have not been... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.8b-16 Amendments to registration statement. (a) Every registered management investment company which is required to file a semi-annual report...

  2. 17 CFR 270.3a-3 - Certain investment companies owned by companies which are not investment companies.

    Science.gov (United States)

    2010-04-01

    ... the definition of the term “investment company” by section 3(b)(1) or 3(b)(2) of the Act (15 U.S.C... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain investment companies owned by companies which are not investment companies. 270.3a-3 Section 270.3a-3 Commodity and...

  3. 17 CFR 270.22e-2 - Pricing of redemption requests in accordance with Rule 22c-1.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Pricing of redemption requests in accordance with Rule 22c-1. 270.22e-2 Section 270.22e-2 Commodity and Securities Exchanges....22e-2 Pricing of redemption requests in accordance with Rule 22c-1. An investment company shall not be...

  4. MODELING SUPERSONIC-JET DEFLECTION IN THE HERBIG–HARO 110-270 SYSTEM WITH HIGH-POWER LASERS

    International Nuclear Information System (INIS)

    Yuan, Dawei; Li, Yutong; Lu, Xin; Yin, Chuanlei; Su, Luning; Liao, Guoqian; Zhang, Jie; Wu, Junfeng; Wang, Lifeng; He, Xiantu; Zhong, Jiayong; Wei, Huigang; Zhang, Kai; Han, Bo; Zhao, Gang; Jiang, Shaoen; Du, Kai; Ding, Yongkun; Zhu, Jianqiang

    2015-01-01

    Herbig–Haro (HH) objects associated with newly born stars are typically characterized by two high Mach number jets ejected in opposite directions. However, HH 110 appears to only have a single jet instead of two. Recently, Kajdi et al. measured the proper motions of knots in the whole system and noted that HH 110 is a continuation of the nearby HH 270. It has been proved that the HH 270 collides with the surrounding mediums and is deflected by 58°, reshaping itself as HH 110. Although the scales of the astrophysical objects are very different from the plasmas created in the laboratory, similarity criteria of physical processes allow us to simulate the jet deflection in the HH 110/270 system in the laboratory with high power lasers. A controllable and repeatable laboratory experiment could give us insight into the deflection behavior. Here we show a well downscaled experiment in which a laser-produced supersonic-jet is deflected by 55° when colliding with a nearby orthogonal side-flow. We also present a two-dimensional hydrodynamic simulation with the Euler program, LARED-S, to reproduce the deflection. Both are in good agreement. Our results show that the large deflection angle formed in the HH 110/270 system is probably due to the ram pressure from a flow–flow collision model

  5. 17 CFR 270.18f-2 - Fair and equitable treatment for holders of each class or series of stock of series investment...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fair and equitable treatment for holders of each class or series of stock of series investment companies. 270.18f-2 Section 270.18f... or series of stock of series investment companies. (a) For purposes of this § 270.18f-2 a series...

  6. 43 CFR 30.270 - How will the hearing be conducted?

    Science.gov (United States)

    2010-10-01

    ... PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.270 How will the hearing be conducted? (a) At the hearing, each party challenging the tribe's claim to purchase the interests in question or the...) On conclusion of the hearing, the judge will issue a decision that determines all of the issues...

  7. 40 CFR 415.270 - Applicability; description of the borax production subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the borax... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Borax Production Subcategory § 415.270 Applicability; description of the borax production subcategory. The...

  8. Stigmastadiene and specific extitntion (270 nm) to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

    OpenAIRE

    Aued-Pimentel,Sabria; Silva,Simone Alves Da; Takemoto,Emy; Cano,Cristiane Bonaldi

    2013-01-01

    The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270) and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these paramete...

  9. The Road Side Unit for the A270 Test Site

    NARCIS (Netherlands)

    Passchier, I.; Driessen, B.J.F.; Heijligers, B.M.R.; Netten, B.D.; Schackmann, P.P.M.

    2011-01-01

    The design and implementation of the Road Side Unit for the A270 Test Site is presented. It consists of a sensor platform and V2I communication platform with full coverage of the test site. A service platform enables applications to make use of these facilities. The RSU will be used both for the

  10. Performance of Jatropha Oil Blends in RD270 Two Cylinders Four ...

    African Journals Online (AJOL)

    The performance characteristics of RD270 two cylinder, four stroke diesel engine fuelled with jatropha oil and its blend with diesel are presented in this paper. The jatropha biodiesel was obtained from National Research Institutes for Chemical Technology, Zaria, Nigeria. The produced biodiesel was blended with neat ...

  11. Functional and genetic epidemiological characterisation of the FFAR4 (GPR120) p.R270H variant in the Danish population

    DEFF Research Database (Denmark)

    Vestmar, Marie Aare; Andersson, Ehm A; Christensen, Charlotte Riis

    2016-01-01

    . Association with quantitative metabolic traits comprised 8720 non-diabetic individuals. RESULTS: p.R270H showed reduced surface expression of FFAR4. Ligand-independent activity was eliminated and strongly impaired through the Gq and Gi signalling pathways, respectively. The ligand-induced maximal signalling...... reactive protein; hs-CRP) and liver function (alanine aminotransferase) in the Danish population (p>0.05). CONCLUSIONS: We demonstrate that p.R270H of FFAR4 impairs Gq and Gi signalling of FFAR4 in vitro; however, this impaired signalling for p.R270H does not translate into associations with human...

  12. Stigmastadiene and specific extitntion (270 nm to evaluate the presence of refined oils in virgin olive oil commercialized in Brazil

    Directory of Open Access Journals (Sweden)

    Sabria Aued-Pimentel

    2013-09-01

    Full Text Available The increased marketing of olive oil in Brazil has intensified legal requirements to ensure regulation of this product. The measurement of the specific extinction at 270 nm (E 270 and content of stigmastadiene can be used to assess the presence of refined oils in virgin olive oil. During the vegetable oil refining process, compounds with conjugated double bonds are generated from unsaturated fatty acids that absorb at 270 nm and sterols, such as stigmasta-3,5-diene. To compare these parameters, seven samples of extra virgin olive oil and three samples of olive oil (blend of virgin and refined were analyzed. Among the samples analyzed, four extra virgin samples had levels of stigmastadiene and E 270 higher than expected, among which two were adulterated with seed oil (rich in linoleic acid and the other two with olive pomace oil. The results demonstrate the higher sensitivity of stigmastadiene to determine the presence of the refined oil in virgin olive oil and good agreement with determining E 270. The latter technique is a simple, quick, and low cost method of determination that can be easily implemented in laboratories to assist in the screening and regulation of olive oils sold in Brazil.

  13. 45 CFR 270.7 - What data will we use to measure performance on the work support and other measures?

    Science.gov (United States)

    2010-10-01

    ... measure performance on the work support and other measures? (a) We will use Census Bureau data to rank... 45 Public Welfare 2 2010-10-01 2010-10-01 false What data will we use to measure performance on the work support and other measures? 270.7 Section 270.7 Public Welfare Regulations Relating to Public...

  14. 200 and 270 GHz SIS receivers development for atmospheric observation

    International Nuclear Information System (INIS)

    Ochiai, S.; Masuko, H.

    1993-01-01

    Superconducting mixers have been developed for observations of atmospheric minor constituents such as ClO and ozone at Communications Research Laboratory. This paper describes the work at development of 200 and 270 GHz SIS mixers. Nb/AlOx/Nb junctions were fabricated at Nobeyama Radio Observatory. The base Nb layer 200 nm, the Al (AlOx) insulation layer, and the counter Nb electrode 150 nm are sputtered. The area outside of a junction defined by etching of the counter electrode is insulated by anodized Nb layer and sputtered SiO 2 . After sputtering thick SiO 2 layer on the whole wafer, a contact hole is made by etching. The thickness of the wiring Nb layer is 500 nm. The junctions are formed on the 250 μm thick fused quartz substrate. After the process of the junction fabrication, the quartz substrate is shaved from the back side until 150 μm thickness. Each junction for 270 GHz mixer has an area of about 1 μm 2 . The normal resistance of the six junctions series array is around 70 Ω. The mixer block has a reduced waveguide (1.2 x 0.1 mm for 200 GHz and 0.98 x 0. 1 mm for 270 GHz). The waveguide has two tuners in addition to a fixed backshort cavity. This configuration can allow to realize the lower embedding impedance, and less sensitive to the position of the tuners. The SIS mixers are cooled in a closed cycle He refrigerator. The LO is optically injected through a Fabry Perot interferometer. The 5--7 GHz IF is fed to a HEMT amplifier cooled at 15 K. The authors have started a preliminary measurement of the noise temperature of the SIS receivers, and comparing with calculated DSB receiver noise temperature assuming 3-port model. They continue to improve the performance of the SIS mixers now. They intend that the receivers shall be utilized for atmospheric monitor from next winter

  15. 17 CFR 270.12d3-1 - Exemption of acquisitions of securities issued by persons engaged in securities related businesses.

    Science.gov (United States)

    2010-04-01

    ... securities issued by persons engaged in securities related businesses. 270.12d3-1 Section 270.12d3-1... in securities related businesses. (a) Notwithstanding section 12(d)(3) of the Act, a registered... securities related business, the determination required by paragraph (b) of this section shall be made as...

  16. 17 CFR 270.12d2-1 - Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act.

    Science.gov (United States)

    2010-04-01

    ..., INVESTMENT COMPANY ACT OF 1940 § 270.12d2-1 Definition of insurance company for purposes of sections 12(d)(2... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of insurance company for purposes of sections 12(d)(2) and 12(g) of the Act. 270.12d2-1 Section 270.12d2-1 Commodity...

  17. 17 CFR 270.26a-2 - Exemptions from certain provisions of sections 26 and 27 for registered separate accounts and...

    Science.gov (United States)

    2010-04-01

    ... deduction of certain fees and charges from the assets of such accounts. 270.26a-2 Section 270.26a-2... registered separate accounts and others regarding custodianship of and deduction of certain fees and charges... by any State or other governmental entity and, if the separate account is registered under the Act as...

  18. Evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I270/I255 corridor in St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the transportation users. The technical system ...

  19. 17 CFR 270.10b-1 - Definition of regular broker or dealer.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.10b-1 Definition of regular broker or dealer. The term regular broker or dealer of an investment company shall mean: (a) One... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of regular broker...

  20. Nature of the 153 and 270 keV transitions in /sup 119/Sb from sup(119m)Te

    Energy Technology Data Exchange (ETDEWEB)

    Sahota, H S [Punjabi Univ., Patiala (India). Dept. of Physics

    1982-08-01

    The 153 and 270 keV transitions in /sup 119/Sb have been investigated for the presence of any anomalous conversion through conversion electron intensity and conversion-electron gamma and gamma-gamma directional correlation measurements. The resulting subshell ratios and particle rarameters have been analysed for the accurate determination of mixing ratios for the transitions. The results are delta/sub 153/ = +-0.0025 and delta/sub 270/ = 0.10 sub(-0.20)sup(+0.03). The conversion process has been found to be normal in both cases.

  1. 17 CFR 270.5b-1 - Definition of “total assets.”

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.5b-1 Definition of “total assets... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âtotal assets.â..., shall mean the gross assets of the company with respect to which the computation is made, taken as of...

  2. Melitrast in coronary angiography; Roentgenkontrastmittel Melitrast-300 und Melitrast-270 in der kardiologischen Diagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Geisler, T.; Funke, B.; Wild, P.; Zotz, R. [Medizinische Klinik, Klinikum Schwalmstadt, Schwalmstadt (Germany); Dietz, G.; Petrov, R. [Dr. F. Koehler Chemie, Alsbach-Haehnlein (Germany); Stefenelli, U. [Fachinstitut fuer Statistik, Wuerzburg (Germany)

    2004-07-01

    The aim of this study was the evaluation of safety and cardiologic efficacy of the non-ionic contrast agent Iosarcol (Melitrast), a contrast agent with low protein affinity in two different iodine concentrations. One hundred patients were prospectively randomized to receive either Melitrast-270 or Melitrast-300 for left heart ventriculography and coronary angiography. Clinical evaluation, blood pressure and pulse measurement were performed and an electrocardiogram was recorded before and after contrast application and the diagnostic efficacy using a score was evaluated. In three patients side effects could be observed 2 hours after the application (vertigo, sickness, sweating). Melitrast in both concentrations led to a good contrast during ventriculography and coronary angiography which could not be differentiated by two experienced observers. Thus a lower iodine concentration and by this a lower viscosity seems to favour Melitrast-270 for invasive cardiologic diagnosis. (orig.)

  3. 17 CFR 270.32a-3 - Exemption from provision of section 32(a)(1) regarding the time period during which a registered...

    Science.gov (United States)

    2010-04-01

    ... select an independent public accountant. 270.32a-3 Section 270.32a-3 Commodity and Securities Exchanges... management investment company must select an independent public accountant. (a) A registered management... U.S.C. 80a-31(a)(1)) that the independent public accountant (“accountant”) be selected at a board of...

  4. Appendices : evaluation of variable speed limits on I-270/I-255 in St. Louis.

    Science.gov (United States)

    2010-10-01

    In May of 2008, MoDOT installed a Variable Speed Limit (VSL) system along the I-270/I-255 corridor in : St. Louis. This project evaluated the VSL system and its potential impacts and benefits to the : transportation users. The technical system ...

  5. 17 CFR 270.30b1-7 - Monthly report for money market funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Monthly report for money... money market funds. (a) Report. Every registered open-end management investment company, or series thereof, that is regulated as a money market fund under § 270.2a-7 must file with the Commission a monthly...

  6. The 270 MeV deuteron beam polarimeter at the Nuclotron Internal Target Station

    Energy Technology Data Exchange (ETDEWEB)

    Kurilkin, P.K. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Ladygin, V.P., E-mail: vladygin@jinr.ru [Joint Institute for Nuclear Research, Dubna (Russian Federation); Moscow State Institute of Radio-engineering Electronics and Automation (Technical University), Moscow (Russian Federation); Uesaka, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Suda, K. [RIKEN Nishina Center, Saitama (Japan); Gurchin, Yu.V.; Isupov, A.Yu. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Itoh, K. [Department of Physics, Saitama University, Saitama (Japan); Janek, M. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Physics Department, University of Zilina, 010 26 Zilina (Slovakia); Karachuk, J.-T. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Advanced Research Institute for Electrical Engineering, Bucharest (Romania); Kawabata, T. [Center for Nuclear Study, University of Tokyo, Tokyo 113-0033 (Japan); Khrenov, A.N.; Kiselev, A.S.; Kizka, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Kliman, J. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia); Krasnov, V.A.; Livanov, A.N. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Nuclear Research, Moscow (Russian Federation); Maeda, Y. [Kyushi University, Hakozaki (Japan); Malakhov, A.I. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Matousek, V.; Morhach, M. [Institute of Physics of Slovak Academy of Sciences, Bratislava (Slovakia)

    2011-06-21

    A deuteron beam polarimeter has been constructed at the Internal Target Station at the Nuclotron of JINR. The polarimeter is based on spin-asymmetry measurements in the d-p elastic scattering at large angles and the deuteron kinetic energy of 270 MeV. It allows to measure vector and tensor components of the deuteron beam polarization simultaneously.

  7. 26 CFR 1.270-1 - Limitation on deductions allowable to individuals in certain cases.

    Science.gov (United States)

    2010-04-01

    ... cultivates, operates, or manages a farm for gain or profit, either as owner or tenant. An individual who... provisions relating to activities not engaged in for profit applicable to taxable years beginning after... THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Items Not Deductible § 1.270-1 Limitation...

  8. 41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...

  9. Fulltext PDF

    Indian Academy of Sciences (India)

    the discovery of new elements using particle accelerators. He con- cludes by stating that "we might have reached the limits of the periodic table as a predictive tool". The third article is by Butera on. Glenn Seaborg who holds the record for the discovery of the largest number of elements - one of them named Seaborgium.

  10. 38 CFR 21.270 - Payment of subsistence allowance during leave and between periods of instruction.

    Science.gov (United States)

    2010-07-01

    ... Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Monetary Assistance Services § 21.270... veteran jointly determine that such payment is not in the veteran's interest: (1) A period between...

  11. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  12. 32 CFR 270.13 - No right to judicial review or legal cause of action.

    Science.gov (United States)

    2010-07-01

    ... DEMOCRATIC REPUBLIC OF VIETNAM Payment § 270.13 No right to judicial review or legal cause of action. Subject... 32 National Defense 2 2010-07-01 2010-07-01 false No right to judicial review or legal cause of..., and such review is specifically precluded. This part does not create or acknowledge any legal right or...

  13. 17 CFR 270.12d1-1 - Exemptions for investments in money market funds.

    Science.gov (United States)

    2010-04-01

    ...)(3) and 270.17e-1(d)(2), the payment of a commission, fee, or other remuneration to a broker shall be...) of the Act if: (1) The commission, fee, or other remuneration is paid in connection with the sale of... directors, the company's investment adviser performs the duties of the board of directors. [71 FR 36655...

  14. 17 CFR 270.6c-6 - Exemption for certain registered separate accounts and other persons.

    Science.gov (United States)

    2010-04-01

    ... portfolio company has the same: (i) Investment objectives, (ii) Fundamental policies, and (iii) Voting... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.6c... which is, or is a part of, a unit investment trust registered under the Act, engaged in a continuous...

  15. Isolation and partial characterization of gypsy moth BTR-270, an anionic brush border membrane glycoconjugate that binds Bacillus thuringiensis Cry1A toxins with high affinity

    Science.gov (United States)

    Algimantas P. Valaitis; Jeremy L. Jenkins; Mi Kyong Lee; Donald H. Dean; Karen J. Garner

    2001-01-01

    BTR-270, a gypsy moth (Lymantria dispar) brush border membrane molecule that binds Bacillus thuringiensis (Bt) Cry1A toxins with high affinity, was purified by preparative gel electrophoresis. Rabbit antibodies specific for the Bt toxin-binding molecule were raised. Attempts to label BTR-270 by protein-directed techniques were...

  16. 40 CFR 270.235 - Options for incinerators, cement kilns, lightweight aggregate kilns, solid fuel boilers, liquid...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Options for incinerators, cement kilns... Technology (MACT) Standards § 270.235 Options for incinerators, cement kilns, lightweight aggregate kilns... incinerator, cement kiln, lightweight aggregate kiln, solid fuel boiler, liquid fuel boiler, or hydrochloric...

  17. 40 CFR 270.315 - What air emissions control information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What air emissions control information... Facility § 270.315 What air emissions control information must I keep at my facility? If you have air emission control equipment subject to 40 CFR part 264, subpart CC, you must keep the following information...

  18. Comparison of mouse, guinea pig and rabbit models for evaluation of plague subunit vaccine F1+rV270.

    Science.gov (United States)

    Qi, Zhizhen; Zhou, Lei; Zhang, Qingwen; Ren, Lingling; Dai, Ruixia; Wu, Benchuan; Wang, Tang; Zhu, Ziwen; Yang, Yonghai; Cui, Baizhong; Wang, Zuyun; Wang, Hu; Qiu, Yefeng; Guo, Zhaobiao; Yang, Ruifu; Wang, Xiaoyi

    2010-02-10

    In this study, a new subunit vaccine that comprised native F1 and recombinant rV270 was evaluated for protective efficacy using mouse, guinea pig and rabbit models in comparison with the live attenuated vaccine EV76. Complete protection against challenging with 10(6) colony-forming units (CFU) of virulent Yersinia pestis strain 141 was observed for mice immunized with the subunit vaccines and EV76 vaccine. In contrast, the subunit vaccine recipes VII (F1-20 microg+rV270-10 microg) and IX (F1-40 microg+rV270-20 microg) and EV76 vaccine provided 86%, 79% and 93% protection against the same level of challenge in guinea pigs and 100%, 83% and 100% protection in rabbits, respectively. The immunized mice with the vaccines had significantly higher IgG titres than the guinea pigs and rabbits, and the immunized guinea pigs developed significantly higher IgG titres than the rabbits, but the anti-F1 response in guinea pigs was more variable than in the mice and rabbits, indicating that guinea pig is not an ideal model for evaluating protective efficacy of plague subunit vaccine, instead the rabbits could be used as an alternative model. All the immunized animals with EV76 developed a negligible IgG titre to rV270 antigen. Furthermore, analysis of IgG subclasses in the immunized animals showed a strong response for IgG1, whereas those receiving EV76 immunization demonstrated predominant production of IgG1 and IgG2a isotypes. The subunit vaccine and EV76 vaccine are able to provide protection for animals against Y. pestis challenge, but the subunit vaccines have obvious advantages over EV76 in terms of safety of use. Copyright (c) 2009 Elsevier Ltd. All rights reserved.

  19. 17 CFR 270.3c-5 - Beneficial ownership by knowledgeable employees and certain other persons.

    Science.gov (United States)

    2010-04-01

    ... Company. For purposes of this definition, the term “investment company” as used in section 2(a)(3) of the Act includes a Covered Company. (2) The term Covered Company means a Section 3(c)(1) Company or a... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c...

  20. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    Energy Technology Data Exchange (ETDEWEB)

    W. S. Thompson

    2005-12-14

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  1. Results of Remediation and Verification Sampling for the 600-270 Horseshoe Landfill

    International Nuclear Information System (INIS)

    Thompson, W.S.

    2005-01-01

    This report presents the results of the 2005 remedial action and verification soil sampling conducted at the 600-270 waste site after removal of soil containing residual concentrations of dichlorodiphenyl trichloroethane and its breakdown products dichlorodiphenyl dichloroethylene and dichlorodiphenyl dichloroethane. The remediation was performed in response to post-closure surface soil sampling performed between 1998 and 2003 that indicated the presence of residual DDT contamination exceeding the Record of Decision for the 1100 Area National Priorities List site cleanup criteria of 1 mg/kg that was established for the original 1994 cleanup activities.

  2. 17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...

  3. Measurement of turbulent flows in a square sectioned 270 .deg. bend

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Sok Hyu; Lee, Gun Hyee [Wonkwang Univ., Iksan (Korea, Republic of); Chun, Kun Ho [Korea Univ., Seoul (Korea, Republic of)

    2000-07-01

    Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall.

  4. Measurement of turbulent flows in a square sectioned 270 .deg. bend

    International Nuclear Information System (INIS)

    Cho, Sok Hyu; Lee, Gun Hyee; Chun, Kun Ho

    2000-01-01

    Most of the past experimental or analytical studies were performed for the curved bend with a square cross-section. Velocity profiles and Reynolds stresses of the turbulence flow in the 270 degree bend with circular cross-section were measured by a hot-wire anemometer. The mean velocity of primary flowing direction effected by the downstream of bend in the entry region of the bend. The flow in the inner part of the bend slowed the distribution velocity relatively large and unsymmetric phenomenon. In the strong secondary flow occurred when the flow passed in the region of 45 degree to 90 degree. The secondary flow appeared very large value in the neighbor region inner wall

  5. Technological aspects at continuous casting of semi-finished products with ϕ270mm

    International Nuclear Information System (INIS)

    Ardelean, E; Ardelean, M; Hepuţ, T; Lăscuţoni, A

    2015-01-01

    Continuous casting installation especially appreciated because steel can be poured in a more varied assortment. The flexibility of the system is not sufficient if the casting parameters are not properly adopted and adapted to the specific brand of steel. This paper presents some technical aspects relative to continuous casting of semi-finished products with ϕ270mm section. Graphical dependencies obtained in Excel and analytical equations of this allows to specialists from industry to adopt values for the addicted parameters according to the independent ones, already known. (paper)

  6. Synthesis and detection of a seaborgium carbonyl complex

    NARCIS (Netherlands)

    Even, J.; Yakushev, A.; Duellmann, Ch E.; Haba, H.; Asai, M.; Sato, T. K.; Brand, H.; Di Nitto, A.; Eichler, R.; Fan, F. L.; Hartmann, W.; Huang, M.; Jaeger, E.; Kaji, D.; Kanaya, J.; Kaneya, Y.; Khuyagbaatar, J.; Kindler, B.; Kratz, J. V.; Krier, J.; Kudou, Y.; Kurz, N.; Lommel, B.; Miyashita, S.; Morimoto, K.; Morita, K.; Murakami, M.; Nagame, Y.; Nitsche, H.; Ooe, K.; Qin, Z.; Schaedel, M.; Steiner, J.; Sumita, T.; Takeyama, M.; Tanaka, K.; Toyoshima, A.; Tsukada, K.; Tuerler, A.; Usoltsev, I.; Wakabayashi, Y.; Wang, Y.; Wiehl, N.; Yamaki, S.

    2014-01-01

    Experimental investigations of transactinoide elements provide benchmark results for chemical theory and probe the predictive power of trends in the periodic table. So far, in gas-phase chemical reactions, simple inorganic compounds with the transactinoide in its highest oxidation state have been

  7. Superheavy element chemistry. Achievements and perspectives

    International Nuclear Information System (INIS)

    Schaedel, M.

    2007-01-01

    Superheavy elements have been synthesized and chemically characterized one-atom-at-a-time up to element 108. Presently, the quest for element 112 is one of the hottest topics in this field. The transactinide elements 104 to 108 are members of group 4 to 8 of the Periodic Table and element 112 belongs into group 12. Chemical properties of some of these elements, like elements 104 and 105, show stunning deviations from simple extrapolations within their respective group while others exhibit great similarities with their lighter homologues elements. First experiments to investigate seaborgium (Sg, element 106) in aqueous solution were performed. Again, in large international collaborations at the GSI, several gas-phase chemistry experiments were performed with hassium (Hs, element 108). Recently, the highly efficient and very clean separation of Hs was applied for nuclear studies of various Hs nuclides investigating their cross section and their nuclear decay properties in the region of the doubly-magic 270 Hs (Z=108, N=162). To overcome certain limitations of the presently used on-line chemical separations the new TransActinide Separation and Chemistry Apparatus (TASCA) - with a gas-filled recoil separator as a front-end tool - was designed and built at the GSI in a collaborative effort. Presently in its commissioning phase, TASCA shall be a key instrument for a big leap into quantitatively and qualitatively new experiments in the region of superheavy elements. (author)

  8. Roles of Asp179 and Glu270 in ADP-Ribosylation of Actin by Clostridium perfringens Iota Toxin.

    Directory of Open Access Journals (Sweden)

    Alexander Belyy

    Full Text Available Clostridium perfringens iota toxin is a binary toxin composed of the enzymatically active component Ia and receptor binding component Ib. Ia is an ADP-ribosyltransferase, which modifies Arg177 of actin. The previously determined crystal structure of the actin-Ia complex suggested involvement of Asp179 of actin in the ADP-ribosylation reaction. To gain more insights into the structural requirements of actin to serve as a substrate for toxin-catalyzed ADP-ribosylation, we engineered Saccharomyces cerevisiae strains, in which wild type actin was replaced by actin variants with substitutions in residues located on the Ia-actin interface. Expression of the actin mutant Arg177Lys resulted in complete resistance towards Ia. Actin mutation of Asp179 did not change Ia-induced ADP-ribosylation and growth inhibition of S. cerevisiae. By contrast, substitution of Glu270 of actin inhibited the toxic action of Ia and the ADP-ribosylation of actin. In vitro transcribed/translated human β-actin confirmed the crucial role of Glu270 in ADP-ribosylation of actin by Ia.

  9. Effect of food on the pharmacokinetics of oral MMI270B (CGS 27023A), a novel matrix metalloproteinase inhibitor

    NARCIS (Netherlands)

    F.A.L.M. Eskens (Ferry); N.C. Levitt; A. Sparreboom (Alex); L. Choi; R. Mather; J. Verweij (Jaap); A.L. Harris

    2000-01-01

    textabstractMMI270B is a matrix metalloproteinase inhibitor (MMPI) with in vitro and in vivo activity. To exert optimal target inhibition, MMPI must be given chronically, and therefore, oral bioavailability is important. We analyzed the effect of food intake on AUC0-8

  10. Chemistry of the heaviest elements--one atom at a time

    International Nuclear Information System (INIS)

    Hoffman, Darleane C.; Lee, Diana M.

    2000-01-01

    In keeping with the goal of the Viewpoint series of the Journal of Chemical Education, this article gives a 75-year perspective of the chemistry of the heaviest elements, including a 50-year retrospective view of past developments, a summary of current research achievements and applications, and some predictions about exciting, new developments that might be envisioned within the next 25 years. A historical perspective of the importance of chemical separations in the discoveries of the transuranium elements from neptunium (Z=93) through mendelevium (Z=101) is given. The development of techniques for studying the chemical properties of mendelevium and still heavier elements on the basis of measuring the radioactive decay of a single atom (''atom-at-a-time'' chemistry) and combining the results of many separate experiments is reviewed. The influence of relativistic effects (expected to increase as Z 2 ) on chemical properties is discussed. The results from recent atom-at-a-time studies of the chemistry of the heaviest elements through seaborgium (Z=106) are summarized and show that their properties cannot be readily predicted based on simple extrapolation from the properties of their lighter homologues in the periodic table. The prospects for extending chemical studies to still heavier elements than seaborgium are considered and appear promising

  11. Symptomatic type 1 protein C deficiency caused by a de novo Ser270Leu mutation in the catalytic domain

    DEFF Research Database (Denmark)

    Lind, B; Koefoed, P; Thorsen, S

    2001-01-01

    the intracellular content of mutant and wild-type protein was similar. Northern blot analysis of total mRNA from transfected cells showed no reduction of the mutant protein C mRNA compared with wild-type protein C mRNA. Collectively, these results indicate that the Ser270Leu mutation in the affected family caused......Heterozygosity for a C8524T transition in the protein C gene converting Ser270(TCG) to Leu(TTG) in the protease domain was identified in a family with venous thrombosis. The mutation was associated with parallel reduction in plasma levels of protein C anticoagulant activity and protein C antigen......, which is consistent with a type 1 deficiency. Transient expression of mutant protein C cDNA in human kidney 293 cells and analysis of protein C antigen in culture media and cell lysates showed that the secretion of mutant protein compared with wild-type protein was reduced by at least 97% while...

  12. THE COMPLETE, TEMPERATURE-RESOLVED EXPERIMENTAL SPECTRUM OF VINYL CYANIDE (H2CCHCN) BETWEEN 210 AND 270 GHz

    International Nuclear Information System (INIS)

    Fortman, Sarah M.; Neese, Christopher F.; De Lucia, Frank C.; Medvedev, Ivan R.

    2011-01-01

    The results of an experimental approach to the identification and characterization of the astrophysical weed vinyl cyanide in the 210-270 GHz region are reported. This approach is based on spectrally complete, intensity-calibrated spectra taken at more than 400 different temperatures in the 210-270 GHz region and is used to produce catalogs in the usual astrophysical format: line frequency, line strength, and lower state energy. As in our earlier study of ethyl cyanide, we also include the results of a frequency point-by-point analysis, which is especially well suited for characterizing weak lines and blended lines in crowded spectra. This study shows substantial incompleteness in the quantum-mechanical (QM) models used to calculate astrophysical catalogs, primarily due to their omission of many low-lying vibrational states of vinyl cyanide, but also due to the exclusion of perturbed rotational transitions. Unlike ethyl cyanide, the QM catalogs for vinyl cyanide include analyses of perturbed excited vibrational states, whose modeling is more challenging. Accordingly, we include an empirical study of the frequency accuracy of these QM models. We observe modest frequency differences for some vibrationally excited lines.

  13. Spin Flipping and Polarization Lifetimes of a 270 MeV Deuteron Beam

    International Nuclear Information System (INIS)

    Morozov, V.S.; Crawford, M.Q.; Etienne, Z.B.; Kandes, M.C.; Krisch, A.D.; Leonova, M.A.; Sivers, D.W.; Wong, V.K.; Yonehara, K.; Anferov, V.A.; Meyer, H.O.; Schwandt, P.; Stephenson, E.J.; Przewoski, B. von

    2003-01-01

    We recently studied the spin flipping of a 270 MeV vertically polarized deuteron beam stored in the IUCF Cooler Ring. We swept an rf solenoid's frequency through an rf-induced spin resonance and observed the effect on the beam's vector and tensor polarizations. After optimizing the resonance crossing rate and setting the solenoid's voltage to its maximum value, we obtained a spin-flip efficiency of about 94 ± 1% for the vector polarization; we also observed a partial spin-flip of the tensor polarization. We then used the rf-induced resonance to measure the vector and tensor polarizations' lifetimes at different distances from the resonance; the polarization lifetime ratio τvector/τtensor was about 1.9 ± 0.4

  14. The electrical characteristics of copper slags in a 270 kVA DC arc furnace

    International Nuclear Information System (INIS)

    Derin, Bora; Sahin, Filiz Cinar; Yucel, Onuralp

    2003-01-01

    The electrical resistance of slags is the main criteria to determine the design and the operation conditions of slag resistance furnace (SRF) depending on temperature and composition. In this study, a 270 kVA DC electric arc furnace were used to determine the electrical characteristic of molten ancient copper slags. The specific conductivity of the slag was estimated by using furnace geometric factor given in the literature as an empirical formula and by using furnace resistance measured during smelting of the copper slag with or without different additives such as coke, CaO and Al 2 O 3 . (Original)

  15. 20 CFR 662.270 - How are the costs of providing services through the One-Stop delivery system and the operating...

    Science.gov (United States)

    2010-04-01

    ... through the One-Stop delivery system and the operating costs of the system to be funded? 662.270 Section... and the operating costs of the system to be funded? The MOU must describe the particular funding arrangements for services and operating costs of the One-Stop delivery system. Each partner must contribute a...

  16. Nuclear structure studies in the seaborgium region at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

    2015-10-15

    New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

  17. 48Ca+249Bk fusion reaction leading to element Z = 117: long-lived α-decaying 270Db and discovery of 266Lr.

    Science.gov (United States)

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Asai, M; Block, M; Boll, R A; Brand, H; Cox, D M; Dasgupta, M; Derkx, X; Di Nitto, A; Eberhardt, K; Even, J; Evers, M; Fahlander, C; Forsberg, U; Gates, J M; Gharibyan, N; Golubev, P; Gregorich, K E; Hamilton, J H; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hinde, D J; Hoffmann, J; Hollinger, R; Hübner, A; Jäger, E; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Laatiaoui, M; Lahiri, S; Lang, R; Lommel, B; Maiti, M; Miernik, K; Minami, S; Mistry, A; Mokry, C; Nitsche, H; Omtvedt, J P; Pang, G K; Papadakis, P; Renisch, D; Roberto, J; Rudolph, D; Runke, J; Rykaczewski, K P; Sarmiento, L G; Schädel, M; Schausten, B; Semchenkov, A; Shaughnessy, D A; Steinegger, P; Steiner, J; Tereshatov, E E; Thörle-Pospiech, P; Tinschert, K; Torres De Heidenreich, T; Trautmann, N; Türler, A; Uusitalo, J; Ward, D E; Wegrzecki, M; Wiehl, N; Van Cleve, S M; Yakusheva, V

    2014-05-02

    The superheavy element with atomic number Z=117 was produced as an evaporation residue in the (48)Ca+(249)Bk fusion reaction at the gas-filled recoil separator TASCA at GSI Darmstadt, Germany. The radioactive decay of evaporation residues and their α-decay products was studied using a detection setup that allowed measuring decays of single atomic nuclei with half-lives between sub-μs and a few days. Two decay chains comprising seven α decays and a spontaneous fission each were identified and are assigned to the isotope (294)117 and its decay products. A hitherto unknown α-decay branch in (270)Db (Z = 105) was observed, which populated the new isotope (266)Lr (Z = 103). The identification of the long-lived (T(1/2) = 1.0(-0.4)(+1.9) h) α-emitter (270)Db marks an important step towards the observation of even more long-lived nuclei of superheavy elements located on an "island of stability."

  18. 17 CFR 270.2a-4 - Definition of “current net asset value” for use in computing periodically the current price of...

    Science.gov (United States)

    2010-04-01

    ... value between calculations made as of the close of the New York Stock Exchange on the preceding business... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of âcurrent net... Section 270.2a-4 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES...

  19. Comparison in myelography between iodixanol 270 and 320 mgI/ml and iotrolan 300 mgI/ml: a multicentre, randomised, parallel-group, double-blind, phase III trial

    International Nuclear Information System (INIS)

    Palmers, Yvan; Kuhn, Fritz-Peter; Petersen, Dirk; De Greef, Danielle

    2002-01-01

    The objective of the trial was to compare the safety and efficacy of the non-ionic, dimeric, isotonic contrast medium iodixanol (Visipaque 270 and 320 mgI/ml) with those of iotrolan (Isovist 300 mgI/ml) in myelography. After lumbar or cervical puncture, 315 patients were examined in a multicentre, double-blind, randomised, comparative myelography study. Image quality, changes in vital signs, immediate and delayed adverse events were registered. There was a tendency for better images with iodixanol 320 than with iodixanol 270 and iotrolan 300, but the overall quality was good or excellent with all products. The frequency of patients reporting adverse events and headache varied much across centres, but there was no statistically significant difference between the contrast media. The incidence of events was higher after lumbar puncture than after cervical puncture, in women rather than in men, and after puncture with a 22-gauge (G) bevel-tipped needle compared with a 24 G Sprotte needle. The frequency of headache did not correlate with the absence of pathology. The higher iodine concentration in iodixanol 320 could be an advantage for film quality. When compared with iotrolan 300, iodixanol 320 and 270 give similar incidences of adverse events, including headache. (orig.)

  20. MCSE Core Elective Exams in a Nutshell Covers exams 70-270, 70-297, and 70-298

    CERN Document Server

    Bhardwaj, Pawan

    2006-01-01

    For Windows XP and Windows Server 2003 administrators preparing forMicrosoft Certified Systems Engineer (MCSE) core exam 70-270, and core exams 70-297, and 70-298, this book is invaluable. Not only does it provide the resources you need to succeed on the exams, but to succeed in the real world as well. Think of this book as the notes you would have taken if you were to capture every essential nugget of information related to the skills measured in the core elective exams. To begin with, MCSE Core Elective Exams in a Nutshell allows you to see all of the topics expected for mastery in each

  1. Properties of an α Particle in a Bohrium 270 Nucleus under the Generalized Symmetric Woods-Saxon Potential

    Directory of Open Access Journals (Sweden)

    Bekir Can LÜTFÜOĞLU

    2017-04-01

    Full Text Available The energy eigenvalues and the wave functions of an α particle in a Bohrium 270 nucleus have been calculated by solving Schrödinger equation for Generalized Symmetric Woods-Saxon potential. Using the energy spectrum by excluding and including the quasi-bound eigenvalues, entropy, internal energy, Helmholtz energy, and specific heat, as functions of reduced temperature have been calculated. Stability and emission characteristics have been interpreted in terms of the wave and thermodynamic functions. The kinetic energy of a decayed α particle was calculated using the quasi-bound states, which has been found close to the experimental value.

  2. 17 CFR 270.2a51-2 - Definitions of beneficial owner for certain purposes under sections 2(a)(51) and 3(c)(7) and...

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.2a51-2 Definitions of... exception set forth in this subparagraph, be excluded from the definition of investment company solely by... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions of beneficial...

  3. Automatic whole core depletion and criticality calculations by MCNPX 2.7.0

    International Nuclear Information System (INIS)

    Kalcheva, S.; Koonen, E.

    2012-01-01

    Different approaches to perform automatic whole core criticality and depletion calculations in a research reactor using MCNPX 2.7.0 are presented. An approximate method is to use the existing symmetries of the burned fuel material distribution in the core, i.e., the axial, radial and azimuth symmetries around the core center, in order to significantly reduce the computation time. In this case it is not necessary to give a unique material number to each burn up cell. Cells having similar burn up and power, achieved during similar irradiation history at same initial fuel composition, will experience similar composition evolution and can therefore be given the same material number. To study the impact of the number of unique burn up materials on the computation time and utilized RAM memory, several MCNPX models have been developed. The paper discusses the accuracy of the model on comparison with measurements of BR2 operation cycles in function of the number of unique burn up materials and the impact of the used Q-value (MeV/fission) of the recoverable fission energy. (authors)

  4. SHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

    Directory of Open Access Journals (Sweden)

    Jefferson Olivatto da Silva

    2011-09-01

    Full Text Available Resenha do livroSHORTER, Aylward. African recruits and missionary conscripts: the White Fathers and the Great War (1914 – 1922. London: Missionaries of Africa History Project, 2007. 270 p. ISBN: 9780955523502

  5. 17 CFR 270.3c-3 - Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of certain terms used in section 3(c)(1) of the Act with respect to certain debt securities offered by small business... COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-3 Definition of certain...

  6. Spin-isospin excitation in sd-shell nuclei studied by the (d,2He) reaction at Ed=270MeV

    International Nuclear Information System (INIS)

    Niizeki, T.; Ohnuma, H.; Yamamoto, T.; Katoh, K.; Yamashita, T.; Hara, Y.; Okamura, H.; Sakai, H.; Ishida, S.; Sakamoto, N.; Otsu, H.; Wakasa, T.; Uesaka, T.; Satou, Y.; Fujita, T.; Ichihara, T.; Orihara, H.; Toyokawa, H.; Hatanaka, K.; Kato, S.; Kubono, S.; Yosoi, M.

    1994-01-01

    The (d, 2 He) reactions on 24 Mg, 26 Mg and 28 Si were studied at E d =270MeV. The 0 cross sections obtained for the 1 + states from the 24 Mg, 28 Si(d, 2 He) reactions show a good correlation with those from the mirror (p,n) reactions. Four peaks were identified in the 26 Mg(d, 2 He) 26 Ne reaction as being due to the 1 + excitation. The B(GT + ) values for these transitions were estimated and compared with the shell model prediction. ((orig.))

  7. Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

    International Nuclear Information System (INIS)

    Janek, M.; Saito, T.; Hatano, M.; Kato, H.; Sakoda, S.; Uchigashima, N.; Yako, K.; Ladygin, V.P.; Isupov, A. Yu.; Ladygina, N.B.; Malakhov, A.I.; Reznikov, S.G.; Vasiliev, T.A.; Uesaka, T.; Maeda, Y.; Suda, K.; Nishikawa, J.; Ohnishi, T.; Sakamoto, N.; Sekiguchi, K.; Okamura, H.; Sakai, H.

    2007-01-01

    The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd → 3 Hen obtained at T d =270 MeV in the angular range 0 -110 in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrate the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m. (orig.)

  8. Analyzing powers Ayy, Axx, Axz and Ay in the dd→3Hen reaction at 270 MeV

    International Nuclear Information System (INIS)

    Janek, M.; Saito, T.; Ladygin, V.P.

    2007-01-01

    The data on the tensor A yy , A xx , A xz and vector A y analyzing powers in the dd→ 3 Hen reaction obtained at T d =270 MeV in the angular range 0-110 deg in the c.m. are presented. The observed negative sign of the tensor analyzing powers A yy , A xx and A xz at small angles clearly demonstrates the sensitivity to the ratio of the D- and S-wave component of the 3 He wave function. However, the one-nucleon exchange calculations by using the standard 3 He wave functions have failed to reproduce the strong variation of the tensor analyzing powers as a function of the angle in the c.m

  9. Ressonância magnética na esclerose múltipla: análise de 270 casos

    Directory of Open Access Journals (Sweden)

    Minguetti Guilberto

    2001-01-01

    Full Text Available O autor apresenta 270 casos de pacientes com história clínica e imagens de ressonância magnética compatíveis com esclerose múltipla. São feitas considerações sobre a incidência quanto ao sexo, grupos etários e localização das lesões. Por se tratar de doença considerada rara nos países tropicais, o autor tece considerações didáticas sobre os critérios clínicos e de imagem úteis na prática radiológica e alerta os neurologistas para o significado desta doença na capital (Curitiba de um estado brasileiro (Paraná situado entre os paralelos 22º e 30º Sul.

  10. 270GHz SiGe BiCMOS manufacturing process platform for mmWave applications

    Science.gov (United States)

    Kar-Roy, Arjun; Preisler, Edward J.; Talor, George; Yan, Zhixin; Booth, Roger; Zheng, Jie; Chaudhry, Samir; Howard, David; Racanelli, Marco

    2011-11-01

    TowerJazz has been offering the high volume commercial SiGe BiCMOS process technology platform, SBC18, for more than a decade. In this paper, we describe the TowerJazz SBC18H3 SiGe BiCMOS process which integrates a production ready 240GHz FT / 270 GHz FMAX SiGe HBT on a 1.8V/3.3V dual gate oxide CMOS process in the SBC18 technology platform. The high-speed NPNs in SBC18H3 process have demonstrated NFMIN of ~2dB at 40GHz, a BVceo of 1.6V and a dc current gain of 1200. This state-of-the-art process also comes with P-I-N diodes with high isolation and low insertion losses, Schottky diodes capable of exceeding cut-off frequencies of 1THz, high density stacked MIM capacitors, MOS and high performance junction varactors characterized up to 50GHz, thick upper metal layers for inductors, and various resistors such as low value and high value unsilicided poly resistors, metal and nwell resistors. Applications of the SBC18H3 platform for millimeter-wave products for automotive radars, phased array radars and Wband imaging are presented.

  11. Prevalence of and risk factors associated with cesarean section in Lebanon - A retrospective study based on a sample of 29,270 women.

    Science.gov (United States)

    Zgheib, Sandy M; Kacim, Mohammad; Kostev, Karel

    2017-12-01

    During the last decades, there has been an alarming and dramatic increase in the number of cesarean births in both developed and undeveloped countries. This increase has not been clinically justified but, nevertheless, has raised an important number of issues. The aim of this study was to determine the risk factors associated with the high cesarean section rates in Lebanon. This study is based on a sample of 29,270 Lebanese women who were pregnant between 2000 and 2015. Among these, 14,327 gave birth by cesarean section and 14,943 gave birth vaginally. To identify the risk factors of cesarean section, logistic regression was applied as a statistical method using the SPSS statistical package. Of the 29,270 pregnant women included in the study, 49% had cesarean sections while 51% gave birth vaginally. Repeat cesarean section accounted for 23% while vaginal birth after cesarean accounted for only 0.2% of deliveries. In addition, weekdays were associated with a preference of providers to carry out more cesarean sections. According to an analysis of our data using logistic regression, the risk factors associated with the increase in cesarean section rates were advanced maternal age, elective cesarean section, malpresentation of fetus, multiple birth, prolonged pregnancy, prolonged labor, and fetal distress. Based on these results, it is recommended that a new health policy be implemented to reduce the number of unnecessary cesarean deliveries in Lebanon. Copyright © 2017 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  12. Fission of 209 Bi by 60-270 MeV tagged photons: cross section measurement and analysis of photo fissility

    International Nuclear Information System (INIS)

    Terranova, M.L.; Tavares, O.A.P.

    1996-07-01

    Tagged photons produced by the ROKK-2 facility have been used to measure the photofission cross section of 209 Bi in the energy range 60-270 MeV. Photofission events were detected by using a nuclear fragment detector designed for fission experiments, based on multiwire spark counters. Fissility values have been deduced and compared with available data obtained in other laboratories by using monochromatic photons. These data, together with early measurements obtained near photofission threshold, have been analysed in the framework of a two-step model which considers the primary photo interaction occurring via the quasi-deuteron and/or photo mesonic processes, followed by a mechanism of evaporation-fission competition for the excited residual nucleus. The model was found to reproduce the main experimental features of 209 Bi photo fissility up to 300 MeV. (author). 52 refs., 7 figs., 2 tabs

  13. Preconditioner and convergence study for the Quantum Computer Aided Design (QCAD) nonlinear poisson problem posed on the Ottawa Flat 270 design geometry.

    Energy Technology Data Exchange (ETDEWEB)

    Kalashnikova, Irina

    2012-05-01

    A numerical study aimed to evaluate different preconditioners within the Trilinos Ifpack and ML packages for the Quantum Computer Aided Design (QCAD) non-linear Poisson problem implemented within the Albany code base and posed on the Ottawa Flat 270 design geometry is performed. This study led to some new development of Albany that allows the user to select an ML preconditioner with Zoltan repartitioning based on nodal coordinates, which is summarized. Convergence of the numerical solutions computed within the QCAD computational suite with successive mesh refinement is examined in two metrics, the mean value of the solution (an L{sup 1} norm) and the field integral of the solution (L{sup 2} norm).

  14. Outcomes of Solo Smart valve in a single-center experience of 270 patients.

    Science.gov (United States)

    Liu, Hao; Khani-Hanjani, Abbas; Yang, Siyuan; Wang, Wei; Sidhu, Surita; Mullen, John; Modry, Dennis; Wang, Shaohua

    2018-04-03

    The Solo Smart pericardial aortic valve has been widely used in Europe as an option for aortic valve replacement (AVR). We are reporting early and midterm clinical outcomes of AVR with the Solo Smart valve in a single North America center. This is a retrospective study of 270 consecutive patients who had AVR at Mazankowski Alberta Heart Institute from February 2011 to March 2015. Follow-up and echocardiographic data were collected retrospectively from electronic and paper charts. Univariate and multivariate analysis were performed to evaluate the results. The mean age was 71.2±10.0 years, 67.4% were male, and 79.3% had combined procedures. Mean STS Score was 4.18±3.91. Early mortality was 3.7% for the entire group and 0% for isolated aortic valve replacement group. Mean cross-clamp time for isolated AVR and AVR with concomitant procedure was 70.8±12.7min and 117.0±45.0min, respectively. Permanent pacemaker implantation was necessary in 2.2% of patients. Echocardiography demonstrated a reduction in mean gradients from 40.8±17.4mmHg to 7.6±3.7 mmHg and peak gradient from 72.5 ± 48.8 mmHg to 15.5±7.5 mmHg. The 1-, 3-, and 5- year overall survival was 93.0%, 86.5% and 75.9%, respectively. At 5 years, freedom from valve-related death was 92.4%, freedom from structural valve deterioration and freedom from aortic valve reoperation were 96.4% and 98%, respectively. The Solo Smart valve is safe and has excellent hemodynamic performance. Aortic valve reoperation and rates of valve-related adverse events during midterm follow-up were low.

  15. Tensor analyzing power T20 of the dd →3Hen and dd →3Hp reactions at zero angle for energies 140, 200, and 270 MeV

    International Nuclear Information System (INIS)

    Ladygin, V. P.; Uesaka, T.; Saito, T.; Hatano, M.; Isupov, A. Yu.; Kato, H.; Ladygina, N. B.; Maeda, Y.; Malakhov, A. I.; Nishikawa, J.; Ohnishi, T.; Okamura, H.; Reznikov, S. G.; Sakai, H.; Sakamoto, N.; Sakoda, S.; Satou, Y.; Sekiguchi, K.; Suda, K.; Tamii, A.

    2006-01-01

    RIKEN Accelerator Research Facility data on the tensor analyzing power T 20 of the dd → 3 Hen and dd → 3 Hp reactions at zero angle for deuteron kinetic energies of 140, 200, and 270 MeV are reported. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S-wave ratio in the 3 He and 3 H wave functions in the energy range of the experiment. Data on T 20 for the 3 Hen channel are in agreement with those for the 3 Hp channel within the experimental errors

  16. The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV at zero angle

    International Nuclear Information System (INIS)

    Ladygin, V.P.; ); Uesaka, T.; Saito, T.

    2006-01-01

    The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero angle obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 Hen and 3 Hp channels are in agreement within experimental accuracy [ru

  17. Silicon photomultiplier readout of a monolithic 270 x 5 x 5 cm{sup 3} plastic scintillator bar for time of flight applications

    Energy Technology Data Exchange (ETDEWEB)

    Roeder, Marko; Bemmerer, Daniel; Heidel, Klaus; Stach, Daniel; Wagner, Andreas; Weinberger, David [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); Cowan, Thomas E.; Gohl, Stefan; Reinicke, Stefan [Helmholtz-Zentrum Dresden-Rossendorf (HZDR), Dresden (Germany); TU Dresden (Germany); Reinhardt, Tobias P.; Zuber, Kai [TU Dresden (Germany); Collaboration: R3B-Collaboration

    2016-07-01

    The detection of 200-1000 MeV neutrons requires large amounts of detector material because of the long nuclear interaction length of these particles. In the example of the NeuLAND neutron time-of-flight detector at FAIR, this is accomplished by using 3000 scintillator bars of 270 x 5 x 5 cm{sup 3} size made of the fast plastic polyvinyltoluene. In the present work, we investigated whether silicon photomultiplier (SiPM) photosensors can replace fast timing photomultiplier tubes. The response of the system consisting of scintillator, SiPM, and preamplifier was studied using 30 MeV single electrons provided by the ELBE superconducting electron linac. The results were interpreted by a simple Monte Carlo simulation, and the time resolution was found to obey an inverse-square-root scaling law with the number of fired pixels. In the electron beam tests, a time resolution of σ{sub t}=136 ps was reached with a pure SiPM readout, well within the design parameters for NeuLAND.

  18. Glenn Seaborg's Contributions to Heavy Element Science and the Periodic Table

    International Nuclear Information System (INIS)

    Hobart, David E.

    2012-01-01

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  19. Glann Seaborg's Contributions to Heavy Element Science and the Periodic Table

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Laboratory

    2012-08-17

    In celebrating the centennial anniversary of the birth of Glenn T. Seaborg it is fitting that we recount and pay tribute to his legacy. Many know of the scientific accomplishments of this man who became a legend and anyone who has attended his lectures can attest to how informative, educational, and entertaining he was. He had a beguiling and whimsical sense of humor and used this to drive home his points and share his passion and quest for discovery. The periodic table is a fundamental cornerstone of science and remains a central unifying principal. Seaborg was the architect of the actinide series of elements and their proper placement in the periodic table and co-discoverer of ten transuranium elements - one of which bears his name, element 106, seaborgium. The work and achievements of this Nobel laureate have touched the lives of many and his legacy will continue for generations to come.

  20. Phase Change Material Selection for Thermal Energy Storage at High Temperature Range between 210 °C and 270 °C

    Directory of Open Access Journals (Sweden)

    José Miguel Maldonado

    2018-04-01

    Full Text Available The improvement of thermal energy storage systems implemented in solar technologies increases not only their performance but also their dispatchability and competitiveness in the energy market. Latent heat thermal energy storage systems are one of those storing methods. Therefore, the need of finding the best materials for each application becomes an appealing research subject. The main goal of this paper is to find suitable and economically viable materials able to work as phase change material (PCM within the temperature range of 210–270 °C and endure daily loading and unloading processes in a system with Fresnel collector and an organic Rankine cycle (ORC. Twenty-six materials have been tested and characterized in terms of their thermophysical conditions, thermal and cycling stability, and health hazard. Two materials out of the 26 candidates achieved the last stage of the selection process. However, one of the two finalists would require an inert working atmosphere, which would highly increase the cost for the real scale application. This leads to a unique suitable material, solar salt (40 wt % KNO3/60 wt % NaNO3.

  1. The tensor analyzing power T20 in the dd → 3Hen and dd → 3Hp reactions at the energies 140, 200 and 270 MeV and at zero degree

    International Nuclear Information System (INIS)

    Ladygin, V.P.; Uesaka, T.; Saito, T.

    2005-01-01

    The data on the tensor analyzing power T 20 in the dd → 3 Hen and dd → 3 Hp reactions at 140, 200 and 270 MeV of the deuteron kinetic energy and at zero degree obtained at RIKEN Accelerator Research Facility are presented. The observed positive sign of T 20 clearly demonstrates the sensitivity to the D/S wave ratios in the 3 He and 3 H in the energy domain of the measurements. The T 20 data for the 3 He-n and 3 H-p channels are in agreement within experimental accuracy

  2. Beam Cherenkov counter conception for in line identification of 270 GeV/c Σ- Ξ- and Ω-

    International Nuclear Information System (INIS)

    Touillon, R.

    1991-06-01

    The purpose of this thesis is to design a beam Cerenkov counter. This counter will provide an on line identification of the Σ - , Ξ - and Ω - hyperons (270 GeV/c) in the experiment WA89 at CERN. The acceptance of the detector should allow tagging these hyperons in a large momentum range (± 25%) and for a beam divergence up to 250 microrad. The first part of this report is devoted to the physical goals such as the study of charmed baryons, the search of multiquark states, and the determination of hadronic and electromagnetic hyperon radii. The experimental WA89 setup is also presented. The major part deals with the design of the Cerenkov counter. The dimension of the detector, the Cerenkov angle value, the focal length of the spherical mirror, etc... are derived from a Monte-Carlo simulation. Various methods of simple photon detection (gaz detector: TEA, TMAE; solid detectors: PM and Image Intensifier) are investigated. The most performing solution uses two conical mirrors in order to reduce the size of the Cerenkov circles and an image intensifier (which detects the single photon) followed by an optical fiber matrix transmitting the luminous signal to 160 photomultipliers. The on line procedure for calculating the radius of each circle (identification of the particle) is studied in detail. Finally, the optimization of the optical system to achromatize the Cerenkov light is discussed [fr

  3. Lessons from Iowa : development of a 270 megawatt compressed air energy storage project in midwest Independent System Operator : a study for the DOE Energy Storage Systems Program.

    Energy Technology Data Exchange (ETDEWEB)

    Holst, Kent (Iowa Stored Energy Plant Agency, Traer, IA); Huff, Georgianne; Schulte, Robert H. (Schulte Associates LLC, Northfield, MN); Critelli, Nicholas (Critelli Law Office PC, Des Moines, IA)

    2012-01-01

    The Iowa Stored Energy Park was an innovative, 270 Megawatt, $400 million compressed air energy storage (CAES) project proposed for in-service near Des Moines, Iowa, in 2015. After eight years in development the project was terminated because of site geological limitations. However, much was learned in the development process regarding what it takes to do a utility-scale, bulk energy storage facility and coordinate it with regional renewable wind energy resources in an Independent System Operator (ISO) marketplace. Lessons include the costs and long-term economics of a CAES facility compared to conventional natural gas-fired generation alternatives; market, legislative, and contract issues related to enabling energy storage in an ISO market; the importance of due diligence in project management; and community relations and marketing for siting of large energy projects. Although many of the lessons relate to CAES applications in particular, most of the lessons learned are independent of site location or geology, or even the particular energy storage technology involved.

  4. Theoretical predictions of properties and gas-phase chromatography behaviour of carbonyl complexes of group-6 elements Cr, Mo, W, and element 106, Sg.

    Science.gov (United States)

    Pershina, V; Anton, J

    2013-05-07

    Fully relativistic, four-component density functional theory electronic structure calculations were performed for M(CO)6 of group-6 elements Cr, Mo, W, and element 106, Sg, with an aim to predict their adsorption behaviour in the gas-phase chromatography experiments. It was shown that seaborgium hexacarbonyl has a longer M-CO bond, smaller ionization potential, and larger polarizability than the other group-6 molecules. This is explained by the increasing relativistic expansion and destabilization of the (n - 1)d AOs with increasing Z in the group. Using results of the calculations, adsorption enthalpies of the group-6 hexacarbonyls on a quartz surface were predicted via a model of physisorption. According to the results, -ΔHads should decrease from Mo to W, while it should be almost equal--within the experimental error bars--for W and Sg. Thus, we expect that in the future gas-phase chromatography experiments it will be almost impossible--what concerns ΔHads--to distinguish between the W and Sg hexacarbonyls by their deposition on quartz.

  5. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  6. Prevalence of pain medication prescriptions in France, Germany, and the UK - a cross-sectional study including 4,270,142 patients.

    Science.gov (United States)

    Jacob, Louis; Kostev, Karel

    2018-01-01

    The goal of the present study was to analyze the prevalence of pain medication prescriptions in general practices in France, Germany, and the UK. This study included all patients aged ≥18 years followed in 2016 in general practitioner practices in France, Germany and the UK. The primary outcome was the prevalence of patients receiving prescriptions for pain medications in France, Germany, and the UK in 2016. The following drugs were included in the analysis: anti-inflammatory and antirheumatic products, non-steroids and analgesics including opioids, antimigraine preparations, and other analgesics and antipyretics. Demographic variables included age and gender. This study included 4,270,142 patients. The prevalences of pain medication prescriptions were 57.3% in France, 29.6% in Germany, and 21.7% in the UK. Although this prevalence generally remained consistent between age groups in France (54.3%-60.3%), it increased with age in Germany (18-30 years: 23.8%; >70 years: 35.8%) and in the UK (18-30 years: 9.3%; >70 years: 43.8%). Finally, the prevalence of pain medication prescriptions was higher in women than in men in all three countries. Paracetamol was prescribed to 82.3% and 60.1% of patients receiving pain medication in France and the UK, respectively, whereas ibuprofen was prescribed to 46.5% of individuals in Germany. The prevalence of pain medication prescriptions was higher in France than in Germany and the UK. Further research is needed to gain a better understanding of the differences in the prescription patterns between these three European countries.

  7. Randomized clinical trial of 270° posterior versus 180° anterior partial laparoscopic fundoplication for gastro-oesophageal reflux disease.

    Science.gov (United States)

    Roks, D J; Koetje, J H; Oor, J E; Broeders, J A; Nieuwenhuijs, V B; Hazebroek, E J

    2017-06-01

    Partial fundoplications provide similar reflux control with fewer post-fundoplication symptoms compared with Nissen fundoplication for gastro-oesophageal reflux disease (GORD). The best choice of procedure for partial fundoplication remains unclear. The aim of this study was to compare the outcome of two different types of partial fundoplication for GORD. A double-blind RCT was conducted between 2012 and 2015 in two hospitals specializing in antireflux surgery. Patients were randomized to undergo either a laparoscopic 270° posterior fundoplication (Toupet) or a laparoscopic 180° anterior fundoplication. The primary outcome was postoperative dysphagia at 12 months, measured by the Dakkak score. Subjective outcome was analysed at 1, 3, 6 and 12 months after surgery. Objective reflux control was assessed before and 6 months after surgery. Ninety-four patients were randomized to laparoscopic Toupet or laparoscopic 180° anterior fundoplication (47 in each group). At 12 months, 85 patients (90 per cent) were available for follow-up. Objective scores were available for 76 (81 per cent). Postoperative Dakkak dysphagia score at 12 months was similar in the two groups (mean 5·9 for Toupet versus 6·4 for anterior fundoplication; P = 0·773). Subjective outcome at 12 months demonstrated no significant differences in control of reflux or post-fundoplication symptoms. Overall satisfaction and willingness to undergo surgery did not differ between the groups. Postoperative endoscopy and 24-h pH monitoring showed no significant differences in mean oesophageal acid exposure time or recurrent pathological oesophageal acid exposure. Both types of partial fundoplication provided similar control of GORD at 12 months, with no difference in post-fundoplication symptoms. Registration number: NTR5702 (www.trialregister.nl). © 2017 BJS Society Ltd Published by John Wiley & Sons Ltd.

  8. [Escherichia coli heat-labile enterotoxin B subunit enhances the immune response against canine parvovirus VP2 in mice immunized by VP2 DNA vaccine].

    Science.gov (United States)

    Han, Dongmei; Zhong, Fei; Li, Xiujin; Wang, Wei; Wang, Xingxing; Pan, Sumin

    2011-01-01

    To investigate the effect of Escherichia coli heat-labile enterotoxin (LT) B subunit (LTB) gene on canine parvovirus (CPV) VP2 gene vaccine. The LTB gene was amplified by PCR from genomic DNA of E. coli 44815 strain. The VP2-70 fragment (210 bp) encoding major epitope of VP2 (70 amino acids) was amplified by PCR from a plasmid encoding VP2 gene. VP2-70 and LTB genes were inserted into the eukaryotic vector to construct VP2-70 gene,LTB gene and VP2-70-LTB fused gene vectors. The mice were immunized with VP2-70 vector, VP2-70-LTB fused vector, or VP2-70 vector plus LTB vector, respectively. The antibody titers at the different time were measured by using ELISA method. The spleen lymphocyte proliferation activity was analyzed by 3-(4, 5-Dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay. The sequence of VP2-70 and LTB genes was identified. The recombinant VP2-70 and LTB proteins could be expressed in HEK293T cells in a secretory manner. The mice immunized with VP2-70 vector, VP2-70-LTB vector or VP2-70 vector plus LTB vector could generate the specific antibody against VP2 protein. The antibody titer immunized with VP2-70-LTB vector reached 1:5120 at 35 d post immunization, significantly higher than that of other two groups (P vaccine in mice.

  9. Transuranium elements: Past, present, and future

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1995-01-01

    In this illustrative Account the authors shall concentrate on four of these elements, chosen for their current interest or pivotal role. The story of plutonium is one of the most dramatic in the history of science, and today, plutonium is at the focus of an extraordinary dilemma. Mendelevium (element 101) has played a pivotal role in blazing the trail for the discovery of the heaviest elements on the basis of open-quotes one atom at a timeclose quotes production. Seaborgium (element 106) was recently named in my honor by the discoverers and may be the last element, at least for some time, for which it will be possible to determine many chemical properties. And element 110 represents recent evidence, after a lapse of 10 years, for the discovery of a chemical element. Recent (1994) recommendations of the IUPAC Commission on the Nomenclature of Inorganic Chemistry for the renaming of elements 104-108 have met with widespread rejection. The author is using the names proposed by the acknowledged discoverers (elements 106-109) or, in the case of the disputed elements 104 and 105, the most logical names. 21 refs., 5 figs

  10. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  11. Excess mortality, causes of death and life expectancy in 270,770 patients with recent onset of mental disorders in Denmark, Finland and Sweden.

    Directory of Open Access Journals (Sweden)

    Merete Nordentoft

    Full Text Available BACKGROUND: Excess mortality among patients with severe mental disorders has not previously been investigated in detail in large complete national populations. OBJECTIVE: To investigate the excess mortality in different diagnostic categories due to suicide and other external causes of death, and due to specific causes in connection with diseases and medical conditions. METHODS: In longitudinal national psychiatric case registers from Denmark, Finland, and Sweden, a cohort of 270,770 recent-onset patients, who at least once during the period 2000 to 2006 were admitted due to a psychiatric disorder, were followed until death or the end of 2006. They were followed for 912,279 person years, and 28,088 deaths were analyzed. Life expectancy and standardized cause-specific mortality rates were estimated in each diagnostic group in all three countries. RESULTS: The life expectancy was generally approximately 15 years shorter for women and 20 years shorter for men, compared to the general population. Mortality due to diseases and medical conditions was increased two- to three-fold, while excess mortality from external causes ranged from three- to 77-fold. Mortality due to diseases and medical conditions was generally lowest in patients with affective disorders and highest in patients with substance abuse and personality disorders, while mortality due to suicide was highest in patients with affective disorders and personality disorders, and mortality due to other external causes was highest in patients with substance abuse. CONCLUSIONS: These alarming figures call for action in order to prevent the high mortality.

  12. [Treatment of mallet finger with dorsal nail glued splint: retrospective analysis of 270 cases].

    Science.gov (United States)

    Facca, S; Nonnenmacher, J; Liverneaux, P

    2007-11-01

    Management of mallet finger is both difficult and controversial. Sequelae are not uncommon, particularly after surgical treatment. Many authors advocate orthopedic treatment which is less invasive but requires greater patient participation to implement. Despite the large number of orthopedic methods proposed, none has proven superiority. We report here our experience with a dorsal adhesive splint which preserves digital pulp function and improves observance. This retrospective analysis included 270 mallet fingers presenting 153 tendon injuries and 117 bony injuries in 265 patients aged 42 years on average and treated from 2003 to 2005. Most of the tendon injuries involved the medius (38.7%) and most of the bony injuries involved the ring finger (35.4%). A splint was fashioned for the two distal phalanges and glued to the nail plate filed for this purpose. The splint was fashioned out of an L-shaped plastic sheet of thermo-malleable plastic dipped in hot water (60 degrees C). The L was molded to the dorsal aspect of the phalanges and rolled like a ring around the second phalanx, then glued to the nail. The splint was worn for eight weeks by patients with a tendon injury and six weeks for those with a bony injury. The splint was then worn at night for two weeks. Three criteria were used to analyze outcome: residual extension deficit, joint involvement, complications. Mean follow-up was 18 months. Mean time from trauma to definitive installation of the splint was six days. The complication rate for this orthopedic method was 14.3%, complications being observed in 6% of patients. All complications were transient except for one case of swan neck deformity and one case of painful osteoarthritis. Thirty splints (11%) became unglued but were all reinstalled using the same protocol. Thirty fingers (14%) presented residual deficit of active extension measuring less than 20 degrees. The quality of the result depended on the type of injury: tendon injuries led to extension

  13. 75 FR 47223 - Louisiana: Final Authorization of State-Initiated Changes and Incorporation by Reference of...

    Science.gov (United States)

    2010-08-05

    ..., unless the EPA receives adverse written comment on this regulation by the close of business September 7... personal information provided, unless the comment includes information claimed to be Confidential Business... 270.14(a) and (b) intro. 517.B.5 270.14(b)(19)(iv). 517.T.6.a 270.14(c) related. 517.V 270.14(b)(21...

  14. Millennial-scale climatic variability between 340 000 and 270 000 years ago in SW Europe: evidence from a NW Iberian margin pollen sequence

    Directory of Open Access Journals (Sweden)

    S. Desprat

    2009-03-01

    Full Text Available We present a new high-resolution marine pollen record from NW Iberian margin sediments (core MD03-2697 covering the interval between 340 000 and 270 000 years ago, a time period centred on Marine Isotope Stage (MIS 9 and characterized by particular baseline climate states. This study enables the documentation of vegetation changes in the north-western Iberian Peninsula and therefore the terrestrial climatic variability at orbital and in particular at millennial scales during MIS 9, directly on a marine stratigraphy. Suborbital vegetation changes in NW Iberia in response to cool/cold events are detected throughout the studied interval even during MIS 9e ice volume minimum. However, they appear more frequent and of higher amplitude during the 30 000 years following the MIS 9e interglacial period and during the MIS 9a-8 transition, which correspond to intervals of an intermediate to high ice volume and mainly periods of ice growth. Each suborbital cold event detected in NW Iberia has a counterpart in the Southern Iberian margin SST record. High to moderate amplitude cold episodes detected on land and in the ocean appear to be related to changes in deep water circulation and probably to iceberg discharges at least during MIS 9d, the mid-MIS 9c cold event and MIS 9b. This work provides therefore additional evidence of pervasive millennial-scale climatic variability in the North Atlantic borderlands throughout past climatic cycles of the Late Pleistocene, regardless of glacial state. However, ice volume might have an indirect influence on the amplitude of the millennial climatic changes in Southern Europe.

  15. Genetic parameters estimate for milk and mozzarella cheese yield, fat and protein percentage in dairy buffaloes in Brazil

    Directory of Open Access Journals (Sweden)

    H. Tonhati

    2010-02-01

    Full Text Available The aim of this study was analyze the (covariance components and genetic and phenotypic relationships in the following traits: accumulated milk yield at 270 days (MY270, observed until 305 days of lactation; accumulated milk yield at 270 days (MY270/ A and at 305 days (MY305, observed until 335 days of lactation; mozzarella cheese yield (MCY and fat (FP and protein (PP percentage, observed until 335 days of lactation. The (covariance components were estimated by Restricted Maximum Likelihood methodology in analyses single, two and three-traits using animal models. Heritability estimated for MY270, MY270/A, MY305, MCY, FP and PP were 0.22; 0.24, 0.25, 0.14, 0.29 and 0.40 respectively. The genetic correlations between MCY and the variables MY270, MY270/A, MY305, PP and FP was: 0.85; 1.00; 0.89; 0.14 and 0.06, respectively. This way, the selection for the production of milk in long period should increase MCY. However, in the search of animals that produce milk with quality, the genetic parameters suggest that another index should be composed allying these studied traits.

  16. Prevalence of Coxsackievirus A6 and Enterovirus 71 in Hand, Foot and Mouth Disease in Nanjing, China in 2013.

    Science.gov (United States)

    Hu, Ya-Qian; Xie, Guang-Cheng; Li, Dan-Di; Pang, Li-Li; Xie, Jing; Wang, Peng; Chen, Ying; Yang, Jing; Cheng, Wei-Xia; Zhang, Qing; Jin, Yu; Duan, Zhao-Jun

    2015-09-01

    Although hand, foot and mouth disease (HFMD) has been strongly associated with enterovirus 71 (EV71), coxsackievirus A16 (CVA16) and other enteroviruses, studies regarding coxsackievirus A6 (CVA6) infection in HFMD are limited. The aim of this study was to identify the major etiological agents causing HFMD in Nanjing in 2013 and explore the clinical and genetic characteristics of the prevalent enterovirus (EV) types in HFMD. A total of 394 throat swabs were collected from hospitalized children diagnosed with HFMD from April to July 2013. EVs were detected by reverse transcription polymerase chain reaction of 5' UTR sequences. Genotyping and phylogenetic analysis were based on VP4 sequences. Demographic and clinical data were obtained. Of the specimens, 68.5% (270/394) were positive for EVs. The genotypes and detection rates were CVA6, 30.00% (81/270); EV71, 17.41% (47/270); HRV, 11.11% (30/270); CVA10, 3.33% (9/270); CVA2, 1.11% (3/270); CVA16, 0.74% (2/270); EV68, 0.37% (1/270); echovirus 6, 0.37% (1/270); echovirus 9, 0.37% (1/270), respectively. Patients infected with CVA6 displayed symptoms atypical of HFMD, including larger vesicles on their limbs and buttocks. Phylogenetic analysis revealed 2 genetically distinct CVA6 strains that circulated independently within the region. Patients infected with CVA6 were more likely to have abnormal periphery blood white blood cell and C-reactive protein levels, while EV71 was more likely to infect the central nervous system, as indicated by clinical manifestations and white blood cell analysis of cerebrospinal fluid. Multiple EV genotypes contributed to HFMD in Nanjing in 2013, and CVA6 was the dominant genotype. The clinical presentation of CVA6 infection differs from that of EV71 infection in HFMD.

  17. 18 CFR 270.201 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... jurisdictional agencies for tight formation gas, occluded natural gas produced from coal seams, and natural gas...

  18. 50 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... restaurant trade, but whose primary business function is not the processing or packaging of fish or fish... harvesters. Research means any type of research designed to advance the image, desirability, usage...

  19. 40 CFR 82.270 - Prohibitions.

    Science.gov (United States)

    2010-07-01

    ... newly manufacture any halon blend. Halon blends manufactured solely for the purpose of aviation fire... capable of recycling the blend to the relevant industry standards for the chemical purity of each... April 6, 1998 the provision that the blend must be returned to it or its designee for recycling; and (3...

  20. 21 CFR 1271.270 - Records.

    Science.gov (United States)

    2010-04-01

    ... particular HCT/P involved. (b) Records management system. You must establish and maintain a records management system relating to core CGTP requirements. Under this system, records pertaining to a particular... procedures, and equipment logs) must also be maintained and organized under the records management system. If...

  1. 40 CFR 270.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... (formerly referred to as the Federal Water Pollution Control Act or Federal Water Pollution Control Act... constituent thereof may enter the environment or be emitted into the air or discharged into any waters... may consist of several treatment, storage, or disposal operational units (for example, one or more...

  2. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  3. Hydrogen as an energy carrier. Final report; Wasserstoff als Energietraeger. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Rebholz, H. [ed.

    1998-12-01

    This final report of the Special Field of Research 270 (SFB 270) documents the work and results of the four promotion phases from 1989 to 1998, presented in reports on 15 part-projects. From its inception, SFB 270, which bears the title ''Hydrogen as an Energy Carrier'', has been dedicated to two fields of work: in Project Area A to the production of hydrogen (7 part-projects) and in Project Area B to the transport and storage of hydrogen (8 part-projects). The scientific results of the part-projects have also been presented in detail in the progress reports and interim reports of 1991, 1994 and 1997. Some of them have also been presented at the colloquiums of SFB 270. Twelve part-projects have been abstracted individually for the ENERGY database. [German] Der vorliegende Abschlussbericht des Sonderforschungsbereichs 270 dokumentiert die Arbeiten und Ergebnisse der vier Foerderungsphasen von 1989 bis 1998. Sie sind in den Berichten von 15 Teilprojekten wiedergegeben. Der Sonderforschungsbereich 270 'Wasserstoff als Energietraeger' hat sich von Anfang an zwei Aufgabengebieten gewidmet: Im Projektbereich A der Herstellung von Wasserstoff (7 Teilprojekte) und im Projektbereich B dem Transport und der Speicherung von Wasserstoff (8 Teilprojekte). Wissenschaftliche Ergebnisse der Teilprojekte sind ausfuehrlich auch in den Arbeits- und Ergebnisberichten 1991, 1994 und 1997 wiedergegeben. Sie wurden auch, in Teilen, in entsprechenden Kolloquien des SFB 270 praesentiert. Fuer die Datenbank ENERGY wurden 12 Teilprojekte separat aufgenommen. (orig.)

  4. Class of backpropagation techniques for limited-angle reconstruction in microwave tomography

    International Nuclear Information System (INIS)

    Paladhi, P. Roy; Tayebi, A.; Udpa, L.; Udpa, S.; Sinha, A.

    2015-01-01

    Filtered backpropagation (FBPP) is a well-known technique used in Diffraction Tomography (DT). For accurate reconstruction using FBPP, full 360° angular coverage is necessary. However, it has been shown that using some inherent redundancies in the projection data in a tomographic setup, accurate reconstruction is still possible with 270° coverage which is called the minimal-scan angle range. This can be done by applying weighing functions (or filters) on projection data of the object to eliminate the redundancies and accurately reconstruct the image from 270° coverage. This paper demonstrates procedures to generate many general classes of these weighing filters. These are all equivalent at 270° coverage but vary in performance at lower angular coverages and in presence of noise. This paper does a comparative analysis of different filters when angular coverage is lower than minimal-scan angle of 270°. Simulation studies have been done to find optimum weight filters for sub-minimal angular coverage (<270°)

  5. Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication, Environmental Protection Agency Number ID4890008952

    Energy Technology Data Exchange (ETDEWEB)

    Holzemer, Michael J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Hart, Edward [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-04-01

    Hazardous Waste Management Act/Resource Conservation and Recovery Act Storage and Treatment Permit Reapplication for the Idaho National Laboratory Materials and Fuels Complex Hazardous Waste Management Act/Resource Conservation and Recovery Act Partial Permit, PER-116. This Permit Reapplication is required by the PER-116 Permit Conditions I.G. and I.H., and must be submitted to the Idaho Department of Environmental Quality in accordance with IDAPA 58.01.05.012 [40 CFR §§ 270.10 and 270.13 through 270.29].

  6. 48 CFR 870.111-3 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... officer shall include the clause at 852.270-2, Bread and bakery products—quantities, in solicitations and contracts for bread and bakery products. (b) The contracting officer shall include the clause at 852.270-3...

  7. Reference: 270 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e development of the root system with nutritional cues. The putative high-affinity nitrate transporter NRT2....1 represses lateral root initiation in response to nutritional cues. 38 13693-8 1

  8. 18 CFR 270.401 - Jurisdictional agency.

    Science.gov (United States)

    2010-04-01

    ..., Springfield, VA 22153. (5) California, except Naval Petroleum Reserve No. 1 (Elk Hills) and No. 2 (Buena Vista..., Office of Conservation, PO Box 94275, Baton Rouge, LA 70804. (15) Maryland—Department of Natural...

  9. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Giving Back — IDRC photo contest winner shares prize with Senegalese colleagues. Brendan Baker can be called many things: an engineer, an international volunteer, an award-winning photographer, and, evidently, a generous man. The winner of IDRC's “Expose Urban Solutions” photo contest, Baker shared his CA$2.

  10. 18 CFR 270.101 - General definitions.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF ENERGY PROCEDURES GOVERNING DETERMINATIONS FOR TAX CREDIT PURPOSES DETERMINATION PROCEDURES... gas produced from coal seams means naturally occurring natural gas released from entrapment from the fractures, pores and bedding planes of coal seams. (7) Natural gas produced from Devonian shale means...

  11. 40 CFR 1065.270 - Chemiluminescent detector.

    Science.gov (United States)

    2010-07-01

    ... Chemiluminescent detector. (a) Application. You may use a chemiluminescent detector (CLD) to measure NOX concentration in raw or diluted exhaust for batch or continuous sampling. We generally accept a CLD for NOX...) Component requirements. We recommend that you use a CLD that meets the specifications in Table 1 of § 1065...

  12. Publications | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-04-20

    Seeking justice: Women's police stations in Latin America. On April 20, 2009, in the small town of Diriomo, Nicaragua, Luz Marina Lezama Suazo, aged 47, was shot dead, allegedly by her husband. According to her sister, “She'd been having problems with him for a while and we had told her to leave.

  13. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 251 - 270 of 270 ... Vol 7, No 1 (2008), The Seasonal Cycle of Sea Level in Sri Lanka and ... in the Submerged Channels of Dar es Salaam Coastal Waters, Abstract PDF ... Vol 3, No 2 (2004), Trophic Ecology of Some Common Juvenile ...

  15. 78 FR 58309 - Proposed Information Collection Activity; Comment Request

    Science.gov (United States)

    2013-09-23

    ... initiative, funded by the Children's Bureau (CB) within ACF, will support planning grants to develop a model... for the process evaluation will be used to assess grantees' organizational capacity and readiness to... response burden hours Baseline Telephone Interview of 540 270 1 1.0 270 Organizational Readiness...

  16. Comparison of Chemical Composition and Energy Property of Torrefied Switchgrass and Corn Stover

    Energy Technology Data Exchange (ETDEWEB)

    Tumuluru, Jaya Shankar, E-mail: jayashankar.tumuluru@inl.gov [Idaho National Laboratory, Idaho Falls, ID (United States)

    2015-11-30

    In the present study, 6-mm ground corn stover and switchgrass were torrefied in temperatures ranging from 180 to 270°C for 15- to 120-min residence time. Thermogravimetric analyzer was used to do the torrefaction studies. At a torrefaction temperature of 270°C and a 30-min residence time, the weight loss increased to >45%. At 180°C and 120 min, there was about 56 and 73% of moisture loss in the corn stover and switchgrass; further increasing the temperature to 270°C and 120 min resulted in about 78.8–88.18% moisture loss in both the feedstock. Additionally, at these temperatures, there was a significant decrease in the volatile content and increase in the fixed carbon content, and the ash content for both the biomasses tested. The ultimate composition like carbon content increased and hydrogen content decreased with increase in the torrefaction temperature and time. At 270°C and 120-min residence time, the carbon content observed was 56.63 and 58.04% and hydrogen content observed was 2.74 and 3.14%. Nitrogen and sulfur content measured at 270°C and 120 min were 0.98, 0.8, 0.076, and 0.07% for both the corn stover and switchgrass. The hydrogen/carbon and oxygen/carbon ratios calculated decreased to the lowest values of 0.59 and 0.64, and 0.71 and 0.76 for both biomasses. The van Krevelen diagram drawn for corn stover and switchgrass torrefied at 270°C indicated that H/C and O/C values are closer to coals like Illinois Basis and Powder River Basin. In the present study, the maximum higher heating value that was observed by corn stover and switchgrass was 21.51 and 21.53 MJ/kg at 270°C and a 120-min residence time. From these results, it can be concluded that corn stover and switchgrass, after torrefaction, shows consistent proximate, ultimate, and energy properties.

  17. Comparison of Chemical Composition and Energy Property of Torrefied Switchgrass and Corn Stover

    International Nuclear Information System (INIS)

    Tumuluru, Jaya Shankar

    2015-01-01

    In the present study, 6-mm ground corn stover and switchgrass were torrefied in temperatures ranging from 180 to 270°C for 15- to 120-min residence time. Thermogravimetric analyzer was used to do the torrefaction studies. At a torrefaction temperature of 270°C and a 30-min residence time, the weight loss increased to >45%. At 180°C and 120 min, there was about 56 and 73% of moisture loss in the corn stover and switchgrass; further increasing the temperature to 270°C and 120 min resulted in about 78.8–88.18% moisture loss in both the feedstock. Additionally, at these temperatures, there was a significant decrease in the volatile content and increase in the fixed carbon content, and the ash content for both the biomasses tested. The ultimate composition like carbon content increased and hydrogen content decreased with increase in the torrefaction temperature and time. At 270°C and 120-min residence time, the carbon content observed was 56.63 and 58.04% and hydrogen content observed was 2.74 and 3.14%. Nitrogen and sulfur content measured at 270°C and 120 min were 0.98, 0.8, 0.076, and 0.07% for both the corn stover and switchgrass. The hydrogen/carbon and oxygen/carbon ratios calculated decreased to the lowest values of 0.59 and 0.64, and 0.71 and 0.76 for both biomasses. The van Krevelen diagram drawn for corn stover and switchgrass torrefied at 270°C indicated that H/C and O/C values are closer to coals like Illinois Basis and Powder River Basin. In the present study, the maximum higher heating value that was observed by corn stover and switchgrass was 21.51 and 21.53 MJ/kg at 270°C and a 120-min residence time. From these results, it can be concluded that corn stover and switchgrass, after torrefaction, shows consistent proximate, ultimate, and energy properties.

  18. Surface effects during exoelectron-emission of BeO ceramics

    International Nuclear Information System (INIS)

    Siegel, V.; Kirchner, H.H.

    1979-01-01

    Studying the behaviour of the two thermally stimulated exoelectron emission (TSEE) maxima of BeO ceramics at about 270 0 C und 325 0 C it can be shown that the TSEE maximum at 270 0 C is closely connected with adsorption and desorption processes occuring on the surface of the samples. In particular, this TSEE maximum is strongly influenced as well by donor-like behaviour of adsorbed hydrogen and lithium as by acceptor-like behaviour of alcohols and nitrides of the lithium. The detailed surface processes leading to the apperance or disapperance of the TSEE maximum at 270 0 C are discussed. (orig.) [de

  19. 48 CFR 302.7000 - Common HHSAR acronyms and abbreviations.

    Science.gov (United States)

    2010-10-01

    ... acronyms and abbreviations. (a) The HHSAR cites numerous acquisition-related and organizational acronyms...-3(b)(3). CDC Centers for Disease Control and Prevention 301.270(b). CFR Code of Federal Regulations....1300(c). PSC Program Support Center (in OS) 301.270(b). R&D research and development 301.607-72(b). RFI...

  20. 32 CFR 270.8 - Authorization of payment.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS COMPENSATION OF CERTAIN FORMER OPERATIVES INCARCERATED BY THE DEMOCRATIC REPUBLIC OF VIETNAM... purpose. Any payment authorized to a person under a legal disability, may, in the discretion of the Commission, be paid for the use of the person, to the natural or legal guardian, committee, conservator, or...

  1. 21 CFR 172.270 - Sulfated butyl oleate.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION... edible vegetable oil using 1-butanol. Following sulfation, the reaction mixture is washed with water and...

  2. 50 CFR 270.3 - Submission of application.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE FISH AND SEAFOOD PROMOTION SPECIES-SPECIFIC SEAFOOD MARKETING COUNCILS... Marketing Council for one or more species of fish and fish products of that species. One signed original and.... Applications should not be bound. (b) The application consists of four parts: (1) A document requesting NMFS to...

  3. 12 CFR 270.4 - Transactions in obligations.

    Science.gov (United States)

    2010-01-01

    ... OPERATIONS OF FEDERAL RESERVE BANKS Regulations Relating to Open Market Operations of Federal Reserve Banks... engage in open market operations as directed by the Committee. (b) Transactions for the System Open... open market operations and the effectuation of open market policies. [38 FR 2753, Jan. 30, 1973, as...

  4. 32 CFR 270.7 - Verification of eligibility.

    Science.gov (United States)

    2010-07-01

    ...) Maintain a liaison with on-site personnel at the National Archives Center, College Park, Maryland, to organize and translate finance records for review. (3) Upon receipt of each Application for Compensation of...

  5. 7 CFR 205.270 - Organic handling requirements.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT..., heating, drying, mixing, grinding, churning, separating, distilling, extracting, slaughtering, cutting... packaging, canning, jarring, or otherwise enclosing food in a container may be used to process an...

  6. 48 CFR 247.270-2 - Technical provisions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...

  7. 32 CFR 270.11 - Limitation on disbursements.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS COMPENSATION OF CERTAIN FORMER OPERATIVES INCARCERATED BY THE DEMOCRATIC REPUBLIC OF VIETNAM... eligible for the payment, i.e., the commando, his surviving spouse, children, parents, or siblings. The...

  8. 48 CFR 552.270-2 - Historic Preference.

    Science.gov (United States)

    2010-10-01

    ... in the competition, the Government will give a 2.5 percent price preference to suitable non-historic... Government will give a 2.5 percent price preference to suitable non-historic developed or undeveloped sites... tradeoffs among price and non-price factors, the Government will give a price evaluation preference, based...

  9. 77 FR 71344 - Texas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2012-11-30

    ... adverse written comment on the codification of the Texas authorized RCRA program by the close of business... Business Information (CBI) or other information whose disclosure is restricted by statute. Do not submit...) introductory paragraph 40 CFR 270.42(a)(1) intro. 30 TAC 305.69(b)(1)(A), except for 40 CFR 270.42(a)(1)(i...

  10. Detection of measles IgM antibodies in children at Kaduna ...

    African Journals Online (AJOL)

    Measles virus IgM antibodies virus was assayed for in 270 sera from children aged 5 months to 8 years attending Yusuf Dantsoho Memorial Hospital, Kaduna, Northern Nigeria, using ELISA. Out of the 270 sera, 192(71.1%) tested positive to measles IgM and 78(28.9%) negative. The sample distribution was 137 from males, ...

  11. Acute kidney damage induced by low- and iso-osmolar contrast media in rats: Comparison study with physiologic MRI and histologic-gene examination.

    Science.gov (United States)

    Wu, Chen-Jiang; Bao, Mei-Ling; Wang, Qing; Wang, Xiao-Ning; Liu, Xi-Sheng; Shi, Hai-Bin; Zhang, Yu-Dong

    2017-01-01

    To investigate the physiopathological effects of low- and iso-osmolar contrast media (CM) on renal function with physiologic MRI and histologic-gene examination. Forty-eight rats underwent time-course DWI and DCE-MRI at 3.0 Tesla (T) before and 5-15 min after exposure of CM or saline (Iop.370: 370 mgI/mL iopromide; Iod.320: 320 mgI/mL iodixanol; Iod.270: 270 mgI/mL iodixanol; 4 gI/kg body weight). Intrarenal viscosity was reflected by apparent diffusion coefficient (ADC). Renal physiologies were evaluated by DCE-derived glomerular filtration rate (GFR), renal blood flow (RBF), and renal blood volume (RBV). Potential acute kidney injury (AKI) was determined by histology and the expression of kidney injury molecule 1 (Kim-1). Iop.370 mainly increased ADC in inner-medulla (△ADC IM : 12.3 ± 11.1%; P < 0.001). Iod.320 and Iod.270 mainly decreased ADC in outer-medulla (△ADC IM ; Iod.320: 16.8 ± 7.5%; Iod.270: 18.1 ± 9.5%; P < 0.001) and inner-medulla (△ADC IM ; Iod.320: 28.4 ± 9.3%; Iod.270: 30.3 ± 6.3%; P < 0.001). GFR, RBF and RBV were significantly decreased by Iod.320 (△GFR: 45.5 ± 24.1%; △RBF: 44.6 ± 19.0%; △RBV: 35.2 ± 10.1%; P < 0.001) and Iod.270 (33.2 ± 19.0%; 38.1 ± 15.6%; 30.1 ± 10.1%; P < 0.001), while rarely changed by Iop.370 and saline. Formation of vacuoles and increase in Kim-1 expression was prominently detected in group of Iod.320, while rarely in Iod.270 and Iop.370. Iso-osmolar iodixanol, given at high-dose, produced prominent AKI in nonhydrated rats. This renal dysfunction could be assessed noninvasively by physiologic MRI. 1 J. Magn. Reson. Imaging 2017;45:291-302. © 2016 International Society for Magnetic Resonance in Medicine.

  12. Subjective and objective image differences in pediatric computed tomography cardiac angiography using lower iodine concentration

    International Nuclear Information System (INIS)

    Hwang, Jae-Yeon; Choo, Ki Seok; Choi, Yoon Young; Kim, Jin Hyeok; Ryu, Hwaseong; Kim, Yong-Woo; Jeon, Ung Bae; Nam, Kyung Jin; Han, Junhee

    2017-01-01

    Several recent studies showed the optimal contrast enhancement with a low-concentration and iso-osmolar contrast media in both adult and pediatric patients. However, low contrast media concentrations are not routinely used due to concerns of suboptimal enhancement of cardiac structures and small vessels. To evaluate the feasibility of using iso-osmolar contrast media containing a low iodine dose for CT cardiac angiography at 80 kilovolts (kVp) in neonates and infants. The iodixanol 270 group consisted of 79 CT scans and the iopromide 370 group of 62 CT scans in patients ≤1 year old. Objective measurement of the contrast enhancement was analyzed and contrast-to-noise ratios of the ascending aorta and left ventricle were calculated. Regarding subjective measurement, a four-point scale system was devised to evaluate degrees of contrast enhancement, image noise, motion artifact and overall image quality of each image set. Reader performance for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment was evaluated. Group objective and subjective measurements were nonsignificantly different. Overall sensitivity, specificity and diagnostic accuracy for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment were 42.8%, 59%, and 50%, respectively. The application of iodixanol 270 achieved optimal enhancement for performing pediatric cardiac CT angiography at 80 kVp in neonates and infants. Objective measurements of contrast enhancement and subjective image quality assessments were not statistically different in the iodixanol 270 and iopromide 370 groups. (orig.)

  13. Effect of Deep Drying and Torrefaction Temperature on Proximate, Ultimate Composition, and Heating Value of 2-mm Lodgepole Pine (Pinus contorta) Grind

    Energy Technology Data Exchange (ETDEWEB)

    Tumuluru, Jaya

    2016-06-01

    Deep drying and torrefaction is a thermal pretreatment method, where biomass is heated in the temperature range of 150–300°C in an inert or reduced environment. The process parameters like temperature and residence time has a significant impact on proximate, ultimate, and energy properties of the biomass. In the present study, torrrefaction experiments were conducted on 2 mm lodgepole pine grind using a thermogravimetric analyzer. Both deep drying and torrefaction temperature (160–270°C) and time (15–120 min) were selected. Torrefied samples were analyzed for proximate, ultimate and energy properties. Results indicated that moisture content decreased with increases in torrefaction temperature and time, where at 270°C and 120 min, the moisture content was found to be 1.15% (w.b.). Volatile content in the biomass decreased from about 80% to about 45%, and ash content increased from 0.77 to about 1.91% at 270°C and 120 min. The hydrogen, oxygen and sulfur content decreased to 3%, 28.24%, and 0.01 whereas carbon content and higher heating value increased to 68.86% and 23.67 MJ/kg at 270°C and 120 min. H/C and O/C ratio calculated at 270°C and 120 min residence time were about 0.56 and 0.47. This study indicated that higher torrefaction temperatures >230°C and residence time >15 min influenced the proximate, ultimate, and energy properties.

  14. Subjective and objective image differences in pediatric computed tomography cardiac angiography using lower iodine concentration

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Jae-Yeon [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Pusan National University Yangsan Hospital, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Choo, Ki Seok; Choi, Yoon Young; Kim, Jin Hyeok; Ryu, Hwaseong; Kim, Yong-Woo; Jeon, Ung Bae; Nam, Kyung Jin [Pusan National University Yangsan Hospital, Department of Radiology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of); Han, Junhee [Pusan National University Yangsan Hospital, Division of Biostatistics, Research Institute for Convergence of Biomedical Science and Technology, Yangsan-si, Gyeongsangnam-do (Korea, Republic of)

    2017-05-15

    Several recent studies showed the optimal contrast enhancement with a low-concentration and iso-osmolar contrast media in both adult and pediatric patients. However, low contrast media concentrations are not routinely used due to concerns of suboptimal enhancement of cardiac structures and small vessels. To evaluate the feasibility of using iso-osmolar contrast media containing a low iodine dose for CT cardiac angiography at 80 kilovolts (kVp) in neonates and infants. The iodixanol 270 group consisted of 79 CT scans and the iopromide 370 group of 62 CT scans in patients ≤1 year old. Objective measurement of the contrast enhancement was analyzed and contrast-to-noise ratios of the ascending aorta and left ventricle were calculated. Regarding subjective measurement, a four-point scale system was devised to evaluate degrees of contrast enhancement, image noise, motion artifact and overall image quality of each image set. Reader performance for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment was evaluated. Group objective and subjective measurements were nonsignificantly different. Overall sensitivity, specificity and diagnostic accuracy for correctly differentiating iodixanol 270 and iopromide 370 by visual assessment were 42.8%, 59%, and 50%, respectively. The application of iodixanol 270 achieved optimal enhancement for performing pediatric cardiac CT angiography at 80 kVp in neonates and infants. Objective measurements of contrast enhancement and subjective image quality assessments were not statistically different in the iodixanol 270 and iopromide 370 groups. (orig.)

  15. 76 FR 12283 - Texas: Final Authorization of State-initiated Changes and Incorporation by Reference of State...

    Science.gov (United States)

    2011-03-07

    ... written comment on the codification of the Texas authorized RCRA program by the close of business April 6.... 30 TAC 305.45(a)(8) intro.--(a)(8)(B).. 40 CFR 270.13(l) related. 30 TAC 305.50(a)(6) 40 CFR 270.17(b.... The Congressional Review Act, 5 U.S.C. 801 et seq., as added by the Small Business Regulatory...

  16. NMR studies of 55Mn in amorphous CexMn100-x alloys

    International Nuclear Information System (INIS)

    Niki, H.; Okamura, K.; Yogi, M.; Amakai, Y.; Takano, H.; Murayama, S.; Obi, Y.

    2008-01-01

    In order to investigate the heavy-fermion like behavior of amorphous alloy Ce x Mn 100-x , the NMR measurements of 55 Mn (I=5/2 ) in Ce 65 Mn 35 have been carried out from 4.2 to 270 K using powdered sample. A broadened NMR spectrum containing five NQR lines split due to NQR interaction is observed. Quadrupole coupling constant 3e 2 Qq/2I(2I-1)h is gradually changed from about 1.8 MHz at 4.2 K to about 1.6 MHz at 270 K. Temperature dependence of the line width is expressed in the Curie-Weiss law with θ p =-10.5K. The value of Knight shift would be almost constant from 4.2 to 270 K

  17. Radiation effects on the species-specific cell sorting-out of the cellular slime molds

    International Nuclear Information System (INIS)

    Satow, Takashi

    1976-01-01

    The effects of gamma-rays irradiation on the development and the species-specific cell sorting-out of the cellular slime mold, Dictyostelium discoideum, were investigated. The interphase amoebae of the organism showed extremely resistant to 60 Co gamma-rays. The percentage of non-stained cells estimated by dye staining method was more than 90% at the dose of 270 kR. The amoebae irradiated at 270 kR performed the development similar in the most respects to that of the un-irradiated amoebae except that a little portion of the fruiting bodies were abnormal and that the appearance of aggregates and slugs delayed 3 hrs. The ability of the species-specific cell sorting-out was not affected by gamma-rays irradiation at 270 kR. (auth.)

  18. Detailed Analysis of the Asteroid Pair (6070) Rheinland and (54827) 2001 NQ8

    Czech Academy of Sciences Publication Activity Database

    Vokrouhlický, D.; Pravec, Petr; Ďurech, J.; Hornoch, Kamil; Kušnirák, Peter; Galád, Adrián; Vraštil, J.; Kučáková, Hana; Pollock, J.; Ortiz, J.L.; Morales, N.; Gaftonyuk, N. M.; Pray, D. P.; Krugly, Yu. N.; Inasaridze, R.Ya.; Ayvazian, V.; Molotov, I.E.; Colazo, C.A.

    2017-01-01

    Roč. 153, č. 6 (2017), 270/1-270/17 ISSN 0004-637X R&D Projects: GA ČR(CZ) GA17-00774S Grant - others:GA ČR(CZ) GA13-01308S Institutional support: RVO:67985815 Keywords : minor planets * asteroids * general Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.533, year: 2016

  19. Inducible clindamycin and methicillin resistant Staphylococcus aureus in a tertiary care hospital, Kathmandu, Nepal.

    Science.gov (United States)

    Adhikari, R P; Shrestha, S; Barakoti, A; Amatya, R

    2017-07-11

    Staphylococcus aureus, an important nosocomial pathogen, is frequently associated with infections in human. The management of the infections by it especially methicillin resistant ones is often difficult because methicillin resistant S. aureus is usually resistant to multiple antibiotics. Macrolide-lincosamide streptogramin B family of antibiotics is commonly used to treat such infections as an alternative to vancomycin. This study was conducted over the period of one and half year from November 2013-April 2015 in Microbiology laboratory of Nepal Medical College and Teaching Hospital, Kathmandu, Nepal to find the incidence of different phenotypes of MLS B resistance among S. aureus from clinical samples and their association with methicillin resistance. Two hundred seventy isolates of S. aureus were included in the study. Methicillin resistance was detected by cefoxitin disc diffusion method and inducible clindamycin resistance by erythromycin and clindamycin disc approximation test (D-test). Of the 270 clinical isolates of S. aureus, 25.1% (68/270) were MRSA. Erythromycin and clindamycin resistance was seen in 54.4% (147/270) and 41.8% (113/270) isolates respectively. Resistance to erythromycin and clindamycin were higher in MRSA as compared to MSSA (erythromycin-resistance: 88.2% Vs 39.1% and clindamycin-resistance: 79.4% Vs 41.8%). The overall prevalence of i MLS B and c MLS B phenotype was 11.48% (31/270) and 29.25% (79/270) respectively. Both i MLS B and c MLS B phenotypes predominated in MRSA strains. Detection rate of MRSA in our study shows the necessity to improve in healthcare practices and to formulate new policy for the control of MRSA infections. Clindamycin resistance in the form of i MLS B and c MLS B especially among MRSA emphasizes the need of D-test to be performed routinely in our set up while using clindamycin as an alternative choice to anti-staphylococcal antibiotics like vancomycin and linezolid in the treatment of staphylococcal infections.

  20. Novel Semiconducting Polymers for Highly Efficient Solar Energy Harvesting

    Science.gov (United States)

    2014-03-11

    we have developed an effective approach to enhance PCE and achieved an unprecedented high PCE value around 9.4%. S SS S X O O S SO OS S X S S X...Address: 128.135.225.61 Language: English (en-us,en;q=0.7,zh-cn;q=0.3) User Agent: Mozilla/5.0 (Windows NT 5.1; rv:27.0) Gecko/20100101 Firefox /27.0 Http

  1. Review: Personal Effects of Divorce in Relation to Children / Recension: Efectos personales del divorcio respecto de los hijos

    Directory of Open Access Journals (Sweden)

    Teresa Duplá Marín

    2013-05-01

    Full Text Available Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270. Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270.

  2. Penentuan Bilangan Asam Dan Bilangan Penyabunan Pada Asam Laurat Hasil Hidrolisis Palm Kernel Oil (PKO) Di PT Socimas Medan

    OpenAIRE

    Tobing, Windy.T.

    2012-01-01

    Has been performed analysis in which the specified number of acid value and saponification value in lauric acid from hydrolysis process of palm kernel oil in PT.Socimas. Analysis of the results obtained acid value 269,9 and saponification value 270,8. Thus the acid value and saponification value correspond to the standart value 269-275 for acid value, and 270-276 for saponification value in PT. Socimas. 092401017

  3. Periovulatory follicular fluid levels of estradiol trigger inflammatory and DNA damage responses in oviduct epithelial cells.

    Directory of Open Access Journals (Sweden)

    Sergio E Palma-Vera

    Full Text Available Ovarian steroid hormones (mainly E2 and P4 regulate oviduct physiology. Serum-E2 acts on the oviduct epithelium from the basolateral cell compartment. Upon ovulation, the apical compartment of the oviduct epithelium is temporarily exposed to follicular fluid, which contains much higher levels of E2 than serum. The aim of this study was to evaluate the effects of human periovulatory follicular fluid levels of E2 on oviduct epithelial cells using two porcine in vitro models.A cell line derived from the porcine oviductal epithelium (CCLV-RIE270 was characterized (lineage markers, proliferation characteristics and transformation status. Primary porcine oviduct epithelial cells (POEC were cultured in air-liquid interface and differentiation was assessed histologically. Both cultures were exposed to E2 (10 ng/ml and 200 ng/ml. Proliferation of CCLV-RIE270 and POEC was determined by real-time impedance monitoring and immunohistochemical detection of Ki67. Furthermore, marker gene expression for DNA damage response (DDR and inflammation was quantified.CCLV-RIE270 was not transformed and exhibited properties of secretory oviduct epithelial cells. Periovulatory follicular fluid levels of E2 (200 ng/ml upregulated the expression of inflammatory genes in CCLV-RIE270 but not in POEC (except for IL8. Expression of DDR genes was elevated in both models. A significant increase in cell proliferation could not be detected in response to E2.CCLV-RIE270 and POEC are complementary models to evaluate the consequences of oviduct exposure to follicular fluid components. Single administration of periovulatory follicular fluid E2 levels trigger inflammatory and DNA damage responses, but not proliferation in oviduct epithelial cells.

  4. Effect of Deep Drying and Torrefaction Temperature on Proximate, Ultimate Composition, and Heating Value of 2-mm Lodgepole Pine (Pinus contorta) Grind.

    Science.gov (United States)

    Tumuluru, Jaya Shankar

    2016-06-22

    Deep drying and torrefaction compose a thermal pretreatment method where biomass is heated in the temperature range of 150-300 °C in an inert or reduced environment. The process parameters, like torrefaction temperature and residence time, have a significant impact on the proximate, ultimate, and energy properties. In this study, torrefaction experiments were conducted on 2-mm ground lodgepole pine ( Pinus contorta ) using a thermogravimetric analyzer. Both deep drying and torrefaction temperature (160-270 °C) and time (15-120 min) were selected. Torrefied samples were analyzed for the proximate, ultimate, and higher heating value. The results indicate that moisture content decreases with increases in torrefaction temperature and time, where at 270 °C and 120 min, the moisture content is found to be 1.15% (w.b.). Volatile content in the lodgepole pine decreased from about 80% to about 45%, and ash content increased from 0.77% to about 1.91% at 270 °C and 120 min. The hydrogen, oxygen, and sulfur content decreased to 3%, 28.24%, and 0.01%, whereas the carbon content and higher heating value increased to 68.86% and 23.67 MJ/kg at 270 °C and 120 min. Elemental ratio of hydrogen to carbon and oxygen to carbon (H/C and O/C) calculated at 270 °C and a 120-min residence time were about 0.56 and 0.47. Based on this study, it can be concluded that higher torrefaction temperatures ≥230 °C and residence time ≥15 min influence the proximate, ultimate, and energy properties of ground lodgepole pine.

  5. Effect of Deep Drying and Torrefaction Temperature on Proximate, Ultimate Composition, and Heating Value of 2-mm Lodgepole Pine (Pinus contorta Grind

    Directory of Open Access Journals (Sweden)

    Jaya Shankar Tumuluru

    2016-06-01

    Full Text Available Deep drying and torrefaction compose a thermal pretreatment method where biomass is heated in the temperature range of 150–300 °C in an inert or reduced environment. The process parameters, like torrefaction temperature and residence time, have a significant impact on the proximate, ultimate, and energy properties. In this study, torrefaction experiments were conducted on 2-mm ground lodgepole pine (Pinus contorta using a thermogravimetric analyzer. Both deep drying and torrefaction temperature (160–270 °C and time (15–120 min were selected. Torrefied samples were analyzed for the proximate, ultimate, and higher heating value. The results indicate that moisture content decreases with increases in torrefaction temperature and time, where at 270 °C and 120 min, the moisture content is found to be 1.15% (w.b.. Volatile content in the lodgepole pine decreased from about 80% to about 45%, and ash content increased from 0.77% to about 1.91% at 270 °C and 120 min. The hydrogen, oxygen, and sulfur content decreased to 3%, 28.24%, and 0.01%, whereas the carbon content and higher heating value increased to 68.86% and 23.67 MJ/kg at 270 °C and 120 min. Elemental ratio of hydrogen to carbon and oxygen to carbon (H/C and O/C calculated at 270 °C and a 120-min residence time were about 0.56 and 0.47. Based on this study, it can be concluded that higher torrefaction temperatures ≥230 °C and residence time ≥15 min influence the proximate, ultimate, and energy properties of ground lodgepole pine.

  6. Rejection of Organic Micropollutants by Clean and Fouled Nanofiltration Membranes

    Directory of Open Access Journals (Sweden)

    Lifang Zhu

    2015-01-01

    Full Text Available The rejection of organic micropollutants, including three polycyclic aromatic hydrocarbons (PAHs and three phthalic acid esters (PAEs, by clean and fouled nanofiltration membranes was investigated in the present study. The rejection of organic micropollutants by clean NF90 membranes varied from 87.9 to more than 99.9%, while that of NF270 membranes ranged from 32.1 to 92.3%. Clear time-dependence was observed for the rejection of hydrophobic micropollutants, which was attributed to the adsorption of micropollutants on the membrane. Fouling with humic acid had a negligible influence on the rejection of organic micropollutants by NF90 membranes, while considerable effects were observed with NF270 membranes, which are significantly looser than NF90 membranes. The observed enhancement in the rejection of organic micropollutants by fouled NF270 membranes was attributed to pore blocking, which was a dominating fouling mechanism for loose NF membranes. Changes in the ionic strength (from 10 to 20 mM reduced micropollutant rejection by both fouled NF membranes, especially for the rejection of dimethyl phthalate and diethyl phthalate by NF270 membranes (from 65.8 to 25.0% for dimethyl phthalate and 75.6 to 33.3% for diethyl phthalate.

  7. Further studies of the stability of LiF:Mg,Cu,P (GR-200) at maximum readout temperatures between 240oC and 280oC

    International Nuclear Information System (INIS)

    Oster, L.; Horowitz, Y.S.; Horowitz, A.

    1996-01-01

    It has recently been shown that LiF:Mg,Cu,P (GR-200) can be read out to temperatures as high as 270 o C for 12 s with negligible loss in sensitivity. In the present work the long-term sensitivity of GR-200 was studied at readout temperatures between 240 o C and 280 o C. The idea was that the readout temperatures above 240 o C might initiate reaction processes which influence the sensitivity only after long-term storage. No difference was found in the behaviour of GR-200 chips with 80 accumulated readouts to 240 o C or 270 o C and after storage of up to four months. Slight losses in sensitivity of 4% for 240 o C and 10% for 270 o C are observed after 80 readouts during four months storage. However, at a maximum readout temperature of 280 o C, a 33% loss in sensitivity after 80 cycles is observed. In conclusion it is found that GR-200 can be read out at temperatures as high as 270 o C with negligible loss in sensitivity (less than 0.1% per readout following an initialisation procedure of 1 readout) and acceptable residual signal (0.6%). (author)

  8. Nuclear Science Division 1994 annual report

    International Nuclear Information System (INIS)

    Myers, W.D.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The open-quotes early implementationclose quotes phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large γ-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive 21 Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium

  9. Nuclear Science Division 1994 annual report

    Energy Technology Data Exchange (ETDEWEB)

    Myers, W.D. [ed.

    1995-06-01

    This report describes the activities of the Nuclear Science Division for the period of January 1, 1994, to December 31, 1994. This was a time of significant accomplishment for all of the programs in the Division. Assembly of the solar neutrino detector at the Sudbury Neutrino Observatory is well under way. All of the components fabricated by LBL were shipped to Sudbury early in the year and our efforts are now divided between assisting the assembly of the detector and preparing software for data analysis once the detector is operational in 1996. Much of the activity at the 88-Inch Cyclotron centered on Gammasphere. The {open_quotes}early implementation{close_quotes} phase of the detector ended in September. This phase was extremely successful, involving over 60 experiments with nearly 200 users from 37 institutions worldwide. The mechanical structure was installed and the final electronic system is expected to operate in March 1995. The Division concurrently hosted a conference on physics for large {gamma}-ray detector arrays at the Clark Kerr Campus at UC Berkeley in August. This was a very successful meeting, reflecting the enthusiasm for this field worldwide. Also at the Cyclotron, the progress toward weak interaction experiments using ultra-thin sources passed a major milestone with the trapping of radioactive {sup 21}Na atoms. We are now engaged in a major upgrade of the experimental area and the outlook is very promising for these novel experiments. Another highlight of research at the Cyclotron was the confirmation of element 106. This development allowed the original LLNL/LBL discovery team to move forward with their proposal to name this element seaborgium.

  10. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  11. Heterogeneously Catalyzed Endothermic Fuel Cracking

    Science.gov (United States)

    2016-08-28

    reactor was circumferentially delivered from a 4.2 kW array consisting of 4 independently PID controlled fiber insulated heaters (Zircar ceramics, FIH...the H-ZSM- 5 lattice and Brønsted acid site characteristics” Micropor . Mesopor. Mater., 222 (2016) 256−270. DISTRIBUTION A: Distribution...distribution on the H-ZSM-5 lattice and Brønsted acid site characteristics" Micropor . Mesopor. Mater., 222 (2016) 256-270. S. M. Opalka, H. Huang

  12. Q-value effects in the synthesis of superheavy elements

    International Nuclear Information System (INIS)

    Graeger, Reimar

    2010-01-01

    Superheavy elements (Z>or similar 104) only exist due to nuclear shell effects, which stabilize them against spontaneous fission (SF). Theoretical calculations predict these shell stabilization effects to reach a maximum at the closures of the next spherical proton and neutron shells, which are anticipated in the region between Z=114 and Z=126 and at N=184. More recent calculations, that also consider deformed nuclear shapes extended this picture and predicted deformed shell closures at Z=108 and at N=162, creating a region of enhanced stability around 270 Hs, confirmed in recent Hs chemistry experiments by measuring the decay of 270 Hs for the first time. Recently, the formation of deformed doubly-magic 270 Hs in the 4n evaporation channel in the fusion reactions 248 Cm( 26 Mg,4n), 244 Pu( 30 Si,4n), 238 U( 36 S,4n), and 226 Ra( 48 Ca,4n) was studied theoretically using a two-parameter Smoluchowski equation. Simple entrance channel arguments make compound nucleus (CN) formation appear favorable for systems with larger mass asymmetry. However, due to a lower reaction Q value, the reactions 238 U( 36 S,4n) 270 Hs and 226 Ra( 48 Ca,4n) 270 Hs are predicted to have higher cross sections compared to the reactions 248 Cm( 26 Mg,4n) 270 Hs and 244 Pu( 30 Si,4n) 270 Hs. The aim of the research done in the framework of this thesis was to study the influence of the reaction (B-Q)-value on the yield of SHE produced in nuclear fusion reactions. Therefore the most promising reactions 36 S+ 238 U and 48 Ca+ 226 Ra have been investigated and compared with the already measured reaction 26 Mg+ 248 Cm. The reaction 36 S+ 238 U was investigated at two beam energies. One correlated decay chain attributed to 270 Hs was found at E * =51 MeV resulting in a cross section of 0.8 -0.7 +2.6 pb. The reaction 48 Ca+ 226 Ra was investigated at three beam energies. Six correlated decay chains attributed to 270 Hs were detected at E * =40 MeV corresponding to a cross section of 8.3 -3.7 +6.7 pb

  13. Dicty_cDB: AFK270 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LFVNKKRKSNPLD GSSTPTNQNQNQNQRKL Frame B: ---xxxxxsxxxxxxxwxnxxxxxxxxxxxgpxxxxsxsssxxxxxxxxxx...kprksmivtlkmtkkkrkkkfyl*tkrenrih*m vvvhqltkiktktken Frame C: ---pxxxxaxxxxpxggxixxxxxxxxxxxxxxqxxvxxxxixxxxxxxxx

  14. Measuring temperatures with modified Kleiber 270B pyrometer

    International Nuclear Information System (INIS)

    Osch, E.V. van.

    1995-05-01

    At ECN a fast pyrometer is being used as a diagnostic tool for plasma disruption simulation experiments on candidate plasma facing materials for future thermonuclear fusion devices such as NET or ITER. The pyrometer is being used to measure the surface temperature response of the materials to short pulse high heat loads as induced by high power laser or electron beam, simulating the disrupting plasma's energy deposition. A procedure to measure surface temperatures without having to know surface emissivity in advance is described. The formulae needed in this procedure to obtain the correct temperature, starting from the initial incorrect temperature reading, are derived. Inversely, the formula to determine the emissivity of the surface when its temperature is known is equally derived. Finally, a small study on background level sensitivity is presented, showing the, in general, small effect of background on the temperature measurement. (orig.)

  15. 50 CFR 270.10 - Responsibilities of a Council.

    Science.gov (United States)

    2010-10-01

    ... economic, market, social, demographic, and biological information as deemed necessary by NMFS; (8) Maintain books and records, prepare and submit to NMFS reports in accordance with respect to the receipt and... contain references to any private brand or trade name and will avoid the use of deceptive acts or...

  16. 48 CFR 552.270-29 - Acceptance of Space.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Acceptance of Space. 552... Acceptance of Space. As prescribed in 570.603, insert the following clause: Acceptance of Space (SEP 1999) (a... designated representative shall promptly inspect the space. (b) The Government will accept the space and the...

  17. 1935 15' Quad #270 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  18. 40 CFR 98.270 - Definition of source category.

    Science.gov (United States)

    2010-07-01

    ... this section: (1) Chemical recovery furnaces at kraft and soda mills (including recovery furnaces that burn spent pulping liquor produced by both the kraft and semichemical process). (2) Chemical recovery... into paperboard products (e.g., containers), or operate coating and laminating processes. (b) The...

  19. 10 CFR 205.270 - Off-the-record communications.

    Science.gov (United States)

    2010-01-01

    ... 18 CFR 1.30(f), against participation in the decision-making process by Department employees who... and any responses made to it. (4) With 48 hours of receiving, making or knowingly causing to be made a...

  20. 48 CFR 514.270-2 - Guidelines for use.

    Science.gov (United States)

    2010-10-01

    ... furnish the types and quantities of supplies or services in the aggregate. (2) How grouping delivery... cases it serves GSA's best interest to combine two or more line items for an aggregate award. Such cases... for similar articles or services is impractical. (b) Before deciding to combine items for aggregate...

  1. Molecular Signatures of Chronic Pain Subtypes

    Science.gov (United States)

    2015-03-01

    inflammatory cytokines in human articular chondrocytes. Arthritis Rheum 2009;60(11):3303–13. 100 Su RC, Becker AB, Kozyrskyj AL, Hayglass KT. Epi...Korzets A. Reflex sympathetic dystrophy of the stump in below-knee amputees. Clin J Pain 1992;8(3):270–5. 31. Sherman RA, Sherman CJ, Parker L. Chronic...sympathetic dystrophy of the stump in below-knee amputees. The Clinical journal of pain. Sep 1992;8(3):270-275. 4. Lindsay DR, Pyati S, Buchheit TE

  2. Fragmentation of dimethyl ether in femtosecond intense field

    Science.gov (United States)

    Zhu, Jingyi; Guo, Wei; Wang, Yanqiu; Wang, Li

    2006-08-01

    The fragmentation of dimethyl ether (DME) in intense femtosecond laser field has been studied at 810, 405 and 270 nm with intensities up to 2.48 × 10 15, 3.86 × 10 15 and 1.62 × 10 14 W/cm 2, respectively. At 405 nm, DME is possibly firstly ionized by multiphoton absorption, and then parent ion DME + dissociates into fragments via filed-induced dissociation. For 810 and 270 nm laser fields, DME firstly dissociates into CH 3O and CH 3 fragments and then these neutral fragments are ionized by field tunneling. Another possible way for DME to dissociate at 810 and 270 nm is that DME is ionized by intense field ejection of inner valance electron and then the excited DME + dissociates into fragment ions. Ultrafast rearrangement of DME or DME + in intense field may be responsible to the unpredictable fragment ions, CHO+/C2H5+andH2+.

  3. Anti-helmínticos na toxocaríase experimental: efeito na recuperação de larvas de Toxocara canis e na resposta humoral Anthelmintics in experimental toxocariasis: effects on larval recovery of Toxocara canis and on immune response

    Directory of Open Access Journals (Sweden)

    Susana Zevallos Lescano

    2005-02-01

    Full Text Available Estudou-se a recuperação de larvas na fase crônica de camundongos infectados por Toxocara canis, bem como a presença de anticorpos anti-Toxocara após tratamento com ivermectina, mebendazol ou tiabendazol, durante cinco dias consecutivos. Os animais foram sangrados pelo plexo retroorbitário entre 30 e 270 dias após a infecção (DPI. Os soros foram processados pela técnica de enzyme linked immunosorbent assay (ELISA para pesquisa de anticorpos da imunoglobulina da classe G (IgG, utilizando antígeno ES de T. canis. Aos 270 DPI, os animais foram sacrificados para recuperação de larvas no sistema nervoso central, no fígado, nos pulmões e músculos. Os resultados do teste imunoenzimático indicam que, aos 20 dias após tratamento (50 DPI, o nível de anticorpos anti-Toxocara IgG aumentou nos três grupos tratados, mantendo-se elevado ao longo do experimento até o 270º DPI. Em relação aos animais infectados e não-tratados, observou-se decréscimo significativo no número de larvas recuperadas nos animais dos três grupos tratados, não se conseguindo a cura parasitológica. Com este estudo conclui-se que as três drogas utilizadas no experimento têm eficácia similar.The effects of treatment with ivermectin, mebendazole or tiabendazole, during five days, on the larval recovery and immune response to Toxocara canis in experimental chronically infected mice were studied. Animals were bled, using the retro-orbital plexus between the 30th and the 270th days post-infection (Dpi, and sera were processed by ELISA technique for IgG antibodies using ES antigen from T. canis. On day 270 all the animals were killed for larval recovery in the central nervous system, liver, lungs and carcass. Immunoenzimatic test results indicate that 20 days after treatment (50 DPI the anti-Toxocara IgG antibody level increased in the three treated groups and remained elevated until 270 DPI. It was observed a significative decrease in larvae recovered from

  4. Mud Pit Risk-Based Closure Strategy Report, Nevada Test Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Brain Hoenes

    2004-08-01

    This report presents the findings of the human and ecological risk assessment for the NTS mud pits. The risk assessment utilizes data from 52 of the 270 NTS mud pits in conjunction with corroborative data from 87 other DOE mud pits associated with nuclear testing (at locations on the NTS, in the western United States, and Alaska) as well as relevant process knowledge. Based on the risk assessment findings, the report provides a strategy for further evaluation, characterization, and closure of all 270 NTS mud pit CASs using the Streamlined Approach for Environmental Restoration (SAFER).

  5. Low-energy electron transmission through high aspect ratio Al O nanocapillaries

    DEFF Research Database (Denmark)

    Milosavljević, A.R.; Jureta, J.; Víkor, G.

    2009-01-01

    Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined with resp......Electron transmission through insulating AlO nanocapillaries of different diameters (40 and 270 nm) and 15 μm length has been investigated for low-energy electrons (2-120 V). The total intensity of transmitted current weakly depends on the incident electron energy and tilt angle defined...

  6. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    1993-01-01

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  7. Design of a ZVS PWM inverter for a brushless DC motor in an EMA application

    Science.gov (United States)

    Bell, J. Brett; Nelms, R. M.; Shepherd, Michael T.

    The Component Development Division of the Propulsion Laboratory at Marshall Space Flight Center (MSFC) is currently investigating the use of electromechanical actuators for use in space transportation applications such as Thrust Vector Control (TVC). These high power servomechanisms will require rugged, reliable, and compact power electronic modules capable of modulating several hundred amperes of current at up to 270 Vdc. This paper will discuss the design and implementation of a zero-voltage-switched PWM (Pulse Width Modulation) inverter which operates from a 270 Vdc source at currents up to 100 A.

  8. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AERVDGVREALKGSKWTEVAGSPTFCNDDPALAVQQMTDMRTAT 180 ... Query: 270 GQRPFEMGEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK 314 ... GQRPFEM...GEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK Sbjct: 241 GQRPFEMGEKAMDTLLAIKKGEKVPEIVYTGLDLVTKDNVAQMLK 285

  9. 48 CFR 1816.402-270 - NASA technical performance incentives.

    Science.gov (United States)

    2010-10-01

    ... under procedures other than FAR part 12 at the discretion of the procurement officer upon consideration of the guidelines in 1816.402. Performance incentives, which are objective and measure hardware... negative, and its associated unit of measurement should reflect the value to the Government of that level...

  10. 24 CFR 234.270 - Condition of the multifamily structure.

    Science.gov (United States)

    2010-04-01

    .... (b) If the property has been damaged by fire and such property was not covered by fire insurance at... Commissioner without deduction from the insurance benefits for any loss occasioned by such fire if the following conditions are met: (1) The property shall have been covered by fire insurance at the time the...

  11. 46 CFR 28.270 - Instruction, drills, and safety orientation.

    Science.gov (United States)

    2010-10-01

    ... Lines or With More Than 16 Individuals On Board, or for Fish Tender Vessels Engaged in the Aleutian... outfit and a self-contained breathing apparatus, if the vessel is so equipped; (8) Making a voice radio...

  12. 48 CFR 352.270-5 - Care of laboratory animals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Care of laboratory animals... of laboratory animals. (a) As prescribed in 370.403(a), the Contracting Officer shall insert the... on Humane Care and Use of Laboratory Animals (January 2006) The Public Health Service (PHS) Policy on...

  13. A Society Based on Work. Information Series No. 270.

    Science.gov (United States)

    Carnevale, Anthony Patrick

    American society is based on work. The industrial revolution exposed a growing proportion of the population to unemployment, underemployment, and dislocation. Early theoreticians believed that unemployment was a temporary labor market imbalance that would correct itself with downward wage adjustments. John Maynard Keynes, on the other hand, argued…

  14. 17 CFR 270.2a-7 - Money market funds.

    Science.gov (United States)

    2010-04-01

    ... portfolio securities are valued at the fund's Acquisition cost as adjusted for amortization of premium or...-Rounding Method of pricing means the method of computing an investment company's price per share for... within the procedures adopted by the board of directors shall be the following: (A) Shadow Pricing...

  15. 48 CFR 352.270-9 - Non-discrimination for conscience.

    Science.gov (United States)

    2010-10-01

    ... acknowledges that an offeror has specific rights, as cited in paragraph (b) of this provision, to exclude... right to not make an award to an offeror whose proposal does not comply with the salient work requirements of the solicitation. Any exercise of that Government right will be made by the Head of the...

  16. 17 CFR 270.18f-3 - Multiple class companies.

    Science.gov (United States)

    2010-04-01

    ... appreciation and depreciation, and Fundwide Expenses shall be allocated based on one of the following methods... each day's income, realized gains and losses, unrealized appreciation and depreciation, and Fundwide... gains or losses, and unrealized appreciation or depreciation, based on the operating results of the...

  17. 48 CFR 1339.270 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... COMMERCE SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information... to 1352.239-71, Electronic and Information Technology, in solicitations for Electronic and...

  18. 48 CFR 352.270-8 - Prostitution and related activities.

    Science.gov (United States)

    2010-10-01

    .../AIDS, or endorse, utilize, or participate in a prevention method or treatment program to which it has a..., medical supplies, logistics support, data management, and freight forwarding. Notwithstanding the... Officer: (1) Organizational Integrity Certification: “I certify that (insert Contractor's name), which...

  19. All projects related to | Page 270 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: PUBLISHING, INTELLECTUAL PROPERTY, COPYRIGHT, ACCESS TO INFORMATION, Internet, STUDENTS. Region: Brazil, South America, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, Far East Asia, South Asia. Program: Networked Economies. Total Funding: ...

  20. 48 CFR 352.270-4 - Protection of human subjects.

    Science.gov (United States)

    2010-10-01

    ... subjects as well as to graphic, written, or recorded information derived from individually identifiable... relation to both the potential benefits, if any, to the subjects and the importance of the knowledge to be... contract until the Contractor corrects the noncompliance. The Contracting Officer may communicate the...

  1. 40 CFR 61.270 - Applicability and designation of sources.

    Science.gov (United States)

    2010-07-01

    ... specific gravity within the range of specific gravities specified in ASTM D836-84 for Industrial Grade... attached to motor vehicles such as trucks, rail cars, barges, or ships. (e) This subpart does not apply to...

  2. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... include, without limitation, controls and procedures designed to ensure that information required to be...

  3. A recombinant estrogen receptor fragment-based homogeneous fluorescent assay for rapid detection of estrogens.

    Science.gov (United States)

    Wang, Dan; Xie, Jiangbi; Zhu, Xiaocui; Li, Jinqiu; Zhao, Dongqin; Zhao, Meiping

    2014-05-15

    In this work, we demonstrate a novel estrogenic receptor fragment-based homogeneous fluorescent assay which enables rapid and sensitive detection of 17β-estradiol (E2) and other highly potent estrogens. A modified human estrogenic receptor fragment (N-His × 6-hER270-595-C-Strep tag II) has been constructed that contains amino acids 270-595 of wild-type human estrogenic receptor α (hER270-595) and two specific tags (6 × His and Strep tag II) fused to the N and C terminus, respectively. The designed receptor protein fragment could be easily produced by prokaryotic expression with high yield and high purity. The obtained protein exhibits high binding affinity to E2 and the two tags greatly facilitate the application of the recombinant protein. Taking advantage of the unique spectroscopic properties of coumestrol (CS), a fluorescent phytoestrogen, a CS/hER270-595-based fluorescent assay has been developed which can sensitively respond to E2 within 1.0 min with a linear working range from 0.1 to 20 ng/mL and a limit of detection of 0.1 ng/mL. The assay was successfully applied for rapid detection of E2 in the culture medium of rat hippocampal neurons. The method also holds great potential for high-throughput monitoring the variation of estrogen levels in complex biological fluids, which is crucial for investigation of the molecular basis of various estrogen-involved processes. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. Thermal stability of biodiesel in supercritical methanol

    Energy Technology Data Exchange (ETDEWEB)

    Hiroaki Imahara; Eiji Minami; Shusaku Hari; Shiro Saka [Kyoto University, Kyoto (Japan). Department of Socio-Environmental Energy Science

    2008-01-15

    Non-catalytic biodiesel production technologies from oils/fats in plants and animals have been developed in our laboratory employing supercritical methanol. Due to conditions in high temperature and high pressure of the supercritical fluid, thermal stability of fatty acid methyl esters and actual biodiesel prepared from various plant oils was studied in supercritical methanol over a range of its condition between 270{sup o}C/17 MPa and 380{sup o}C/56 MPa. In addition, the effect of thermal degradation on cold flow properties was studied. As a result, it was found that all fatty acid methyl esters including poly-unsaturated ones were stable at 270{sup o}C/17 MPa, but at 350{sup o}C/43 MPa, they were partly decomposed to reduce the yield with isomerization from cis-type to trans-type. These behaviors were also observed for actual biodiesel prepared from linseed oil, safflower oil, which are high in poly-unsaturated fatty acids. Cold flow properties of actual biodiesel, however, remained almost unchanged after supercritical methanol exposure at 270{sup o}C/17 MPa and 350{sup o}C/43 MPa. For the latter condition, however, poly-unsaturated fatty acids were sacrificed to be decomposed and reduced in yield. From these results, it was clarified that reaction temperature in supercritical methanol process should be lower than 300{sup o}C, preferably 270{sup o}C with a supercritical pressure higher than 8.09 MPa, in terms of thermal stabilization for high-quality biodiesel production. 9 refs., 3 figs., 4 tabs.

  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IDFMRLAINGTAEAHRACMKYCKPGMYEF Sbjct: 121 IRTKAVYKYNTNETELHDVLFEARTVKTKEEIDFMRLAINGTAEAHRACMKYCKPGMYEF 180 ... Query: 270 CHRYATDLTLTYPIN...GKFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG 329 ... CHRYATDLTLTYPING...KFTEQQKTIYNIVLSCNRGCEAAMKPGVKWYNIHELSNKLMLKG Sbjct: 241 CHRYATDLTLTYPINGKFTEQQKTIYNIVLS

  6. The influence of strain on annealing behaviour of heavily rolled aluminium AA1050

    DEFF Research Database (Denmark)

    Mishin, Oleg; Juul Jensen, Dorte; Hansen, Niels

    2012-01-01

    Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened microstru......Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened...

  7. The two domain hypothesis of limb prepattern and its relevance to congenital limb anomalies.

    Science.gov (United States)

    Tao, Hirotaka; Kawakami, Yasuhiko; Hui, Chi-Chung; Hopyan, Sevan

    2017-07-01

    Functional annotation of mutations that cause human limb anomalies is enabled by basic developmental studies. In this study, we focus on the prepatterning stage of limb development and discuss a recent model that proposes anterior and posterior domains of the early limb bud generate two halves of the future skeleton. By comparing phenotypes in humans with those in model organisms, we evaluate whether this prepatterning concept helps to annotate human disease alleles. WIREs Dev Biol 2017, 6:e270. doi: 10.1002/wdev.270 For further resources related to this article, please visit the WIREs website. © 2017 Wiley Periodicals, Inc.

  8. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  9. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADACRLLGDRAYRLCLTDMRLPDGDGIELVAHIQTQQPGLPVAVV 78 ... Query: 150 AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPV...NCGAISPEL 209 ... AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL Sbjct: 139 AALAQLR...VQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL 198 ... Query: 270 GAHAEESVDVR

  10. Young's Modulus of Single-Crystal Fullerene C Nanotubes

    Directory of Open Access Journals (Sweden)

    Tokushi Kizuka

    2012-01-01

    Full Text Available We performed bending tests on single-crystal nanotubes composed of fullerene C70 molecules by in situ transmission electron microscopy with measurements of loading forces by an optical deflection method. The nanotubes with the outer diameters of 270–470 nm were bent using simple-beam and cantilever-beam loading by the piezomanipulation of silicon nanotips. Young's modulus of the nanotubes increased from 61 GPa to 110 GPa as the outer diameter decreased from 470 nm to 270 nm. Young's modulus was estimated to be 66% of that of single-crystal C60 nanotubes of the same outer diameter.

  11. 12 MW

    DEFF Research Database (Denmark)

    Hasager, Charlotte Bay; Pena Diaz, Alfredo; Mikkelsen, Torben

    '12MW: final report' is for the project with the full title ‘12 MW wind turbines: the scientific basis for their operation at 70 to 270 m height offshore’ that had the goal to experimentally investigate the wind and turbulence characteristics between 70 and 270 m above sea level and thereby...... establish the scientific basis relevant for the next generation of huge 12 MW wind turbines operating offshore. The project started 1st October 2005 and ended 31st March 2009. Firstly was conducted a 6-month experiment at the Horns Rev offshore wind farm deploying a lidar and a sodar on the transformer...

  12. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sensor ... histidine kinase [Tropheryma whipplei str. Twist] ... Length = 81 ... Query: 211 MLDSLEKALGERD...KTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE 270 ... MLDSLEKALGERD...KTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE Sbjct: 1 ... MLDSLEKALGERDKTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIE 60 ...

  13. Resposta de cultivares de algodoeiro a subdoses de glyphosate Response of cotton cultivars to reduced rates of glyphosate

    Directory of Open Access Journals (Sweden)

    O.M. Yamashita

    2005-12-01

    Full Text Available Avaliou-se a resposta de nove cultivares de algodoeiro, de importância econômica no Estado do Mato Grosso, quanto à intoxicação causada por subdoses de glyphosate. Os cultivares de algodoeiro utilizados foram Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal, BRS Facual, Antares e Coodetec 407. As plantas foram cultivadas em tubetes preenchidos com substrato de solo e mantidas em casa telada, tendo recebido a aplicação do glyphosate aos 20 dias após a emergência, época em que apresentavam quatro folhas verdadeiras. As subdoses de glyphosate, simulando deriva, foram de 270 e 540 g ha-1. Também foi utilizada testemunha, sem aplicação do herbicida, para efeito de comparação. Foram realizadas avaliações semanais até 42 dias após a aplicação dos tratamentos (DAA, período em que também foi tomada a altura das plantas. Os sintomas visuais de intoxicação iniciaram-se aos 3 DAA, caracterizados pelo amarelecimento das pontas das folhas mais novas, seguido de murchamento do ápice das plantas. Na dose de 270 g ha-1 esses sintomas foram de baixa intensidade, mas a 540 g ha-1 causaram, na maioria dos casos, toxidez "preocupante" a "muito alta". Os cultivares BRS Facual e FM 986 mostraram-se os mais suscetíveis. A altura das plantas foi mais afetada quando se aplicou a menor dose de glyphosate. Houve recuperação de todos os cultivares tratados com 270 g ha-1 de glyphosate até os 42 DAA. Quando tratados com 540 g ha-1 de glyphosate, os cultivares Fabrika, Coodetec 407, BRS-Facual e ITA-90 foram mais sensíveis, apresentando redução de altura entre 84 e 90% aos 42 DAA. Os cultivares menos sensíveis na dose de 270 g ha-1 de glyphosate não foram os mesmos para a dose de 540 g ha-1.The response of nine cotton cultivars economically important in the state of Mato Grosso was evaluated in relation to the toxicity caused by reduced rates of glyphosate. The cotton cultivars used were Fabrika, Makina, ITA-90, FM 986, FM 966, Delta Opal

  14. Effects of cereal breakfasts on postprandial glucose, appetite regulation and voluntary energy intake at a subsequent standardized lunch; focusing on rye products

    Directory of Open Access Journals (Sweden)

    Björck Inger ME

    2011-01-01

    Full Text Available Abstract Background Rye products have been demonstrated to lower the acute insulin demand, induce a low and prolonged blood glucose response (high Glycemic Profile, GP and reduce subclinical inflammation. These products may therefore contribute to a lowered risk of obesity, type 2 diabetes and cardio vascular disease. The objective of the present paper was to evaluate the mechanism for a reduced postprandial insulin demand with rye products, and to explore possible appetite regulating properties. Methods 10 healthy subjects were served breakfast meals (50 g of available starch with endosperm- or whole grain rye breads, with and without lactic acid, boiled whole grain rye- (RK or wheat (WK kernels, or white wheat bread reference (WWB in random order in a cross-over design. Plasma concentrations of glucose, ghrelin, serum insulin, free fatty acids, adiponectin, breath hydrogen excretion (H2, and subjective satiety was evaluated during the postprandial phase. 270 min after the breakfast, an ad lib lunch buffet was served and the voluntary energy intake (EI was registered. Results All rye products and WK induced lower insulinemic indices (II than WWB. A lower incremental insulin peak following breakfast correlated with a lower EI at lunch (r = 0.38. A low II was related to improved satiety in the early postprandial phase (fullness AUC 0-60 min, r = -0.36. RK induced a higher GP compared to WWB and WK. A higher GP was related to a lowered desire to eat before lunch (AUC 210-270 and to a lower concentration of ghrelin in the late postprandial phase after breakfast (270 min, r = -0.29 and -0.29, which in turn was related to a lower voluntary EI (r = 0.43 and 0.33. The RK breakfast improved satiety in the early postprandial phase (0-60 min compared to WWB, and induced a lower EI at lunch (-16%. A high content of indigestible carbohydrates in the breakfast products was related to improved satiety (0-60 min, r = 0.68 for fullness, and a higher breath H2

  15. Recovery of gonadal development in tiger puffer Takifugu rubripes after exposure to 17β-estradiol during early life stages

    Science.gov (United States)

    Hu, Peng; Liu, Bin; Meng, Zhen; Liu, Xinfu; Jia, Yudong; Yang, Zhi; Lei, Jilin

    2017-05-01

    The aim of the present study was to investigate the long-term effects of 17β-estradiol (E2) exposure on gonadal development in the tiger puff er ( Takifugu rubripes), which has a genetic sex determination system of male homogametic XY-XX. Tiger puff er larvae were exposed to 1, 10 and 100 μg/L E2 from 15 to 100 days post-hatch (dph) and then maintained in clean seawater until 400 dph. Changes in sex ratio, gonadal structure and gonadosomatic index (GSI) were monitored at 100, 160, 270 and 400 dph. Sex-associated single nucleotide polymorphism (SNP) markers were used to analyze the genetic sex of samples, except those at 100 dph. Exposure had a positive effect on the conversion of genetically male gonads into phenotypically female gonads at 100 dph. However, gonads from 60% of genetic XY males in the 1-μg/L E2 group and 100% in the 10-μg/L E2 group developed intersexual gonads at 160 dph; gonads of all genetic XY males in the two treatment groups reverted to testis by 270 dph. While 38%, 57% and 44% of gonads of XY fish in the 100-μg/L E2 group reverted to intersexual gonads at 160, 270 and 400 dph, respectively, none reverted to testis after E2 treatment. In addition, E2 exposure inhibited gonadal growth of both genetic sexes, as indicated by the clear dose-dependent decrease in GSI at 270 and 400 dph. The results showed that exposure to E2 during the early life stages of tiger puff er disrupted gonadal development, but that fish recovered after migration to clean seawater. The study suggests the potential use of tiger puff er as a valuable indicator species to evaluate the effects of environmental estrogens on marine fish, thereby protecting valuable fishery resources.

  16. Creep properties of forged 2219 T6 aluminum alloy shell of general-purpose heat source-radioisotope thermoelectric generator

    International Nuclear Information System (INIS)

    Hammond, J.P.

    1981-12-01

    The shell (2219 T6 aluminum forging) of the General Purpose Heat Source-Radioisotope Thermoelectric Generator was designed to retain the generator under sufficient elastic stress to secure it during space flight. A major concern was the extent to which the elastic stress would relax by creep. To determine acceptability of the shell construction material, the following proof tests simulating service were performed: 600 h of testing at 270 0 C under 24.1 MPa stress followed by 10,000 h of storage at 177 0 C under 55.1 MPa, both on the ground; and 10,000 h of flight in space at 270 0 C under 34.4 MPa stress. Additionally, systematic creep testing was performed at 177 and 260 0 C to establish creep design curves. The creep tests performed at 177 0 C revealed comparatively large amounts of primary creep followed by small amounts of secondary creep. The early creep is believed to be abetted by unstable substructures that are annealed out during testing at this temperature. The creep tests performed at 270 0 C showed normal primary creep followed by large amounts of secondary creep. Duplicate proof tests simulating the ground exposure conditions gave results that were in good agreement. The proof test simulating space flight at 270 0 C gave 0.11% primary creep followed by 0.59% secondary creep. About 10% of the second-stage creep was caused by four or five instantaneous strains, which began at the 4500-h mark. One or two of these strain bursts, occurred in each of several other tests at 177 and 260 0 C but were assessed as very moderate in magnitude. The effect is attributable to a slightly microsegregated condition remaining from the original cast structure

  17. 40 CFR 270.14 - Contents of part B: General requirements.

    Science.gov (United States)

    2010-07-01

    ..., and engineering studies shall be certified by a qualified Professional Engineer. For post-closure... § 264.1 provides otherwise: (1) A general description of the facility. (2) Chemical and physical... atmosphere. (9) A description of precautions to prevent accidental ignition or reaction of ignitable...

  18. Data supporting Boyes et al., Neurotoxicology 53, 257-270, 2016

    Data.gov (United States)

    U.S. Environmental Protection Agency — Visual evoked potential data from rats exposed to toluene Electroretinogram data from rats exposed to toluene Counts of rod and m-cone photoreceptor cells in retinas...

  19. 40 CFR 270.1 - Purpose and scope of these regulations.

    Science.gov (United States)

    2010-07-01

    ... Overview and definitions 40 CFR part 260 3001 Identification and listing of hazardous waste 40 CFR part 261... hazardous waste management units must have permits during the active life (including the closure period) of... of a permit for the active life of a hazardous waste management facility or unit does not affect the...

  20. 48 CFR 852.270-2 - Bread and bakery products-quantities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Bread and bakery products... Bread and bakery products—quantities. As prescribed in 870.111-3, insert the following clause: Bread and Bakery Products—Quantities (JAN 2008) The bidder agrees to furnish up to 25 percent more or 25 percent...

  1. P270: Factors associated with fall rate in psychogeriatric residents

    NARCIS (Netherlands)

    Kosse, N.M.; de Groot, Maartje H; Hortobágyi, T.; Lamoth, C.J.C.

    2014-01-01

    Introduction: Falls in psychogeriatric residents represent a costly but unresolved safety issue. Identifying fall risk factors and their inter-relationship may help to individualize prevention programs and increase the effectiveness. Therefore, we aimed to examine the relationship between patient

  2. Literature review on induced exposure models, Task 2 HS-270

    Science.gov (United States)

    1982-02-01

    Sections 1, 2 and 3 of this report describe the development of : induced exposure models, together with d discussion of questions : of validity. These Sections focus on the most important and : relevant results from the literature, while Appendix A c...

  3. 46 CFR 170.270 - Door design, operation, installation, and testing.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Door design, operation, installation, and testing. 170..., operation, installation, and testing. (a) Each Class 1 door must have a quick action closing device... the welding process so that the door frame is not distorted. (e) For each watertight door which is in...

  4. Structure of the thioredoxin-fold domain of human phosducin-like protein 2

    International Nuclear Information System (INIS)

    Lou, Xiaochu; Bao, Rui; Zhou, Cong-Zhao; Chen, Yuxing

    2009-01-01

    The X-ray crystal structure of the Trx-fold domain of hPDCL2 was solved at 2.70 Å resolution and resembled the Trx-fold domain of rat phosducin. Human phosducin-like protein 2 (hPDCL2) has been identified as belonging to subgroup II of the phosducin (Pdc) family. The members of this family share an N-terminal helix domain and a C-terminal thioredoxin-fold (Trx-fold) domain. The X-ray crystal structure of the Trx-fold domain of hPDCL2 was solved at 2.70 Å resolution and resembled the Trx-fold domain of rat phosducin. Comparative structural analysis revealed the structural basis of their putative functional divergence

  5. 78 FR 4135 - Programmatic Environmental Impact Statement for the Training Mission and Mission Support...

    Science.gov (United States)

    2013-01-18

    ... INFORMATION CONTACT: Mr. Gene Zirkle at (270) 798-9854, during normal working business hours Monday through.... This includes the formalization of environmental stewardship best management practices (BMPs...

  6. Hyperbaric oxygen in skeletal muscle of rats submitted to total acute left hindlimb ischemia: A research report.

    Science.gov (United States)

    da Silva, Luis Gustavo Campos; Dalio, Marcelo Bellini; Joviliano, Edwaldo Edner; Feres, Omar; Piccinato, Carlos Eli

    2015-01-01

    Determine the effect of hyperbaric oxygen treatment in skeletal muscle of rats submitted to total acute left hindlimb ischemia. An experimental study was designed using 48 Wistar rats divided into four groups (n = 12): Control; Ischemia (I)--total hindlimb ischemia for 270 minutes; Hyperbaric oxygen treatment during ischemia (HBO2)--total hindlimb ischemia for 270 minutes and hyperbaric oxygen during the first 90 minutes; Pre-treatment with hyperbaric oxygen (PHBO2)--90 minutes of hyperbaric oxygen treatment before total hindlimb ischemia for 270 minutes. Skeletal muscle injury was evaluated by measuring levels of aspartate aminotransferase (AST), lactate dehydrogenase (LDH), total creatine phosphokinase (CPK); muscular malondialdehyde (MDA), muscular glycogen, and serum ischemia-modified albumin (IMA). AST was significantly higher in I, HBO2 and PHBO2 compared with control (P = .001). There was no difference in LDH. CPK was significantly higher in I, HBO2 and PHBO2, compared with control (p = .014). MDA was significantly higher in PHBO2, compared with other groups (p = .042). Glycogen was significantly decreased in I, HBO2 and PHBO2, compared with control (p < .001). Hyperbaric oxygen treatment in acute total hindlimb ischemia exerted no protective effect on muscle injury, regardless of time of application. When applied prior to installation of total ischemia, hyperbaric oxygen treatment aggravated muscle injury.

  7. Renewable energy powered membrane technology: Impact of pH and ionic strength on fluoride and natural organic matter removal.

    Science.gov (United States)

    Owusu-Agyeman, Isaac; Shen, Junjie; Schäfer, Andrea Iris

    2018-04-15

    Real water pH and ionic strength vary greatly, which influences the performance of membrane processes such as nanofiltration (NF) and reverse osmosis (RO). Systematic variation of pH (3-12) and ionic strength (2-10g/L as total dissolved solids (TDS)) was undertaken with a real Tanzanian water to investigate how water quality affects retention mechanisms of fluoride (F) and natural organic matter (NOM). An autonomous solar powered NF/RO system driven by a solar array simulator was supplied with constant power from a generator. An open NF (NF270) and a brackish water RO (BW30) membrane were used. A surface water with a very high F (59.7mg/L) and NOM (110mgC/L) was used. Retention of F by NF270 was 80% at pH4, and about 99% at pH >5, due to the smaller pore size and hence a more dominant size exclusion. In consequence, only little impact of ionic strength increase was observed for BW30. The concentration of NOM in permeates of both NF270 and BW30 were typically energy fluctuations, this research emphasises on feed water quality that affects system performance and may alter due to a number of environmental factors. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. On conductivity, permittivity, apparent diffusion coefficient, and their usefulness as cancer markers at MRI frequencies.

    Science.gov (United States)

    Hancu, Ileana; Roberts, Jeannette Christine; Bulumulla, Selaka; Lee, Seung-Kyun

    2015-05-01

    To investigate the permittivity and conductivity of cancerous and normal tissues, their correlation to the apparent diffusion coefficient (ADC), and the specificity that they could add to cancer detection. Breast and prostate carcinomas were induced in rats. Conductivity and permittivity measurements were performed in the anesthetized animals using a dielectric probe and an impedance analyzer between 50 and 270 MHz. The correlations between ADCs (measured at 128 MHz) and conductivity values were investigated. Frequency-dependent discriminant functions were computed to assess the value that each parameter adds to cancer detection. Tumors exhibited higher permittivity than muscle tissue by 27%/12%/5% at 64/128/270MHz. Frequency independent, 15-20% higher conductivity was also noted in tumors compared to muscle tissue over the same frequency range. Strong negative correlation was observed between tissue conductivity and ADC. Whereas permittivity had the strongest discriminatory power at 64 MHz, it became comparable to ADC at 128 MHz and less important than ADC at 270 MHz. Conductivity measurements offered limited advantages in separating cancer from normal tissue beyond what ADC already provided; conversely, permittivity added separation power when added to the discriminant function. The moderately high cancerous tissue permittivity and conductivity impose strong constraints on the capability of MRI-based tissue electrical property measurements. © 2014 Wiley Periodicals, Inc.

  9. ORF Sequence: NC_003423 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available orphan; low similarity to glycoamylases and other cell surface proteins; contains ~250-270 copies of a 13 AA repeat, NSS...TNSISFANTTPENTSTQITSPTAVNSSTPITSSSVLNSSTPITSSSILNTSTPITSSSVLNSSTPITSSSILNSSTPITSSTVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSSTPITSSTVVNTSTPITSSTVVNSSTPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTSITSSSVLNSS...TPITSSTVVNTSTPITSSSVLNSSTPITSSTVVNTSTPITRYSVLNSSTPITSSTVLNSSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTPITSSSVLNSS...TPITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSSTAITSSTALNTSTPITSSSVLNSSTPITSSTALNTSTPITSSSVLNSS

  10. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1325 ... Filter by project status ... Urban Poverty and Environment Programme : Colombo; monitoring and evaluation component; monitoring findings ... Enough foreign direct investment quickens economic growth everywhere.

  11. Traženje zajedničkoga kulturnog identiteta na početku 20. Stoljeća: Josef Vajs I pokret za obnovu glagoljaškoga pjevanja u hrvatskoj I češkoj

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš

    2013-01-01

    Roč. 44, č. 2 (2013), s. 257-270 ISSN 0587-5455 Institutional support: RVO:68378076 Keywords : Josef Vajs * Glagolitic singing * Glagolitic liturgy Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Peer Instruction in the Learning Laboratory: A Strategy To Decrease Student Anxiety.

    Science.gov (United States)

    Owens, Laura D.; Walden, Debra J.

    2001-01-01

    To decrease nursing students' anxiety during psychomotor skills testing in learning laboratories, paid peer instructors were trained to assist. Over 3 years, 270 students participated and reported positive outcomes. (SK)

  13. "3"1P Nuclear Magnetic Resonance of Charge-Density-Wave Transition in a Single Crystal of RuP

    International Nuclear Information System (INIS)

    Fan Guo-Zhi; Luo Jian-Lin; Chen Rong-Yan; Wang Nan-Lin

    2015-01-01

    We perform "3"1P nuclear magnetic resonance (NMR) measurements on a single crystal of RuP. The anomalies in resistivity at about T_A = 270 K and T_B = 330 K indicate that two phase transitions occur. The line shape of "3"1P NMR spectra in different temperature ranges is attributed to the charge density distribution. The Knight shift and spin-lattice relaxation rate 1/T_1T are measured from 10 K to 300 K. At about T_A = 270 K, they both decrease abruptly with the temperature reduction, which reveals the gap-opening behavior. Well below T_A, they act like the case of normal metal. Charge-density-wave phase transition is proposed to interpret the transition occurring at about T_A. (paper)

  14. Identification and functional analysis of a novel mutation in the PAX3 gene associated with Waardenburg syndrome type I.

    Science.gov (United States)

    Niu, Zhijie; Li, Jiada; Tang, Fen; Sun, Jie; Wang, Xueping; Jiang, Lu; Mei, Lingyun; Chen, Hongsheng; Liu, Yalan; Cai, Xinzhang; Feng, Yong; He, Chufeng

    2018-02-05

    Waardenburg syndrome type 1 (WS1) is a rare autosomal dominant genetic disorder of neural crest cells (NCC) characterized by congenital sensorineural hearing loss, dystopia canthorum, and abnormal iris pigmentation. WS1 is due to loss-of-function mutations in paired box gene 3 (PAX3). Here, we identified a novel PAX3 mutation (c.808C>G, p.R270G) in a three-generation Chinese family with WS1, and then analyzed its in vitro activities. The R270G PAX3 retained nuclear distribution and normal DNA-binding ability; however, it failed to activate MITF promoter, suggesting that haploinsufficiency may be the underlying mechanism for the mild WS1 phenotype of the study family. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Importance of computerized tomography for surgical treatment of intracranial hematomas

    International Nuclear Information System (INIS)

    Diemath, H.E.

    1982-01-01

    The improved treatment by using computerized tomography (CT) located operating theater and intensive care unit is reported in comparison of 3,382 patients with severe head injuries. By preoperative use of CT the frequency of diagnosed hermatomas was about the same (29.5% before CT; 27.0% with CT) but the preoperative diagnosed multiple hematomas were much more frequent (14.0% resp. 27.0%). The most important advantage however is the saving of time by CT in this localisation by which the chance of survival has increased from 54% to 69%. Without any doubt everywhere in neurotraumatology the CT should be situated as near as possible to the intensive care unit and to the operating theater and should be available 24 hours a day. (Author) [de

  16. Migrace v české etnologii: náměty k obohacení migrační teorie

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    2016-01-01

    Roč. 26, č. 4 (2016), s. 263-270 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : ethnology * social and cultural anthropology * migration * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. 20 CFR 437.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...) Final request for payment (SF-270) (if applicable). (iv) Invention disclosure (if applicable). (v... are not limited to: (i) Final performance or progress report. (ii) Financial Status Report (SF 269) or...

  18. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. 45 CFR 1174.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  20. 45 CFR 1157.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  1. 24 CFR 85.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  2. 45 CFR 1183.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  3. 21 CFR 1403.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  4. 49 CFR 18.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  5. 43 CFR 12.90 - Closeout.

    Science.gov (United States)

    2010-10-01

    ....) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  6. 22 CFR 135.50 - Closeout.

    Science.gov (United States)

    2010-04-01

    ...). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  7. 28 CFR 66.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ....) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5... include but are not limited to: (1) Final performance or progress report. (2) Financial Status Report (SF...

  8. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8491 ... Building emerging leaders in communications policy in Africa and Asia. In Africa and Asia, ... Perspectives ... Agricultural extension uses scientific research to educate farmers and improve agricultural practices.

  9. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  10. Structurally Oriented Nano-Sheets in Co Thin Films: Changing Their Anisotropic Physical Properties by Thermally-Induced Relaxation.

    Science.gov (United States)

    Vergara, José; Favieres, Cristina; Magén, César; de Teresa, José María; Ibarra, Manuel Ricardo; Madurga, Vicente

    2017-12-05

    We show how nanocrystalline Co films formed by separated oblique nano-sheets display anisotropy in their resistivity, magnetization process, surface nano-morphology and optical transmission. After performing a heat treatment at 270 °C, these anisotropies decrease. This loss has been monitored measuring the resistivity as a function of temperature. The resistivity measured parallel to the direction of the nano-sheets has been constant up to 270 °C, but it decreases when measured perpendicular to the nano-sheets. This suggests the existence of a structural relaxation, which produces the change of the Co nano-sheets during annealing. The changes in the nano-morphology and the local chemical composition of the films at the nanoscale after heating above 270 °C have been analysed by scanning transmission electron microscopy (STEM). Thus, an approach and coalescence of the nano-sheets have been directly visualized. The spectrum of activation energies of this structural relaxation has indicated that the coalescence of the nano-sheets has taken place between 1.2 and 1.7 eV. In addition, an increase in the size of the nano-crystals has occurred in the samples annealed at 400 °C. This study may be relevant for the application in devices working, for example, in the GHz range and to achieve the retention of the anisotropy of these films at higher temperatures.

  11. Toxicity studies of the water extract from the calyces of Hibiscus sabdariffa L. in rats.

    Science.gov (United States)

    Sireeratawong, Seewaboon; Itharat, Arunporn; Khonsung, Parirat; Lertprasertsuke, Nirush; Jaijoy, Kanjana

    2013-01-01

    Acute and chronic toxicities of the water extract from calyces of Hibiscus sabdariffa were studied in male and female rats. After 14 days of a single oral administration of test substance 5,000 mg/kg body weight, measurement of the body and organ weights, necropsy and health monitoring were performed. No signs and differences of the weights or behaviour compared to the control rats were observed. The results indicated that the single oral administration of H. sabdariffa extract in the amount of 5,000 mg/kg body weight does not produce acute toxicity. The chronic toxicity was determined by oral feeding both male and female rats daily with the extract at the doses of 50, 100, and 200 mg/kg body weight for 270 days. The examinations of signs, animal behaviour and health monitoring showed no defects in the test groups compared to the control groups. Both test and control groups (day 270th) and satellite group (day 298th) were analysed by measuring their final body and organ weights, taking necropsy, and examining haematology, blood clinical chemistry, and microanatomy. Results showed no differences from the control groups. Overall, our study demonstrated that an oral administration of H. sabdariffa extract at the doses of 50, 100 and 200 mg/kg body weight for 270 days does not cause chronic toxicity in rat.

  12. Influence of boiler load on water tubes burnout

    Energy Technology Data Exchange (ETDEWEB)

    Said, S.A.M.; Habib, M.A.; Badr, H.M.; Mansour, R. [King Fahd Univ. of Petroleum and Minerals, Dhahran (Saudi Arabia). Dept. of Mechanical Engineering

    2009-07-01

    The influence of boiler loads on water tube burnout was investigated. The in-service boiler had 2 burners at different levels located in the front of the burner's wall. Homogenous-flow and separated-flow models were designed to simulate the water circulation and combustion processes inside the boiler tubes. Heat flux calculations were derived by solving the conservation of mass, momentum, and energy equations and species concentration as well as by solving turbulence, reaction rate, and radiation model equations. Results of the study showed that heat flux during full loads ranged from close to 0 to 270 kW/m2. The right side screen wall of the burner exhibited higher heat flux values in the middle region of the wall where large areas were subjected to heat flux close to a maximum of 270 kW/m2. Results also included reductions in heat flux values at partial loads. Maximum values were reduced from 270 kW/m2 ato 230 kW/m2 at 75 per cent capacity and 200 kW/m2 at 60 per cent capacity. The rate of steam generation increased from 0.1 kg/s to 0.153 kg/s when the distance from the burner wall increased from 2 meters to 12 meters. 10 refs., 10 figs.

  13. Structurally Oriented Nano-Sheets in Co Thin Films: Changing Their Anisotropic Physical Properties by Thermally-Induced Relaxation

    Directory of Open Access Journals (Sweden)

    José Vergara

    2017-12-01

    Full Text Available We show how nanocrystalline Co films formed by separated oblique nano-sheets display anisotropy in their resistivity, magnetization process, surface nano-morphology and optical transmission. After performing a heat treatment at 270 °C, these anisotropies decrease. This loss has been monitored measuring the resistivity as a function of temperature. The resistivity measured parallel to the direction of the nano-sheets has been constant up to 270 °C, but it decreases when measured perpendicular to the nano-sheets. This suggests the existence of a structural relaxation, which produces the change of the Co nano-sheets during annealing. The changes in the nano-morphology and the local chemical composition of the films at the nanoscale after heating above 270 °C have been analysed by scanning transmission electron microscopy (STEM. Thus, an approach and coalescence of the nano-sheets have been directly visualized. The spectrum of activation energies of this structural relaxation has indicated that the coalescence of the nano-sheets has taken place between 1.2 and 1.7 eV. In addition, an increase in the size of the nano-crystals has occurred in the samples annealed at 400 °C. This study may be relevant for the application in devices working, for example, in the GHz range and to achieve the retention of the anisotropy of these films at higher temperatures.

  14. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1368 ... ICT in the context of education system ... Statistical handbook on baseline survey : part 1; data tables; (Focus City ... Technologies (ICT) in international development assistance - issues, trends and opportunities.

  15. TMX-U [Tandem Mirror Experiment-Upgrade]: Final report, Volume 2

    International Nuclear Information System (INIS)

    Porter, G.D.

    1988-01-01

    This paper discusses the plasma control and the physics accomplishments of the Tandem Mirror Experiment-Upgrade. This particular volume discusses fueling, ion heating, Fokker-Planck modeling, plasma stability and technical development. 270 refs

  16. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1804 ... IDRC's Democratic Governance, Women's Rights and Gender Equality ... from complex interactions between natural and human systems. ... years of potential life lost due to premature mortality or disability (DALYs).

  17. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 657 ... Home · Project; South of Sahara .... Trauma, Development and Peacebuilding : Toward an ... the conceptualization of post-traumatic stress disorder (PTSD), ... Centre for Environmental Economics and Policy in Africa.

  18. Prožitek architektury

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2008-01-01

    Roč. 87, č. 4 (2008), s. 270-272 E-ISSN 1214-4029 Institutional research plan: CEZ:AV0Z80330511 Keywords : contemporary architecture * Peter Zumthor Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. 13 CFR 143.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  20. 10 CFR 600.250 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  1. 15 CFR 24.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  2. 14 CFR 1273.50 - Closeout.

    Science.gov (United States)

    2010-01-01

    ... Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention... extend this timeframe. These may include but are not limited to: (1) Final performance or progress report...

  3. Publications | Page 27 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 7331 ... Through the Global Entrepreneurship Monitor, Canadian and ... helps female entrepreneurs connect to global supply chains ... The report details activities and outputs of the groundwater management strategy with ...

  4. 76 FR 50216 - Ocean Transportation Intermediary License; Revocation

    Science.gov (United States)

    2011-08-12

    ... & Freight Forwarders. Address: 7094 Peachtree Industrial Boulevard, Suite 270-1, Norcross, GA 30071. Date...: 021616N. Name: Scrap-N-Ship Logistics Corp. Address: 810 SW. 173rd Avenue, Pembroke Pines, FL 33029. Date...

  5. Effect of drought stress on qualitative characteristics of olive oil of cv Koroneiki

    Directory of Open Access Journals (Sweden)

    Kotsifaki, Fani

    2001-08-01

    Full Text Available Quality characteristics (acidity, peroxide values, K232, K270, oxidative stability and chemical compositional data (fatty acids, sterols and triacylglycerols were studied in virgin olive oil samples from olive trees, cv Koroneiki, subjected to different water regimes. Experimental trials were carried out using three-year old own-rooted olive trees (Olea europaea L variety Koroneiki. Plants were subjected to two irrigation treatments to maintain soil water potential to -0.03 MPa and -1.5 MPa. Results showed that irrigation significantly increased the fruit oil content and the oxidative stability and peroxide value of the resulting oil. Olive oil from fruits of irrigated trees showed significant higher values in total saturated fatty acids. Total sterols were also significantly influenced by irrigation. Acidity and specific absorption coefficients K232, K270, of olive oils were not significantly affected.Se han estudiado los valores de calidad reglamentada (acidez, índice de peróxido, los valores de absorbancia en UV (K270, K232, estabilidad oxidativa media en Rancimat 120ºC y características químicas (ácidos grasos, esteroles, triglicéridos en aceite de oliva virgen variedad Koroneiki sometidos a diferentes regímenes hídricos. El estudio se ha realizado en árboles adultos de 3 años cultivados en contenedor al aire libre. Los árboles se riegan con dos dosis tratando de mantener un potencial de agua en el suelo de unos -0,03 Mpa y -1,5 Mpa. Los resultados muestran en los olivos de riego un aumento significativo de la riqueza grasa y de la estabilidad del aceite. Los aceites producidos en olivos de riego presentan una mayor proporción de ácidos grasos saturados (palmítico-esteárico. Los esteroles totales se ven significativamente influenciados por el riego. Acidez y absorbancia K270, K232 no se han visto afectados por el riego.

  6. SU-F-E-20: A Mathematical Model of Linac Jaw Calibration Integrated with Collimator Walkout

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Y; Corns, R; Huang, V [Fraser Valley Cancer Centre - BC Cancer Agency, Surrey, BC (United Kingdom)

    2016-06-15

    Purpose: Accurate jaw calibration is possible, but it does not necessarily achieve good junctions because of collimator rotation walkout. We developed a mathematical model seeking to pick an origin for calibration that minimizes the collimator walkout effect. Methods: We use radioopaque markers aligned with crosshair on the EPID to determine the collimator walkout at collimator angles 0°, 90° and 270°. We can accurately calibrate jaws to any arbitrary origin near the radiation field centre. While the absolute position of an origin moves with the collimator walkout, its relative location to the crosshair is an invariant. We studied two approaches to select an optimal origin. One approach seeks to bring all three origin locations (0°–90°–270°) as close as possible by minimizing the perimeter of the triangle formed by these points. The other approach focuses on the gap for 0°–90° junctions. Results: Our perimeter cost function has two variables and non-linear behaviour. Generally, it does not have zero-perimeter-length solution which leads to perfect jaw matches. The zero solution can only be achieved, if the collimator rotates about a single fixed axis. In the second approach, we can always get perfect 0°–0° and 0°–90° junctions, because we ignore the 0°–270° situation. For our TrueBeams, both techniques for selecting an origin improved junction dose inhomogeneities to less than ±6%. Conclusion: Our model considers the general jaw matching with collimator rotations and proposes two potential solutions. One solution optimizes the junction gaps by considering all three collimator angles while the other only considers 0°–90°. The first solution will not give perfect matching, but can be clinically acceptable with minimized collimator walkout effect, while the second can have perfect junctions at the expense of the 0°–270° junctions. Different clinics might choose between these two methods basing on their clinical practices.

  7. Dietary protein and carbohydrate requirement of juvenile Hawaiian limpet (Cellana sandwicensis Pease, 1861 fed practical diet

    Directory of Open Access Journals (Sweden)

    Nhan Thai Hua

    2016-10-01

    Full Text Available Abstract This study was conducted to evaluate dietary protein and carbohydrate requirement of juvenile Hawaiian limpets Cellana sandwincensis. A total of 64 juvenile limpets (3.12 ± 0.86 g were fed five different dietary protein levels ranging from 270 to 470 g kg−1 for 90 days. Carbohydrate and lipid levels were held constant at 180 and 49.7 g kg−1, respectively. Weight gain and growth rates of the animals did not differ significantly (P > 0.05 among the protein levels ranging from 270 g kg−1 (0.30 % day−1 to 470 g kg−1 (0.23 % day−1. Next, opihi were fed four diets with protein levels from 210 to 500 g kg−1 with a constant carbohydrate level at 120 g kg−1. Weight gain and specific growth rates of opihi increased with increasing dietary protein from 210 to 350 g kg−1, and significantly (P < 0.05 decreased at the 500 g kg−1 diet. Highest weight gain, growth rates, and protein efficiency ratio were achieved at 350 g kg−1. Elevated carbohydrate levels (180–370 g kg−1 produced a significant difference (P < 0.05 in growth. The fastest growth rates of animals were obtained with 270 g kg−1 (0.27 % day−1 and 320 g kg−1 (0.26 % day−1. The weight gain of animals fed 180 and 370 g kg−1 carbohydrate diets were significantly (P < 0.05 lower than those of animals fed 270 and 320 g kg−1. We conclude that about 350 g kg−1 protein and 320 g kg−1 carbohydrate levels could be used for opihi.

  8. THE EFFECT OF GREEN TEA LEAF EXTRACT ON SPATIAL MEMORY FUNCTION AND SUPEROXYDE DISMUTASE ENZYME ACTIVITY IN MICE WITH D-GALACTOSE INDUCED DIMENTIA

    Directory of Open Access Journals (Sweden)

    Ainun Rahmasari Gumay

    2017-04-01

    Full Text Available Background: Oxidative stress and inflammation play an important role in pathogenesis of brain aging and neurodegenerative diseases such as Alzheimer. Green tea has been shown to have antioxidant, anti-inflammatory, anticancer, and neuroprotective activity. Objectives: to determine the effect of green tea extract on spatial memory function and superoxide dismutase enzyme activity in mice with D-galactose induced dementia Methods: An experimental study using "post test only control group design". Twenty male BALB/c Mice aged 6-8 weeks were divided into 4 groups. Negative control group (NG was induced by subcutaneous injection of D-galactose (150 mg/kg BW once daily for 6 weeks. GT-90, GT-270, GT-540 were induced by D-galactose and orally administered with 90, 270, and 540 mg/kg BW of green tea extract once daily for 6 weeks. The spatial memory functions were assessed using Morris water maze and SOD enzyme activities were evaluated using ELISA. One-way Anova and Kruskal-Wallis were used for statistical analysis.  Results: mean percentage of latency time in the GT-90 (35.29 (SD= 2.69%, GT-270 (35.28 (SD= 2.62%, and GT-540 (35.62 (SD=5.05% were significantly higher compared to that of NG (20.38 (SD = 3.21%, p <0.05. SOD enzyme activity in the GT-270 (0.78 (SD = 0.07 U/ml was significantly higher compared to that of NG (0.51 (SD = 0.01 U ml, p= 0.004. Conclusion: Green tea extract may improve spatial memory function and the activity of superoxide dismutase enzyme in mice with D-galactose induced dementia.

  9. SU-F-E-20: A Mathematical Model of Linac Jaw Calibration Integrated with Collimator Walkout

    International Nuclear Information System (INIS)

    Zhao, Y; Corns, R; Huang, V

    2016-01-01

    Purpose: Accurate jaw calibration is possible, but it does not necessarily achieve good junctions because of collimator rotation walkout. We developed a mathematical model seeking to pick an origin for calibration that minimizes the collimator walkout effect. Methods: We use radioopaque markers aligned with crosshair on the EPID to determine the collimator walkout at collimator angles 0°, 90° and 270°. We can accurately calibrate jaws to any arbitrary origin near the radiation field centre. While the absolute position of an origin moves with the collimator walkout, its relative location to the crosshair is an invariant. We studied two approaches to select an optimal origin. One approach seeks to bring all three origin locations (0°–90°–270°) as close as possible by minimizing the perimeter of the triangle formed by these points. The other approach focuses on the gap for 0°–90° junctions. Results: Our perimeter cost function has two variables and non-linear behaviour. Generally, it does not have zero-perimeter-length solution which leads to perfect jaw matches. The zero solution can only be achieved, if the collimator rotates about a single fixed axis. In the second approach, we can always get perfect 0°–0° and 0°–90° junctions, because we ignore the 0°–270° situation. For our TrueBeams, both techniques for selecting an origin improved junction dose inhomogeneities to less than ±6%. Conclusion: Our model considers the general jaw matching with collimator rotations and proposes two potential solutions. One solution optimizes the junction gaps by considering all three collimator angles while the other only considers 0°–90°. The first solution will not give perfect matching, but can be clinically acceptable with minimized collimator walkout effect, while the second can have perfect junctions at the expense of the 0°–270° junctions. Different clinics might choose between these two methods basing on their clinical practices.

  10. Factors affecting vaccine handling and storage practices among ...

    African Journals Online (AJOL)

    Objective: Assessing the factors associated with vaccine handling and storage practices. Methods: This was a .... Others include insufficient/unavailable backup refrigerators (52%) .... Human Vaccines 2010; 6(3): 270-278. 5. Joao Carlos de ...

  11. Drug Does Not Improve Set of Cardiovascular Outcomes for Diastolic Heart Failure

    Science.gov (United States)

    ... 270 sites spread across the United States, Canada, Argentina, Brazil, the Republic of Georgia, and Russia. Trial ... The other method required looked at a person's history of heart failure hospitalization within the last year. ...

  12. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8531 ... GrOW briefs: From research to policy ... this research and offer actionable recommendations for decision-maker. ... Economic growth and gender equality ... Although women's labour force participation has increased ...

  13. Granulomatosis with polyangiitis

    Science.gov (United States)

    ... ncbi.nlm.nih.gov/pubmed/21372195 . Specks U, Merkel PA, Seo P, et al. Efficacy of remission- ... PA: Elsevier Saunders; 2016:chap 270. Stone JH, Merkel PA, Spiera R, et al. Rituximab versus cyclophosphamide ...

  14. Deteksi Antibodi terhadap Cysticercus Cellulosae pada Babi Lokal yang Dipotong di Tempat Pemotongan Babi Panjer, Denpasar

    Directory of Open Access Journals (Sweden)

    Ida Bagus Ngurah Swacita

    2016-03-01

    Full Text Available Sistiserkosis merupakan penyakit yang bersifat zoonosis yang disebabkan oleh larva cacing pita Taenia solium yang disebut Cysticercus cellulosae. Di Indonesia terdapat tiga provinsi yang berstatus endemik penyakit sistiserkosis, salah satunya adalah provinsi Bali. Penelitian ini bertujuan untuk mendeteksi antibodi terhadap C. cellulosae pada babi lokal yang dipotong di tempat pemotongan babi Panjer, Denpasar. Sampel penelitian adalah 270 sampel serum babi lokal yang dipotong di tempat pemotongan babi Panjer, Denpasar Selatan. Babi lokal ini berasal dari Nusa Penida, Karangasem dan Negara. Sampel serum diuji dengan metode ELISA (Enzyme Linked Immunosorbent Assay indirect. Hasil penelitian menunjukkan bahwa antibodi C. cellulosae terdeteksi pada 33 sampel. Disimpulkan bahwa terdeteksi antibodi C. cellulosae pada 33 sampel dari 270 sampel serum babi lokal yang dipotong di tempat pemotongan babi Panjer, Denpasar.

  15. Dicty_cDB: Contig-U13887-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available k cognate 70kd protein (44kd atpase n-terminal 270 3e-70 U20256_1( U20256 |pid:none) Ceratitis capitata heat shock-li...io rerio heat shock 70kDa prote... 271 9e-71 NRL( 1NGC ) Heat-shock cognate 70kd protein (44kd atpase n-term...BC041201 |pid:none) Xenopus laevis Heat shock cognate ... 270 2e-70 NRL( 1NGD ) Heat-shock cognate 70kd protein (44kd atpase n-term...hitrite 70kDa heat shoc... 269 4e-70 NRL( 1NGB ) Heat-shock cognate 70kd protein (44kd atpase n-term...( 1NGH ) Heat-shock cognate 70kd protein (44kd atpase n-terminal 268 1e-69 EF655662_1( EF655662 |pid:none) T

  16. 48 CFR 514.270-4 - Grouping line items for aggregate award.

    Science.gov (United States)

    2010-10-01

    ... may have sufficient requirements so that individual shipments involve economic production runs and... franchises in certain territories, grouping different territories could tend to restrict competition. (3...

  17. 17 CFR 270.22c-2 - Redemption fees for redeemable securities.

    Science.gov (United States)

    2010-04-01

    ... holder of an interest in such a trust. (5) Shareholder information agreement means a written agreement... interested persons of the fund, must either: (i) Approve a redemption fee, in an amount (but no more than two... necessary or not appropriate. (2) Shareholder information. With respect to each financial intermediary that...

  18. 17 CFR 270.3a-4 - Status of investment advisory programs.

    Science.gov (United States)

    2010-04-01

    ... basis of the client's financial situation and investment objectives and in accordance with any... regarding the client's financial situation and investment objectives, and gives the client the opportunity... been any changes in the client's financial situation or investment objectives, and whether the client...

  19. : tous les projets | Page 270 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    $ 2,500,000.00. Adaptation aux effets qu'ont les changements climatiques sur les ressources en eau. Projet. Les connaissances sont encore très incomplètes en ce qui a trait aux les conséquences actuelles et possibles des risques liés au ...

  20. 40 CFR 270.25 - Specific part B information requirements for equipment.

    Science.gov (United States)

    2010-07-01

    ..., boiler, process heater, condenser, or carbon adsorption system and chooses to use test data to determine....1033(j). (3) A design analysis, specifications, drawings, schematics, and piping and instrumentation... Administrator that present basic control device information. The design analysis shall address the vent stream...

  1. 24 CFR 213.270 - Supplementary loans; election of action; claims; debentures.

    Science.gov (United States)

    2010-04-01

    ... desires to pursue. (b) Maximum claim period. Notice of intention to file claim on a form prescribed by the... filed on submitting claim. Within 30 days after the filing of the notice of intention to file claim, or...) All records, ledger cards, documents, books, papers and accounts relating to the loan transaction; (10...

  2. 17 CFR 270.3a-8 - Certain research and development companies.

    Science.gov (United States)

    2010-04-01

    ...) Capital preservation investment means an investment that is made to conserve capital and liquidity until the funds are used in the issuer's primary business or businesses; (5) Controlled primarily means...

  3. 40 CFR 270.19 - Specific part B information requirements for incinerators.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM...) When seeking an exemption under § 264.340 (b) or (c) of this chapter (Ignitable, corrosive, or reactive... chapter, solely because it is reactive (Hazard Code R) for characteristics other than those listed in...

  4. 40 CFR 270.15 - Specific part B information requirements for containers.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... ignitable or reactive wastes) and § 264.177(c) (location of incompatible wastes), where applicable. (d...

  5. 48 CFR 213.270 - Use of the Governmentwide commercial purchase card.

    Science.gov (United States)

    2010-10-01

    ... exception for an electronic commerce/electronic data interchange system or operational requirement that... Medical Electronic Catalog Program are two examples where use of the purchase card may not be cost...

  6. Hyperthyroidism treatment by iodine 131: about a study on 270 patients

    International Nuclear Information System (INIS)

    Leroux, M.A.

    2005-01-01

    This study constitutes a starting point for a thought about the use of iodine 131 in the treatment of hyperthyroidism. The therapies are different depending on the teams, for the iodine 131 activities to deliver and their calculation modes; The use of synthesis anti-thyroid drugs before therapy is discussed. The radiation protection is an important factor in the decision of a metabolic radiotherapy. The indications of the treatment by radioactive iodine are different in Europe and in Usa. (N.C.)

  7. Euroopa Liidu 7. Raamprogrammi projekt FLAVOURE / Marge Malbe

    Index Scriptorium Estoniae

    Malbe, Marge, 1968-

    2011-01-01

    2009. a sai Eesti Maaviljeluse Instituut 843,270.00 € suuruse Euroopa Liidu finantseeringu 3 aastat kestva projekti FLAVOURE (Food and Feed Laboratory of Varied and Outstanding Research in Estonia) läbiviimiseks ja koordineerimiseks

  8. 76 FR 49802 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-08-11

    ... reject the selection of the fund's independent public accountant. Rule 32a-4 (17 CFR 270.32a-4) exempts... information unless it displays a currently valid control number. The public may view the background...

  9. Correlates of Weapon Carrying in School among Adolescents in Three Countries

    Czech Academy of Sciences Publication Activity Database

    Stickley, A.; Koyanagi, A.; Koposov, R.; Blatný, Marek; Hrdlička, M.; Schwab-Stone, M.; Ruchkin, V.

    2015-01-01

    Roč. 39, č. 1 (2015), s. 99-108 ISSN 1945-7359 Institutional support: RVO:68081740 Keywords : adolescent * Czech Republic * Russia * United States * weapon carrying Subject RIV: AN - Psychology Impact factor: 1.270, year: 2015

  10. South African Journal of Education - Vol 22, No 4 (2002)

    African Journals Online (AJOL)

    Analysing the role of ICT in bridging the digital divide amongst learners · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Marlien Herselman, K.G. Britton, 270-274 ...

  11. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

  12. Reactive Laser-induced Ablation as Approach to Titanium Oxycarbide Films

    Czech Academy of Sciences Publication Activity Database

    Jandová, Věra; Fajgar, Radek; Dytrych, Pavel; Koštejn, Martin; Dřínek, Vladislav; Kupčík, Jaroslav

    2015-01-01

    Roč. 590, SEP 1 (2015), s. 270-275 ISSN 0040-6090 Institutional support: RVO:67985858 Keywords : IR laser * reactive ablation * titanium ethoxide Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.761, year: 2015

  13. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 369 ... High income inequality in developed countries is attributed to skill-biased ... Resources and Division of Labour along Gender Lines in Veracruz, Mexico ... ICTs for Microcredit Delivery : Correspondent Banking in Brazil.

  14. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  15. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 875 ... In order to maximize learning from IDRC-organized events, ... Exploring the Emerging Impacts of Open Data in Developing Countries network ... data, and shares examples of potential social and economic benefits.

  16. Original Research Article Phytochemical, Proximate and Metal

    African Journals Online (AJOL)

    Erah

    2.80%, fibre 2.70% and fat 1.80% but a relatively high content of ... tolerable upper intake established by the overseeing body. ... multiple organs, including the nervous, cardiovascular, gastro-intestinal, hepatic, renal, and hematologic systems.

  17. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 8494 ... Financial inclusion is an enabler for women's economic empowerment. ... Agency and IDRC, will support 140 doctoral and 60 early career women scientists in ... Addressing the Barriers to Young Women's Economic ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 270 ... ... A Ten-year Period of Daily Sea Surface Temperature at a Coastal ... anthropogenic habitat modification around an East African estuary, Abstract PDF ... Development of the Mangrove Crab Parasesarma catenata Ortman, ...

  19. Post-brooding management of local guinea fowls ( Numida meleagris )

    African Journals Online (AJOL)

    Amposem, I Adam. Abstract. No abstract. Bulletin of Animal Health and Production in Africa Vol. 54 (4) 2006: pp. 270-276. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 270 ... Western Indian Ocean Journal of Marine Science. ... effective light trap for sampling tropical fish and crustacean larvae, Abstract PDF ... of Glutamate Dehydrogenase from the Marine Red Alga Gracilaria sordida (Harv.) ...

  1. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 282 ... Gender, International Law and Justice : Access to Gender Equality ... Culture and the Exercise of Decision Making by Women in West Africa ... in economic, political and social decision-making, and weak participation.

  2. A scent shield to survive: identification of the repellent compounds secreted by the male offspring of the cuckoo bumblebee Bombus vestalis

    Czech Academy of Sciences Publication Activity Database

    Lhomme, P.; Ayasse, M.; Valterová, Irena; Lecocq, T.; Rasmont, P.

    2015-01-01

    Roč. 157, č. 3 (2015), s. 263-270 ISSN 0013-8703 Institutional support: RVO:61388963 Keywords : Hymenoptera * Apidae * Psithyrus * social parasitism * repellent * GC-EAD * chemical camouflage Subject RIV: EG - Zoology Impact factor: 1.442, year: 2015

  3. Determination of mercury and selenium in consumed food items in Libya using instrumental and radiochemikal NAA

    Czech Academy of Sciences Publication Activity Database

    Alamin, M. B.; Bejey, A.M.; Kučera, Jan; Mizera, Jiří

    2006-01-01

    Roč. 270, č. 1 (2006), s. 143-146 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : mercury * selenium * food items Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.509, year: 2006

  4. Võstavka sprovotsirovala skandal

    Index Scriptorium Estoniae

    2008-01-01

    Prantsuse fotograafi Andre Zucca (1897-1973) fotonäitus "Les Parisiens sous lѫOccupation" näitab natsiokupatsiooni aegset Pariisi elu. 270 värvifotot on eksponeeritud Pariisi raekojas (Bibliotheque Historique de la Ville of Paris)

  5. Knowledge and Perceptions of Date Rape among Female ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    to collect data. Knowledge .... The basic steps in the data gathering process ... Book. Newspaper. Radio. Lecture. Internet. Church/Mosque. Parents. 295. 270 .... Ladies/girls who love to demand material things from men and yet do not want.

  6. 42 CFR 84.1147 - Silica mist test for dust, fume, and mist respirators; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... shall be ground to pass 99+ percent through a 270-mesh sieve. (e) Samples of the test suspension will be taken during each test period for analysis. (f) The total amount of silica mist unretained in the...

  7. 40 CFR Appendix B to Part 97 - Final Section 126 Rule: Non-EGU Allocations, 2004-2007

    Science.gov (United States)

    2010-07-01

    ... MOBIL OIL CORPORATION 55006 027 0 NJ Gloucester MOBIL OIL CORPORATION 55006 270 14 NJ Monmouth NESTLE CO., INC., THE 20004 006 13 NJ Monmouth NESTLE CO., INC., THE 20004 007 13 NJ Middlesex NEW JERSEY STEEL...

  8. Fermentative digestion in the ostrich (Struthio camelus var ...

    African Journals Online (AJOL)

    Analytical. VFA concentrations in the samples were determined by gas ... Column temperature was programmed ... hindgut of the ostriches was calculated assuming combustion ... (270 mCi/mmol) and [U_14C]-acetate (57.9 mCi/mmol) were.

  9. Meče 11.-13. století z území Moravy

    Czech Academy of Sciences Publication Activity Database

    Žákovský, P.; Hošek, Jiří; Sedláčková, L.

    2013-01-01

    Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. ballistic performance of a quenched and tempered steel against

    African Journals Online (AJOL)

    eobe

    was investigated. Low alloy steel ... obliquity obliquity with a projectile velocity with a projectile velocity with a projectile .... quenching on low carbon and alloyed steel [5, 15]. Several studies .... Mars 190, Mars 240, Mars 270, Creusot-Loire,.

  11. Echocardiographic diagnosis of rare pathological patterns of sinus of Valsalva aneurysm.

    Directory of Open Access Journals (Sweden)

    Yali Yang

    Full Text Available To evaluate the value and improve the diagnostic accuracy of echocardiography in the diagnosis of a sinus of Valsalva aneurysm (SVA with rare pathological patterns.Echocardiographic features and surgical findings from 270 Chinese patients with SVA treated in the last 18 years (1995-2013 at the Union Hospital were compared retrospectively; 22 of 270 cases had rare patterns.The patients with SVA, a rare origin, a rare extending position, or a rare course accounted for 3.4%, 7.4%, and 0.4% of the 270 cases, respectively. The three most common aneurysmal complications of the patients with rare patterns were severe aortic regurgitation (16, obstruction of the ventricular outflow tract or valvular orifice (3, and conduction disturbance (3. The origin, course, extending position and rupture status of the SVAs determined by echocardiography were entirely consistent with surgical findings in 81.8% of the 22 cases. With the exception of one failed diagnosis of an aneurysmal wall dissection and one misdiagnosis of a descending aortic dissection, the echocardiographic results of SVA complications and associated cardiovascular lesions were also confirmed.We could accurately diagnose SVAs with rare pathological patterns by echocardiographic identification of distinguishing features. However, for several conditions, we could not accurately identify the origin or course of the aneurysm or define its relationship to adjacent structures using conventional echocardiography alone. Therefore, we recommend combining conventional echocardiography with different imaging techniques, such as transesophageal echocardiography, three-dimensional echocardiography, computed tomography angiography, and aortic angiography.

  12. Directory of Open Access Journals (Sweden)

    Pola Becerril-Montes

    2013-04-01

    Full Text Available The resistance of 139 Mycobacterium tuberculosis (MTB isolates from the city of Monterrey, Northeast Mexico, to first and second-line anti-TB drugs was analysed. A total of 73 isolates were susceptible and 66 were resistant to anti-TB drugs. Monoresistance to streptomycin, isoniazid (INH and ethambutol was observed in 29 cases. Resistance to INH was found in 52 cases and in 29 cases INH resistance was combined with resistance to two or three drugs. A total of 24 isolates were multidrug-resistant (MDR resistant to at least INH and rifampicin and 11 MDR cases were resistant to five drugs. The proportion of MDR-TB among new TB cases in our target population was 0.72% (1/139 cases. The proportion of MDR-TB among previously treated cases was 25.18% (35/139 cases. The 13 polyresistant and 24 MDR isolates were assayed against the following seven second-line drugs: amikacin (AMK, kanamycin (KAN, capreomycin (CAP, clofazimine (CLF, ethionamide (ETH, ofloxacin (OFL and cycloserine (CLS. Resistance to CLF, OFL or CLS was not observed. Resistance was detected to ETH (10.80% and to AMK (2.70%, KAN (2.70% and CAP (2.70%. One isolate of MDR with primary resistance was also resistant to three second-line drugs. Monterrey has a high prevalence of MDR-TB among previously treated cases and extensively drug-resistant-MTB strains may soon appear.

  13. A population-based study of first and second-line drug-resistant tuberculosis in a high-burden area of the Mexico/United States border

    Directory of Open Access Journals (Sweden)

    Pola Becerril-Montes

    2013-04-01

    Full Text Available The resistance of 139 Mycobacterium tuberculosis (MTB isolates from the city of Monterrey, Northeast Mexico, to first and second-line anti-TB drugs was analysed. A total of 73 isolates were susceptible and 66 were resistant to anti-TB drugs. Monoresistance to streptomycin, isoniazid (INH and ethambutol was observed in 29 cases. Resistance to INH was found in 52 cases and in 29 cases INH resistance was combined with resistance to two or three drugs. A total of 24 isolates were multidrug-resistant (MDR resistant to at least INH and rifampicin and 11 MDR cases were resistant to five drugs. The proportion of MDR-TB among new TB cases in our target population was 0.72% (1/139 cases. The proportion of MDR-TB among previously treated cases was 25.18% (35/139 cases. The 13 polyresistant and 24 MDR isolates were assayed against the following seven second-line drugs: amikacin (AMK, kanamycin (KAN, capreomycin (CAP, clofazimine (CLF, ethionamide (ETH, ofloxacin (OFL and cycloserine (CLS. Resistance to CLF, OFL or CLS was not observed. Resistance was detected to ETH (10.80% and to AMK (2.70%, KAN (2.70% and CAP (2.70%. One isolate of MDR with primary resistance was also resistant to three second-line drugs. Monterrey has a high prevalence of MDR-TB among previously treated cases and extensively drug-resistant-MTB strains may soon appear.

  14. Subsurface ammonium maxima in northern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Satyanarayana, D.; Sahu, S.D.; Panigrahy, P.K.; Sarma, V.V.; Suguna, C.

    environments: The eastern tropical North Pacific Ocean and the Cariaco Trench. PhD Thesis, University of California at Los Angeles, 270 pp. Codispoti, L. A. (1981). Temporal nutrient variability in three different upwelling regions. In Coastal Upwelling, ed...

  15. Temperature and 8 MeV electron irradiation effects on GaAs solar cells

    Indian Academy of Sciences (India)

    1Department of Physics, Mangalore Institute of Technology and Engineering, ... strate were irradiated with 1 MeV electrons, they showed high radiation tolerance ... under both forward and reverse bias in the temperature range of 270–315 K ...

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 270 ... Journal of Pharmaceutical and Allied Sciences. ... Vol 14, No 4 (2017), Influence of ampicllin/cloxacilin combination on pharmacokinetics of metformin in type ... effect of polymer type and composition on drug release from ...

  17. Sounding Cratonic Fill in Small Buried Craters Using Ground Penetrating Radar: Analog Study to the Martian Case

    OpenAIRE

    Heggy , Essam; Paillou , Philippe

    2006-01-01

    We report results from a 270 MHz GPR survey performed on a recently discovered impact field in the southwestern Egyptian desert. The investigation suggests the ability of radar techniques to detect small-buried craters and probe their filling

  18. Taxonomic revision of the genus Asellia (Chiroptera: Hipposideridae) with description of a new species from southern Arabia

    Czech Academy of Sciences Publication Activity Database

    Benda, P.; Vallo, Peter; Reiter, A.

    2011-01-01

    Roč. 13, č. 2 (2011), s. 245-270 ISSN 1508-1109 Institutional research plan: CEZ:AV0Z60930519 Keywords : Asellia * morphology * morphometry * mtDNA * taxonomy * phylogeny Subject RIV: EG - Zoology Impact factor: 1.116, year: 2011

  19. Rapeseed oil as feedstock for high functionality polyol synthesis

    Czech Academy of Sciences Publication Activity Database

    Kirpluks, M.; Kalnbunde, D.; Walterová, Zuzana; Cabulis, U.

    2017-01-01

    Roč. 5, 3-4 (2017), s. 258-270 ISSN 2164-6325 Institutional support: RVO:61389013 Keywords : polyols * polyurethane foams * renewable raw materials Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.812, year: 2016

  20. ORF Alignment: NC_000853 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

  1. Publications | Page 27 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 7331 ... ... to build local capacity through funding, knowledge sharing, and training. ... Use of Mobile Phones by the Rural Poor: Gender perspectives from ... as a result of changes in diet, nutrition, and physical activity levels.

  2. Riccioli Revisited. A New Analysis of Giovanni Battista Riccioli’s New Almagest

    Directory of Open Access Journals (Sweden)

    Anna-Luna Post

    2016-09-01

    Full Text Available Review of: Christopher M. Graney, Setting Aside All Authority. Giovanni Battista Riccioli and the Science against Copernicus in the Age of Galileo, University of Notre Dame Press, 2015, 270 p., ill., ISBN: 9780268029883, $29.00.

  3. Lockerbie protsess: kas sõltumatu, väärikas ja üdini õiglane? / John P. Grant

    Index Scriptorium Estoniae

    Grant, John P.

    2013-01-01

    Lockerbie kohal Edela-Šotimaal 1988. aasta detsembris toimunud Pan Ami lennu 103 sabotaažist, mille tagajärjel hukkus 270 inimest. Massimõrva toimepanemises süüdistatavate kohtuprotsessist ja hinnangust Šotimaa õigussüsteemile

  4. An investigation of fatigue in LIGA Ni MEMS thin films

    International Nuclear Information System (INIS)

    Allameh, S.M.; Lou, J.; Kavishe, F.; Buchheit, T.; Soboyejo, W.O.

    2004-01-01

    This paper presents results of an experimental study of fatigue in LIGA Ni micro-electro-mechanical systems (MEMS)/thin films produced by electroplating from a sulfamate bath at a current density of 50 mA/cm 2 . Following a brief description of microstructure and micro-tensile properties, the results of stress-life (S-N) experiments are presented for specimens with thicknesses of 70 and 270 μm. Specimens with the thicker cross-sections (270 μm thick) are shown to have comparable fatigue resistance to annealed bulk Ni in the as-plated condition. The thinner specimens (70 μm thick) have comparable fatigue resistance to hardened Ni, and better fatigue resistance than the thicker samples. The underlying fatigue fracture modes are elucidated via scanning electron microscopy. The implications of the results are then discussed for the failure analysis of LIGA Ni MEMS structures

  5. Gas-liquid equilibrium in mixtures of methane + m-xylene, and methane + m-cresol

    Energy Technology Data Exchange (ETDEWEB)

    Simnick, J J; Sebastian, H M; Lin, H M; Chao, K C

    1979-01-01

    Compositions of saturated equilibrium liquid and vapor phases as determined in a flow apparatus for methane + m-xylene mixtures at 370/sup 0/, 450/sup 0/, 520/sup 0/, and 600/sup 0/F (190/sup 0/, 230/sup 0/, 270/sup 0/, and 310/sup 0/C) and up to 200 atm, and for methane + m-cresol at 370/sup 0/, 520/sup 0/, 660/sup 0/, and 730/sup 0/F (190/sup 0/, 270/sup 0/, 350/sup 0/, and 390/sup 0/C) and up to 250 atm. Compared with published data on its solubility in benzene, methane appears to be more soluble in m-xylene at similar conditions but substantially less soluble in m-cresol. This difference indicates that the functional groups CH/sub 3/ and OH play different roles in determining the solubility of methane.

  6. 78 FR 64200 - Caribbean Fishery Management Council; Public Meetings

    Science.gov (United States)

    2013-10-28

    ... Caribbean Fishery Management Council's (Council) Scientific and Statistical Committee (SSC) will hold... Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries Service (NMFS), National... held at the Caribbean Fishery Management Council Headquarters, located at 270 Mu[ntilde]oz Rivera...

  7. Tvarohomakový koláč

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Ivana

    2006-01-01

    Roč. 89, č. 5 (2006), s. 270-272 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET200610406 Institutional research plan: CEZ:AV0Z90610518 Keywords : adjectives * word formation * orthography Subject RIV: AI - Linguistics

  8. Women between a new marriage and an independent position: rural widows in Bohemia in the first half of the nineteenth century

    Czech Academy of Sciences Publication Activity Database

    Velková, Alice

    15 2010, č. 3 (2010), s. 255-270 ISSN 1081-602X Institutional research plan: CEZ:AV0Z80150510 Keywords : Widowhood * Remarriage * 19th century Bohemia * Rural family Subject RIV: AB - History Impact factor: 0.595, year: 2010

  9. "Praemium Imperiale" laureaadid / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2001-01-01

    Jaapani printsi Hitachi ja Japan Arts Associationi ühiselt väljaantavad preemiad (ca 270 000 Saksa marka) said prantsuse arhitekt Jean Nouvel, korea maalikunstnik Lee Ufan, ungari skulptor Martan Pan, USA helilooja Ornette Colema ja dramaturg Arthur Miller.

  10. Evaluation of microlithographic performance of 'deep UV' resists ...

    Indian Academy of Sciences (India)

    demand newer resists for high resolution geometry. A great deal of ... the wavelength of exposure, emissions of high-pressure mercury lamps ... liquid BHMC. 2.70 g of ..... 28 2611. 23. Sebenik A, Lapanje S 1975 J. Chromatography 106 454.

  11. Geology of the V28 Quadrangle: Hecate Chasma, Venus

    Science.gov (United States)

    Stofan, E. R.; Guest, J. E.; Brian, A. W.

    2000-01-01

    The Hecate Chasma Quadrangle (V28), mapped at 1:5,000,000 scale, extends from 0-25 N and 240-270 Longitude. The quadrangle has thirteen impact craters, several large volcanoes, many coronae, three chasmata, and northern Hinemoa Planitia.

  12. Habitat requirements of the long-tailed ground squirrel (Spermophilus undulatus) in the southern Altai

    Czech Academy of Sciences Publication Activity Database

    Řičánková, V.; Fric, Zdeněk; Chlachula, J.; Šťastná, P.; Faltýnková, A.; Zemek, František

    2006-01-01

    Roč. 270, - (2006), s. 1-8 ISSN 0952-8369 Institutional research plan: CEZ:AV0Z60870520 Keywords : Spermophilus undulatus * Altai mountains * habitat selection * predation risk * grazing Subject RIV: EH - Ecology, Behaviour Impact factor: 1.413, year: 2006

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 270 ... ... Estimation of Folate (Vitamin B9) in fresh Lactuca sativa (Lettuce), Spinancia ... Evaluation of the microbiological quality and stability of folic acid ... Health status and pregnancy experience of pregnant women in a rural ...

  14. H2O synthesis, crystal structure, experimental and theoretical stu

    Indian Academy of Sciences (India)

    2018-03-22

    Mar 22, 2018 ... and diphosphopentamolybdates (abbreviated as {P2Mo5}), included in this .... Each Mo atom is surrounded by six oxygen atoms. The. Mo–O .... limit value of absorption (270 nm) the optical energy gap (Eg) was calculated ...

  15. New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.

    2013-01-01

    Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  16. Has the ultimate state of turbulent thermal convection been observed?

    Czech Academy of Sciences Publication Activity Database

    Skrbek, L.; Urban, Pavel

    2015-01-01

    Roč. 785, DEC (2015), s. 270-282 ISSN 0022-1120 R&D Projects: GA ČR GA14-02005S Institutional support: RVO:68081731 Keywords : turbulent convection * turbulent flows Subject RIV: BK - Fluid Dynamics Impact factor: 2.514, year: 2015

  17. : tous les projets | Page 606 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: NATURAL DISASTERS, EARLY WARNING SYSTEMS, ACCESS TO INFORMATION, COASTS, LITTORAL ZONES, MANGROVES, REFORESTATION, SHELTERBELTS. Région: India, Sri Lanka, Central Asia, Far East Asia, South Asia. Programme: Économies en réseaux. Financement total : CA$ 3,485,270.00.

  18. High capacity hydrogen storage nanocomposite materials

    Science.gov (United States)

    Zidan, Ragaiy; Wellons, Matthew S.

    2017-12-12

    A novel hydrogen absorption material is provided comprising a mixture of a lithium hydride with a fullerene. The subsequent reaction product provides for a hydrogen storage material which reversibly stores and releases hydrogen at temperatures of about 270.degree. C.

  19. Blood parasites in northern goshawk (Accipiter gentilis) with an emphasis to Leucocytozoon toddi

    Czech Academy of Sciences Publication Activity Database

    Hanel, J.; Doležalová, J.; Stehlíková, Š.; Modrý, David; Chudoba, J.; Synek, P.; Votýpka, Jan

    2016-01-01

    Roč. 115, č. 1 (2016), s. 263-270 ISSN 0932-0113 Institutional support: RVO:60077344 Keywords : avian blood parasites * Haemosporida * Trypanosoma * PCR detection * birds of prey * raptors * mixed infection Subject RIV: EG - Zoology Impact factor: 2.329, year: 2016

  20. Ameliorative effects of ascorbic acid on rectal temperature ...

    African Journals Online (AJOL)

    Jane

    2011-08-29

    Aug 29, 2011 ... On day 1 post-transportation, the control rabbits lost 2.70% of the pre- transportation ... the adverse effects of stress due to road transportation. Key words: ... Besides, management strate-gies aimed at alleviating stress due to ...

  1. Towards supported bolaamphiphile membranes for water filtration: Roles of lipid and substrate

    NARCIS (Netherlands)

    Kaufman, Y.; Grinberg, S.; Linder, C..; Heldman, E.; Gilron, J.; Shen, Yue-xiao; Kumar, M.; Lammertink, Rob G.H.; Freger, V.

    2014-01-01

    Supported biomimetic membranes hold potential for applications such as biosensors and water purification by filtration. The current paper reports on the preparation of a supported bolaamphiphile membrane on two polymeric nanofiltration membranes: NF-270 made of polyamide with carboxylic surface

  2. Letopis na cestě ke kronice. Počátky beletrizace analistického textu

    Czech Academy of Sciences Publication Activity Database

    Černá, Alena M.

    2012-01-01

    Roč. 4, č. 2 (2012), s. 259-270 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Old Bohemian Annals * Old Czech * historical stylistics Subject RIV: AI - Linguistics

  3. : tous les projets | Page 420 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TRADITIONAL MEDICINE, MEDICINAL PLANTS, INDIGENOUS KNOWLEDGE, SMALL ENTERPRISES. Région: Belize, North and Central America, South America. Programme: Fondements pour l'innovation. Financement total : CA$ 49,270.00. Projet Itzama : développement durable d'une communauté autochtone ...

  4. Impact of video-endoscopy on the results of retrosigmoid-transmeatal microsurgery of vestibular schwannoma: prospective study

    Czech Academy of Sciences Publication Activity Database

    Chovanec, M.; Zvěřina, E.; Profant, Oliver; Skřivan, J.; Čakrt, O.; Lisý, J.; Betka, J.

    2013-01-01

    Roč. 270, č. 4 (2013), s. 1277-1284 ISSN 0937-4477 Grant - others:GA MZd(CZ) NS9909 Institutional support: RVO:68378041 Keywords : vestibular schwannoma * acoustic neuroma * endoscopy-assisted microsurgery Subject RIV: FH - Neurology Impact factor: 1.608, year: 2013

  5. Is hybridization involved in the evolution of the Chenopodium album aggregate? An analysis based on chromosome counts and genome size estimation

    Czech Academy of Sciences Publication Activity Database

    Mandák, Bohumil; Trávníček, Pavel; Paštová, Ladislava; Kořínková, Dana

    2012-01-01

    Roč. 270, č. 7 (2012), s. 530-540 ISSN 0367-2530 R&D Projects: GA ČR GA206/09/1126 Institutional support: RVO:67985939 Keywords : Chenopodium * hybridization * polyploidization Subject RIV: EF - Botanics Impact factor: 1.716, year: 2012

  6. 76 FR 66965 - Treasure Coast Specialty Pharmacy Decision and Order

    Science.gov (United States)

    2011-10-28

    ... standards applied to an indictment at common law.'' Citizens State Bank of Marshfield v. FDIC, 751 F.2d 209...,403 (DEA 2011) (citing Goldberg, 397 U.S. at 270 (quoting Greene v. McElroy, 360 U.S. 474, 496 (1959...

  7. Afspraken voor het uitwisselen en hergebruik van onderwijsmateriaal

    NARCIS (Netherlands)

    Manderveld, Jocelyn

    2005-01-01

    Manderveld, J. (2004) Afspraken voor het uitwisselen en hergebruik van onderwijsmateriaal. In: Gorissen, P., Manderveld, J., Benneker, F. & Cordewener, B. Leertechnologie in de Lage Landen (pp. 17-19). Utrecht, Stichting Surf. Ook beschikbaar in dspace: http://hdl.handle.net/1820/270

  8. Excessive extrapolations in cosmology

    Czech Academy of Sciences Publication Activity Database

    Křížek, Michal; Somer, L.

    2016-01-01

    Roč. 22, č. 3 (2016), s. 270-280 ISSN 0202-2893 Institutional support: RVO:67985840 Keywords : cosmology * friedmann equation Subject RIV: BA - General Mathematics Impact factor: 0.734, year: 2016 http://link.springer.com/article/10.1134%2FS0202289316030105

  9. Emotional Strategies and Their Relationship to Complaints of Psychosomatic and Neurotic Symptoms.

    Science.gov (United States)

    Ogden, Jenni A.; Von Sturmer, Guy

    1984-01-01

    Examined the emotional strategies people use and their psychological consequences. Adults (N=270 and 329) were classified into emotional strategy groups. Suppressed emotives had a significantly higher score on the Complaint Questionnaire than emotive and nonemotive groups, suggesting neurotic tendencies. (JAC)

  10. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Research Article Volume 94 Issue 2 June 2015 pp 261-270 ... North Carolina design III (NCIII) is one of the most powerful and widely used mating designs ... However, the quantitative trait mapping (QTL) conducted in previous studies with this ...

  11. Chemsearch Journal Volume 4 Number 1, June, 2013

    African Journals Online (AJOL)

    Magashi

    2013-06-01

    Jun 1, 2013 ... for human consumption either at meal or leisure times (Ogah and ... presence of CO2 gas or other ... plants species (Andrews et al., 2007; Wanyika et al., 2010; Violeta et ... highest absorption value at 270nm.Standard linear.

  12. mos119_0601a.tif-- Side scan sonar image from survey effort HMPR-119-2006-01a in the Olympic Coast national marine sanctuary.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This side scan sonar imagery of the sea floor (90-270 m water depths) was mosaiced from acoustic data collected in April 2006 aboard the NOAA ship McArthurII.A Klein...

  13. Seed germination and seedling vigour of italian ryegrass, cocksfoot and timothy following harvest and storage Germinação de sementes e o vigor de plantas jovens de azevem italiano, dactilis e timóteo após a colheita e o armazenamento

    Directory of Open Access Journals (Sweden)

    Rade Stanisavljevic

    2011-12-01

    Full Text Available During post-harvest maturation, different species vary in the length of dormancy breaking or germination increases. Seed dormancy and slow seedling development often limit establishment of forage grass stands. Seed germination and seedling vigour of Italian ryegrass (Lolium italicum A. Braun, Synonym Lolium multiflorum L., cocksfoot (Dactylis glomerata L. and timothy (Phleum pretense L. were observed after harvest and storage. After harvest in June, seeds were stored under standard storage conditions and sampled every 30 days after harvest (DAH, up to 270 DAH, and then every 60 days up to 990 DAH. At each date, seeds were tested for final germination percentage and for seedling vigour traits. Timothy seeds had a maximum germination (88% and the best seedlings vigour at 90 DAH, which implies that early autumn (September-October is the best sowing period for freshly harvested seeds of timothy. Timothy seed germination was poor from 270 DAH (73%. The best germination and vigour of Italian ryegrass and cocksfoot seedlings were between 270 and 330 DAH, which equates to spring sowing time (March-April in the succeeding year. Cocksfoot and Italian ryegrass seeds maintained satisfactory germination levels up to 630 DAH (81% and 810 DAH (81%, respectively. The data can serve for the determination of a proper storage duration management between harvest and sowing of the tested species under ambient conditions of south-eastern Europe.Durante o armazenamento, diferentes espécies comportam-se diferentemente quanto à dormência e crescimento de plântulas. A dormência o desenvolvimento lento das plântulas limitam a época do plantio das gramíneas forrageiras plurianuais. A germinação de sementes e o crescimento das plântulas de azevem italiano (Lolium italicum A. Braun sin. Lolium multiflorum L., Dactilis (Dactilis glomerata L. e de timoteo (Phleum pratense L. foi pesquisada durante a maturação pós-colheita e a silagem. Após a colheita, em junho

  14. Removal of heavy metals from aluminum anodic oxidation wastewaters by membrane filtration.

    Science.gov (United States)

    Ates, Nuray; Uzal, Nigmet

    2018-05-27

    Aluminum manufacturing has been reported as one of the largest industries and wastewater produced from the aluminum industry may cause significant environmental problems due to variable pH, high heavy metal concentration, conductivity, and organic load. The management of this wastewater with a high pollution load is of great importance for practitioners in the aluminum sector. There are hardly any studies available on membrane treatment of wastewater originated from anodic oxidation. The aim of this study is to evaluate the best treatment and reuse alternative for aluminum industry wastewater using membrane filtration. Additionally, the performance of chemical precipitation, which is the existing treatment used in the aluminum facility, was also compared with membrane filtration. Wastewater originated from anodic oxidation coating process of an aluminum profile manufacturing facility in Kayseri (Turkey) was used in the experiments. The characterization of raw wastewater was in very low pH (e.g., 3) with high aluminum concentration and conductivity values. Membrane experiments were carried out with ultrafiltration (PTUF), nanofiltration (NF270), and reverse osmosis (SW30) membranes with MWCO 5000, 200-400, and 100 Da, respectively. For the chemical precipitation experiments, FeCl 3 and FeSO 4 chemicals presented lower removal performances for aluminum and chromium, which were below 35% at ambient wastewater pH ~ 3. The membrane filtration experimental results show that, both NF and RO membranes tested could effectively remove aluminum, total chromium and nickel (>90%) from the aluminum production wastewater. The RO (SW30) membrane showed a slightly higher performance at 20 bar operating pressure in terms of conductivity removal values (90%) than the NF 270 membrane (87%). Although similar removal performances were observed for heavy metals and conductivity by NF270 and SW30, significantly higher fluxes were obtained in NF270 membrane filtration at any pressure

  15. 超声监测药物流产的临床指导作用

    Institute of Scientific and Technical Information of China (English)

    李伟华

    2014-01-01

    Objective Of uterus before and after medical abortion for effective ultrasonic monitoring, according to the uterine cavity ultrasonography image is different, choose different treatment plan. Methods The hospital 270 cases of drug abortion patients before and after the abortion of ultrasonic monitoring, and the evaluation results.Results In 270 cases of drug abortion patients, 238 cases of success, incomplete medical abortion 22 cases, medical abortion failure in 5 cases;Abortion failure patients according to the uterine cavity ultrasound echo how much to give different treatment.Conclusion Ultrasound can not only to monitor the whole process of medical abortion, can also according to the blood flow characteristics of uterine bleeding after medical abortion, for clinical analysis provides the reference for the reasons of bleeding after medical abortion time extended, and according to the womb ultrasound images to guide clinical treatment.%目的:为了减少不全流产的发生率,准确的评价超声在药物流产中的作用,并选择不同的治疗方案。方法对270例药物流产患者流产前后进行超声监测并对效果进行评估。结果270例中流产成功238例,流产不全22例,流产失败5例;流产失败患者根据超声所见宫内回声多少给予不同的处理。结论超声不仅能对药物流产的全过程进行监测,还可根据药物流产后出血的子宫的血流特点,为临床分析药物流产后出血时间延长的原因提供依据,并可根据子宫内超声图像指导临床治疗。

  16. Aplicación de la espectrofotometría UV-visible al estudio de la estabilidad térmica de aceites vegetales comestibles

    Directory of Open Access Journals (Sweden)

    Molero Meneses, M.

    2000-12-01

    Full Text Available The thermal s tabi l i ty of three ol ive oils of different characteristics, under atmosphere of air, nitrogen and oxygen has been studied, by means of simultaneous thermal analysis (TG-TGDUV-visible spectrophotometry. The specific extinction coefficient values of the oils at 232 and 270 nm were calculated at different temperatures from room temperature to those corresponding to the 10% of the thermogravimetric curve. The results show the negative influence of the temperature and the oxidant atmosphere on the thermal stability of the oils; this is verified by the increase of the coefficients K232 and K270 and by the decreasing of the degradation beginning temperature under such atmospheres, compared with the results obtained under inert atmosphere. On the other hand, in this work is made evident a high correlation between the obtained data from thermal analysis and those obtained from UV-visible spectrophotometry.Se estudia la estabilidad térmica de tres aceites de oliva de distintas características, en atmósfera de aire, oxígeno y nitrógeno, mediante la combinación de las técnicas de análisis térmico (TG-TGD y espectrofotometría UV-visible. Para ello se miden los coeficientes de extinción específico a 232 y 270 nm de los aceites a distintas temperaturas, comprendidas entre la temperatura ambiente y la correspondiente al 10% de la curva termogravimétrica. Los resultados muestran la influencia negativa de la temperatura y de la atmósfera oxidante sobre la estabilidad de los aceites, que se manifiesta por el fuerte incremento de los coeficientes K232 y K270, y por el descenso de la temperatura de comienzo de la degradación en dichas atmósferas, comparado con los resultados obtenidos en atmósfera inerte. Por otra parte, en el trabajo se pone de manifiesto una alta correlación entre los datos obtenidos por análisis térmico y los obtenidos por espectrofotometría UV-visible.

  17. Demografía del caracol Plicopurpura pansa (Neotaenioglossa: Muricidae y constitución de la comunidad malacológica asociada en Guerrero, México

    Directory of Open Access Journals (Sweden)

    Rafael Flores-Garza

    2007-12-01

    Full Text Available Estudiamos la demografía de Plicopurpura pansa en Playa Ventura, Guerrero, México, con base en muestreos trimestrales. Su densidad fue de 5.19 caracoles/m². La proporción sexual fue cercana al 1:1. La talla promedio fue de 20.10 mm. Las tallas mejor representadas en hembras fueron de 10.5 a 27.0 mm y en machos de 12.0 a 27.0 mm. La población es de alta densidad y mayor frecuencia de tallas pequeñas. Hubo diferencias entre las tallas promedio de cada muestreo, formándose dos grupos de medias para cada sexo. El peso promedio fue 1.79 g. Las hembras presentaron mayor variación en peso, lo cual podría estar relacionado con el ciclo reproductivo. Hubo reclutamiento en cinco fechas de recolección. El mayor número de cópulas se observaron en marzo de 2001. Se identificaron 26 especies de gasterópodos, siete de bivalvos y una de poliplacóforos. La especie con mayor dominancia fue Brachidontes semilaevis.Demography of the snail Plicopurpura pansa (Neotaenioglossa: Muricidae and constitution of the associated mollusk community, in Guerrero, Mexico. We quarterly sampled the molluskan community of Playa Ventura, Guerrero, Mexico. Sample size (20 m² in 1m² units was determined by the spatial distribution pattern of Plicopurpura pansa using a negative binomial distribution. The density of the P. pansa was 5.19 snails/m² and the sex ratio near 1:1. The average size was 20.10 mm (most females were 10.5 to 27.0 mm; most males 12.0 to 27.0 mm. Density was high and small sized dominated. Mean size varied with time. General mean weight was 1.79 g. Females weight varied more, maybe because of the reproductive cycle. Recruits were collected in five samplings. Most copulation activity was in March of 2001. The associated community includes 26 species of Gastropoda, five of Bivalvia and one of Polyplacophora, Brachidontes semilaevis being dominant. Rev. Biol. Trop. 55 (3-4: 867-878. Epub 2007 December, 28.

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 270 ... Western Indian Ocean Journal of Marine Science. ... Vol 3, No 2 (2004), Motives for Poaching in Marine Protected Areas in the Seychelles, Abstract PDF ... Vol 13, No 2 (2014), Occurrence and vulnerability of a giant sea ...

  19. Learning for Semantic Parsing and Natural Language Generation Using Statistical Machine Translation Techniques

    Science.gov (United States)

    2007-08-01

    individual players to take: Productions Meaning of predicates DIRECTIVE → (do PLAYER ACTION) PLAYER should take ACTION. DIRECTIVE → ( dont PLAYER...Computational Lin- guistics (COLING-ACL-2006), Poster Sessions, pp. 263–270. Sydney, Australia. 170 Daniel Gildea and Daniel Jurafsky (2002

  20. Negative affect as a mediator of the relationship between vigorous-intensity exercise and smoking

    NARCIS (Netherlands)

    Tart, C.D.; Leyro, T.M.; Richter, A.; Zvolensky, M.J.; Smits, J.A.J.

    2010-01-01

    The present cross-sectional study evaluated whether people who engage in vigorous-intensity exercise are better able to regulate negative affective states, thereby changing core maintenance factors of smoking. Participants were a community sample of adults (n = 270) who completed self-report

  1. Intramuscular adrenaline does not reduce the incidence of respiratory distress and hypoglycaemia in neonates delivered by elective caesarean section at term

    DEFF Research Database (Denmark)

    Pedersen, Pernille; Avlund, O L; Pedersen, B L

    2008-01-01

    AIM: To test whether intramuscular injection of 30 microg adrenaline decreased the incidence of respiratory distress and hypoglycaemia in term infants delivered by elective caesarean section before active labour. METHOD: The study was randomised and double-blinded. A total of 270 neonates were...

  2. Technologické využití elektronového svazku

    Czech Academy of Sciences Publication Activity Database

    Zobač, Martin; Zobačová, Jitka; Vlček, Ivan

    2012-01-01

    Roč. 57, č. 10 (2012), s. 270-274 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : focused intense electron beam * welding * machining * heat treatment * surface modifica­tion * engraving * texturing * additive manufactu­ring Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  3. Contractual Alliance Governance: Impact of Different Contract Functions on Alliance Performance

    NARCIS (Netherlands)

    Faems, D.L.M.; Alberink, Rutger; Groen, Arend J.; Klein Woolthuis, Rosalinde

    2010-01-01

    Recent research on alliance governance has emphasized that contracts can have both a control and coordination function. In this paper, we test the impact of these different contract functions on alliance performance. Conducting structural equation analyses on a sample of 270 Dutch technology

  4. Systematic characterisation of disease associated balanced chromosome rearrangements by FISH: cytogenetically and genetically anchored YACs identify microdeletions and candidate regions for mental retardation genes

    DEFF Research Database (Denmark)

    Wirth, J; Nothwang, H G; van der Maarel, S

    1999-01-01

    the Mendelian Cytogenetics Network (MCN), a collaborative effort of, at present, 270 cytogenetic laboratories throughout the world. In this pilot study, we have characterised 10 different MR associated chromosome regions delineating candidate regions for MR. Five of these regions are narrowed to breakpoint...

  5. ZnO/Bi2O3 nanowire composites as a new family of photocatalysts

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Slušná, Michaela; Tolasz, Jakub; Zetková, K.

    2015-01-01

    Roč. 270, Part A (2015), s. 83-91 ISSN 0032-5910 R&D Projects: GA TA ČR TA02010541 Institutional support: RVO:61388980 Keywords : Zinc oxide * Photocatalysis * Bi3+ doping Subject RIV: CA - Inorganic Chemistry Impact factor: 2.759, year: 2015

  6. Methods applied for the characterization of Si:H thin films with embedded nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Stuchlíková, The-Ha; Remeš, Zdeněk; Purkrt, Adam; Stuchlík, Jiří; Král, Karel

    2015-01-01

    Roč. 7, č. 4 (2015), s. 270-274 ISSN 2164-6627 R&D Projects: GA MŠk LH12236 Institutional support: RVO:68378271 Keywords : electrical conductivity * activation energy * CPM * SEM * I - V characteristics * nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism

  7. Message and source factors, market uncertainty and extrafunctional information processing : hypotheses and empirical evidence

    NARCIS (Netherlands)

    Song, X.M.

    2001-01-01

    This article examines how the perceived quality of extrafunctional information improves the innovation management process and contributes to success with innovations. Data collected from 420 Japanese managers and 270 US managers are used to test hypotheses about the antecedents of satisfaction with

  8. Transmission of electrons through Al2O3 nanocapillaries

    DEFF Research Database (Denmark)

    Milosavljević, A.R.; Jureta, J.J.; Víkor, Gy.

    2012-01-01

    We investigate transmission of low-energy electrons (250 eV) through insulating AlO nanocapillaries (270 nm diameter and 15 μm length). Kinetic energy distribution of electrons transmitted through the nanocapillaries in the straightforward direction, time dependence of the transmission rate both...

  9. DOE Matching Grant Program; FINAL

    International Nuclear Information System (INIS)

    Dr Marvin Adams

    2002-01-01

    OAK 270 - The DOE Matching Grant Program provided$50,000.00 to the Dept of N.E. at TAMU, matching a gift of$50,000.00 from TXU Electric. The$100,000.00 total was spent on scholarships, departmental labs, and computing network

  10. IMS Learning Design: De stand van zaken

    NARCIS (Netherlands)

    Tattersall, Colin; Manderveld, Jocelyn

    2005-01-01

    Tattersall, C. & Manderveld, J. (2004) IMS Learning Design: De stand van zaken In: Gorissen, P., Manderveld, J., Benneker, F. & Cordewener, B. Leertechnologie in de Lage Landen (pp. 31-33). Utrecht, Stichting Surf. Ook beschikbaar in dspace: http://hdl.handle.net/1820/270

  11. Retesting with the TRUE Test in a population-based twin cohort with hand eczema

    DEFF Research Database (Denmark)

    Lerbaek, Anne; Kyvik, Kirsten Ohm; Menné, Torkil

    2007-01-01

    Population-based studies on contact allergy with retesting of individuals are infrequently performed. Variable degrees of persistence are reported when individuals with contact allergy are retested with years in between. The patch test results of 270 individuals tested in 2005-2006 are presented ...

  12. Corrosion fatigue behaviour of aluminium 5083-H111 welded using gas metal arc welding method

    CSIR Research Space (South Africa)

    Mutombo, K

    2011-12-01

    Full Text Available Aluminium and its alloys are widely used as engineering materials on account of their low density, high strength-to-weight ratios, excellent formability and good corrosion resistance in many environments. Pure aluminium has a density of only 2.70 g...

  13. Spektrální radiometry pro měření světelných podmínek pro růst rostlin

    Czech Academy of Sciences Publication Activity Database

    Oupický, Pavel

    2006-01-01

    Roč. 51, č. 10 (2006), s. 270-273 ISSN 0447-6441 R&D Projects: GA AV ČR(CZ) 1QS100820502 Institutional research plan: CEZ:AV0Z20430508 Keywords : Radiometer * spectral * plant * growth Subject RIV: BH - Optics, Masers, Lasers

  14. 78 FR 12101 - Importer of Controlled Substances; Notice of Application; Caraco Pharmaceutical Laboratories, LTD.

    Science.gov (United States)

    2013-02-21

    ... DEPARTMENT OF JUSTICE Drug Enforcement Administration Importer of Controlled Substances; Notice of Application; Caraco Pharmaceutical Laboratories, LTD. Pursuant to Title 21 Code of Federal Regulations 1301.34 (a), this is notice that on November 22, 2012, Caraco Pharmaceutical Laboratories, Ltd., 270 Prospect...

  15. Inverse vertical migration and feeding in glacier lanternfish (Benthosema glaciale)

    KAUST Repository

    Dypvik, Eivind

    2011-11-08

    A bottom-mounted upward-facing 38-kHz echo sounder was deployed at ~400 m and cabled to shore in Masfjorden (~60 52?N, ~5 24?E), Norway. The scattering layers seen during autumn (September-October) 2008 were identified by trawling. Glacier lanternfish (Benthosema glaciale) were mainly distributed below ~200 m and displayed three different diel behavioral strategies: normal diel vertical migration (NDVM), inverse DVM (IDVM) and no DVM (NoDVM). The IDVM group was the focus of this study. It consisted of 2-year and older individuals migrating to ~200-270 m during the daytime, while descending back to deeper than ~270 m during the night. Stomach content analysis revealed increased feeding during the daytime on overwintering Calanus sp. We conclude that visually searching glacier lanternfish performing IDVM benefit from the faint daytime light in mid-waters when preying on overwintering Calanus sp. 2011 The Author(s).

  16. Elections to the Senior Staff Advisory Committee (“The Nine”) 2016

    CERN Multimedia

    Malika Meddahi, ex-spokesperson of the Nine

    2016-01-01

    The electronic voting process for the Senior Staff Advisory Committee (“The Nine”) was closed on Monday 22 August 2016 at 23:59.    Of the 544 Senior Staff members eligible to vote, 270 voted. This represents a participation of 50% to be compared to 52% in 2015, to 59% in 2014, 63% in 2013, 61% in 2012, 43% in 2011, 44% in 2010, 57% in 2009, 53% in 2008, 63% in 2007, and 64% in 2006. The results are: Total votes:  270 Valid votes:  268 (of which 4 blanks) Null votes:  2   Electoral group 1 (Research Physicists) Candidate Dept Votes Result David Enterria EP 31   Andreas Hoecker EP 107 ELECTED   Electoral group 2 (Applied Physicists, Engineers, Computer Scientists) Candidate Dept Votes Result Latchezar Betev EP 16   Maria Dimou IT 34   Vittorio Parma TE ...

  17. Evaluation of a type 1 diabetes serum cohort by SELDI-TOF MS protein profiling

    DEFF Research Database (Denmark)

    Albrethsen, J.; Kaas, A.; Schonle, E.

    2009-01-01

    Proteomics analysis of serum from patients with type 1 diabetes (T1D) may lead to novel biomarkers for prediction of disease and for patient monitoring. However, the serum proteome is highly sensitive to sample processing and before proteomics biomarker research serum cohorts should preferably...... be examined for potential bias between sample groups. S ELDI-TOF MS protein profiling was used for preliminary evaluation of a biological-bank with 766 serum samples from 270 patients with T1D, collected at 18 different paediatric centers representing 15 countries in Europe and Japan over 2 years (2000......-2002). Samples collected 1 (n = 270), 6 (n = 248), and 12 (n = 248) months after T1D diagnosis were grouped across centers and compared. The serum protein profiles varied with collection site and day of analysis; however, markers of sample processing were not systematically different between samples collected...

  18. Properties and thermal decomposition of the double salts of uranyl nitrate-ammonium nitrate

    International Nuclear Information System (INIS)

    Notz, K.J.; Haas, R.A.

    1989-01-01

    The formation of ammonium nitrate-uranyl nitrate double salts has important effects on the thermal denitration process for the preparation of UO 3 and on the physical properties of the resulting product. Analyses were performed, and properties and decomposition behavior were determined for three double salts: NH 4 UO 2 (NO 3 ) 3 , (NH 4 ) 2 UO 2 (NO 3 ) 4 , and (NH 4 ) 2 UO 2 (NO 3 ) 4 ·2H 2 O. The tinitrate salt decomposes without melting at 270-300 C to give a γ-UO 3 powder of ∼3-μm average size, with good ceramic properties for fabrication into UO 2 nuclear fuel pellets. The tetranitrate dihydrate melts at 48 C; it also dehydrates to the anhydrous salt. The anhydrous tetranitrate decomposes exothermically, without melting, at 170-270 C by losing one mole of ammonium nitrate to form the trinitrate salt

  19. Effect of Gossypium hirsutum and Ricinus comunis meals in growth and yield of Brassica oleracea var. italica Plenck

    Directory of Open Access Journals (Sweden)

    Juan Francisco Avendaño Mora

    2018-01-01

    Full Text Available Cultivation of broccoli in Equador uses high doses of inorganic nitrogen fertilizers, which cause problems in the soil, the environment and the crop yield itself. In this work organic amendments were applied to Haplustolls soil by implementing the following trial treatments: castor bean meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, cotton seed meal (270 kg N ha-1, 202.5 kg N ha-1, 152 kg N ha-1, and control without organic fertilization. Results confirmed that applications of organic meals made from cotton seed and castor bean had a favorable effect on growth and yield of Broccoli in the canton Riobamba, Chimborazo province, Ecuador. Result gets into the hands of broccoli farmers give new alternatives of organic fertilization to restore physical, chemical and biological properties of the soil and will increase crop yields and help environmental preservation.

  20. Effect of Elevated Temperature Annealing on Nafion/SiO2 Composite Membranes for the All-Vanadium Redox Flow Battery

    Directory of Open Access Journals (Sweden)

    Sixiu Zeng

    2018-04-01

    Full Text Available Conducting Nafion/SiO2 composite membranes were successfully prepared using a simple electrostatic self-assembly method, followed by annealing at elevated temperatures of 240, 270, and 300 °C. Membrane performance was then investigated in vanadium redox flow batteries (VRB. These annealed composite membranes demonstrated lower vanadium permeability and a better selectivity coefficient than pure Nafion membranes. The annealing temperature of 270 °C created the highest proton conductivity in the Nafion/SiO2 composite membranes. The microstructures of these membranes were analyzed using transmission electron microscopy, small-angle X-ray scattering, and positron annihilation lifetime spectroscopy. This study revealed that exposure to high temperatures resulted in an increase in the free volumes of the composite membranes, resulting in improved mechanical and chemical behavior, with the single cell system containing composite membranes performing better than systems containing pure Nafion membranes.

  1. Safety and Efficacy of Ultrasound-Guided Fiducial Marker Implantation for CyberKnife Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae Hyun; Hong, Seong; Sook; Kim, Jung Hoon; Park, Hyun Jeong; Chang, Yun Woo; Chang, A Ram [Soonchunhyang University Seoul Hospital, Seoul (Korea, Republic of); Kwon, Seok Beom [Hallym University College of Medicine, Chuncheon (Korea, Republic of)

    2012-06-15

    To evaluate the safety and technical success rate of an ultrasound-guided fiducial marker implantation in preparation for CyberKnife radiation therapy. We retrospectively reviewed 270 percutaneous ultrasound-guided fiducial marker implantations in 77 patients, which were performed from June 2008 through March 2011. Of 270 implantations, 104 were implanted in metastatic lymph nodes, 96 were in the liver, 39 were in the pancreas, and 31 were in the prostate. During and after the implantation, major and minor procedure-related complications were documented. We defined technical success as the implantation enabling adequate treatment planning and CT simulation. The major and minor complication rates were 1% and 21%, respectively. One patient who had an implantation in the liver suffered severe abdominal pain, biloma, and pleural effusion, which were considered as major complication. Abdominal pain was the most common complication in 11 patients (14%). Among nine patients who had markers inserted in the prostate, one had transient hematuria for less than 24 hours, and the other experienced transient voiding difficulty. Of the 270 implantations, 261 were successful (97%). The reasons for unsuccessful implantations included migration of fiducial markers (five implantations, 2%) and failure to discriminate the fiducial markers (three implantations, 1%). Among the unsuccessful implantation cases, six patients required additional procedures (8%). The symptomatic complications following ultrasound-guided percutaneous implantation of fiducial markers are relatively low. However, careful consideration of the relatively higher rate of migration and discrimination failure is needed when performing ultrasound-guided percutaneous implantations of fiducial markers.

  2. Preliminary estimation of bryophyte biomass and carbon pool from three contrasting different vegetation types

    Czech Academy of Sciences Publication Activity Database

    Singh, M.K.; Juhász, A.; Csintalan, Z.; Kaligaric, M.; Marek, Michal V.; Urban, Otmar; Tuba, Z.

    2005-01-01

    Roč. 33, č. 1 (2005), s. 267-270 ISSN 0133-3720 Grant - others:EU(CZ) HPRI-CT-2002-00197 Institutional research plan: CEZ:AV0Z60870520 Keywords : bryophyte * carbon pool * rain forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.320, year: 2005

  3. Sandpit lakes vegetation in the Třeboň biosphere reserve: effect of anthropogenic activities

    Czech Academy of Sciences Publication Activity Database

    Křiváčková, O.; Pecharová, E.; Čížková, Hana

    2006-01-01

    Roč. 25, č. 3 (2006), s. 270-281 ISSN 1335-342X Institutional research plan: CEZ:AV0Z60870520 Keywords : Sandpit lakes * vegetation * succession * Illecebrum verticillatum * Lycopodiella inundata * Drosera rotundifoia * Lysimachia thyrsiflora Subject RIV: EH - Ecology, Behaviour Impact factor: 0.085, year: 2005

  4. Evolutionary algorithm-based multi-criteria optimization of triboelectrostatic separator

    Czech Academy of Sciences Publication Activity Database

    Mach, F.; Adam, L.; Kacerovský, J.; Karban, P.; Doležel, Ivo

    2014-01-01

    Roč. 270, November (2014), s. 134-142 ISSN 0377-0427 R&D Projects: GA ČR(CZ) GAP102/11/0498 Institutional support: RVO:61388998 Keywords : separation processes * triboelectricity * particle separators Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.266, year: 2014

  5. 48 CFR 1352.239-71 - Electronic and information technology.

    Science.gov (United States)

    2010-10-01

    ... Electronic and information technology. As prescribed in 48 CFR 1339.270(a), insert the following provision: Electronic and Information Technology (APR 2010) (a) To be considered eligible for award, offerors must propose electronic and information technology (EIT) that meet the applicable Access Board accessibility...

  6. China’s Gender Imbalance and Its Implications on China-Japan and China-Taiwan Security Relations

    Science.gov (United States)

    2011-12-01

    ties. Both sides agreed to allow 270 direct flights per week across the strait to enhance tourism and commerce by eliminating intermediate points...inaction against Japan or Taiwan would doom China to widespread social unrest and possible regime collapse. On the other hand, choosing military

  7. Effect of olive storage period at two different temperatures on oil ...

    African Journals Online (AJOL)

    ambient and 5°C) for different periods before oil extraction at 0, 7, 14, 21 and 28 days to investigate the effect of postharvest fruit storage on olive oil quality. Conventional analyses (acidity, peroxide value, specific extinction coefficient at 232 and 270 ...

  8. 48 CFR 2152.231-70 - Accounting and allowable cost.

    Science.gov (United States)

    2010-10-01

    ... allowable cost. As prescribed in 2131.270, insert the following clause: Accounting and Allowable Cost (OCT... cost; (ii) Incurred with proper justification and accounting support; (iii) Determined in accordance... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Accounting and allowable...

  9. Primary cutaneous malignancies in the Northern Cape Province of ...

    African Journals Online (AJOL)

    Results. A total of 4 270 biopsies (13 cutaneous malignancies) were identified. The commonest was squamous cell carcinoma (SCC), followed by basal cell carcinoma, Kaposi's sarcoma (KS), cutaneous malignant melanoma (CMM) and basosquamous carcinoma, in descending order. The odds of a white male developing ...

  10. HIGH-THROUGHPUT SCREENING TECHNOLOGY FOR MONITORING PHYTOHORMONE PRODUCTION IN MICROALGAE

    Czech Academy of Sciences Publication Activity Database

    Jirásková, D.; Poulíčková, A.; Novák, Ondřej; Sedláková, Kamila; Hradecká, Veronika; Strnad, Miroslav

    2009-01-01

    Roč. 45, č. 1 (2009), s. 108-118 ISSN 0022-3646 R&D Projects: GA ČR GA206/09/1284 Institutional research plan: CEZ:AV0Z50380511 Keywords : abscisic acid * auxins * cytokinins Subject RIV: BO - Biophysics Impact factor: 2.270, year: 2009

  11. In Vivo distribution of hydrocortisone over whole blood : A novel method for the extraction of erythrocytes

    NARCIS (Netherlands)

    Driessen, O.; Treuren, L.; Moolenaar, A.; Meijer, J.W.A.; Verheijen, P.

    1990-01-01

    Ten mg hydrocortisone (HC) was administered intravenously to a healthy volunteer after a dexamethasone suppresion test and HC concentrations were determined from 1-270 min in plasma, plasma water and on erythrocytes. HC was extracted front erythrocyte concentrates with high efficiency by HC-poor

  12. Oenothera coronifera, a new alien species for the Czech flora, and Oenothera stricta, recorded again after nearly two centuries

    Czech Academy of Sciences Publication Activity Database

    Mihulka, Stanislav; Pyšek, Petr; Pyšek, A.

    2003-01-01

    Roč. 75, - (2003), s. 263-270 ISSN 0032-7786 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/99/1239 Institutional research plan: CEZ:AV0Z6005908 Keywords : alien plants * casual occurrence * Oenothera Subject RIV: EF - Botanics

  13. Beckova škála deprese BDI-II - standardizace a využití v praxi

    Czech Academy of Sciences Publication Activity Database

    Ptáček, R.; Raboch, J.; Vňuková, M.; Hlinka, Jaroslav; Anders, M.

    2016-01-01

    Roč. 112, č. 6 (2016), s. 270-274 ISSN 1212-0383 Grant - others:1 LF(CZ) PRVOUK Institutional support: RVO:67985807 Keywords : BDI-II * depression * standards * validity * reliability Subject RIV: FL - Psychiatry, Sexuology OBOR OECD: Psychiatry http://www.cspsychiatr.cz/detail.php?stat=1121

  14. Reviews | Murugan | Lexikos

    African Journals Online (AJOL)

    P.R. Subramanian (Chief Editor). Kriyavill Tarkalat Tamil Akarati (TamilTamil- ArJkilam) (Dictionary of Contemporary Tamil (Tamil-Tamil-English)), 1992, reprint 1997, xxxvi + 980 pp. ISBN 81-85602-57-3. Chennai: Cre-A Publishers. E-mail: crea@vsnl.com.Price Rs. 270,00.

  15. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 1130 ... IDRC-funded researchers propose local urban agriculture as a solution to food insecurity in a recent paper published by the International Centre for Advanced Mediterranean Agronomic Studies. ... Agricultural extension uses scientific research to educate farmers and improve agricultural practices.

  16. 36 CFR 1207.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  17. 32 CFR 33.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

  18. 38 CFR 43.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

  19. 29 CFR 97.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  20. 40 CFR 31.50 - Closeout.

    Science.gov (United States)

    2010-07-01

    ..., Federal agencies may extend this timeframe. These may include but are not limited to: (1) Final... Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally-owned property report: In accordance...

  1. 44 CFR 13.50 - Closeout.

    Science.gov (United States)

    2010-10-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable.) (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  2. 41 CFR 105-71.150 - Closeout.

    Science.gov (United States)

    2010-07-01

    ... limited to: (1) Final performance or progress report. (2) Financial Status Report (SF 269) or Outlay Report and Request for Reimbursement for Construction Programs (SF-271) (as applicable). (3) Final request for payment (SF-270) (if applicable). (4) Invention disclosure (if applicable). (5) Federally...

  3. Search Results | Page 27 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 261 - 270 of 439 ... ... Poverty alleviation 26 Apply Poverty alleviation filter · Economic and social ... Grassroots Innovation in China and India ... Enabling Violence-affected Young Adults to Deal with Trauma - Phase II ... Women's Participation in Development Initiatives and its Impact on Gender Dynamics (Afghanistan).

  4. Potential of Mean Force between Ions Infinitely Diluted Simple Short-Range Models of Aqueous Electrolytes

    Czech Academy of Sciences Publication Activity Database

    Vlček, Lukáš; Nezbeda, Ivo

    2005-01-01

    Roč. 8, č. 2 (2005), s. 261-270 ISSN 1607-324X R&D Projects: GA ČR(CZ) GA203/02/0764 Institutional research plan: CEZ:AV0Z40720504 Keywords : aqueou selecrolytes * ssr model * primitive water Subject RIV: CF - Physical ; Theoretical Chemistry

  5. 78 FR 33441 - Importer of Controlled Substances; Notice of Registration; Caraco Pharmaceutical Laboratories, LTD

    Science.gov (United States)

    2013-06-04

    ... Registration; Caraco Pharmaceutical Laboratories, LTD By Notice dated February 8, 2013, and published in the Federal Register on February 21, 2013, 78 FR 12101, Caraco Pharmaceutical Laboratories, Ltd., 270 Prospect... 952(a), and determined that the registration of Caraco Pharmaceutical Laboratories, Ltd., to import...

  6. Converse Theorems for Safety and Barrier Certificates

    Czech Academy of Sciences Publication Activity Database

    Ratschan, Stefan

    Online 11 January 2018. (2018) ISSN 0018-9286 R&D Projects: GA ČR GA15-14484S Institutional support: RVO:67985807 Keywords : Safety * Robustness * Radio frequency * Differential equations * Tools * Computer science * Controllability Subject RIV: IN - Informatics, Computer Science Impact factor: 4.270, year: 2016

  7. 40 CFR 270.17 - Specific part B information requirements for surface impoundments.

    Science.gov (United States)

    2010-07-01

    ... migration of any hazardous constituents into the ground water or surface water at any future time; (2) The....19 of this chapter; (5) Proposed action leakage rate, with rationale, if required under § 264.222 of..., including the double liner system, leak detection system, cover system, and appurtenances for control of...

  8. 17 CFR 270.0-1 - Definition of terms used in this part.

    Science.gov (United States)

    2010-04-01

    ... adviser, principal underwriter, administrator (“management organizations”), or any of their control... select and nominate any other disinterested director of the fund; (iii) Any person who acts as legal... advisers and experts necessary to carry out their duties. (b) Unless otherwise specifically provided, the...

  9. 40 CFR 270.26 - Special part B information requirements for drip pads.

    Science.gov (United States)

    2010-07-01

    ... residuals. (14) A description of how each drip pad, including appurtenances for control of run-on and run..., detailed plans and an engineering report describing how the requirements of § 264.90(b)(2) of this chapter will be met. (c) Detailed plans and an engineering report describing how the drip pad is or will be...

  10. 40 CFR 270.42 - Permit modification at the request of the permittee.

    Science.gov (United States)

    2010-07-01

    ... decontamination of facility equipment or structures, with prior approval of the Director 1 1 e. Changes in... 12. Changes in background values for hazardous constituents in soil and soil-pore liquid 2 13...

  11. 41 CFR 102-117.270 - What are agency performance measures for transportation?

    Science.gov (United States)

    2010-07-01

    ...) Increase the use of electronic commerce; (2) Adopt industry best practices and services to meet your agency... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are agency... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION...

  12. CWAP Certified Wireless Analysis Professional Official Study Guide Exam PW0-270

    CERN Document Server

    Westcott, David A; Miller, Ben; Mackenzie, Peter

    2011-01-01

    The official study guide for the Certified Wireless Analysis Professional certification from CWNPFour leading wireless experts thoroughly prepare you for the vendor-neutral CWAP exam administered by CWNP, the industry leader for enterprise Wi-Fi training and certification.  This official study guide not only covers all exam objectives for the CWAP exam, it also prepares you to administer and troubleshoot complex enterprise WLAN environments.Covers all exam objectives for the Certified Wireless Analysis Professional (CWAP) examCovers 802.11 physical (PHY) and 802.11 MAC layer frame formats and

  13. 17 CFR 270.23c-3 - Repurchase offers by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... repurchase pricing date, either in whole or in part, without penalty or premium, as necessary to permit the... repurchase payment deadline shall occur seven days after the repurchase pricing date applicable to such tender. (5) Repurchase pricing date with respect to a tender of common stock shall mean the date on which...

  14. SU-E-T-270: Optimized Shielding Calculations for Medical Linear Accelerators (LINACs).

    Science.gov (United States)

    Muhammad, W; Lee, S; Hussain, A

    2012-06-01

    The purpose of radiation shielding is to reduce the effective equivalent dose from a medical linear accelerator (LINAC) to a point outside the room to a level determined by individual state/international regulations. The study was performed to design LINAC's room for newly planned radiotherapy centers. Optimized shielding calculations were performed for LINACs having maximum photon energy of 20 MV based on NCRP 151. The maximum permissible dose limits were kept 0.04 mSv/week and 0.002 mSv/week for controlled and uncontrolled areas respectively by following ALARA principle. The planned LINAC's room was compared to the already constructed (non-optimized) LINAC's room to evaluate the shielding costs and the other facilities those are directly related to the room design. In the evaluation process it was noted that the non-optimized room size (i.e., 610 × 610 cm 2 or 20 feet × 20 feet) is not suitable for total body irradiation (TBI) although the machine installed inside was having not only the facility of TBI but the license was acquired. By keeping this point in view, the optimized INAC's room size was kept 762 × 762 cm 2. Although, the area of the optimized rooms was greater than the non-planned room (i.e., 762 × 762 cm 2 instead of 610 × 610 cm 2), the shielding cost for the optimized LINAC's rooms was reduced by 15%. When optimized shielding calculations were re-performed for non-optimized shielding room (i.e., keeping room size, occupancy factors, workload etc. same), it was found that the shielding cost may be lower to 41 %. In conclusion, non- optimized LINAC's room can not only put extra financial burden on the hospital but also can cause of some serious issues related to providing health care facilities for patients. © 2012 American Association of Physicists in Medicine.

  15. 40 CFR 270.24 - Specific part B information requirements for process vents.

    Science.gov (United States)

    2010-07-01

    ... incinerator, flare, boiler, process heater, condenser, or carbon adsorption system to comply with the... each compliance test required by § 264.1033(k). (3) A design analysis, specifications, drawings... texts acceptable to the Regional Administrator that present basic control device information. The design...

  16. 17 CFR 270.19b-1 - Frequency of distribution of capital gains.

    Science.gov (United States)

    2010-04-01

    ... eligible trust security which adversely affects the ability of such issuer to continue payment of principal... which adversely affects the ability of such issuer to continue payment of principal or interest on its... request as not being necessary or appropriate in the public interest or for the protection of investors...

  17. 17 CFR 270.34b-1 - Sales literature deemed to be misleading.

    Science.gov (United States)

    2010-04-01

    ... includes the information specified in paragraphs (a) and (b) of this section. Note to introductory text of..., illustrations, and descriptions contained in investment company sales literature are misleading, see § 230.156... adjusted to reflect the effect of taxes (not including a quotation of tax equivalent yield or other similar...

  18. 40 CFR 270.16 - Specific part B information requirements for tank systems.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... systems in which ignitable, reactive, or incompatible wastes are to be stored or treated, a description of...

  19. 40 CFR 270.18 - Specific part B information requirements for waste piles.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... quality of the residuals; (f) If ignitable or reactive wastes are to be placed in a waste pile, an...

  20. 40 CFR 270.23 - Specific part B information requirements for miscellaneous units.

    Science.gov (United States)

    2010-07-01

    ... address and ensure compliance of the unit with each factor in the environmental performance standards of § 264.601. If the applicant can demonstrate that he does not violate the environmental performance... the Director to be necessary for evaluation of compliance of the unit with the environmental...

  1. Postoje obyvatel k situaci na trhu s bydlením a bytové politice: existují v České republice „housing classes“?

    Czech Academy of Sciences Publication Activity Database

    Kostelecký, Tomáš

    2005-01-01

    Roč. 41, č. 2 (2005), s. 253-270 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA403/03/0417 Institutional research plan: CEZ:AV0Z70280505 Keywords : models * electoral predictions * surveys Subject RIV: AO - Sociology, Demography Impact factor: 0.113, year: 2005

  2. Disseminating and Promoting Smart Farming Technologies –The SmartAKIS Network

    NARCIS (Netherlands)

    Tinker, D.; Kernecker, M.; Knierim, A.; Wurbs, A.; Wolters, Sandra; Evert, van F.K.; Bellostas, N.; Aït-Amar, S.; Balafoutis, T.; Fountas, S.

    2017-01-01

    This paper summarises the early stages of the Smart AKIS project which aims to collect and disseminate Smart Farming Technologies (SFT) in line with farmers' needs. The methodology of collecting information and opinions from over 270 farmers from seven countries about SFTs is given. The methodology

  3. Workplace Incivility and Conflict Management Styles: Predicting Job Performance, Organizational Commitment and Turnover Intent

    Science.gov (United States)

    Reio, Thomas G., Jr.; Trudel, Jeannie

    2013-01-01

    The purpose of this study was to examine the relations among conflict management styles and target and instigator incivility and job performance, organizational commitment, and turnover intent. Data from 270 employees suggested that experiencing and instigating uncivil behavior occurred frequently. Using an integrative conflict management style…

  4. 76 FR 4348 - Labor-Management Cooperation Grant Program Information Collection Request

    Science.gov (United States)

    2011-01-25

    ...: Application for Federal Assistance (SF-424), Accounting System and Financial Capability Questionnaire (LM-3), Request for Advance or Reimbursement SF-270 (LM- 6), Financial Status Report SF-269a (LM-7), Project... the estimated time per response is 60 minutes. The Accounting System and Financial Capability...

  5. 40 CFR 761.125 - Requirements for PCB spill cleanup.

    Science.gov (United States)

    2010-07-01

    ... greater which are subject to decontamination requirements under TSCA, including those spills listed under... required. (2) Disposal of cleanup debris and materials. All concentrated soils, solvents, rags, and other... than 1 pound of PCBs by weight (less than 270 gallons of untested mineral oil)—(1) Decontamination...

  6. Some Empirical Dimensions of Countertrade

    OpenAIRE

    Jean-Francois Hennart

    1990-01-01

    This paper discusses some of the recent theories of why countries impose countertrade obligations and compares some of the implications of these theories with data obtained from a comprehensive database of countertrade transactions.© 1990 JIBS. Journal of International Business Studies (1990) 21, 243–270

  7. Experiment list: SRX1090865 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available amming || cell type=intermediate stage of somatic cell reprogramming || chip antibo...,95.9,8.5,270 GSM1816302: pre-iPS rep.H3K4me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell reprogr

  8. Securing the Aviation Transportation System

    Science.gov (United States)

    2007-12-01

    additional 100,000 airport workers who perform duties in sterile areas (the indoor gate area past the security check point).197 These same...containing thirteen handguns, an assault rifle and eight pounds of marijuana .270 However, two Federal Air Marshals were also onboard the aircraft.271

  9. Installation Restoration Program. Phase 1: Records Search, Pope Air Force Base, North Carolina

    Science.gov (United States)

    1985-05-01

    Diazinon Calcium Cyanide A-Dust Pramitol 25E Mayforce Rodeo PZ 270 Dursban Fungicides Prograss PZ 250 Baygon Weed Hoe 108 Unicorn Fogging Solution Benlate...head; the direction in which ground water flows. I DPDO: Defense Property Disposal Office, previously included Redistri- bution and Marketing (R&M

  10. External Insect Morphology: A Negative Factor in Attitudes toward Insects and Likelihood of Incorporation in Future Science Education Settings

    Science.gov (United States)

    Wagler, Ron; Wagler, Amy

    2012-01-01

    This study investigated if the external morphology of an insect had a negative effect on United States (US) preservice elementary teacher's attitudes toward insects and beliefs concerning the likelihood of incorporating insects into future science education settings. 270 US kindergarten through sixth grade preservice elementary teachers…

  11. Diastereoselective reduction of 1-(4-fluorophenyl)-3(R)-[3-oxo-3-(4-fluorophenyl) -propyl]-4 (S)-(4-hydroxyphenyl)azetidin-2-one to Ezetimibe by the whole cell catalyst Rhodococcus fascians MO22

    Czech Academy of Sciences Publication Activity Database

    Kyslíková, Eva; Babiak, P.; Marešová, Helena; Palyzová, Andrea; Hajíček, J.; Kyslík, Pavel

    2010-01-01

    Roč. 67, 3-4 (2010), s. 266-270 ISSN 1381-1177 R&D Projects: GA MŠk 2B08064 Institutional research plan: CEZ:AV0Z50200510 Keywords : Biotransformation * Rhodococcus fascians MO22 * Ezetimibe Subject RIV: CE - Biochemistry Impact factor: 2.330, year: 2010

  12. Investigations of the 1 KHZ Sound Absorption in Sea Water.

    Science.gov (United States)

    1983-01-15

    York, 465 pages. Seward, T. M. (1974) Determination of the first ionization constant of silicic acid from quartz solubility in borate buffer...attenuation coefficient. J. Acoust. Soc. Am. 42, 270-271. Uppstrom, L (1968) A modified method for the determination of boron with curcumin and a simplified

  13. 76 FR 54932 - TSCA Inventory Update Reporting Modifications; Chemical Data Reporting

    Science.gov (United States)

    2011-09-06

    ... route of entry (inhalation, ingestion, skin contact, absorption, etc.), but excludes accidental or... and hydrocarbon waxes. 8006-20-0 Fuel gases, low and medium B.T.U. 8008-20-6 Kerosine (petroleum...-27-0 Fuel gases, refinery. 68333-22-2 Residues (petroleum), atmospheric. 68333-23-3 Naphtha...

  14. Cu induced morphology changes at Pb/Si (111) interface: separation of "5 x 5"-Cu structure into individual domains

    Czech Academy of Sciences Publication Activity Database

    Shukrynau, Pavel; Mutombo, Pingo; Hietschold, M.; Cháb, Vladimír

    2013-01-01

    Roč. 270, Apr (2013), s. 157-162 ISSN 0169-4332 R&D Projects: GA AV ČR IAA1010413 Institutional support: RVO:68378271 Keywords : scanning tunnelling microscopy * copper * lead * silicon * surface chemical reaction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.538, year: 2013

  15. 20 CFR 221.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... 270 of this chapter). The Board is responsible for making this decision. ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 221.1 Section 221.1 Employees... Security Administration or the Railroad Retirement Board will pay benefits to a railroad employee, and his...

  16. Marine migration and habitat use of anadromous brown trout Salmo trutta

    DEFF Research Database (Denmark)

    Eldøy, Sindre Håvarstein; Davidsen, Jan Grimsrud; Thorstad, Eva Bonsak

    2015-01-01

    The biology and ecology of anadromous brown trout (Salmo trutta) at sea is poorly understood. This study provided information on spatial and temporal distribution of sea trout in the ocean. The behaviour of 115 individuals (veteran migrants, 270–700 mm) was tracked by using acoustic telemetry...

  17. Solubilities of hydrogen and methane in coal liquids

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Ho-mu; Sebastian, H M; Simnick, J J; Chao, Kwang Chu

    1981-04-01

    The solubilities of hydrogen and methane in Exxon Donor Solvent (EDS) and Solvent Refined Coal II (SRC-II) coal liquids are determined at 190 and 270 C and pressures to 250 atm. Two narrow boiling distillate cuts from EDS and three from SRC-II are studied.

  18. Review of Physical and Chemical Methods for Characterization of Fuels

    Science.gov (United States)

    1981-12-01

    Reversed-phase chromatography REF Refractometry CAL Calorimetry POT Potentiometry CC Coordination chromatography MSB Mossbauer spectroscopy FS Flame...petroleum distillates ......... .... ........................ . .... A-2-63 Determination of the nitrogen content of shale oil furnace oil by refractometry ... refractometry ............................................ A-2-70 SAPONIFICATION NUMBER Saponification number of petroleum products.......................A-2

  19. 78 FR 40200 - Duke Energy Carolinas, LLC, Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel...

    Science.gov (United States)

    2013-07-03

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos. 72-1004, 72-40, 50-269, 50-270, and 50-287; NRC-2013-0135] Duke Energy Carolinas, LLC, Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel Storage Installation; Environmental Assessment and Finding of No Significant Impact AGENCY: Nuclear...

  20. 78 FR 45575 - Duke Energy Carolinas, LLC; Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel...

    Science.gov (United States)

    2013-07-29

    ... NUCLEAR REGULATORY COMMISSION [Docket Nos.: 72-1004, 72-40, 50-269, 50-270, 50-287; and NRC-2013- 0135] Duke Energy Carolinas, LLC; Oconee Nuclear Station Units 1, 2, and 3; Independent Spent Fuel Storage Installation AGENCY: Nuclear Regulatory Commission. ACTION: Exemption; issuance. SUMMARY: The NRC...