WorldWideScience

Sample records for sculpin myoxocephalus octodecemspinosus

  1. Influence of crude oil and pulp and paper mill effluent on mixed infections of Trichodina cottidarium and T. saintjohnsi (Ciliophora) parasitizing Myoxocephalus octodecemspinosus and M. scorpius

    Khan, R.A.; Barker, D.E.; Williams-Ryan, K.; Hooper, R.G.

    1994-01-01

    Samples of longhorn sculpin (Myoxocephalus octodecemspinosus) were exposed to sediment contaminated with crude oil or pulp and paper mill effluent for periods up to 13 months in the laboratory. Other samples were collected at sites where crude oil or effluent from a pulp and paper mill are discharged. The intensity of gill infections of Trichodina spp. on exposed fish was significantly higher than on controls 5, 9, and 13 months after exposure. The intensity of the ciliates was also greater on sculpins collected near an oil-receiving terminal than on those sampled 5 km from the polluted site. Field collections of longhorn and shorthorn (Myoxocephalus scorpius) sculpins at and distant from a pulp and paper mill had high and low intensities of the ciliates, respectively. Similarly, the intensity of trichodinid ciliates was also significantly greater in longhorn sculpins exposed to effluent-contaminated sediment than in controls 5 months after exposure. The results suggest that the intensity of gill-inhibiting species such as trichodinids in susceptible fish hosts increases after chronic exposure to crude oil and to pulp and paper mill effluent, and the parasites may serve as indicators of pollution. 24 refs., 4 figs., 1 tab

  2. Reproduction of the shorthorn sculpin Myoxocephalus scorpius in northern Norway

    Luksenburg, JA; Pedersen, T; Falk-Petersen, IB

    The reproduction and life history events of the shorthorn sculpin Myoxocephalus scorpius were studied in an unexploited high latitude population in Tromso, northern Norway. Shorthorn sculpins were sampled from November 1998 to March 1999 to determine sex ratio, spawning period, oogenesis, fecundity,

  3. Metal residues, histopathology and presence of parasites in the liver and gills of fourhorn sculpin (Myoxocephalus quadricornis) and shorthorn sculpin (Myoxocephalus scorpius) near a former lead-zinc mine in East Greenland

    Dang, Mai [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia); Nørregaard, Rasmus; Bach, Lis; Sonne, Christian; Søndergaard, Jens; Gustavson, Kim; Aastrup, Peter [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, PO Box 358, DK-4000 Roskilde (Denmark); Nowak, Barbara, E-mail: B.Nowak@utas.edu.au [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia)

    2017-02-15

    Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) and lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.

  4. Food habits of Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) in the northeastern Chukchi and western Beaufort Seas

    Gray, Benjamin P.; Norcross, Brenda L.; Beaudreau, Anne H.; Blanchard, Arny L.; Seitz, Andrew C.

    2017-01-01

    Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) belong to Cottidae, the second most abundant fish family in the western Arctic. Although considered important in food webs, little is known about their food habits throughout this region. To address this knowledge gap, we examined and compared the diets of 515 Arctic staghorn sculpin and 422 shorthorn sculpin using stomachs collected over three summers in the northeastern Chukchi Sea (2010-2012) and one summer in the western Beaufort Sea (2011). We used permutational multivariate analysis of variance (PERMANOVA) and non-metric multidimensional scaling (nMDS) to compare sculpin diets between regions and selected size classes. Differences in mouth morphologies and predator size versus prey size relationships were examined using regression techniques. Arctic staghorn sculpin and shorthorn sculpin diet compositions differed greatly throughout the Chukchi and Beaufort Seas. Regardless of body size, the smaller-mouthed Arctic staghorn sculpin consumed mostly benthic amphipods and polychaetes, whereas the larger-mouthed shorthorn sculpin shifted from a diet composed of benthic and pelagic macroinvertebrates as smaller individuals to shrimps and fish prey as larger individuals. Within shared habitats, the sculpins appear to partition prey, either by taxa or size, in a manner that suggests no substantial overlap occurs between species. This study increases knowledge of sculpin feeding ecology in the western Arctic and offers regional, quantitative diet information that could support current and future food web modeling efforts.

  5. Comparison of heavy metals, parasites and histopathology in sculpins (Myoxocephalus spp.) from two sites at a lead-zinc mine in North East Greenland

    Nørregaard, Rasmus Dyrmose; Dang, Mai; Bach, Lis

    2018-01-01

    light on the present contamination and its potential effects on local fish we investigated gill and liver histology of sculpins (Myoxocephalus spp.) around the former mining area. Two species of sculpins were caught; shorthorn sculpins (M. scorpius; n = 16) and fourhorn sculpins (M. quadricornis; n = 17...... a significantly higher prevalence of chondroplastic tissue and intensity of neutral, mixed and total mucus cells in the gills compared to the shorthorn sculpins. The data indicate that both sculpin species could be useful indicator species for environmental monitoring of metal pollution in Arctic areas. However...

  6. Gastric evacuation rate, index of fullness, and daily ration of Lake Michigan slimy sculpin (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii)

    Mychek-Londer, Justin G.; Bunnell, David B.

    2013-01-01

    Accurate estimates of fish consumption are required to understand trophic interactions and facilitate ecosystem-based fishery management. Despite their importance within the food-web, no method currently exists to estimate daily consumption for Great Lakes slimy (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii). We conducted experiments to estimate gastric evacuation (GEVAC) and collected field data from Lake Michigan to estimate index of fullness [(g prey/g fish weight)100%) to determine daily ration for water temperatures ranging 2–5 °C, coinciding with the winter and early spring season. Exponential GEVAC rates equaled 0.0115/h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 °C and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin. Index of fullness varied with fish size, and averaged 1.93% and 1.85% for slimy and deepwater sculpins, respectively. Maximum index of fullness was generally higher (except for the smallest sizes) for both species in 2009–2010 than in 1976 despite reductions in a primary prey, Diporeia spp. Predictive daily ration equations were derived as a function of fish dry weight. Estimates of daily consumption ranged from 0.2 to 0.8% of their body weight, which was within the low range of estimates from other species at comparably low water temperatures. These results provide a tool to estimate the consumptive demand of sculpins which will improve our understanding of benthic offshore food webs and aid in management and restoration of these native species in the Great Lakes.

  7. Biochemical indicators of pollution exposure in shorthorn sculpin (Myoxocephalus scorpius), caught in four harbours on the southwest coast of Iceland.

    Stephensen; Svavarsson; Sturve; Ericson; Adolfsson-Erici; Förlin

    2000-04-01

    Shorthorn sculpins (Myoxocephalus scorpius) were caught in four Icelandic harbours, differing in size, use and traffic. Biochemical responses in liver were measured and chemicals analysed in bile. Eyrarbakki harbour, which has not been in use for many years was chosen as a control site. Njar partial differentialvík harbour is a small fishing harbour and a marina, Sandger partial differentiali harbour is a large fishing harbour, and Reykjavík harbour is a large fishing harbour and an international transport harbour. Higher levels of DNA-adducts and cytochrome P4501A (CYP1A) in the fish from the harbours in Sandger partial differentiali, Njar partial differentialvík and Reykjavík, compared to Eyrarbakki harbour, indicate PAH exposure. This was confirmed by PAH analysis in bile. The higher activities of the antioxidant enzymes catalase (CAT), glutathione peroxidase (GPx) and glutathione reductase (GR) in fish caught in Sandger partial differentiali, than in fish caught in the other harbours, indicate exposure of sculpin to prooxidative compounds in Sandger partial differentiali harbour. Shorthorn sculpin seems to be a convenient species for monitoring pollution in northern coastal areas.

  8. Evaluation of the use of common sculpin (Myoxocephalus scorpius) organ histology as bioindicator for element exposure in the fjord of the mining area Maarmorilik, West Greenland

    Sonne, Christian, E-mail: csh@dmu.dk [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Leifsson, Pall S. [University of Copenhagen, Faculty of Health and Medical Sciences, Department of Veterinary Disease Biology, Bülowsvej 17, DK-1870 Frederiksberg (Denmark); Gustavson, Kim [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark)

    2014-08-15

    The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and

  9. Evaluation of the use of common sculpin (Myoxocephalus scorpius) organ histology as bioindicator for element exposure in the fjord of the mining area Maarmorilik, West Greenland

    Sonne, Christian; Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders; Leifsson, Pall S.; Gustavson, Kim

    2014-01-01

    The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and

  10. Metal levels in flathead sole (Hippoglossoides elassodon) and great sculpin (Myoxocephalus polyacanthocephalus) from Adak Island, Alaska: Potential risk to predators and fishermen

    Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Timothy

    2007-01-01

    Increasingly there is a need to assess the contaminant levels in fish as indicators of the health and well-being of both the fish and their consumers, including humans. This paper examines the levels of arsenic, cadmium, chromium, lead, manganese, mercury, and selenium in the kidney, liver, and muscle of great sculpin and flathead sole from Adak Island in the Aleutian Islands, Alaska. Both species are consumed by the local Aleuts and others. There were significant differences in the levels of heavy metals as a function of tissue for both fish species; the liver of sculpin and sole generally had the highest levels of most metals, except for arsenic, lead, and selenium. Sole had significantly higher mean levels of arsenic in kidney (32,384 vs. 531 ppb, wet weight), liver (18,954 vs. 2532 ppb), and muscle (19,452 vs. 1343 ppb) than did sculpin. Sole also had higher mean levels of cadmium (230 vs. 63 ppb), lead (1236 vs. 48 ppb), mercury (150 vs. 107 ppb), and selenium (5215 vs. 1861 ppb) in kidney than did sculpin. There were significant correlations among weight and length measurements for both species. However, except for mercury, there were few significant correlations among tissue types for most metals. Only mercury and manganese levels were significantly correlated with size for sculpin (but not for sole). Levels of arsenic, lead, and mercury may pose a risk to predators that consume them, and arsenic and mercury may pose a risk to human consumers

  11. Sexual and geographical variation in life history parameters of the shorthorn sculpin

    Luksenburg, JA; Pedersen, T

    2002-01-01

    A total of 293 shorthorn sculpins Myoxocephalus scorpius from Tromso, northern Norway, were sampled between November 1998 and April 1999 to determine sex, total length, age, growth, maturity and mortality. Females grew to larger sizes (L-infinity=26.9 v. 18.5 cm), matured later (2 v. 1 year of age)

  12. Prevalence of the parasitic copepod Haemobaphes intermedius on juvenile buffalo sculpins from Washington State

    Halpenny, C.M.; Kocan, R.M.; Hershberger, P.K.

    2004-01-01

    The parasitic copepod, Haemobaphes intermedius, was detected in 62% of juvenile buffalo sculpins Enophrys bison, a previously unreported host, from the San Juan Islands archipelago in Washington State. Most infestations were characterized by the presence of a single female copepod infestations with multiple H. intermedius occurred either unilaterally or bilaterally in 29% of parasitized individuals. Impaired condition of parasitized hosts was indicated by significantly lower total lengths and weights (34.9 mm; 1.6 g) than in unparasitized cohorts (38.9 mm; 2.1 g). Host specificity was indicated by the failure to detect H. intermedius in 43 sympatric great sculpins Myoxocephalus polyacanthocephalus from the same location.

  13. Diet and habitat use by age-0 deepwater sculpins in northern Lake Huron, Michigan and the Detroit River

    Roseman, Edward F.

    2014-01-01

    Deepwater sculpins (Myoxocephalus thompsonii) are an important link in deepwater benthic foodwebs of the Great Lakes. Little information exists about deepwater sculpin spawning habits and early life history ecology due to difficulty in sampling deep offshore habitats. Larval and age-0 deepwater sculpins collected in northern Lake Huron and the Detroit River during 2007 were used to improve our understanding of their habitat use, diet, age, and growth. Peak larval density reached 8.4/1000 m3 in the Detroit River during April and was higher than that in Lake Huron. Offshore bottom trawls at DeTour and Hammond Bay first collected benthic age-0 deepwater sculpins in early September when fish were ≥ 25 mm TL. Otolith analysis revealed that hatch dates for pelagic larvae occurred during late March and larvae remained pelagic for 40 to 60 days. Diet of pelagic larvae (10–21 mm TL) was dominated by calanoid copepods at all sample locations. Diets of benthic age-0 fish varied by location and depth: Mysis and chironomids were prevalent in fish from Hammond Bay and the 91 m site at DeTour, but only chironomids were found in fish from the 37 m DeTour site. This work showed that nearshore epilimnetic sites were important for pelagic larvae and an ontogenetic shift from pelagic planktivore to benthivore occurred at about 25 mm TL in late summer. Age analysis showed that larvae remained pelagic long enough to be transported through the St. Clair–Detroit River system, Lake Erie, and the Niagara River, potentially contributing to populations in Lake Ontario.

  14. Evidence for glutamatergic mechanisms in the vagal sensory pathway initiating cardiorespiratory reflexes in the shorthorn sculpin Myoxocephalus scorpius.

    Sundin, L; Turesson, J; Taylor, E W

    2003-03-01

    Glutamate is a major neurotransmitter of chemoreceptor and baroreceptor afferent pathways in mammals and therefore plays a central role in the development of cardiorespiratory reflexes. In fish, the gills are the major sites of these receptors, and, consequently, the terminal field (sensory area) of their afferents (glossopharyngus and vagus) in the medulla must be an important site for the integration of chemoreceptor and baroreceptor signals. This investigation explored whether fish have glutamatergic mechanisms in the vagal sensory area (Xs) that could be involved in the generation of cardiorespiratory reflexes. The locations of the vagal sensory and motor (Xm) areas in the medulla were established by the orthograde and retrograde axonal transport of the neural tract tracer Fast Blue following its injection into the ganglion nodosum. Glutamate was then microinjected into identified sites within the Xs in an attempt to mimic chemoreceptor- and baroreceptor-induced reflexes commonly observed in fish. By necessity, the brain injections were performed on anaesthetised animals that were fixed by 'eye bars' in a recirculating water system. Blood pressure and heart rate were measured using an arterial cannula positioned in the afferent branchial artery of the 3rd gill arch, and ventilation was measured by impedance probes sutured onto the operculum. Unilateral injection of glutamate (40-100 nl, 10 mmol l(-1)) into the Xs caused marked cardiorespiratory changes. Injection (0.1-0.3 mm deep) in different rostrocaudal, medial-lateral positions induced a bradycardia, either increased or decreased blood pressure, ventilation frequency and amplitude and, sometimes, an initial apnea. Often these responses occurred simultaneously in various different combinations but, occasionally, they appeared singly, suggesting specific projections into the Xs for each cardiorespiratory variable and local determination of the modality of the response. Response patterns related to chemoreceptor reflex activation were predominantly located rostral of obex, whereas patterns related to baroreceptor reflex activation were more caudal, around obex. The glutamate-induced bradycardia was N-methyl-D-aspartate (NMDA) receptor dependent and atropine sensitive. Taken together, our data provide evidence that glutamate is a putative player in the central integration of chemoreceptor and baroreceptor information in fish.

  15. LABORATORY CULTURE METHODS FOR THE MOTTLED SCULPIN (COTTUS BAIRDI)

    Fish from the family Cottidae (Sculpin Family) are being researched to determine their sensitivity to various metals in freshwater systems. The ability to culture them in the lab would facilitate species sensitivity comparisons. We collected adult mottled sculpins (C. bairdi) f...

  16. Mechanosensory based orienting behaviors in fluvial and lacustrine populations of mottled sculpin (Cottus bairdi)

    Sheryl Coombs; Gary D. Grossman

    2006-01-01

    We compared prey-orienting and rheotactic behaviors in a fluvial (Coweeta Creek) and lacustrine (Lake Michigan) population of mottled sculpin. Blinded sculpin from both populations exhibited unconditioned, mechanosensory based rheotaxis to low velocity flows. Whereas Lake Michigan sculpin generally showed increasing levels of positive rheotaxis to increasing velocities...

  17. An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream

    Carrico, B.A.; Ryon, M.G.

    1996-02-01

    A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins

  18. An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream

    Carrico, B.A.; Ryon, M.G.

    1996-02-01

    A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins.

  19. A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius.

    Cutfield, S M; Cutfield, J F

    1993-09-01

    The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.

  20. A short-term look at potential changes in Lake Michigan slimy sculpin diets

    French, John R. P.; Stickel, Richard G.; Stockdale, Beth A.; Black, M. Glen

    2010-01-01

    Diporeia hoyi and Mysis relicta are the most important prey items of slimy sculpins (Cottus cognatus) in the Great Lakes. Slimy sculpins were collected from dreissenid-infested bottoms off seven Lake Michigan ports at depths of 27–73 m in fall 2003 to study their lake-wide diets. Relatively large dreissenid biomass occurred at depths of 37- and 46-m. Quagga mussels (Dreissena bugnesis) composed at least 50% of dreissenid biomass at Manistique, Saugatuck, and Sturgeon Bay. Mysis accounted for 82% of the sculpin diet by dry weight at eastern Lake Michigan while Diporeia composed 54–69% of the diet at western Lake Michigan and dominated the diets of slimy sculpins at all sites deeper than 46 m. In northern Lake Michigan, this diet study in new sites showed that slimy sculpin consumed more prey with low energy contents, especially chironomids, than Mysis and Diporeia in shallow sites (depth diet studies on sedentary benthic fishes to be conducted along perimeters of the Great Lakes to observe changes in their diets that may be impacted by changing benthic macroinvertebrate communities.

  1. An individual-based simulation model for mottled sculpin (Cottus bairdi) in a southern Appalachian stream

    Brenda Rashleigh; Gary D. Grossman

    2005-01-01

    We describe and analyze a spatially explicit, individual-based model for the local population dynamics of mottled sculpin (Cottus bairdi). The model simulated daily growth, mortality, movement and spawning of individuals within a reach of stream. Juvenile and adult growth was based on consumption bioenergetics of benthic macroinvertebrate prey;...

  2. Population trends and current status of the endangered Pyrenean sculpin Cottus hispaniolensis in the Spanish part of the Garonne drainage

    Rocaspana Rafel

    2017-01-01

    Full Text Available The status of Pyrenean sculpin Cottus hispaniolensis was assessed in the Spanish part of the Garonne drainage on the basis of its distribution and abundance from 2001 to 2016. Population trends showed a progressive reduction in range extension and density, exacerbated by a severe spate occurred in 2013. However, C. hispaniolensis was resilient to this natural disturbance by compensating for mortality with increasing recruitment. Both occurrence and density of Pyrenean sculpin showed a positive correlation with coarse substrates. Riverine habitat deterioration, mainly channelization, presence of dams and flow regulation are the main factors threatening sculpin populations. Several management measures are proposed.

  3. Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius).

    Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L

    1986-12-30

    The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

  4. Patterns of ancestry and genetic diversity in reintroduced populations of the slimy sculpin: Implications for conservation

    Huff, David D.; Miller, Loren M.; Vondracek, Bruce C.

    2010-01-01

    Reintroductions are a common approach for preserving intraspecific biodiversity in fragmented landscapes. However, they may exacerbate the reduction in genetic diversity initially caused by population fragmentation because the effective population size of reintroduced populations is often smaller and reintroduced populations also tend to be more geographically isolated than native populations. Mixing genetically divergent sources for reintroduction purposes is a practice intended to increase genetic diversity. We documented the outcome of reintroductions from three mixed sources on the ancestral composition and genetic variation of a North American fish, the slimy sculpin (Cottus cognatus). We used microsatellite markers to evaluate allelic richness and heterozygosity in the reintroduced populations relative to computer simulated expectations. Sculpins in reintroduced populations exhibited higher levels of heterozygosity and allelic richness than any single source, but only slightly higher than the single most genetically diverse source population. Simulations intended to mimic an ideal scenario for maximizing genetic variation in the reintroduced populations also predicted increases, but they were only moderately greater than the most variable source population. We found that a single source contributed more than the other two sources at most reintroduction sites. We urge caution when choosing whether to mix source populations in reintroduction programs. Genetic characteristics of candidate source populations should be evaluated prior to reintroduction if feasible. When combined with knowledge of the degree of genetic distinction among sources, simulations may allow the genetic diversity benefits of mixing populations to be weighed against the risks of outbreeding depression in reintroduced and nearby populations.

  5. The isolation, purification and amino-acid sequence of insulin from the teleost fish Cottus scorpius (daddy sculpin).

    Cutfield, J F; Cutfield, S M; Carne, A; Emdin, S O; Falkmer, S

    1986-07-01

    Insulin from the principal islets of the teleost fish, Cottus scorpius (daddy sculpin), has been isolated and sequenced. Purification involved acid/alcohol extraction, gel filtration, and reverse-phase high-performance liquid chromatography to yield nearly 1 mg pure insulin/g wet weight islet tissue. Biological potency was estimated as 40% compared to porcine insulin. The sculpin insulin crystallised in the absence of zinc ions although zinc is known to be present in the islets in significant amounts. Two other hormones, glucagon and pancreatic polypeptide, were copurified with the insulin, and an N-terminal sequence for pancreatic polypeptide was determined. The primary structure of sculpin insulin shows a number of sequence changes unique so far amongst teleost fish. These changes occur at A14 (Arg), A15 (Val), and B2 (Asp). The B chain contains 29 amino acids and there is no N-terminal extension as seen with several other fish. Presumably as a result of the amino acid substitutions, sculpin insulin does not readily form crystals containing zinc-insulin hexamers, despite the presence of the coordinating B10 His.

  6. 76 FR 3044 - Fisheries of the Exclusive Economic Zone Off Alaska; Sculpins, Sharks, Squid, and Octopus in the...

    2011-01-19

    ..., Squid, and Octopus in the Gulf of Alaska AGENCY: National Marine Fisheries Service (NMFS), National... prohibiting directed fishing for sculpins, sharks, squid, and octopus in the Gulf of Alaska (GOA). This action..., and octopus in the GOA. DATES: Effective 1200 hrs, Alaska local time (A.l.t.), January 13, 2011...

  7. The effect of perfusion and irrigation flow rate variations on NaCl efflux from the isolated, perfused head of the marine teleost, Myoxocephalus octodecimspinosus

    Claiborne, J.B.; Evans, D.H.

    1981-01-01

    In vivo branchial blood pressure and unidirectional efflux values for NaCl were determined in the marine teleost, Myoxocephalus octodecimspinosus. Utilizing an isolated, perfused head preparation, perfused at in vivo pressure levels, NaCl efflux was measured and compared to in vivo values. The effect of variations in perfusion or irrigation rates on the ion efflux across the gills of the isolated head was also studied. The efflux of 22 Na from the isolated, perfused head was found to be similar to in vivo values and dependent on perfusion flow and pressure. In vitro 36 Cl efflux was lower than the efflux from intact animals and was determined to be flow/pressure independent. Irrigation rate changes at all rates tested did not affect the unidirectional efflux of either ion. (Auth.)

  8. Effect of perfusion and irrigation flow rate variations on NaCl efflux from the isolated, perfused head of the marine teleost, Myoxocephalus octodecimspinosus

    Claiborne, J.B. (Miami Univ., Coral Gables, FL (USA)); Evans, D.H. (Mt. Desert Island Biological Laboratory, Salsbury Cove, ME, USA)

    1981-06-01

    In vivo branchial blood pressure and unidirectional efflux values for NaCl were determined in the marine teleost, Myoxocephalus octodecimspinosus. Utilizing an isolated, perfused head preparation, perfused at in vivo pressure levels, NaCl efflux was measured and compared to in vivo values. The effect of variations in perfusion or irrigation rates on the ion efflux across the gills of the isolated head was also studied. The efflux of /sup 22/Na from the isolated, perfused head was found to be similar to in vivo values and dependent on perfusion flow and pressure. In vitro /sup 36/Cl efflux was lower than the efflux from intact animals and was determined to be flow/pressure independent. Irrigation rate changes at all rates tested did not affect the unidirectional efflux of either ion.

  9. Shifts in the diets of slimy sculpin (Cottus cognatus) and lake whitefish (Coregonus clupeaformis) in Lake Ontario following the collapse of the burrowing amphipod Diporeia

    Owens, Randall W.; Dittman, Dawn E.

    2003-01-01

    In Lake Ontario, the diets of slimy sculpin Cottus cognatus and lake whitefish Coregonus clupeaformis shifted from a diet dominated by the burrowing amphipod, Diporeia, and to a lesser extent, Mysis, to a more diverse diet, after Diporeia collapsed, to one dominated by Mysis and prey that were formerly less important or uncommon such as Chironomidae, Oligochaeta, and Ostracoda. Additionally, lake whitefish still preyed on native mollusks like Sphaeriidae and Gastropoda, but also preyed on exotic mollusks, Dreissena spp., which are swallowed intact and subsequently crushed in its muscular stomach. Whether Diporeia was abundant (1992) or scarce (1999), selection indices for Diporeia by slimy sculpins was positive, suggesting that Diporeia was a preferred prey. Unlike lake whitefish, slimy sculpins avoided Dreissena; therefore, energy diverted to Dreissena production was a real loss for slimy sculpins. The shifts in the diet of these benthic fishes corresponded with drastic changes in the benthic community between 1992 and 1999. The collapse of Diporeia, formerly the most abundant macroinvertebrate in the benthic community, along with sharp declines in the abundance of Oligochaeta and Sphaeriidae, coincided with the establishment and rapid expansion of Dreissena bugensis, the quagga mussel, and to a lesser degree Dreissena polymorpha, the zebra mussel. It appears that the Diporeia population first collapsed at depths >70 m in southeastern Lake Ontario by autumn 1992, at shallower depths in the eastern Lake Ontario by 1995, and along the entire south shore line at depths 100 m by 1999. In response to the disappearance of Diporeia, populations of two native benthivores, slimy sculpin and lake whitefish, collapsed in eastern Lake Ontario, perhaps due in part to starvation, because Diporeia was their principal prey. Presently, alternative food resources do not appear sufficient to sustain these two benthivores at their former levels of abundance. We do not expect slimy

  10. Primary structures of three fragments of proglucagon from the pancreatic islets of the daddy Sculpin (Cottus scorpius).

    Conlon, J M; Falkmer, S; Thim, L

    1987-04-01

    Three peptides isolated from the Brockmann bodies of the daddy sculpin, a teleostean fish, have been identified as fragments of one or more proglucagons. The peptide L Q D A E D S S R F D A D D T L A G E A R E L S T P K represents the NH2 terminus of proglucagon (residues 1-27), H S E G T F S N D Y S K Y L E T R R A Q D F V Q W L K N S represents glucagon and H A D G T F T S D V S S Y L N D Q A I K D F V A K L K S G K V represents the glucagon-like peptide at the COOH terminus of the precursor. The fast-atom bombardment mass spectra of the three peptides were consistent with the proposed structures and demonstrated that further posttranslational modifications of the peptides had not taken place. Sculpin glucagon is identical to anglerfish glucagon II but sculpin proglucagon(1-27) and glucagon-like peptide show stronger homology to the corresponding regions of anglerfish proglucagon I than to proglucagon II. The structures of the peptides are suggestive of the action of trypsin-like and carboxypeptidase-B-like enzymes at the site of pairs of basic amino acid residues in proglucagon. The presence of a COOH-terminal lysyl group in proglucagon(1-27) may indicate, however, that the penultimate prolyl residue partially inhibits the action of the carboxypeptidase-B-like activity.

  11. Effects of un-ionized ammonia on histological, endocrine, and whole organism endpoints in slimy sculpin (Cottus cognatus)

    Spencer, P. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)], E-mail: paula.spencer@usask.ca; Pollock, R.; Dube, M. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)

    2008-12-11

    Ammonia is known to be an important toxicant in aquatic environments. Although ammonia toxicity has been well studied in many fish species, effects of chronic exposure on slimy sculpin (Cottus cognatus), a critical biomonitoring species for northern aquatic habitats, are not well known. Further, with increasing mining development in Canada's north, this information is critical to better predict potential effects of mine effluent discharges on northern fish species. Slimy sculpin were exposed to six concentrations of un-ionized ammonia (NH{sub 3}) relevant to concentrations found in northern mining effluents: control (0 ppm), 0.278 ppm, 0.556 ppm, 0.834 ppm, 1.112 ppm, and 1.668 ppm. An LC{sub 50} of 1.529 ppm was calculated from mortality data. Histopathological examination of gills indicated significant tissue damage, measured as lamellar fusion and epithelial lifting, at 0.834 ppm, 1.112 ppm, and 1.668 ppm. Using gill endpoints, NOEC and LOEC were calculated as 0.556 ppm and 0.834 ppm, respectively. An EC{sub 50} of 0.775 ppm was determined for lamellar fusion and an EC{sub 50} of 0.842 ppm for epithelial lifting. Hemorrhage of gills was present in mortalities, which occurred at 1.668 ppm of un-ionized ammonia. A significant decrease in liver somatic index (LSI) was seen in both male and female fish at 0.834 ppm and 1.112 ppm, respectively. Gonadosomatic index (GSI) in female fish significantly increased at 1.668 ppm un-ionized ammonia with an associated significant increase in total wholebody testosterone concentrations. GSI in male fish also significantly increased at 1.668 ppm but no differences were seen in testosterone concentrations. No significant differences were seen in gonad histopathological assessments or condition factor. Gill histopathology endpoints may be a more sensitive indicator for detecting effects in slimy sculpin exposed to ammonia than traditional chronic endpoints. Results from this study indicate that ammonia concentrations commonly

  12. Impact of ocean acidification on the hypoxia tolerance of the woolly sculpin, Clinocottus analis.

    Hancock, Joshua R; Place, Sean P

    2016-01-01

    As we move into the Anthropocene, organisms inhabiting marine environments will continue to face growing challenges associated with changes in ocean pH (ocean acidification), dissolved oxygen (dead zones) and temperature. These factors, in combination with naturally variable environments such as the rocky intertidal zone, may create extreme physiological challenges for organisms that are already performing near their biological limits. Although numerous studies have examined the impacts of climate-related stressors on intertidal animals, little is known about the underlying physiological mechanisms driving adaptation to ocean acidification and how this may alter organism interactions, particularly in marine vertebrates. Therefore, we have investigated the effects of decreased ocean pH on the hypoxia response of an intertidal sculpin, Clinocottus analis . We used both whole-animal and biochemistry-based analyses to examine how the energetic demands associated with acclimation to low-pH environments may impact the fish's reliance on facultative air breathing in low-oxygen environments. Our study demonstrated that acclimation to ocean acidification resulted in elevated routine metabolic rates and acid-base regulatory capacity (Na + ,K + -ATPase activity). These, in turn, had downstream effects that resulted in decreased hypoxia tolerance (i.e. elevated critical oxygen tension). Furthermore, we present evidence that these fish may be living near their physiological capacity when challenged by ocean acidification. This serves as a reminder that the susceptibility of teleost fish to changes in ocean pH may be underestimated, particularly when considering the multiple stressors that many experience in their natural environments.

  13. Using molecular biomarkers and traditional morphometric measurements to assess the health of slimy sculpin (Cottus cognatus) from streams with elevated selenium in North-Eastern British Columbia.

    Miller, Lana L; Isaacs, Meghan A; Martyniuk, Christopher J; Munkittrick, Kelly R

    2015-10-01

    Canadian fish-based environmental effects monitoring programs use individual and population-level endpoints to assess aquatic health. Impacts of coal mining and selenium (Se) exposure were assessed in slimy sculpin (Cottus cognatus) from reference streams located both inside and outside of a coal zone, and from 1 stream with a history of coal mining, using traditional environmental effects monitoring endpoints. In addition, physical characteristics of the streams and benthic macro-invertebrate communities were assessed. To determine whether the assessment of effects could be improved by including molecular markers, real-time polymerase chain reaction assays were optimized for genes associated with reproduction (vtg, esr1, star, cyp19a1, and gys2), and oxidative and cellular stress (sod1, gpx, gsr, cat, and hsp 90). Water Se levels exceeded guidelines in the stream with historical mining (4 μg/L), but benthic macroinvertebrates did not exceed dietary thresholds (2-3 μg/g dry wt). Whole-body Se levels were above British Columbia's tissue guideline in fish from all streams, but only above the draft US Environmental Protection Agency (USEPA) criterion (7.91 μg/g dry wt) at the reference stream inside the coal zone. Some markers of cellular and oxidative stress were elevated in fish liver at the exposed site (sod1, gpx), but some were lower (cat, sod1, gpx, gsr, hsp90) in the gonads of fish inside the coal zone. Some of the differences in gene expression levels between the reference and impacted sites were sex dependent. Based on benthic macroinvertebrate assessments, the authors hypothesize that traditional and molecular differences in slimy sculpin at impacted sites may be driven by food availability rather than Se exposure. The present study is the first to adapt molecular endpoints in the slimy sculpin for aquatic health assessments. © 2015 SETAC.

  14. The effect of bloom of filamentous green algae on the reproduction of yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottoidae) during ecological crisis in Lake Baikal.

    Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A

    2016-03-01

    In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population.

  15. Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder.

    Conlon, J M; Davis, M S; Falkmer, S; Thim, L

    1987-11-02

    The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.

  16. Complete Mitochondrial Genomes of the Cherskii’s Sculpin and Siberian Taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome

    Evgeniy S Balakirev

    2017-08-01

    Full Text Available The complete mitochondrial (mt genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3% has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027. At the same time, a surprisingly low level of divergence (1.4% has been detected between the GenBank C czerskii (KJ956027 and the Amur sculpin Cottus szanaga (KX762049, KX762050. We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1, bearing 2 introgressed fragments (≈0.9 kb [kilobase] from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550. Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.

  17. Complete Mitochondrial Genomes of the Cherskii's Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome.

    Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

    2017-01-01

    The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii's sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.

  18. Adaptive genomic divergence under high gene flow between freshwater and brackish-water ecotypes of prickly sculpin (Cottus asper) revealed by Pool-Seq.

    Dennenmoser, Stefan; Vamosi, Steven M; Nolte, Arne W; Rogers, Sean M

    2017-01-01

    Understanding the genomic basis of adaptive divergence in the presence of gene flow remains a major challenge in evolutionary biology. In prickly sculpin (Cottus asper), an abundant euryhaline fish in northwestern North America, high genetic connectivity among brackish-water (estuarine) and freshwater (tributary) habitats of coastal rivers does not preclude the build-up of neutral genetic differentiation and emergence of different life history strategies. Because these two habitats present different osmotic niches, we predicted high genetic differentiation at known teleost candidate genes underlying salinity tolerance and osmoregulation. We applied whole-genome sequencing of pooled DNA samples (Pool-Seq) to explore adaptive divergence between two estuarine and two tributary habitats. Paired-end sequence reads were mapped against genomic contigs of European Cottus, and the gene content of candidate regions was explored based on comparisons with the threespine stickleback genome. Genes showing signals of repeated differentiation among brackish-water and freshwater habitats included functions such as ion transport and structural permeability in freshwater gills, which suggests that local adaptation to different osmotic niches might contribute to genomic divergence among habitats. Overall, the presence of both repeated and unique signatures of differentiation across many loci scattered throughout the genome is consistent with polygenic adaptation from standing genetic variation and locally variable selection pressures in the early stages of life history divergence. © 2016 John Wiley & Sons Ltd.

  19. Complex postglacial recolonization inferred from population genetic structure of mottled sculpin Cottus bairdii in tributaries of eastern Lake Michigan, U.S.A.

    Homola, J J; Ruetz, C R; Kohler, S L; Thum, R A

    2016-11-01

    This study used analyses of the genetic structure of a non-game fish species, the mottled sculpin Cottus bairdii to hypothesize probable recolonization routes used by cottids and possibly other Laurentian Great Lakes fishes following glacial recession. Based on samples from 16 small streams in five major Lake Michigan, U.S.A., tributary basins, significant interpopulation differentiation was documented (overall F ST = 0·235). Differentiation was complex, however, with unexpectedly high genetic similarity among basins as well as occasionally strong differentiation within basins, despite relatively close geographic proximity of populations. Genetic dissimilarities were identified between eastern and western populations within river basins, with similarities existing between eastern and western populations across basins. Given such patterns, recolonization is hypothesized to have occurred on three occasions from more than one glacial refugium, with a secondary vicariant event resulting from reduction in the water level of ancestral Lake Michigan. By studying the phylogeography of a small, non-game fish species, this study provides insight into recolonization dynamics of the region that could be difficult to infer from game species that are often broadly dispersed by humans. © 2016 The Fisheries Society of the British Isles.

  20. Recent changes in the deep-water fish populations of Lake Michigan

    Moffett, James W.

    1957-01-01

    The deep-water fish fauna of Lake Michigan consisted of lake trout (Salvelinus namaycush), burbot (Lota lota maculosa), seven species of chubs or deep-water ciscoes (Leucichthys spp.), and the deep-water sculpin (Myoxocephalus quadricornis). Other species occupied the deep-water zone but were not typically part of the fauna.

  1. Complete Mitochondrial Genomes of the Cherskii’s Sculpin Cottus czerskii and Siberian Taimen Hucho taimen Reveal GenBank Entry Errors: Incorrect Species Identification and Recombinant Mitochondrial Genome

    Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J

    2017-01-01

    The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii. A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii. Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis, submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information. PMID:28890653

  2. Juvenile groundfish habitat in Kachemak Bay, Alaska, during late summer

    Abookire, Alisa A.; Piatt, John F.; Norcross, Brenda L.

    2001-01-01

    We investigated the habitat of juvenile groundfishes in relation to depth, water temperature, and salinity in Kachemak Bay, Alaska. Stations ranging in depth from 10 to 70 m and with sand or mud-sand substrates were sampled with a small-meshed beam trawl in August-September of 1994 to 1999. A total of 8,201 fishes were captured, comprising at least 52 species. Most fishes (91%) had a total length 5% of the total catch) were flathead sole Hippoglossoides elassodon, slim sculpin Radulinus asprellus, Pacific halibut Hippoglossus stenolepis, and arrowtooth flounder Atheresthes stomias. Depth accounted for most of the spatial variability in juvenile groundfish abundance, and neither temperature nor salinity was correlated with fish abundance. Juvenile groundfishes concentrated in either shallow (less than or equal to 20 m) or deep (50-70 m) water, with co-occurrence of some species between 30-40 m. Shallow fishes were the rock soles, Pacific halibut, and great sculpin Myoxocephalus polyacanthocephalus. Deep species were flathead sole, slim sculpin, spinycheek starsnout Bathyagonus infraspinatus, rex sole Glyptocephalus zachirus, tadpole sculpin Psychrolutes paradoxus, and whitebarred prickleback Poroclinus rothrocki. This 6-year study provides baseline data on relative abundance and distribution of juvenile groundfishes in Kachemak Bay and may provide a useful tool for predicting the presence of species in similar habitats in other areas of Alaska.

  3. Benthic prey fish assessment, Lake Ontario 2013

    Weidel, Brian C.; Walsh, Maureen; Connerton, Michael J.

    2014-01-01

    The 2013 benthic fish assessment was delayed and shortened as a result of the U.S. Government shutdown, however the assessment collected 51 of the 62 planned bottom trawls. Over the past 34 years, Slimy Sculpin abundance in Lake Ontario has fluctuated, but ultimately decreased by two orders of magnitude, with a substantial decline occurring in the past 10 years. The 2013 Slimy Sculpin mean bottom trawl catch density (0.001 ind.·m-2, s.d.= 0.0017, n = 52) and mean biomass density (0.015 g·m-2 , s.d.= 0.038, n = 52) were the lowest recorded in the 27 years of sampling using the original bottom trawl design. From 2011-2013, the Slimy Sculpin density and biomass density has decreased by approximately 50% each year. Spring bottom trawl catches illustrate Slimy Sculpin and Round Goby Neogobius melanostoma winter habitat overlaps for as much as 7 months out of a year, providing opportunities for competition and predation. Invasive species, salmonid piscivory, and declines in native benthic invertebrates are likely all important drivers of Slimy Sculpin population dynamics in Lake Ontario. Deepwater Sculpin Myoxocephalus thompsonii, considered rare or absent from Lake Ontario for 30 years, have generally increased over the past eight years. For the first time since they were caught in this assessment, Deepwater Sculpin density and biomass density estimates declined from the previous year. The 2013 abundance and density estimates for trawls covering the standard depths from 60m to 150m was 0.0001 fish per square meter and 0.0028 grams per square meter. In 2013, very few small (recruitment. Nonnative Round Gobies were first detected in the USGS/NYSDEC Lake Ontario spring Alewife assessment in 2002. Since that assessment, observations indicate their population has expanded and they are now found along the entire south shore of Lake Ontario, with the highest densities in U.S. waters just east of the Niagara River confluence. In the 2013 spring-based assessment, both the

  4. Elevated temperature exacerbates Ichthyophonus infections in buffalo sculpin

    Halpenny, C.M.; Kocan, R.M.; Winton, J.R.; Perry, J.A.; Hershberger, P.K.

    2002-01-01

    High incidences of Ichthyophonus hoferi, a parasite primarily of marine and estuarine fishes, have recently been reported in rockfishes and Pacific herring from the eastern North Pacific (Kent et al 2001, Hershberger et al 2002). Taxonomic position of I. hoferi remains unresolved, but recent phylogenetic studies have grouped the organism with Dermocystidium, Psorospermium, the rosette agent of salmonids, and Rhinosporidium in the Mesomycetozoa, a novel clade of protists near the animal-fungal divergence (Herr et al 1999). Genetic differences among isolates from the east coast of North America indicate that more than one species of Ichthyophonus exist (Rand et al 2000), and different species have likely been assigned the same name based on morphological characteristics. Therefore, hereafter in this manuscript, the organism will be referred to as Ichthyophonus .

  5. Visual sensitivity of deepwater fishes in Lake Superior.

    Kelly A Harrington

    Full Text Available The predator-prey interactions in the offshore food web of Lake Superior have been well documented, but the sensory systems mediating these interactions remain unknown. The deepwater sculpin, (Myoxocephalus thompsoni, siscowet (Salvelinus namaycush siscowet, and kiyi (Coregonus kiyi inhabit low light level environments. To investigate the potential role of vision in predator-prey interactions, electroretinography was used to determine visual sensitivity for each species. Spectral sensitivity curves revealed peak sensitivity at 525 nm for each species which closely corresponds to the prevalent downwelling light spectrum at depth. To determine if sufficient light was available to mediate predator-prey interactions, visual sensitivity was correlated with the intensity of downwelling light in Lake Superior to construct visual depth profiles for each species. Sufficient daytime irradiance exists for visual interactions to approximately 325 m for siscowet and kiyi and 355 m for the deepwater sculpin during summer months. Under full moon conditions, sufficient irradiance exists to elicit ERG response to light available at approximately 30 m for the siscowet and kiyi and 45 m for the deepwater sculpin. Visual interactions are therefore possible at the depths and times when these organisms overlap in the water column indicating that vision may play a far greater role at depth in deep freshwater lakes than had been previously documented.

  6. Epidermis structure and blood parameter differences between sculpin Cottus gobio and Siberian sculpin Cottus poecilopus from the Morava watershed

    Halačka, Karel; Vítek, T.; Vetešník, Lukáš; Spurný, P.

    2012-01-01

    Roč. 61, č. 1 (2012), s. 9-16 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : goblet cell * sacciform cell * erythrocyte * leucocyte Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  7. Relationship between oxidizable fatty acid content and level of antioxidant glutathione peroxidases in marine fish

    Grim, Jeffrey M.; Hyndman, Kelly A.; Kriska, Tamas; Girotti, Albert W.; Crockett, Elizabeth L.

    2011-01-01

    SUMMARY Biological membranes can be protected from lipid peroxidation by antioxidant enzymes including catalase (CAT) and selenium-dependent glutathione peroxidases 1 and 4 (GPx1 and GPx4). Unlike GPx1, GPx4 can directly detoxify lipid hydroperoxides in membranes without prior action of phospholipase A2. We hypothesized that (1) GPx4 is enhanced in species that contain elevated levels of highly oxidizable polyunsaturated fatty acids (PUFA) and (2) activities of antioxidant enzymes are prioritized to meet species-specific oxidative stresses. In this study we examined (i) activities of the oxidative enzyme citrate synthase (CS) and antioxidant (CAT, GPx1 and GPx4) enzymes, (ii) GPx4 protein expression, and (iii) phospholipid composition in livers of five species of marine fish (Myxine glutinosa, Petromyzon marinus, Squalus acanthias, Fundulus heteroclitus and Myoxocephalus octodecemspinosus) that contain a range of PUFA. GPx4 activity was, on average, 5.8 times higher in F. heteroclitus and S. acanthias than in the other three marine fish species sampled. Similarly, activities of CAT and GPx1 were highest in S. acanthias and F. heteroclitus, respectively. GPx4 activity for all species correlates with membrane unsaturation, as well as oxidative activity as indicated by CS. These data support our hypothesis that GPx4 level in marine fish is a function, at least in part, of high PUFA content in these animals. GPx1 activity was also correlated with membrane unsaturation, indicating that marine species partition resources among glutathione-dependent defenses for protection from the initial oxidative insult (e.g. H2O2) and to repair damaged lipids within biological membranes. PMID:22031739

  8. Evaluating the biodegradability and effects of dispersed oil using Arctic test species and conditions: phase 2 activities

    MacFarlin, Kelly M.; Perkins, Robert A. [University of Alaska Fairbanks (United States)], email: raperkins@alaska.edu; Gardiner, William W.; Word, Jack D. [NewFields NorthWest (United States)

    2011-07-01

    In the event of a marine oil spill, managers have to make correct and rapid decisions, weighing a number of possibilities, which include natural attenuation, mechanical recovery, in situ burning, and/or chemical dispersion. To do this, the relative toxicity of physically and chemically dispersed fresh oil and the rates of biodegradation for fresh and weathered oil need to be understood in advance. A joint industry program was established in 2008 to research and discuss these areas. Phase 1 activities included determining the species relevant to the Beaufort and Chukchi Sea ecosystems, creating and setting up a toxicity and biodegradation laboratory with a cold room in Barrow, Alaska, developing collection and culture methods for test organisms, and developing toxicity and biodegradation test protocols. The second phase of this now completed research is discussed in this paper. It consisted of toxicity testing of the local environmentally significant species, the copepod (C. glacialis), Arctic cod (B. saida), and larval sculpin (Myoxocephalus sp.).

  9. Studies of evolutionary temperature adaptation: muscle function and locomotor performance in Antarctic fish.

    Franklin, C E

    1998-09-01

    1. Studies of evolutionary temperature adaptation of muscle and locomotor performance in fish are reviewed with a focus on the Antarctic fauna living at subzero temperatures. 2. Only limited data are available to compare the sustained and burst swimming kinematics and performance of Antarctic, temperate and tropical species. Available data indicate that low temperatures limit maximum swimming performance and this is especially evident in fish larvae. 3. In a recent study, muscle performance in the Antarctic rock cod Notothenia coriiceps at 0 degree C was found to be sufficient to produce maximum velocities during burst swimming that were similar to those seen in the sculpin Myoxocephalus scorpius at 10 degrees C, indicating temperature compensation of muscle and locomotor performance in the Antarctic fish. However, at 15 degrees C, sculpin produce maximum swimming velocities greater than N. coriiceps at 0 degree C. 4. It is recommended that strict hypothesis-driven investigations using ecologically relevant measures of performance are undertaken to study temperature adaptation in Antarctic fish. Recent detailed phylogenetic analyses of the Antarctic fish fauna and their temperate relatives will allow a stronger experimental approach by helping to separate what is due to adaptation to the cold and what is due to phylogeny alone.

  10. Lake Ontario benthic prey fish assessment, 2015

    Weidel, Brian C.; Walsh, Maureen; Holden, Jeremy P.; Connerton, Michael J.

    2016-01-01

    Benthic prey fishes are a critical component of the Lake Ontario food web, serving as energy vectors from benthic invertebrates to native and introduced piscivores. Since the late 1970’s, Lake Ontario benthic prey fish status was primarily assessed using bottom trawl observations confined to the lake’s south shore, in waters from 8 – 150 m (26 – 492 ft). In 2015, the Benthic Prey Fish Survey was cooperatively adjusted and expanded to address resource management information needs including lake-wide benthic prey fish population dynamics. Effort increased from 55 bottom trawl sites to 135 trawl sites collected in depths from 8 - 225m (26 – 738 ft). The spatial coverage of sampling was also expanded and occurred in all major lake basins. The resulting distribution of tow depths more closely matched the available lake depth distribution. The additional effort illustrated how previous surveys were underestimating lake-wide Deepwater Sculpin, Myoxocephalus thompsonii, abundance by not sampling in areas of highest density. We also found species richness was greater in the new sampling sites relative to the historic sites with 11 new fish species caught in the new sites including juvenile Round Whitefish, Prosopium cylindraceum, and Mottled sculpin, Cottus bairdii. Species-specific assessments found Slimy Sculpin, Cottus cognatus abundance increased slightly in 2015 relative to 2014, while Deepwater Sculpin and Round Goby, Neogobius melanostomus, dramatically increased in 2015, relative to 2014. The cooperative, lake-wide Benthic Prey Fish Survey expanded our understanding of benthic fish population dynamics and habitat use in Lake Ontario. This survey’s data and interpretations influence international resource management decision making, such as informing the Deepwater Sculpin conservation status and assessing the balance between sport fish consumption and prey fish populations. Additionally a significant Lake Ontario event occurred in May 2015 when a single

  11. Sphaeromyxa artedielli sp. n. (Myxozoa: Sphaeromyxidae), a parasite of sculpins (Cottidae) in northern Norway

    Karlsbakk, E.; Bårdsgjære Einen, A.C.; Bartošová, Pavla

    2013-01-01

    Roč. 60, č. 5 (2013), s. 425-432 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GPP506/11/P724 Institutional support: RVO:60077344 Keywords : Myxosporeans * marine fish * new species * Artediellus atlanticus * Triglops murrayi * SSU rRNA gene sequences * pseudogene * northern Atlantic Ocean * Sphaeromyxa balbianii Subject RIV: EE - Microbiology, Virology Impact factor: 1.211, year: 2013

  12. 77 FR 59488 - Endangered and Threatened Wildlife and Plants; Endangered Status for Grotto Sculpin and...

    2012-09-27

    ... true for waste waters from septic systems (Aley 2012, pers. comm.). Contamination of groundwater by... degradation of aquatic resources, including such things as illegal waste disposal, chemical leaching, contaminated groundwater, vertical drains, urban development, sedimentation, and industrial sand mining...

  13. Toxaphene in the aquatic environment of Greenland

    Vorkamp, Katrin; Rigét, Frank F.; Dietz, Rune

    2015-01-01

    The octa- and nonachlorinated bornanes (toxaphene) CHBs 26, 40, 41, 44, 50 and 62 were analysed in Arctic char (Salvelinus alpinus), shorthorn sculpin (Myoxocephalus scorpius), ringed seal (Pusa hispida) and black guillemot eggs (Cepphus grylle) from Greenland. Despite their high trophic level, ringed seals had the lowest concentrations of these species, with a Σ 6 Toxaphene median concentration of 13–20 ng/g lipid weight (lw), suggesting metabolisation. The congener composition also suggests transformation of nona- to octachlorinated congeners. Black guillemot eggs had the highest concentrations (Σ 6 Toxaphene median concentration of 971 ng/g lw). Although concentrations were higher in East than in West Greenland differences were smaller than for other persistent organic pollutants. In a circumpolar context, toxaphene had the highest concentrations in the Canadian Arctic. Time trend analyses showed significant decreases for black guillemot eggs and juvenile ringed seals, with annual rates of −5 to −7% for Σ 6 Toxaphene. The decreases were generally steepest for CHBs 40, 41 and 44. - Highlights: • Toxaphene was detected in freshwater and marine species of Greenland. • Relatively low concentrations in ringed seal suggest metabolisation. • The concentrations in Greenland appear lower than those in the Canadian Arctic. • Significant decreases were found in juvenile ringed seals and black guillemot eggs. - The banned insecticide toxaphene is widely present in the aquatic environment of Greenland, but concentrations are decreasing

  14. Estimating differential reproductive success from nests of related individuals, with application to a study of the Mottled Sculpin, Cottus bairdi

    Beatrix Jones; Gary D. Grossman; Daniel C.I. Walsh; Brady A. Porter; John C. Avise; Anthony C. Flumera

    2007-01-01

    Understanding how variation in reproductive success is related to demography is a critical component in understanding the life history of an organism. Parentage analysis using molecular markers can be used to estimate the reproductive success of different groups of individuals in natural populations. Previous models have been developed for cases where offspring are...

  15. Biological recipient control at the Ringhals nuclear power plant. Annual report for 2011

    Jansson, Maria; Gustavsson, Frida; Fagerholm, Bjoern

    2012-01-01

    The cooling system of the Ringhals nuclear power plant affects the fish community in two steps. In the first step, seawater is used to cool the system in the nuclear power plant. Fish eggs, larvae and small juveniles are carried by the incoming water and are exposed to risk of damage or mortality. In the second step the heated water is released back into the sea, where the fish is affected by the increase in temperature. Reactor 1 and reactor 3 at Ringhals nuclear power plant produced electricity during the major part of the year 2011, with exceptions for the annual audits, and shorter stops in production. Reactor 2 only operated between January and April, due to a fire which led to a shutdown and a thorough remediation work during the rest of the year. Reactor 4 was producing electricity from January to June, but was later shutdown due to a prolonged annual audit until November. Fish eggs and fish larvae are sampled in the incoming cooling water using a modified Bongo net to monitor losses of eggs and larvae in the nuclear power plant. The abundance of shorthorn sculpin larvae (Myoxocephalus scorpius) has decreased since the sampling period started, although it is still the most abundant larvae. Also the abundance of rock gunnel larvae (Pholis gunnellus) has decreased over the years. To sample juvenile fish a modified Isaacs-Kidd midwater-trawl is used. This sampling is mainly focused on glass eels (Anguilla anguilla). The abundance of glass eels have declined strongly since the beginning of the 1980's, but a minor increase was observed in 2011. The decline of the glass eel abundance is most probably due to a general decrease in recruitment and not to a local effect caused by the nuclear power plant. The effects of the heated water released into the sea are monitored by fykenet surveys in the recipient as well as in a reference area. These two areas are monitored in two seasons to compare differences between the two areas in naturally cold and warm water of the

  16. Biological recipient control at the Ringhals nuclear power plant. Annual report for 2011; Biologisk recipientkontroll vid Ringhals kaernkraftverk. Aarsrapport foer 2011

    Jansson, Maria; Gustavsson, Frida; Fagerholm, Bjoern

    2012-07-01

    The cooling system of the Ringhals nuclear power plant affects the fish community in two steps. In the first step, seawater is used to cool the system in the nuclear power plant. Fish eggs, larvae and small juveniles are carried by the incoming water and are exposed to risk of damage or mortality. In the second step the heated water is released back into the sea, where the fish is affected by the increase in temperature. Reactor 1 and reactor 3 at Ringhals nuclear power plant produced electricity during the major part of the year 2011, with exceptions for the annual audits, and shorter stops in production. Reactor 2 only operated between January and April, due to a fire which led to a shutdown and a thorough remediation work during the rest of the year. Reactor 4 was producing electricity from January to June, but was later shutdown due to a prolonged annual audit until November. Fish eggs and fish larvae are sampled in the incoming cooling water using a modified Bongo net to monitor losses of eggs and larvae in the nuclear power plant. The abundance of shorthorn sculpin larvae (Myoxocephalus scorpius) has decreased since the sampling period started, although it is still the most abundant larvae. Also the abundance of rock gunnel larvae (Pholis gunnellus) has decreased over the years. To sample juvenile fish a modified Isaacs-Kidd midwater-trawl is used. This sampling is mainly focused on glass eels (Anguilla anguilla). The abundance of glass eels have declined strongly since the beginning of the 1980's, but a minor increase was observed in 2011. The decline of the glass eel abundance is most probably due to a general decrease in recruitment and not to a local effect caused by the nuclear power plant. The effects of the heated water released into the sea are monitored by fykenet surveys in the recipient as well as in a reference area. These two areas are monitored in two seasons to compare differences between the two areas in naturally cold and warm water of

  17. Trophic transfer of persistent organochlorine contaminants (OCs) within an Arctic marine food web from the southern Beaufort-Chukchi Seas

    Hoekstra, P.F.; O'Hara, T.M.; Fisk, A.T.; Borgaa, K.; Solomon, K.R.; Muir, D.C.G.

    2003-01-01

    The trophic status and biomagnification of persistent OCs within the near-shore Beaufort-Chukchi Seas food web from Barrow, AK is discussed. - Stable isotope values (δ 13 C, δ 15 N) and concentrations of persistent organochlorine contaminants (OCs) were determined to evaluate the near-shore marine trophic status of biota and biomagnification of OCs from the southern Beaufort-Chukchi Seas (1999-2000) near Barrow, AK. The biota examined included zooplankton (Calanus spp.), fish species such as arctic cod (Boreogadus saida), arctic char (Salvelinus alpinus), pink salmon (Oncorhynchus gorbuscha), and fourhorn sculpin (Myoxocephalus quadricornis), along with marine mammals, including bowhead whales (Balaena mysticetus), beluga whales (Delphinapterus leucas), ringed seals (Phoca hispida) and bearded seals (Erignathus barbatus). The isotopically derived trophic position of biota from the Beaufort-Chukchi Seas marine food web, avian fauna excluded, is similar to other coastal food webs in the Arctic. Concentrations of OCs in marine mammals were significantly greater than in fish and corresponded with determined trophic level. In general, OCs with the greatest food web magnification factors (FWMFs) were those either formed due to biotransformation (e.g. p,p'-DDE, oxychlordane) or considered recalcitrant (e.g. β-HCH, 2,4,5-Cl substituted PCBs) in most biota, whereas concentrations of OCs that are considered to be readily eliminated (e.g. γ-HCH) did not correlate with trophic level. Differences in physical-chemical properties of OCs, feeding strategy and possible biotransformation were reflected in the variable biomagnification between fish and marine mammals. The FWMFs in the Beaufort-Chukchi Seas region were consistent with reported values in the Canadian Arctic and temperate food webs, but were statistically different than FWMFs from the Barents and White Seas, indicating that the spatial variability of OC contamination in top-level marine Arctic predators is

  18. Changes in the Lake Michigan food web following dreissenid mussel invasions: A synthesis

    Madenjian, Charles P.; Bunnell, David B.; Warner, David M.; Pothoven, Steven A.; Fahnenstiel, Gary L.; Nalepa, Thomas F.; Vanderploeg, Henry A.; Tsehaye, Iyob; Claramunt, Randall M.; Clark, Richard D

    2015-01-01

    Using various available time series for Lake Michigan, we examined changes in the Lake Michigan food web following the dreissenid mussel invasions and identified those changes most likely attributable to these invasions, thereby providing a synthesis. Expansion of the quagga mussel (Dreissena rostriformis bugensis) population into deeper waters, which began around 2004, appeared to have a substantial predatory effect on both phytoplankton abundance and primary production, with annual primary production in offshore (> 50 m deep) waters being reduced by about 35% by 2007. Primary production likely decreased in nearshore waters as well, primarily due to predatory effects exerted by the quagga mussel expansion. The drastic decline inDiporeia abundance in Lake Michigan during the 1990s and 2000s has been attributed to dreissenid mussel effects, but the exact mechanism by which the mussels were negatively affecting Diporeia abundance remains unknown. In turn, decreased Diporeiaabundance was associated with reduced condition, growth, and/or energy density in alewife (Alosa pseudoharengus), lake whitefish (Coregonus clupeaformis), deepwater sculpin (Myoxocephalus thompsonii), and bloater (Coregonus hoyi). However, lake-wide biomass of salmonines, top predators in the food web, remained high during the 2000s, and consumption of alewives by salmonines actually increased between the 1980–1995 and 1996–2011 time periods. Moreover, abundance of the lake whitefish population, which supports Lake Michigan's most valuable commercial fishery, remained at historically high levels during the 2000s. Apparently, counterbalancing mechanisms operating within the complex Lake Michigan food web have enabled salmonines and lake whitefish to retain relatively high abundances despite reduced primary production.

  19. 2D or Not 2D? Testing the Utility of 2D Vs. 3D Landmark Data in Geometric Morphometrics of the Sculpin Subfamily Oligocottinae (Pisces; Cottoidea).

    Buser, Thaddaeus J; Sidlauskas, Brian L; Summers, Adam P

    2018-05-01

    We contrast 2D vs. 3D landmark-based geometric morphometrics in the fish subfamily Oligocottinae by using 3D landmarks from CT-generated models and comparing the morphospace of the 3D landmarks to one based on 2D landmarks from images. The 2D and 3D shape variables capture common patterns across taxa, such that the pairwise Procrustes distances among taxa correspond and the trends captured by principal component analysis are similar in the xy plane. We use the two sets of landmarks to test several ecomorphological hypotheses from the literature. Both 2D and 3D data reject the hypothesis that head shape correlates significantly with the depth at which a species is commonly found. However, in taxa where shape variation in the z-axis is high, the 2D shape variables show sufficiently strong distortion to influence the outcome of the hypothesis tests regarding the relationship between mouth size and feeding ecology. Only the 3D data support previous studies which showed that large mouth sizes correlate positively with high percentages of elusive prey in the diet. When used to test for morphological divergence, 3D data show no evidence of divergence, while 2D data show that one clade of oligocottines has diverged from all others. This clade shows the greatest degree of z-axis body depth within Oligocottinae, and we conclude that the inability of the 2D approach to capture this lateral body depth causes the incongruence between 2D and 3D analyses. Anat Rec, 301:806-818, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  20. Operations Charioteer, Musketeer, Touchstone, Cornerstone, Aqueduct, Sculpin and Julin. Tests Mill Yard, Diamond Beech, Mighty Oak, Middle Note Mission Ghost, Mission Cyber, Misty Echo, Disko Elm, Mineral Quarry, Distant Zenith, Diamond Fortune, and Hunters Trophy

    1999-05-01

    2l.SU -Wf6e:uJfr-02tSU -V 69E ;W 9-2l IS« 0VS9 v 6se :w e"g(HSH ttWS:uJB-86SU ¥0l-8:uJ9"fr6SUOVW WW2 :lug-98SU U68l-:ujg-,£SSH — —VZL-VU61ZSU...and JAYCOR conducted infrared window material optical properties experiments; Lawrence Livermore National Laboratory (LLNL) conducted 146 device

  1. Operations Charioteer, Musketeer, Touchstone, Cornerstone, Aqueduct, Sculpin and Julin. Tests Mill Yard, Diamond Beech, Mighty Oak, Middle Note Mission Ghost, Mission Cyber, Misty Echo, Disko Elm, Mineral Quarry, Distant Zenith, Diamond Fortune, and Hunters Trophy

    Schoengold, Carole

    1999-01-01

    ...; Tests MILL YARD, DIAMOND BEECH, MIGHTY OAK, MIDDLE NOTE, MISSION GHOST, MISSION CYBER, MISTY ECHO, DISKO ELM, MINERAL QUARRY, DISTANT ZENITH, DIAMOND FORTUNE, and HUNTERS TROPHY, 9 October 1985 to 18 September 1992...

  2. Aquaculture disturbance impacts the diet but not ecological linkages of a ubiquitous predatory fish

    McPeek, Kathleen C.; McDonald, P. Sean; VanBlaricom, Glenn

    2015-01-01

    Aquaculture operations are a frequent and prominent cause of anthropogenic disturbance to marine and estuarine communities and may alter species composition and abundance. However, little is known about how such disturbances affect trophic linkages or ecosystem functions. In Puget Sound, Washington, aquaculture of the Pacific geoduck clam (Panopea generosa) is increasing and involves placing nets and polyvinyl chloride (PVC) tubes in intertidal areas to protect juvenile geoducks from predators. Initial studies of the structured phase of the farming cycle have documented limited impacts on the abundance of some species. To examine the effect of geoduck aquaculture on ecological linkages, the trophic relationships of a local ubiquitous consumer, Pacific staghorn sculpin (Leptocottus armatus), to its invertebrate prey were compared between geoduck aquaculture sites and nearby reference areas with no aquaculture. Mark-recapture data indicated that sculpin exhibit local site fidelity to cultured and reference areas. The stomach contents of sculpin and stable isotope signatures of sculpin and their prey were examined to study the trophic ecology of cultured and reference areas. Results showed that the structured phase of geoduck aquaculture initiated some changes to staghorn sculpin ecology, as reflected in sculpin diet through stomach content analysis. However, carbon and nitrogen stable isotopes revealed that the general food web function of sculpin remained unchanged. The source of carbon at the base of the food web and the trophic position of sculpin were not impacted by geoduck aquaculture. The study has important implications for geoduck aquaculture management and will inform regulatory decisions related to shellfish aquaculture policy.

  3. Mercury levels and potential risk from subsistence foods from the Aleutians.

    Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Tim; Snigaroff, Ronald; Snigaroff, Dan; Patrick, Robert; Weston, Jim

    2007-10-01

    Considerable attention has been devoted to contaminants (mainly PCBs and mercury) in subsistence foods (particularly fish) from various parts of the world. However, relatively little attention has been devoted to examining mercury levels in a full range of subsistence foods from a particular region. While managers and scientists compute risk based on site-specific data on contaminant levels and consumption rates, a first step in making risk decisions by subsistence peoples is knowledge about the relative levels of mercury in the foods they eat. This study examined levels of mercury in subsistence foods (edible components) from several islands in the western Aleutians of Alaska, including algae (4 species), invertebrates (9 species), fish (15 species) and birds (5 species). Samples were gathered by both subsistence hunters/fishers and by scientists using the same equipment. Another objective was to determine if there were differences in mercury levels in subsistence foods gathered from different Aleutian islands. We tested the null hypotheses that there were no interspecific and interisland differences in mercury levels. Because of variation in distribution and the nature of subsistence hunting and fishing, not all organisms were collected from each of the islands. There were significant and important differences in mercury levels among species, but the locational differences were rather small. There was an order of magnitude difference between algae/some invertebrates and fish/birds. Even within fish, there were significant differences. The highest mean mercury levels were in flathead sole (Hippoglossoides elassodon, 0.277 ppm), yellow irish lord (Hemilepidotus jardani, 0.281 ppm), great sculpin (Myoxocephalus polyacanthocephalus, 0.366 ppm), glaucous-winged gull (Larus glaucescens, 0.329 ppm) and its eggs (0.364 ppm), and pigeon guillemot (Cepphus columba, 0.494 ppm). Mercury levels increased with increasing weight of the organisms for limpets (Tectura scutum

  4. Brown trout and food web interactions in a Minnesota stream

    Zimmerman, J.K.H.; Vondracek, B.

    2007-01-01

    1. We examined indirect, community-level interactions in a stream that contained non-native brown trout (Salmo trutta Linnaeus), native brook trout (Salvelinus fontinalis Mitchill) and native slimy sculpin (Cottus cognatus Richardson). Our objectives were to examine benthic invertebrate composition and prey selection of fishes (measured by total invertebrate dry mass, dry mass of individual invertebrate taxa and relative proportion of invertebrate taxa in the benthos and diet) among treatments (no fish, juvenile brook trout alone, juvenile brown trout alone, sculpin with brook trout and sculpin with brown trout). 2. We assigned treatments to 1 m2 enclosures/exclosures placed in riffles in Valley Creek, Minnesota, and conducted six experimental trials. We used three designs of fish densities (addition of trout to a constant number of sculpin with unequal numbers of trout and sculpin; addition of trout to a constant number of sculpin with equal numbers of trout and sculpin; and replacement of half the sculpin with an equal number of trout) to investigate the relative strength of interspecific versus intraspecific interactions. 3. Presence of fish (all three species, alone or in combined-species treatments) was not associated with changes in total dry mass of benthic invertebrates or shifts in relative abundance of benthic invertebrate taxa, regardless of fish density design. 4. Brook trout and sculpin diets did not change when each species was alone compared with treatments of both species together. Likewise, we did not find evidence for shifts in brown trout or sculpin diets when each species was alone or together. 5. We suggest that native brook trout and non-native brown trout fill similar niches in Valley Creek. We did not find evidence that either species had an effect on stream communities, potentially due to high invertebrate productivity in Valley Creek. ?? 2007 Blackwell Publishing Ltd.

  5. Evaluating the negative effect of benthic egg predators on bloater recruitment in northern Lake Michigan

    Bunnell, David B.; Mychek-Londer, Justin G.; Diana, James S.; Stott, Wendylee; Madenjian, Charles P.

    2012-01-01

    As the only extant deepwater cisco in Lake Michigan, bloater is currently at record low levels of abundance.  Several mechanisms to regulate their recruitment have been proposed, including skewed sex ratios, predation on their larvae by adult alewife, and climatic factors during early life history stages, but none has unequivocal support.  In this research, we evaluated an alternative mechanism of egg predation that was supported by an inverse relationship between bloater recruitment and biomass of slimy sculpin, which are known to be effective egg predators.  To that end, we used a combination of field sampling, laboratory experiments, and modeling to estimate the proportion of bloater eggs consumed by sculpins each year between 1973 and 2008.  Monthly field sampling between January through May 2009-2010 (when bloater eggs were incubating) offshore of Frankfort (Michigan), Sturgeon Bay (Wisconsin), Two Rivers (Wisconsin), and Muskegon (Michigan) provided benthivore diets for subsequent laboratory processing.  Identification and enumeration of stomach contents and subsequent genetic analyses of eggs revealed that the mean proportion of bloater eggs in slimy sculpin diets (N = 1016) equaled 0.04.  Bloater eggs also were consumed by deepwater sculpins (N = 699) at a slightly lower mean proportion (0.02), and only one round goby diet among 552 enumerated revealed a bloater egg.  Based on the diet results, we developed daily ration models to estimate consumption for both deepwater and slimy sculpins.  We conducted feeding experiments to estimate gastric evacuation (GEVAC) for water temperatures ranging 2-5 °C, similar to those observed during egg incubation.  GEVAC rates equaled 0.0115/ h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin.  Index of fullness [(g prey/g fish weight)100%] was estimated from sculpins sampled in

  6. Experimental Gravel Bar Habitat Creation in the Tombigbee River, Mississippi

    Miller, Andrew C

    2006-01-01

    Prior to development of the Tennessee Tombigbee Waterway (TTW), the Tombigbee River was well-known for supporting a dense and diverse fauna, including sculpins, minnows, mussels, snails, worms, and immature insects...

  7. Identification of natural hybrids between Cottus poecilopus, Heckel, 1837, and Cottus gobio, Linnaeus, 1758, at a hybrid zone on the Svratka River (Czech Republic)

    Vítek, T.; Halačka, Karel; Bartoňová-Marešová, Eva; Vetešník, Lukáš; Spurný, P.

    2014-01-01

    Roč. 30, č. 1 (2014), s. 102-108 ISSN 0175-8659 Institutional support: RVO:68081766 Keywords : Fish communities * sculpins Cottus * bullhead * Pisces * Pleistocene Subject RIV: EG - Zoology Impact factor: 0.867, year: 2014

  8. The influence of cooling water outlet of the Ringhals power plant on the coastal fish colony

    Neuman, E.

    1988-03-01

    Fish abundance has been monitored with fyke nets in 1976-1987 at the cooling-water outlet from the Ringhals nuclear power plant at the Swedish west coast and in a reference area. Judging from the dependence of the catches on temperature, Myoxocephalus scorpius, Zoarces viviparus, Gadus morhua and Platichtys flesus can be classified as cold-water species and Symphodus melops, Ctenolabrus rupestris, Carci nus maenas and Anguilla anguilla as warm-water species. As a rule the warm-water species were more and the cold-water fishes less abundant in the outlet area than in the reference area. The catch of the economically important Anguilla was about three times greater in the heated area. A lower abundance than expected of Ctenolabrus and Myoxocephalus at the outlet may be caused by a loss of eggs and larvae in the cooling-water system. (author)

  9. Bottom trawl assessment of Lake Ontario prey fishes

    Weidel, Brian C.; Connerton, Michael J.; Holden, Jeremy

    2018-01-01

    Managing Lake Ontario fisheries in an ecosystem-context requires prey fish community and population data. Since 1978, multiple annual bottom trawl surveys have quantified prey fish dynamics to inform management relative to published Fish Community Objectives. In 2017, two whole-lake surveys collected 341 bottom trawls (spring: 204, fall: 137), at depths from 8-225m, and captured 751,350 fish from 29 species. Alewife were 90% of the total fish catch while Deepwater Sculpin, Round Goby, and Rainbow Smelt comprised the majority of the remaining total catch (3.8, 3.1, and 1.1% respectively). The adult Alewife abundance index for US waters increased in 2017 relative to 2016, however the index for Canadian waters declined. Adult Alewife condition, assessed by the predicted weight of a 165 mm fish (6.5 inches), declined in 2017 from record high values observed in spring 2016. Spring 2017 Alewife condition was slightly less than the 10-year average, but the fall value was well below the 10-year average, likely due to increased Age-1 Alewife abundance. The Age-1 Alewife abundance index was the highest observed in 40 years, and 8-times higher than the previous year. The Age-1 index estimates Alewife reproductive success the preceding year. The warm summer and winter of 2016 likely contributed to the large year class. In contrast the relatively cool 2017 spring and cold winter may result in a lower than average 2017 year class. Abundance indices for Rainbow Smelt, Cisco, and Emerald Shiner either declined or remained at low levels in 2017. Pelagic prey fish diversity continues to be low since a single species, Alewife, dominates the catch. Deepwater Sculpin were the most abundant benthic prey fish in 2017 because Round Goby abundance declined sharply from 2016. Slimy Sculpin density continued to decline and the 2017 biomass index for US waters was the lowest ever observed. Prior to Round Goby proliferation, juvenile Slimy Sculpin comprised ~10% of the Slimy Sculpin catch, but

  10. New eastern Pacific Ocean record of the rare deep-water fish, Psychrolutes phrictus (Scorpaeniformes: Psychrolutidae)

    Aguirre-Villaseñor, Hugo; Cruz-Acevedo, Edgar; Salas-Singh, Carolina

    2016-01-01

    Abstract: Psychrolutes phrictus is a benthic deep sea fish known from the eastern North Pacific. On 30 March 2008, a specimen of the blob sculpin P. phrictus (297 mm LT) was caught off the Guerrero coast, Mexico (17°45′24″N, 101°59′04″W). The blob sculpin was taken at a depth of 1,100 m within a temperature range of 3.88-4.25 °C, where hypoxic (0.57-0.39 mg/l) conditions prevailed; the specimen was captured over a muddy bottom using a benthic sledge. Representatives of this species had never ...

  11. NATIVE AND INTRODUCED LARVAL FISHES IN SUISAN MARSH, CALIFORNIA,: THE EFFECTS OF FRESHWATER FLOW

    We sampled ichthyoplankton weekly in Suisun Marsh in the San Francisco Estuary from February to June each year from 1994 to 1999. We collected approximately 227,900 fish, predominantly shimofuri goby Tridentiger bifasciatus (60%) and prickly sculpin Cottus asper (33%). Principal ...

  12. Offshore Fish Community: Ecological Interactions

    The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone...

  13. Community shelter use in response to two benthic decapod predators in the Long Island Sound.

    Hudson, David M; Reagan, Dugan; Crivello, Joseph F

    2016-01-01

    To investigate community shelter effects of two invasive decapod species, Hemigrapsus sanguineus and Carcinus maenas, in the Long Island Sound (LIS), we deployed artificial shelters in the intertidal and immediate subtidal zones. These consisted of five groups during the summer: a control, a resident H. sanguineus male or female group, and a resident C. maenas male or female group. We quantified utilization of the shelters at 24 h by counting crabs and fish present. We found significant avoidance of H. sanguineus in the field by benthic hermit crabs (Pagurus spp.) and significant avoidance of C. maenas by the seaboard goby (Gobiosoma ginsburgi). The grubby (Myoxocephalus aenaeus) avoided neither treatment, probably since it tends to be a predator of invertebrates. H. sanguineus avoided C. maenas treatments, whereas C. maenas did not avoid any treatment. Seasonal deployments in the subtidal indicated cohabitation of a number of benthic species in the LIS, with peak shelter use corresponding with increased predation and likely reproductive activity in spring and summer for green crabs (C. maenas), hermit crabs (Pagurus spp.), seaboard gobies (G. ginsburgi), and grubbies (Myoxocephalus aenaeus).

  14. Community shelter use in response to two benthic decapod predators in the Long Island Sound

    David M. Hudson

    2016-07-01

    Full Text Available To investigate community shelter effects of two invasive decapod species, Hemigrapsus sanguineus and Carcinus maenas, in the Long Island Sound (LIS, we deployed artificial shelters in the intertidal and immediate subtidal zones. These consisted of five groups during the summer: a control, a resident H. sanguineus male or female group, and a resident C. maenas male or female group. We quantified utilization of the shelters at 24 h by counting crabs and fish present. We found significant avoidance of H. sanguineus in the field by benthic hermit crabs (Pagurus spp. and significant avoidance of C. maenas by the seaboard goby (Gobiosoma ginsburgi. The grubby (Myoxocephalus aenaeus avoided neither treatment, probably since it tends to be a predator of invertebrates. H. sanguineus avoided C. maenas treatments, whereas C. maenas did not avoid any treatment. Seasonal deployments in the subtidal indicated cohabitation of a number of benthic species in the LIS, with peak shelter use corresponding with increased predation and likely reproductive activity in spring and summer for green crabs (C. maenas, hermit crabs (Pagurus spp., seaboard gobies (G. ginsburgi, and grubbies (Myoxocephalus aenaeus.

  15. Susceptibility of various Japanese freshwater fish species to an isolate of viral haemorrhagic septicaemia virus (VHSV) genotype IVb

    Ito, Takafumi; Olesen, Niels Jørgen

    2013-01-01

    Genotype IVb of viral haemorrhagic septicaemia virus (VHSV) was isolated for the first time in the Great Lakes basin in 2003, where it spread and caused mass mortalities in several wild fish species throughout the basin. In order to prevent further spreading of the disease and to assess risks...... mortalities in bluegill Lepomis macrochirus used as positive controls, Japanese fluvial sculpin Cottus pollux, and iwana Salvelinus leucomaenis pluvius were 50, 80 and 0%, respectively. In Expt 2, cumulative mortalities of 100, 100 and 10% were observed in Japanese fluvial sculpin C. pollux, Japanese rice......-isolation by cell culture was successful from all dead fish. We detected the virus in the brain from a few surviving bluegill 50 d post exposure by both cell culture and RT-PCR. These results revealed that VHSV IVb could become a serious threat to wild freshwater fish species in Japan, and that some surviving fish...

  16. Viability and infectivity of Ichthyophonus sp. in post-mortem Pacific herring, Clupea pallasii.

    Kocan, Richard; Hart, Lucas; Lewandowski, Naomi; Hershberger, Paul

    2014-12-01

    Ichthyophonus-infected Pacific herring, Clupea pallasii , were allowed to decompose in ambient seawater then serially sampled for 29 days to evaluate parasite viability and infectivity for Pacific staghorn sculpin, Leptocottus armatus . Ichthyophonus sp. was viable in decomposing herring tissues for at least 29 days post-mortem and could be transmitted via ingestion to sculpin for up to 5 days. The parasite underwent morphologic changes during the first 48 hr following death of the host that were similar to those previously reported, but as host tissue decomposition progressed, several previously un-described forms of the parasite were observed. The significance of long-term survival and continued morphologic transformation in the post-mortem host is unknown, but it could represent a saprozoic phase of the parasite life cycle that has survival value for Ichthyophonus sp.

  17. On behavioural responses to smell and sight of alpine bullhead Cottus poecilopus Heckel for an allopatric and a sympatric population of brown trout Salmo trutta L.

    Hauge, Joakim

    2007-01-01

    Freshwater sculpins and salmonids coexist in many streams throughout the Northern hemisphere, and often constitute an important component of stream ecosystems. Alpine bullhead Cottus poecilopus Heckel have been known to predate eggs and fry of brown trout Salmo trutta L., and also to function as a competitor to older brown trout for habitat and prey items. This study was designed to examine possible behavioural differences in activity level and positioning between a sympatric and an allopatri...

  18. 78 FR 13813 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands; 2013 and...

    2013-03-01

    ..., sculpins, sharks, squids, and octopuses. \\5\\ In December 2012 the Council recommended that the red king... decreased because of smaller OFLs and ABCs resulting from lower biomass estimates. The TACS for octopuses... Squids BSAI 2,620 1,970 700 595 0 2,620 1,970 700 595 0 Octopuses BSAI 3,450 2,590 500 425 0 3,450 2,590...

  19. Temporal changes in the prevalence of parasites in two Oregon estuary-dwelling fishes.

    Olson, Robert E; Pierce, Jack R; Jacobson, Kym C; Burreson, Eugene M

    2004-06-01

    The parasite faunas of juvenile English sole (Parophrys vetulus) in 1971-1972 and staghorn sculpin (Leptocottus armatus) in 1971 from Yaquina Bay, Oregon, were compared with faunas found in the same estuary in 1997-2000 (English sole) and 1999-2000 (staghorn sculpin). The 7 most commonly occurring parasites in 1971 were compared with the same species observed during the same month and sampling sites in 1997-2000. Multivariate community analysis of juvenile English sole parasites supported the suggestion that the 1971 parasite data were representative of the early-1970s time period. Four of the parasite species infecting English sole and 6 of those infecting staghorn sculpins had significantly lower prevalences in 1997-2000. Parasite species with significantly lower prevalences also had reduced intensity levels. One parasite (Glugea stephani) of English sole increased in prevalence in the 1997-2000 samples in association with the warm estuarine temperatures during the 1997 El Niño year. Although the causes for the changes in occurrence of other parasites were not determined, ecological changes in Yaquina Bay that may have influenced parasite ecology include apparent changes in the estuary ichthyofauna that occurred between the sampling periods. Such changes could be associated with increases in the number of California sea lions (Zalophus californianus) subsequent to establishment of the Marine Mammal Protection Act in 1972.

  20. Fish assemblage structure and relations with environmental conditions in a Rocky Mountain watershed

    Quist, M.C.; Hubert, W.A.; Isaak, D.J.

    2004-01-01

    Fish and habitat were sampled from 110 reaches in the Salt River basin (Idaho and Wyoming) during 1996 and 1997 to assess patterns in fish assemblage structure across a Rocky Mountain watershed. We identified four distinct fish assemblages using cluster analysis: (1) allopatric cutthroat trout (Oncorhynchus clarki (Richardson, 1836)); (2) cutthroat trout - brook trout (Salvelinus fontinalis (Mitchell, 1814)) - Paiute sculpin (Cottus beldingi Eigenmann and Eigenmann, 1891); (3) cutthroat trout - brown trout (Salmo trutta L., 1758) - mottled sculpin (Cottus bairdi Girard, 1850); and (4) Cyprinidae-Catostomidae. The distribution of fish assemblages was explained by thermal characteristics, stream geomorphology, and local habitat features. Reaches with allopatric cutthroat trout and the cutthroat trout - brook trout - Paiute sculpin assemblage were located in high-elevation, high-gradient streams. The other two fish assemblages were generally located in low-elevation streams. Associations between habitat gradients, locations of reaches in the watershed, and occurrence of species were further examined using canonical correspondence analysis. The results suggest that stream geomorphology, thermal conditions, and local habitat characteristics influence fish assemblage structure across a Rocky Mountain watershed, and they provide information on the ecology of individual species that can guide conservation activities. ?? 2004 NRC Canada.

  1. Spatial distribution of pelagic fish larvae in the northern main basin of Lake Huron

    Roseman, Edward F.; O'Brien, Timothy P.

    2013-01-01

    Larval fish occurrence in inshore and offshore zones in the northern main basin of Lake Huron was assessed during 2007 as part of a larger ecological examination of Lake Huron foodwebs and habitats. Day and night collections using neuston and conical nets at inshore (1.5–15 m depths) and offshore (37 and 91 m depths) locations at De Tour and Hammond Bay to assess the abundance, phenology, and spatial distribution of pelagic ichthyoplankton during spring and early summer were made. In general, densities of larval fishes were higher at De Tour than Hammond Bay during daytime neuston net collections, with the exception of Longnose Sucker, which were only collected at Hammond Bay. Lake Whitefish, Burbot, and Rainbow Smelt dominated inshore catches in early spring with Cisco, Deepwater Sculpin, Emerald Shiner, Bloater, Slimy Sculpin, Ninespine Stickleback, and Yellow Perch larvae also collected.Nighttime nearshore and offshore sampling revealed that Rainbow Smelt and Burbot larvae were present in relatively high abundances compared to inshore densities. Concentrations of larvae of deepwater demersal fishes such as Lake Whitefish and Deepwater Sculpin suggest that inshore zones in northern Lake Huron are important nursery habitats emphasizing a critical production and recruitment linkage between inshore and deepwater zones.

  2. The morphology and sculpture of ossicles in the Cottidae (Teleostei of the Baltic Sea

    Heli Špilev

    2010-09-01

    Full Text Available Small to very small ossified structures (ossicles such as cephalic horns, dermal tubercles, fin-ray rods, lateral-line canal segments, branchial tooth plates and gill-raker tubercles of three species of the teleostean fish family Cottidae inhabiting the Baltic Sea are described and for the first time illustrated with SEM images, with emphasis on their microscopic external features. The morphology and sculpture of these small ossicles notably differ in the three genera, but differences can also occur between males and females, as documented here in Myoxocephalus scorpius (Linnaeus. The detailed features of such ossicles are potentially useful for taxonomic identification in sea-floor sediments or gut contents, in a manner similar to their use in many modern and fossil fishes, and may also prove useful as phylogenetically important characters at generic and familial levels.

  3. Congener Patterns of Persistent Organic Pollutants Establish the Extent of Contaminant Biotransport by Pacific Salmon in the Great Lakes.

    Gerig, Brandon S; Chaloner, Dominic T; Janetski, David J; Rediske, Richard R; O'Keefe, James P; Moerke, Ashley H; Lamberti, Gary A

    2016-01-19

    In the Great Lakes, introduced Pacific salmon (Oncorhynchus spp.) can transport persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs), to new environments during their spawning migrations. To explore the nature and extent of POP biotransport by salmon, we compared 58 PCB and 6 PBDE congeners found in spawning salmon directly to those in resident stream fish. We hypothesized that stream fish exposed to salmon spawners would have congener patterns similar to those of salmon, the presumed contaminant source. Using permutational multivariate analysis of variance (PERMANOVA) and nonmetric multidimensional scaling (NMDS), we found that POP congener patterns of Pacific salmon varied among regions in the Great Lakes basin (i.e., Lake Huron, Lake Michigan, or Lake Superior), tissue type (whole fish or eggs), and contaminant type (PCB or PBDE). For stream-resident fish, POP congener pattern was influenced by the presence of salmon, location (i.e., Great Lakes Basin), and species identity (i.e., brook trout [Salvelinus fontinalis] or mottled sculpin [Cottus bairdii]). Similarity in congener patterns indicated that salmon are a source of POPs to brook trout in stream reaches receiving salmon spawners from Lake Michigan and Lake Huron but not from Lake Superior. Congener patterns of mottled sculpin differed from those of brook trout and salmon, suggesting that brook trout and mottled sculpin either use salmon tissue to differing degrees, acquire POPs from different dietary sources, or bioaccumulate or metabolize POPs differently. Overall, our analyses identified the important role of salmon in contaminant biotransport but also demonstrated that the extent of salmon-mediated POP transfer and uptake in Great Lakes tributaries is location- and species-specific.

  4. Status and trends of prey fish populations in Lake Michigan, 2013

    Madenjian, Charles P.; Bunnell, David B.; Desorcie, Timothy J.; Kostich, Melissa Jean; Armenio, Patricia M.; Adams, Jean V.

    2015-01-01

    The U.S. Geological Survey Great Lakes Science Center has conducted lake-wide surveys of the fish community in Lake Michigan each fall since 1973 using standard 12-m bottom trawls towed along contour at depths of 9 to 110 m at each of seven index transects. The resulting data on relative abundance, size and age structure, and condition of individual fishes are used to estimate various population parameters that are in turn used by state and tribal agencies in managing Lake Michigan fish stocks. All seven established index transects of the survey were completed in 2013. The survey provides relative abundance and biomass estimates between the 5-m and 114-m depth contours of the lake (herein, lake-wide) for prey fish populations, as well as burbot, yellow perch, and the introduced dreissenid mussels. Lake-wide biomass of alewives in 2013 was estimated at 29 kilotonnes (kt, 1 kt = 1000 metric tonnes), which was more than three times the 2012 estimate. However, the unusually high standard error associated with the 2013 estimate indicated no significant increase in lake-wide biomass between 2012 and 2013. Moreover, the age distribution of alewives remained truncated with no alewife exceeding an age of 5. The population of age-1 and older alewives was dominated (i.e., 88%) by the 2010 and 2012 year-classes. Record low biomass was observed for deepwater sculpin (1.3 kt) and ninespine stickleback (0.004 kt) in 2013, while bloater (1.6 kt) and rainbow smelt (0.2 kt) biomasses remained at low levels. Slimy sculpin lake-wide biomass was 0.32 kt in 2013, marking the fourth consecutive year of a decline. The 2013 biomass of round goby was estimated at 10.9 kt, which represented the peak estimate to date. Burbot lake-wide biomass (0.4 kt in 2013) has remained below 3 kt since 2001. Numeric density of age-0 yellow perch (i.e., fish per ha, which is indicative of a relatively poor year-class. Lake-wide biomass estimate of dreissenid mussels in 2013 was 23.2 kt. Overall, the total

  5. Environmental Baseline Studies of St. Marys River Near Neebish Island, Michigan, Prior to Proposed Extension of Navigation Season, 1981. Great Lakes- St. Lawrence Seaway, Navigation Season Extension Program

    1983-06-01

    developmental stage were usually measured. All fish larvae were identified to the lowest taxonomic unit. Complete descriptions of the early life history ...14 04 e44 14 C4 04 %1 On 14 U.0 ’. 1 (T% N Nq N4 C14 Ř 00 IkeA .4 IA C4 - * eq N C- * en .4 .4 U in * . n . aD cc Cn -4 0o en % z ; 0 c 0O 0: oc 0 i...Dissertation. Mich. State Univ. In preparation. Bailey, J. E. 1952. Life history and ecology of the sculpin Cottus bairdi punctulatus in southwestern

  6. The offshore benthic fish community

    Lantry, Brian F.; Lantry, Jana R.; Weidel, Brian C.; Walsh, Maureen; Hoyle, James A.; Schaner, Teodore; Neave, Fraser B.; Keir, Michael

    2014-01-01

    Lake Ontario’s offshore benthic fish community includes primarily slimy sculpin, lake whitefish, rainbow smelt, lake trout, burbot, and sea lamprey. Of these, lake trout have been the focus of an international restoration effort for more than three decades (Elrod et al. 1995; Lantry and Lantry 2008). The deepwater sculpin and three species of deepwater ciscoes (Coregonus spp.) that were historically important in the offshore benthic zone became rare or were extirpated by the 1960s (Christie 1973; Owens et al. 2003; Lantry et al. 2007b; Roth et al. 2013). Ecosystem changes continue to influence the offshore benthic fish community, including the effects of dreissenid mussels, the near disappearance of burrowing amphipods (Diporeia spp.) (Dermott et al. 2005; Watkins et al. 2007), and the increased abundance and expanded geographic distribution of round goby (see Nearshore Fish Community chapter) (Lantry et al. 2007b). The fish-community objectives for the offshore benthic fish community, as described by Stewart et al. (1999), are:

  7. Life history and biogeographic diversification of an endemic western North American freshwater fish clade using a comparative species tree approach.

    Baumsteiger, Jason; Kinziger, Andrew P; Aguilar, Andres

    2012-12-01

    The west coast of North America contains a number of biogeographic freshwater provinces which reflect an ever-changing aquatic landscape. Clues to understanding this complex structure are often encapsulated genetically in the ichthyofauna, though frequently as unresolved evolutionary relationships and putative cryptic species. Advances in molecular phylogenetics through species tree analyses now allow for improved exploration of these relationships. Using a comprehensive approach, we analyzed two mitochondrial and nine nuclear loci for a group of endemic freshwater fish (sculpin-Cottus) known for a wide ranging distribution and complex species structure in this region. Species delimitation techniques identified three novel cryptic lineages, all well supported by phylogenetic analyses. Comparative phylogenetic analyses consistently found five distinct clades reflecting a number of unique biogeographic provinces. Some internal node relationships varied by species tree reconstruction method, and were associated with either Bayesian or maximum likelihood statistical approaches or between mitochondrial, nuclear, and combined datasets. Limited cases of mitochondrial capture were also evident, suggestive of putative ancestral hybridization between species. Biogeographic diversification was associated with four major regions and revealed historical faunal exchanges across regions. Mapping of an important life-history character (amphidromy) revealed two separate instances of trait evolution, a transition that has occurred repeatedly in Cottus. This study demonstrates the power of current phylogenetic methods, the need for a comprehensive phylogenetic approach, and the potential for sculpin to serve as an indicator of biogeographic history for native ichthyofauna in the region. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. Contaminants of emerging concern in a large temperate estuary.

    Meador, James P; Yeh, Andrew; Young, Graham; Gallagher, Evan P

    2016-06-01

    This study was designed to assess the occurrence and concentrations of a broad range of contaminants of emerging concern (CECs) from three local estuaries within a large estuarine ecosystem. In addition to effluent from two wastewater treatment plants (WWTP), we sampled water and whole-body juvenile Chinook salmon (Oncorhynchus tshawytscha) and Pacific staghorn sculpin (Leptocottus armatus) in estuaries receiving effluent. We analyzed these matrices for 150 compounds, which included pharmaceuticals, personal care products (PPCPs), and several industrial compounds. Collectively, we detected 81 analytes in effluent, 25 analytes in estuary water, and 42 analytes in fish tissue. A number of compounds, including sertraline, triclosan, estrone, fluoxetine, metformin, and nonylphenol were detected in water and tissue at concentrations that may cause adverse effects in fish. Interestingly, 29 CEC analytes were detected in effluent and fish tissue, but not in estuarine waters, indicating a high potential for bioaccumulation for these compounds. Although concentrations of most detected analytes were present at relatively low concentrations, our analysis revealed that overall CEC inputs to each estuary amount to several kilograms of these compounds per day. This study is unique because we report on CEC concentrations in estuarine waters and whole-body fish, which are both uncommon in the literature. A noteworthy finding was the preferential bioaccumulation of CECs in free-ranging juvenile Chinook salmon relative to staghorn sculpin, a benthic species with relatively high site fidelity. Published by Elsevier Ltd.

  9. Survey of fishes and environmental conditions in Abbotts Lagoon, Point Reyes National Seashore, California

    Saiki, M.K.; Martin, B.A.

    2001-01-01

    This study was conducted to gain a better understanding of fishery resources in Abbotts Lagoon, Point Reyes National Seashore. During February/March, May, August, and November 1999, fish were sampled with floating variable-mesh gill nets and small minnow traps from as many as 14 sites in the lagoon. Water temperature, dissolved oxygen, pH, total ammonia(NH3 + NH4+), salinity, turbidity, water depth, and bottom substrate composition were also measured at each site. A total of 2,656 fish represented by eight species was captured during the study. Gill nets captured Sacramento perch, Archoplites interruptus; largemouth bass, Micropterus salmoides; Pacific herring, Clupea pallasi; prickly sculpin, Cottus asper, silver surfperch, Hyperprosopon ellipticum; longfin smelt, Spirinchus thaleichthys; and striped bass, Morone saxatilis; whereas minnow traps captured Sacramento perch; prickly sculpin; and threespine stickleback, Gasterosteus aculeatus. Cluster analysis (Ward's minimum variance method of fish catch statistics identified two major species assemblages-the first dominated by Sacramento perch and, to a lesser extent, by largemouth bass, and the second dominated by Pacific herring and threespine stickleback. Simple discriminant analysis of environmental variables indicated that salinity contributed the most towards separating the two assemblages.

  10. Stable Isotopic Shifts in Fish Bones from Multiple Archeological Coastal Middens in Penobscot Bay, Maine

    Harris, C.; Johnson, B.; Ambrose, W. G.; Bourque, B.; Dostie, P.; Crowley, E.

    2010-12-01

    The carbon and nitrogen stable isotope compositions of collagen extracted from well-preserved archeological fish bones has the potential to provide useful information on fish diets and food web dynamics over time. Previous work on the Turner Farm archaeological site in Penobscot Bay, Gulf of Maine, reveals significant shifts in fish diets have occurred since European colonization (post 1620’s). The objective of the present study was to analyze samples from other archaeological sites within Penobscot Bay to characterize the spatial extent of the isotopic shift measured at Turner Farm. Stratified cod, flounder, and sculpin bones were analyzed from eight coastal middens located approximately 50km apart from one another within Penobscot Bay. The bones were sampled from three time horizons (0kya, 0.5-1kya, and 2.2-2.4kya). All bone samples were demineralized in 0.2M HCl at 4°C for 2 to 7 days and then extracted in 0.25M NaOH at 4°C for 1 to 2 hours. After freeze-drying, the bulk isotopic composition of each sample was analyzed using the EA-IRMS. In all stratigraphic horizons analyzed, cod were more enriched in δ13C and δ15N than sculpin, and flounder were the most depleted in δ13C and δ15N . However, the isotopic offsets between the fish species decreased from 2.4kya to the present. The nitrogen isotope composition was relatively constant over time and space for all species, implying that trophic levels for the fishes analyzed have not changed significantly in Penobscot Bay for the last 2,400 years. The carbon isotope composition also appears to be constant spatially in Penobscot Bay, however, the modern signal was more depleted than the paleo signal in all three species. The difference between the modern and paleo δ13C is ~5‰ for cod and flounder, and ~9‰ for sculpin. These shifts may, in part, be explained by decreases in both primary producer and prey species diversity, as kelp forests replace eelgrass beds in the Gulf of Maine.

  11. Geographic variation in host fish use and larval metamorphosis for the endangered dwarf wedgemussel

    White, Barbara (St. John); Ferreri, C. Paola; Lellis, William A.; Wicklow, Barry J.; Cole, Jeffrey C.

    2017-01-01

    Host fishes play a crucial role in survival and dispersal of freshwater mussels (Unionoida), particularly rare unionids at conservation risk. Intraspecific variation in host use is not well understood for many mussels, including the endangered dwarf wedgemussel (Alasmidonta heterodon) in the USA.Host suitability of 33 fish species for dwarf wedgemussel glochidia (larvae) from the Delaware and Connecticut river basins was tested in laboratory experiments over 9 years. Relative suitability of three different populations of a single host fish, the tessellated darter (Etheostoma olmstedi), from locations in the Connecticut, Delaware, and Susquehanna river basins, was also tested.Connecticut River basin A. heterodon metamorphosed into juvenile mussels on tessellated darter, slimy sculpin (Cottus cognatus), and Atlantic salmon (Salmo salar) parr. Delaware River basin mussels metamorphosed using these three species, as well as brown trout (Salmo trutta), banded killifish (Fundulus diaphanus), mottled sculpin (Cottus bairdii), striped bass (Morone saxatilis), and shield darter (Percina peltata). Atlantic salmon, striped bass, and sculpins were highly effective hosts, frequently generating 5+ juveniles per fish (JPF) and metamorphosis success (MS; proportion of attaching larvae that successfully metamorphose) ≥ 0.4, and producing juveniles in repeated trials.In experiments on tessellated darters, mean JPF and MS values decreased as isolation between the mussel source (Connecticut River) and each fish source increased; mean JPF = 10.45, 6.85, 4.14, and mean MS = 0.50, 0.41, and 0.34 in Connecticut, Delaware, and Susquehanna river darters, respectively. Host suitability of individual darters was highly variable (JPF = 2–11; MS = 0.20–1.0).The results show that mussel–host fish compatibility in A. heterodon differs among Atlantic coastal rivers, and suggest that hosts including anadromous Atlantic salmon and striped bass may help sustain A. heterodon in parts of

  12. Nursery use of shallow habitats by epibenthic fishes in Maine nearshore waters

    Lazzari, M. A.; Sherman, S.; Kanwit, J. K.

    2003-01-01

    Species richness and abundance of epibenthic fishes were quantified with daytime beam trawl tows in shallow water habitats during April-November 2000 of three mid-coast Maine estuaries: Casco Bay, Muscongus Bay and the Weskeag River. Five shallow (Gasterosteus aculeatus, Apeltes quadracus, Pungitius pungitius, Myoxocephalus aenaeus, and Cylcopterus lumpus. The fish community of mid-coast estuaries was dominated by young-of-the-year (YOY) and juvenile fishes and all of the habitat types function as nursery areas. Twelve species (38%) of commercial and recreational importance were collected in the three estuaries, but the percentage was higher in Casco Bay (44%) and the Weskeag River (46%). These species included Anguilla rostrata, Clupea harengus, Gadus morhua, Microgadus tomcod, Pollachius virens, Urophycis chuss, Urophycis regia, Urophycis tenuis, Osmerus mordax, Macrozoarces americanus, Tautogolabrus adspersus, and Pleuronectes americanus. Four species, G. morhua, M. tomcod, P. virens, and U. tenuis were more common in spring than summer or autumn. P. americanus was most abundant in summer followed by spring and autumn. This study documents the importance of shallow estuarine areas in Maine as nurseries for these species.

  13. Dispersion and bioaccumulation of elements from an open-pit olivine mine in Southwest Greenland assessed using lichens, seaweeds, mussels and fish.

    Søndergaard, Jens

    2013-08-01

    This study investigated dispersion and bioaccumulation of mining-related elements from an open-pit olivine mine at Seqi in Southwest Greenland (64° N) using lichens (Flavocetraria nivalis), seaweeds (Fucus vesiculosus), mussels (Mytilus edulis) and fish (Myoxocephalus scorpius). The mine operated between 2005 and 2009, and samples were taken every year within a monitoring area 0-17 km from the mine during the period 2004-2011. A total of 46 elements were analysed in the samples. After mining began, highly elevated metal concentrations, especially nickel (Ni), chromium (Cr), iron (Fe) and cobalt (Co), were observed in lichens relative to pre-mining levels (up to a factor of 130) caused by dust dispersion from the mining activity. Elevated metal concentrations could be measured in lichens in distances up to ~5 km from the mine/ore treatment facility. Moderately elevated concentrations of Ni and Cr (up to a factor of 7) were also observed in seaweeds and mussels but only in close vicinity (<1 km) to the mine. Analyses of fish showed no significant changes in element composition. After mine closure, the elevated metal concentrations in lichens, seaweeds and mussels decreased markedly, and in 2011, significantly elevated metal concentrations could only be measured in lichens and only within a distance of 1 km from the mine.

  14. Second Baseline Study in the Citronen Fjord Area North Greenland 1997

    Glahder, C.

    is not significantly different from that of uncontaminated fjords in West Greenland. This year relatively many Collared lemmings were seen which was probably the reason why one pair of Arctic foxes raised six cubs, why two pairs of Long-tailed skuas fled youngs (1 and 2), and why a Gyr falcon, female, was seen (a new...... period samples were collected of seaweed (Laminaria sp), fish (Fourhorned sculpin), river sediments, Arctic willow, Entired-leafed mountain avens, grasses and faeces from Muskox, Alpine hare and Collared lemming. These samples have been prepared for storage, and are now stored at the National...... Environmental Research Institute, Department of Arctic Environment together with the samples from the first baseline study in 1994. Sea water and fresh water were sampled and analysed for dissolved zinc. The total amount of zinc discharged from the Eastern River during the period from 22 June to 13 August...

  15. Mercury and selenium concentrations in biofilm, macroinvertebrates, and fish collected in the Yankee Fork of the Salmon River, Idaho, USA, and their potential effects on fish health

    Rhea, Darren T.; Farag, Aïda M.; Harper, David D.; McConnell, Elizabeth; Brumbaugh, William G.

    2013-01-01

    The Yankee Fork is a large tributary of the Salmon River located in central Idaho, USA, with an extensive history of placer and dredge-mining activities. Concentrations of selenium (Se) and mercury (Hg) in various aquatic trophic levels were measured in the Yankee Fork during 2001 and 2002. Various measurements of fish health were also performed. Sites included four on the mainstem of the Yankee Fork and two off-channel sites in partially reclaimed dredge pools used as rearing habitat for cultured salmonid eggs and fry. Hg concentrations in whole mountain whitefish and shorthead sculpin ranged from 0.28 to 0.56 μg/g dry weight (dw), concentrations that are generally less than those reported to have significant impacts on fish. Biofilm and invertebrates ranged from 0.05 to 0.43 μg Hg/g dw. Se concentrations measured in biota samples from the Yankee Fork were greater than many representative samples collected in the Snake and Columbia watersheds and often exceeded literature-based toxic thresholds. Biofilm and invertebrates ranged from 0.58 to 4.66 μg Se/g dw. Whole fish ranged from 3.92 to 7.10 μg Se/g dw, and gonads ranged from 6.91 to 31.84 μg Se/g dw. Whole-body Se concentrations exceeded reported toxicological thresholds at three of four sites and concentrations in liver samples were mostly greater than concentrations shown to have negative impacts on fish health. Histological examinations performed during this study noted liver abnormalities, especially in shorthead sculpin, a bottom-dwelling species.

  16. System-Wide Significance of Predation on Juvenile Salmonids in Columbia and Snake River Reservoirs : Annual Report 1992.

    Petersen, James H.; Poe, Thomas P.

    1993-12-01

    Northern squawfish (Ptychocheilus oregonensis) predation on juvenile salmonids was characterized during 1992 at ten locations in the Columbia River below Bonneville Dam and at three locations in John Day Reservoir. During the spring and summer, 1,487 northern squawfish were collected in the lower Columbia River and 202 squawfish were sampled in John Day Reservoir. Gut content data, predator weight, and water temperature were used to compute a consumption index (CI) for northern squawfish, and overall diet was also described. In the Columbia River below Bonneville Dam, northern squawfish diet was primarily fish (spring 69%; summer 53%), most of which were salmonids. Salmonids were also the primary diet component in the Bonneville Dam tailrace, John Day Dam forebay, and the McNary Dam tailrace. Crustaceans were the dominant diet item at the John Day mid-reservoir location, although sample sizes were small. About half of the non-salmonid preyfish were sculpins. The consumption index (CI) of northern squawfish was generally higher during summer than during spring. The highest CI`s were observed during summer in the tailrace boat restricted zones of Bonneville Dam (CI = 7.8) and McNary Dam (CI = 4.6). At locations below Bonneville Dam, CI`s were relatively low near Covert`s Landing and Rooster Rock, higher at four locations between Blue Lake and St. Helens, and low again at three downriver sites (Kalama, Ranier, and Jones Beach). Northern squawfish catches and CI`s were noticeably higher throughout the lower Columbia compared to mid-reservoir sites further upriver sampled during 1990--92. Predation may be especially intense in the free-flowing section of the Columbia River below Bonneville Dam. Smallmouth bass (Micropterus dolomieui; N = 198) ate mostly fish -- 25% salmonids, 29% sculpins, and 46% other fish. Highest catches of smallmouth bass were in the John Day Dam forebay.

  17. Mercury and persistent organic pollutants in native and invading forage species of the Canadian Arctic: Consequences for food web dynamics.

    Pedro, Sara; Fisk, Aaron T; Tomy, Gregg T; Ferguson, Steven H; Hussey, Nigel E; Kessel, Steven T; McKinney, Melissa A

    2017-10-01

    Contaminant dynamics within Arctic marine food webs may be altered through the climate-driven northward invasions of temperate/boreal species. Here, we compare tissue concentrations of total mercury (THg) and legacy and emerging persistent organic pollutants (POPs) in native versus invading forage species sampled from 2012 to 2014 near Arviat, Clyde River, and Resolute Bay, NU, representing, low, mid- and high eastern Canadian Arctic regions, respectively. Concentrations of THg, legacy Σ-polychlorinated biphenyls (ΣPCB) and Σ-organochlorine (ΣOC) pesticides were detected in all forage species, whereas emerging halogenated flame retardants were detected in only a few individuals. Concentrations of major contaminant groups among regions did not vary for Arctic cod (Boreogadus saida), while for sculpin (Cottoidea) there was no clear latitudinal trend. Thus, considering interspecific variation, native sculpin and northern shrimp (Pandalus borealis) had the highest overall concentrations of THg (0.17 ± 0.02 and 0.21 ± 0.01 μg g -1 wet weight, respectively), ΣPCB (322 ± 35 and 245 ± 25 ng g -1 lipid weight (lw), respectively), and ΣOC (413 ± 38 and 734 ± 64 ng g -1 lw, respectively). Comparing the keystone native species, Arctic cod, to its 'replacement' species, capelin (Mallotus villosus) and sandlance (Ammodytes spp.), THg concentrations were higher in Arctic cod compared to capelin (p compound patterns, in capelin and sandlance relative to Arctic cod seem, therefore, more likely related to a more "temperate"-type contaminant signature in the invaders. Nevertheless, the relatively small (up to two-fold) magnitude of these differences suggested limited effects of these ecological changes on contaminant uptake by Arctic piscivores. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Selected organic compounds and trace elements in streambed sediments and fish tissues, Cook Inlet Basin, Alaska

    Frenzel, Steven A.

    2000-01-01

    Organochlorines, semivolatile organic compounds (SVOCs), and trace elements were investigated in streambed sediments and fish tissues at selected sites in the Cook Inlet Basin, Alaska, during 1998. At most sites, SVOCs and organochlorine compounds were either not detected or detected at very low concentrations. Chester Creek at Arctic Boulevard at Anchorage, which was the only site sampled with a significant degree of development in the watershed, had elevated levels of many SVOCs in streambed sediment. Coring of sediments from two ponds on Chester Creek confirmed the presence of elevated concentrations of a variety of organic compounds. Moose Creek, a stream with extensive coal deposits in its watershed, had low concentrations of numerous SVOCs in streambed sediment. Three sites located in national parks or in a national wildlife refuge had no detectable concentrations of SVOCs. Trace elements were analyzed in both streambed sediments and tissues of slimy sculpin. The two media provided similar evidence for elevated concentrations of cadmium, lead, and zinc at Chester Creek. In this study, 'probable effect levels '(PELs) were determined from sediments finer than 0.063 millimeters, where concentrations tend to be greatest. Arsenic and chromium concentrations exceeded the PEL at eight and six sites respectively. Zinc exceeded the PEL at one site. Cadmium and copper concentrations were smaller than the PEL at all sites. Mercury concentrations in streambed sediments from the Deshka River were near the PEL, and selenium concentrations at that site also appear to be elevated above background levels. At half the sites where slimy sculpin were sampled, selenium concentrations were at levels that may cause adverse effects in some species.

  19. Comparison of thiaminase activity in fish using the radiometric and 4-nitrothiophenol colorimetric methods

    Honeyfield, D.C.; Hanes, J.W.; Brown, L.; Kraft, C.E.; Begley, T.P.

    2010-01-01

    Thiaminase induced thiamine deficiency occurs in fish, humans, livestock and wild animals. A non-radioactive thiaminase assay was described in 2007, but a direct comparison with the radioactive 14C-thiamine method which has been in use for more than 30years has not been reported. The objective was to measure thiaminase activity in forage fish (alewife Alosa pseudoharengus, rainbow smelt Osmerus mordax, and slimy sculpin Cottus cognatus) consumed by predators that manifest thiamine deficiency using both methods. Modifications were made to the colorimetric assay to improve repeatability. Modification included a change in assay pH, enhanced sample clean-up, constant assay temperature (37??C), increase in the concentration of 4-nitrothiophenol (4NTP) and use of a spectrophotometer fitted with a 0.2cm cell. A strong relationship between the two assays was found for 51 alewife (R2=0.85), 36 smelt (R2=0.87) and 20 sculpin (R2=0.82). Thiaminase activity in the colorimetric assay was about 1000 times higher than activity measured by the radioactive method. Application of the assay to fish species from which no thiaminase activity has previously been reported resulted in no 4NTP thiaminase activity being found in bloater Coregonus hoyi, lake trout Salvelinus namaycusch, steelhead trout Oncorhynchus mykiss or Chinook salmon Oncorhynchus tshawytscha. In species previously reported to contain thiaminase, 4NTP thiaminase activity was measured in bacteria Paenibacillus thiaminolyticus, gizzard shad Dorosoma cepedianum, bracken fern Pteridium aquilinum, quagga mussel Dreissena bugensis and zebra mussels D. polymorpha. ?? 2010.

  20. Higher mass-independent isotope fractionation of methylmercury in the pelagic food web of Lake Baikal (Russia).

    Perrot, Vincent; Pastukhov, Mikhail V; Epov, Vladimir N; Husted, Søren; Donard, Olivier F X; Amouroux, David

    2012-06-05

    Mercury undergoes several transformations that influence its stable isotope composition during a number of environmental and biological processes. Measurements of Hg isotopic mass-dependent (MDF) and mass-independent fractionation (MIF) in food webs may therefore help to identify major sources and processes leading to significant bioaccumulation of methylmercury (MeHg). In this work, δ(13)C, δ(15)N, concentration of Hg species (MeHg, inorganic Hg), and stable isotopic composition of Hg were determined at different trophic levels of the remote and pristine Lake Baikal ecosystem. Muscle of seals and different fish as well as amphipods, zooplankton, and phytoplankton were specifically investigated. MDF during trophic transfer of MeHg leading to enrichment of heavier isotopes in the predators was clearly established by δ(202)Hg measurements in the pelagic prey-predator system (carnivorous sculpins and top-predator seals). Despite the low concentrations of Hg in the ecosystem, the pelagic food web reveals very high MIF Δ(199)Hg (3.15-6.65‰) in comparison to coastal fish (0.26-1.65‰) and most previous studies in aquatic organisms. Trophic transfer does not influence MIF signature since similar Δ(199)Hg was observed in sculpins (4.59 ± 0.55‰) and seal muscles (4.62 ± 0.60‰). The MIF is suggested to be mainly controlled by specific physical and biogeochemical characteristics of the water column. The higher level of MIF in pelagic fish of Lake Baikal is mainly due to the bioaccumulation of residual MeHg that is efficiently turned over and photodemethylated in deep oligotrophic and stationary (i.e., long residence time) freshwater columns.

  1. Connectivity and conditional models of access and abundance of species in stream networks.

    Chelgren, Nathan D; Dunham, Jason B

    2015-07-01

    Barriers to passage of aquatic organisms at stream road crossings are a major cause of habitat fragmentation in stream networks. Accordingly, large investments have been made to restore passage at these crossings, but often without estimation of population-level benefits. Here, we describe a broad-scale approach to quantifying the effectiveness of passage restoration in terms interpretable at population levels, namely numbers of fish and length of stream gained through restoration, by sampling abundance in a study design that accounts for variable biogeographic species pools, variable stream and barrier configurations, and variable probabilities of capture and detectability for multiple species. We modified an existing zero-inflated negative-binomial model to estimate the probability of site access, abundance conditional on access, and capture probability of individual fish. Therein, we modeled probability of access as a function of gradient, stream road-crossing type, and downstream access by fish simultaneously with a predictive model for abundance at sites accessible to fish. Results indicated that replacement of barriers with new crossing designs intended to allow for greater movement was associated with dramatically higher probability of access for all fishes, including migratory Pacific salmon, trout, sculpin, and lamprey. Conversely, existing non-replaced crossings negatively impacted fish distributions. Assuming no downstream constraints on access, we estimated the potential length of stream restored by the program ranged between 7.33 (lamprey) and 15.28 km (small coastal cutthroat and rainbow trout). These contributions represented a fraction of the total length available upstream (187 km) of replaced crossings. When limited ranges of species were considered, the estimated contributions of culvert replacement were reduced (1.65-km range, for longnose dace to 12.31 km for small coastal cutthroat and rainbow trout). Numbers of fish contributed ranged from

  2. Tracing organophosphorus and brominated flame retardants and plasticizers in an estuarine food web.

    Brandsma, Sicco H; Leonards, Pim E G; Leslie, Heather A; de Boer, Jacob

    2015-02-01

    Nine organophosphorus flame retardants (PFRs) were detected in a pelagic and benthic food web of the Western Scheldt estuary, The Netherlands. Concentrations of several PFRs were an order of magnitude higher than those of the brominated flame retardants (BFRs). However, the detection frequency of the PFRs (6-56%) was lower than that of the BFRs (50-97%). Tris(2-butoxyethyl) phosphate (TBOEP), tris(isobutyl) phosphate (TIBP) and tris(2-chloroisopropyl) phosphate (TCIPP) were the dominant PFRs in sediment with median concentrations of 7.0, 8.1 and 1.8 ng/g dry weight (dw), respectively. PFR levels in the suspended particular matter (SPM) were 2-12 times higher than that in sediment. TBOEP, TCIPP, TIBP, tris(2-chloroethyl) phosphate (TCEP) and tris(phenyl) phosphate (TPHP) were found in organisms higher in the estuarine food web. The highest PFR concentrations in the benthic food web were found in sculpin, goby and lugworm with median concentrations of 17, 7.4, 4.6 and 2.0 ng/g wet weight (ww) for TBOEP, TIBP, TCIPP and TPHP, respectively. Comparable levels were observed in the pelagic food web, BDE209 was the predominant PBDE in sediment and SPM with median concentrations up to 9.7 and 385 ng/g dw, respectively. BDE47 was predominant in the biotic compartment of the food web with highest median levels observed in sculpin and common tern eggs of 79 ng/g lipid weight (lw) (2.5 ng/g ww) and 80 ng/g lw (11 ng/g ww), respectively. Trophic magnification was observed for all PBDEs with the exception of BDE209. Indications of trophic magnification of PFRs were observed in the benthic food web for TBOEP, TCIPP and TCEP with tentative trophic magnification factors of 3.5, 2.2 and 2.6, respectively (pwebs. The relative high PFR levels in several fish species suggest high emissions and substantial exposure of organisms to PFRs in the Western Scheldt. Copyright © 2014 Elsevier B.V. All rights reserved.

  3. Healing of corneal epithelial wounds in marine and freshwater fish.

    Ubels, J L; Edelhauser, H F

    The corneal epithelium of a fish is in direct contact with the aquatic environment and is a barrier to movement of ions and water into and through the cornea. This tissue layer is thus important in maintenance of corneal transparency. When the epithelium is wounded, its protective function is lost and corneal transparency remains compromised until the epithelial barrier is re-established. This study was undertaken to investigate the healing response of the fish cornea to epithelial abrasion. Wounds were stained with fluorescein and photographed during healing. Wound areas were measured by planimetry. The cornea of the sculpin, a marine teleost, becomes edematous after wounding and heals at 2.54 to 3.42 mm2/hr. Nonswelling corneas of the elasmobranchs--dogfish shark and skate--heal at 1.29 mm2/hr, respectively. The wounded eye of the rainbow trout, a freshwater teleost, is stressed by the low osmolality of the environment. Severe corneal edema and cataracts develop following epithelial wounding, and the cornea heals at 0.64 mm2/hr. Although the healing rates in teleosts differ from those in mammals, histology shows that the corneal healing mechanism is essentially the same in fish and mammals.

  4. Physiological and biochemical responses of small fish exposed to Athabasca oil sands sediment

    Tetrault, G.R.; Environment Canada, Burlington, ON; McMaster, M.E.; Dixon, D.G.; Parrott, J.L.

    2002-01-01

    A study was conducted to determine the influence of naturally occurring oil sands related compounds on the reproductive function and hepatic responses of fish. Wild fish, both exposed and unexposed to the compounds in question, were collected along with sediments for laboratory testing. The study showed that in vitro gonadal incubation levels of steroid production were lower at the tributary sites within the oil sands deposits. One indicator of exposure to oil sands related compounds (hepatic 7-ethoxyresorufin-O-deethylase activity) was shown to be 5 times higher at the same sites. In addition, slimy sculpin were exposed to sediment samples from the Steepbank River site for 4 to 8 days to evaluate the absorption of the indicator. The indicator in exposed fish was found to be comparable to that measured in fish native to the oil sands area. The study was not capable of predicting an altered ability of gonadal tissue of exposed fish to produce steroid hormones in vitro. It was concluded that future development could compromise the reproductive health of fish in the area

  5. Passive sampling of bioavailable organic chemicals in Perry County, Missouri cave streams.

    Fox, J Tyler; Adams, Ginny; Sharum, Martin; Steelman, Karen L

    2010-12-01

    Two types of passive samplers--semipermeable membrane devices (SPMDs) and polar organic chemical integrative samplers (POCIS)--were deployed in spring 2008 to assess bioavailable concentrations of aquatic contaminants in five cave streams and resurgences in Perry County, Missouri. Study sites represent areas of high cave biodiversity and the only known habitat for grotto sculpin (Cottus carolinae). Time-weighted average (TWA) water concentrations were calculated for 20 compounds (n = 9 SPMDs; n = 11 POCIS) originating primarily from agricultural sources, including two organochlorine insecticides, dieldrin and heptachlor epoxide, which were found at levels exceeding U.S. EPA criteria for the protection of aquatic life. GIS data were used to quantify and map sinkhole distribution and density within the study area. Infiltration of storm runoff and its influence on contaminant transport were also evaluated using land cover and hydrological data. This work provides evidence of cave stream contamination by a mix of organic chemicals and demonstrates the applicability of passive samplers for monitoring water quality in dynamic karst environments where rapid transmission of storm runoff makes instantaneous water sampling difficult.

  6. Offshore Fish Community: Ecological Interactions | Science ...

    The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone. Bloater is abundant in the offshore zone but appears restricted to depths shallower than 150 m (Selgeby and Hoff 1996; Stockwell et al. 2010), although it occuppied greater depths several decades ago (Dryer 1966; Peck 1977). Shortjaw is relatively rare in the offshore zone (Hoff and Todd 2004; Gorman and Hoff 2009; Gorman and Todd 2007). Lake whitefish is also known to frequent bathymetric depths >100 m (Yule et al. 2008b). In this chapter, we develop a conceptual model of the offshore food web based on data collected during 2001-2005 and on inferences from species interactions known for the nearshore fish community. We then develop a framework for examination of energy and nutrient movements within the pelagic and benthic habitats of the offshore zone and across the offshore and nearshore zones. To document research results.

  7. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Robert J Miller

    Full Text Available Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  8. Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.

    Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V

    2012-01-01

    Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.

  9. Hypothesis carbon flow through the deepwater Lake Ontario foodweb

    Flint, R.W.

    1986-01-01

    Several accounts in recent years have attempted to conceptualize foodwebs in valuable fishery systems, producing useful heuristic tools to help shape research and management policy. Here a mass balance conceptual model of the Lake Ontario deepwater foodweb is developed to evaluate energy pathways and determine available nutrition for predatory salmonines. A number of different trophic links were defined from phytoplankton, through the various forage species, to the tertiary consumers. Phytoplankton photosynthesis resulted in 178 g C/m/sup 2//yr production at the base of the foodweb. Approximately 60% of primary production was counted as required support for pelagic zooplankton and benthos. Dominant forage fish (alewife, smelt and sculpin) annually appeared to consume all smaller zooplankton carbon production, 93% of mysid production, 66% of most benthic community production, and, more specifically, 94% of amphipod carbon production. The model indicated that approximately 1.22 g C/m/sup 2//yr was available for support of top level predators. Based upon historic fishery records and stocking rates, these predators required approximately half of the annual carbon available as nutritional support. Impacts of trophic rearrangements in the Lake Ontario foodweb are discussed based upon model results

  10. Columbia River System Operation Review final environmental impact statement. Appendix K: Resident fish

    1995-11-01

    The System Operation Review (SOR) is a study and environmental compliance process being used by the three Federal agencies to analyze future operations of the system and river use issues. The goal of the SOR is to achieve a coordinated system operation strategy for the river that better meets the needs of all river users. This technical appendix addresses only the effects of alternative system operating strategies for managing the Columbia River system. In this appendix the Resident Fish Work Group (RFWG) has attempted to characterize and evaluate impacts of dam operation on an extremely complex and diverse integrated resource. Not only is this required under the National Environmental Policy Act (NEPA) for SOR, there are resident fish populations that have status under the Federal Endangered Species Act (ESA) or equivalent state regulations (Kootenai River white sturgeon, Snake River white sturgeon, sandroller, shorthead and torrent sculpins, bull trout, westslope cutthroat trout, redband trout, and burbot). The RFWG has also attempted to develop operating alternatives that benefit not only resident fish, but anadromous fish, wildlife, and other human interests as well. The authors have recognized the co-evolution of resident fish, anadromous fish, and other integrated resources in the basin

  11. Acute toxicity of zinc to several aquatic species native to the Rocky Mountains.

    Brinkman, Stephen F; Johnston, Walter D

    2012-02-01

    National water-quality criteria for the protection of aquatic life are based on toxicity tests, often using organisms that are easy to culture in the laboratory. Species native to the Rocky Mountains are poorly represented in data sets used to derive national water-quality criteria. To provide additional data on the toxicity of zinc, several laboratory acute-toxicity tests were conducted with a diverse assortment of fish, benthic invertebrates, and an amphibian native to the Rocky Mountains. Tests with fish were conducted using three subspecies of cutthroat trout (Colorado River cutthroat trout Oncorhynchus clarkii pleuriticus, greenback cutthroat trout O. clarkii stomias, and Rio Grande cutthroat trout O. clarkii virginalis), mountain whitefish (Prosopium williamsoni), mottled sculpin (Cottus bairdi), longnose dace (Rhinichthys cataractae), and flathead chub (Platygobio gracilis). Aquatic invertebrate tests were conducted with mayflies (Baetis tricaudatus, Drunella doddsi, Cinygmula sp. and Ephemerella sp.), a stonefly (Chloroperlidae), and a caddis fly (Lepidostoma sp.). The amphibian test was conducted with tadpoles of the boreal toad (Bufo boreas). Median lethal concentrations (LC(50)s) ranged more than three orders of magnitude from 166 μg/L for Rio Grande cutthroat trout to >67,000 μg/L for several benthic invertebrates. Of the organisms tested, vertebrates were the most sensitive, and benthic invertebrates were the most tolerant.

  12. Bioaccumulation of radionuclides in fertilized Canadian Shield lake basins

    Bird, G.A.; Schwartz, W.J.; Hesslein, R.H.; Mills, K.H.; Turner, M.A.

    1998-01-01

    Radionuclide tracers of heavy metals ( 59 Fe, 60 Co, 65 Zn, 75 Se 85 Sr, 134 Cs and 203 Hg) representing potential contamination from nuclear power plants, industry and agriculture were added to separate basins of Lake 226, Experimental Lakes Area, northwestern Ontario. The two basins were part of a eutrophication experiment and differed in their trophic status; the north basin (L226N) was eutrophic whereas the south basin (L226S) was mesotrophic. Our objective was to determine the uptake of the radionuclides by biota and the effect of lake trophic status on their bioaccumulation. The trophic status of the lakes did not appear to have a marked effect on the accumulation of radionuclides by the biota. This may have been because of a mid-summer leakage of nutrients between the basins which enhanced primary production in L226S, because there is a time lag between primary production and the availability of the radionuclides to the fishes or because trophic status does not affect the uptake of at least some of these radionuclides. However, there was a tendency for faster uptake of the radionuclides in L226N by fish than L226S, but the differences were not significant. Concentrations in the biota generally decreased in the order: fathead minnow>pearl dace>tadpoles>slimy sculpin>leeches. Concentrations in biota generally decreased in the order: 65 Zn> 203 Hg> 75 Se> 134 Cs> 60 Co> 85 Sr= 59 Fe. Cobalt-60 concentrations in tadpoles were greater than in the other biota. Radionuclide concentrations in the tissues of lake whitefish indicated that uptake was predominately from food. Radionuclide concentrations were usually higher in the posterior gut, liver and kidney than in other tissues, whereas body burdens were generally high in the muscle for 75 Se, 134 Cs and 203 Hg; kidney and gut for 60 Co; and bone for 65 Zn and 75 Se. Mercury-203 burdens were also high in the bone and gut

  13. Ecology of Siberian Taimen Hucho taimen in the Lake Baikal Basin

    Matveyev, Arcadi N.; Pronin, Nikolai M.; Samusenok, Vitali P.; Bronte, Charles R.

    1998-01-01

    Taimen Hucho taimen historically inhabited most tributaries and littoral areas of Lake Baikal, in south central Siberia, where they supported subsistence and commercial fisheries. Logging, pollution, and overfishing have caused dramatic population declines or local extinction of most stocks. Most of what is known about this species has been published in eastern journals and therefore is not readily available to western scientists. New data collected during the 1980s and 1990s have been combined with other reports to provide an overview of the biology and life history of this species. Taimen are long-lived fish and can reach ages of 29 years and sizes up to 60 kg. Populations can either be strictly riverine or anadromous. Adults from both life histories ascend rivers in spring to spawn and feed, and less extensive migrations occur in fall to prey on spawning omul (Coregonus autumnalis migratorius). Principal food items for age 1 and 2 taimen are macroinvertebrates, but young taimen quickly become piscivorous at age 2 when they consume mainly black Baikal grayling (Thymallus arcticus baicalensis), and sculpins (Taracottus kneri, Cottus kesslerij). Males reach sexual maturity at ages 7 to 8 and later for females at ages 8 to 9. Average egg production per female was about 22,000 eggs. Parasite burdens are heavy but composed of few species and mediated by prey items consumed. This fish is a highly-specialized predator and plays an indispensable role in the structure of fish communities in mountains and foothills. Taimen conservation in the Baikal region is impossible without adoption and implementation of a dedicated rehabilitation program that includes the protection of remaining populations and habitat, and possibly introduction of hatchery-reared fish in selected areas where habitat remains, but parental stocks are low.

  14. Determining potential adverse effects in marine fish exposed to pharmaceuticals and personal care products with the fish plasma model and whole-body tissue concentrations.

    Meador, James P; Yeh, Andrew; Gallagher, Evan P

    2017-11-01

    The Fish Plasma Model (FPM) was applied to water exposure and tissue concentrations in fish collected from two wastewater treatment plant impacted estuarine sites. In this study we compared predicted fish plasma concentrations to Cmax values for humans, which represents the maximum plasma concentration for the minimum therapeutic dose. The results of this study show that predictions of plasma concentrations for a variety of pharmaceutical and personal care products (PPCPs) from effluent concentrations resulted in 37 compounds (54%) exceeding the response ratio (RR = Fish [Plasma]/1%Cmax total ) of 1 compared to 3 compounds (14%) detected with values generated with estuarine receiving water concentrations. When plasma concentrations were modeled from observed whole-body tissue residues, 16 compounds out of 24 detected for Chinook (67%) and 7 of 14 (50%) for sculpin resulted in an RR tissue value greater than 1, which highlights the importance of this dose metric over that using estuarine water. Because the tissue residue approach resulted in a high percentage of compounds with calculated response ratios exceeding a value of unity, we believe this is a more accurate representation for exposure in the field. Predicting plasma concentrations from tissue residues improves our ability to assess the potential for adverse effects in fish because exposure from all sources is captured. Tissue residues are also more likely to represent steady-state conditions compared to those from water exposure because of the inherent reduction in variability usually observed for field data and the time course for bioaccumulation. We also examined the RR in a toxic unit approach to highlight the importance of considering multiple compounds exhibiting a similar mechanism of action. Published by Elsevier Ltd.

  15. Prey fish returned to Forster's tern colonies suggest spatial and temporal differences in fish composition and availability.

    Peterson, Sarah H; Ackerman, Joshua T; Eagles-Smith, Collin A; Herzog, Mark P; Hartman, C Alex

    2018-01-01

    Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster's tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster's terns are limited in the distance they forage; thus, changes in the prey species returned to Forster's tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available habitat.

  16. Introduced northern pike predation on salmonids in southcentral Alaska

    Sepulveda, Adam J.; Rutz, David S.; Ivey, Sam S.; Dunker, Kristine J.; Gross, Jackson A.

    2013-01-01

    Northern pike (Esox lucius) are opportunistic predators that can switch to alternative prey species after preferred prey have declined. This trophic adaptability allows invasive pike to have negative effects on aquatic food webs. In Southcentral Alaska, invasive pike are a substantial concern because they have spread to important spawning and rearing habitat for salmonids and are hypothesised to be responsible for recent salmonid declines. We described the relative importance of salmonids and other prey species to pike diets in the Deshka River and Alexander Creek in Southcentral Alaska. Salmonids were once abundant in both rivers, but they are now rare in Alexander Creek. In the Deshka River, we found that juvenile Chinook salmon (Oncorhynchus tshawytscha) and coho salmon (O. kisutch) dominated pike diets and that small pike consumed more of these salmonids than large pike. In Alexander Creek, pike diets reflected the distribution of spawning salmonids, which decrease with distance upstream. Although salmonids dominated pike diets in the lowest reach of the stream, Arctic lamprey (Lampetra camtschatica) and slimy sculpin (Cottus cognatus) dominated pike diets in the middle and upper reaches. In both rivers, pike density did not influence diet and pike consumed smaller prey items than predicted by their gape-width. Our data suggest that (1) juvenile salmonids are a dominant prey item for pike, (2) small pike are the primary consumers of juvenile salmonids and (3) pike consume other native fish species when juvenile salmonids are less abundant. Implications of this trophic adaptability are that invasive pike can continue to increase while driving multiple species to low abundance.

  17. Population demographics and life history of the round hickorynut (Obovaria subrotunda) in the Duck River, Tennessee

    Ehlo, Chase A.; Layzer, James B.

    2014-01-01

    Population characteristics and life history aspects of healthy mussel populations are poorly understood. The reproductive cycle, age and growth, and population structure of Obovaria subrotunda were examined at four sites in the middle Duck River, Tennessee. Obovaria subrotunda was confirmed to be a bradytictic species, spawning in the late summer and holding glochidia in the gills for 11 mo until the following summer. Fecundity was positively related to mussel length (R2  =  0.75) and ranged from 7122 to 76,584 glochidia. Fourteen species of fish found in the Duck River, in the families Percidae, Cyprinidae, and Cottidae, were infested with glochidia in the laboratory to examine potential hosts. Juveniles transformed onEtheostoma blennioides (greenside darter), E. obama (spangled darter), E. flabellare (fantail darter), and Cottus carolinae (banded sculpin). Analyses of shell thin-sections indicated that males grew faster and obtained a larger size than females. Individuals live to at least 14 y old. Females became sexually mature at age one. Four sites were quantitatively sampled using a systematic design with three random starts. The observed ratio of adult males to females (0.9∶1) did not differ significantly from 1∶1. Results of the quantitative sampling showed an increase in density compared to earlier studies and a high proportion of 1 to 5 y old O. subrotunda.

  18. Prey fish returned to Forster’s tern colonies suggest spatial and temporal differences in fish composition and availability

    Peterson, Sarah; Ackerman, Joshua T.; Eagles-Smith, Collin A.; Herzog, Mark; Hartman, C. Alex

    2018-01-01

    Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster’s tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster’s terns are limited in the distance they forage; thus, changes in the prey species returned to Forster’s tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available

  19. Recovery of a mining-damaged stream ecosystem

    Christopher A. Mebane

    2015-03-01

    Full Text Available Abstract This paper presents a 30+ year record of changes in benthic macroinvertebrate communities and fish populations associated with improving water quality in mining-influenced streams. Panther Creek, a tributary to the Salmon River in central Idaho, USA suffered intensive damage from mining and milling operations at the Blackbird Mine that released copper (Cu, arsenic (As, and cobalt (Co into tributaries. From the 1960s through the 1980s, no fish and few aquatic invertebrates could be found in 40 km of mine-affected reaches of Panther Creek downstream of the metals contaminated tributaries, Blackbird and Big Deer Creeks. Efforts to restore water quality began in 1995, and by 2002 Cu levels had been reduced by about 90%, with incremental declines since. Rainbow Trout (Oncorhynchus mykiss were early colonizers, quickly expanding their range as areas became habitable when Cu concentrations dropped below about 3X the U.S. Environmental Protection Agency’s biotic ligand model (BLM based chronic aquatic life criterion. Anadromous Chinook Salmon (O. tshawytscha and steelhead (O. mykiss have also reoccupied Panther Creek. Full recovery of salmonid populations occurred within about 12-years after the onset of restoration efforts and about 4-years after the Cu chronic criteria had mostly been met, with recovery interpreted as similarity in densities, biomass, year class strength, and condition factors between reference sites and mining-influenced sites. Shorthead Sculpin (Cottus confusus were slower than salmonids to disperse and colonize. While benthic macroinvertebrate biomass has increased, species richness has plateaued at about 70 to 90% of reference despite the Cu criterion having been met for several years. Different invertebrate taxa had distinctly different recovery trajectories. Among the slowest taxa to recover were Ephemerella, Cinygmula and Rhithrogena mayflies, Enchytraeidae oligochaetes, and Heterlimnius aquatic beetles. Potential

  20. Effects of depletion sampling by standard three-pass pulsed DC electrofishing on blood chemistry parameters of fishes from Appalachian streams

    Densmore, Christine L.; Panek, Frank M.

    2013-01-01

    Adverse effects on fishes captured by electrofishing techniques have long been recognized, although the extent of associated physical injury and behavioral alterations are highly variable and dependent on a number of factors. We examined the effects of three-pass pulsed DC (PDC) electrofishing on two salmonid species (Rainbow Trout Oncorhynchus mykiss and Brook Trout Salvelinus fontinalis) and five other genera (Green Sunfish Lepomis cyanellus, Potomac Sculpin Cottus girardi, Fathead Minnow Pimephales promelas, Largemouth Bass Micropterus salmoides, and Channel Catfish Ictalurus punctatus) common to Appalachian streams. We examined the corresponding effects of PDC electroshock on the following physiological indicators of stress and trauma: blood glucose and serum lactate, as well as on other blood chemistry, namely, enzymes, electrolytes, minerals, and proteins. All species demonstrated physiological responses to PDC electroshock, indicated by the biochemical differences in blood parameters in unshocked and shocked groups of fish with or without gross evidence of hemorrhagic trauma. Serum lactate was the most consistent indicator of these effects. Significant differences in whole blood glucose levels were also noted in treatment groups in all species except Green Sunfish, although the patterns observed were not as consistent as for serum lactate. Elevations in the serum enzymes, aspartate aminotransferase and creatine kinase, in the electroshocked fish occurred only in the two salmonid species. In many instances, although blood parameters were elevated in electroshocked fish compared with the unshocked controls for a given species, there were no differences in those levels in electroshocked fish based on the presence of gross hemorrhagic trauma to axial musculature. While some of the blood parameters examined correlated with both the occurrence of electroshock and the resultant tissue injury, there was no apparent link between the altered blood chemistry and

  1. Temporal and geographic variation in fish communities of lower Cook Inlet, Alaska

    Robards, Martin D.; Piatt, John F.; Kettle, Arthur B.; Abookire, Alisa A.

    1999-01-01

    Nearshore and shelf fish communities were studied in three areas of lower Cook Inlet, Alaska: the Barren Islands (oceanic and well-mixed waters), Kachemak Bay (mixed oceanic waters with significant freshwater runoff), and Chisik Island (estuarine waters). Fish were sampled with beach seines (n=413 sets) and midwater trawls (n=39 sets). We found that lower Cook Inlet supported a diverse nearshore fish community of at least 52 species. Fifty of these species were caught in Kachemak Bay, 24 at Chisik Island, and 12 at the Barren Islands. Pacific sand lance dominated Barren Islands and Kachemak Bay nearshore habitats, comprising 99% and 71% of total individuals, respectively. The nearshore Chisik Island fish community was not dominated by any one species; instead it exhibited higher diversity. These spatial differences appeared linked to local oceanographic regimes and sediment influx. Analysis of historical data revealed that the nearshore Kachemak Bay fish community changed significantly between 1976 and 1996, showing increased diversity and abundance in several taxa, notably gadids, salmonids, pleuronectids, and sculpins. Decadal differences appeared to be related to large-scale climate changes in the North Pacific. Catches of most taxa peaked in May-August, and were low during other months of the year. Several species were present for only part of the summer. Species composition of seine catches differed significantly between consecutive high and low tides, but not between consecutive sets or years. Midwater trawls took 26 species, 14 of which were present in Kachemak Bay, 19 near Chisik Island, and 7 at the Barren Islands. Community structures in shelf and nearshore waters were similar: diversity was high and abundance low at Chisik Island, whereas a few abundant species dominated at both Kachemak Bay and the Barren Islands. In addition, the low fish abundance near Chisik Island appeared to be related to declining seabird numbers at this colony.

  2. Evidence for an amoeba-like infectious stage of ichthyophonus sp. and description of a circulating blood stage: a probable mechanism for dispersal within the fish host

    Kocan, Richard; LaPatra, Scott; Hershberger, Paul

    2013-01-01

    Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.–infected tissues. By 24–48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a “halo” and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae (“germination tubes”) were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20–25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤25 μm to ≥82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.

  3. The distribution of 4-nonylphenol in marine organisms of North American Pacific Coast estuaries.

    Diehl, Jennifer; Johnson, Sarah E; Xia, Kang; West, Amy; Tomanek, Lars

    2012-04-01

    One of the chemical breakdown products of nonylphenol ethoxylates, 4-nonylphenol (4-NP), accumulates in organisms and is of concern as an environmental pollutant due to its endocrine disrupting effects. We measured 4-NP levels in the seawater, sediment, and twelve organisms within the California estuary, Morro Bay, and examined biomagnification of 4-NP using stable isotope abundances (δ(15)N and δ(13)C) to quantify trophic position. 4-NP concentrations in organisms from Morro Bay included 25000±8600 ng g(-1) lw in liver of California sea lion, 14000±5600 ng g(-1) lw in liver of harbor porpoise, 138000±55000 ng g(-1) lw in liver of sea otters, 15700±3600 ng g(-1) lw in liver of seabirds, 36100±6100 ng g(-1) lw in arrow goby fish, 62800±28400 ng g(-1) lw in oysters, and 12700±1300 ng g(-1) lw in mussels. 4-NP levels generally showed a pattern of trophic dilution among organisms in Morro Bay, with exceptions of biomagnification observed between three trophic links: mussel to sea otter (BMF 10.9), oyster to sea otter (BMF 2.2), and arrow goby to staghorn sculpin (BMF 2.7). Our examination of other west coast estuaries of USA and Canada revealed that mean 4-NP concentrations in gobies and mussels from Morro Bay were significantly higher than those from a more urbanized estuary, San Francisco Bay (goby: 11100±3800 ng g(-1) lw) and from a remote estuary, Bamfield Inlet, Canada (goby: 9000±900 ng g(-1) lw, mussel: 6100±700 ng g(-1) lw). Relative to other estuaries worldwide, 4-NP levels in seawater (0.42±0.16 μg L(-1)) and sediment (53±14 ng g(-1) dw) of Morro Bay are low, but gobies and oysters have higher 4-NP levels than comparable fauna. Copyright © 2012 Elsevier Ltd. All rights reserved.

  4. Evidence for an amoeba-like infectious stage of Ichthyophonus sp. and description of a circulating blood stage: a probable mechanism for dispersal within the fish host.

    Kocan, Richard; LaPatra, Scott; Hershberger, Paul

    2013-04-01

    Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.-infected tissues. By 24-48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a "halo" and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae ("germination tubes") were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20-25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤ 25 μm to ≥ 82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.

  5. Bull trout life history, genetics, habitat needs, and limiting factors in central and northeast Oregon, Annual Report 1995

    Hemmingsen, A.R.; Buchanan, D.V.; Howell, P.J.

    1996-03-01

    To fulfill one objective of the present study, genetic characteristics of Oregon bull trout will be determined by analysis of mitochondrial and nuclear DNA. During 1995, the authors collected and sampled a total of 1,217 bull trout from 46 streams in the Columbia River Basin. DNA analysis of those samples will be conducted at University of Montana. They primarily sampled juvenile fish near natal areas to increase the likelihood of identifying discrete populations while minimizing risk of injury to large spawners. Fork lengths of all fish sampled ranged from 2.6 to 60.5 cm with a median of 12 cm. Eighty-four percent of all bull trout sampled were less than 19 cm while two percent were larger than 27 cm. Bull trout were collected by several methods, mostly by electrofishing. Eighty-six percent of all bull trout sampled were collected by electrofishing with a programmable waveform electrofisher. They observed injuries caused by electrofishing to 8% of that proportion. Based on preliminary analysis, no waveform combination used appeared less injurious than others. Highest voltages appeared less injurious than some that were lower. Frequency of electrofishing injury was significantly correlated to fork length over the range-from 4 to 26 cm. There were indications for substantial risk for such injury to bull trout larger than 26 cm. Other species found in association with bull trout included chinook salmon Oncorhynchus tshawytscha, mountain whitefish Prosopium williamsoni, rainbow trout Oncorhynchus mykiss, sculpins Cottus spp., cutthroat trout Oncorhynchus clarki, non-native brook trout Salvelinus fontinalis, and tailed frogs Ascaphus truei. Rainbow trout was the species most frequently associated with bull trout. No injury or mortality was observed for any of the associated species captured

  6. Using Streamflow and Stream Temperature to Assess the Potential Responses of Freshwater Fish to Climate Change

    VanCompernolle, M.; Ficklin, D. L.; Knouft, J.

    2017-12-01

    Streamflow and stream temperature are key variables influencing growth, reproduction, and mortality of freshwater fish. Climate-induced changes in these variables are expected to alter the structure and function of aquatic ecosystems. Using Maxent, a species distribution model (SDM) based on the principal of maximum entropy, we predicted potential distributional responses of 100 fish species in the Mobile River Basin (MRB) to changes in climate based on contemporary and future streamflow and stream temperature estimates. Geologic, topographic, and landcover data were also included in each SDM to determine the contribution of these physical variables in defining areas of suitable habitat for each species. Using an ensemble of Global Climate Model (GCM) projections under a high emissions scenario, predicted distributions for each species across the MRB were produced for both a historical time period, 1975-1994, and a future time period, 2060-2079, and changes in total area and the percent change in historical suitable habitat for each species were calculated. Results indicate that flow (28%), temperature (29%), and geology (29%), on average, contribute evenly to determining areas of suitable habitat for fish species in the MRB, with landcover and slope playing more limited roles. Temperature contributed slightly more predictive ability to SDMs (31%) for the 77 species experiencing overall declines in areas of suitable habitat, but only 21% for the 23 species gaining habitat across all GCMs. Species are expected to lose between 15-24% of their historical suitable habitat, with threatened and endangered species losing 22-30% and those endemic to the MRB losing 19-28%. Sculpins (Cottidae) are expected to lose the largest amount of historical habitat (up to 84%), while pygmy sunfish (Elassomatidae) are expected to lose less than 1% of historical habitat. Understanding which species may be at risk of habitat loss under future projections of climate change can help

  7. Heterosigma bloom and associated fish kill

    Hershberger, P.K.; Rensel, J.E.; Postel, J.R.; Taub, F.B.

    1997-01-01

    A bloom of the harmful marine phytoplankton, Heterosigma carterae occurred in upper Case Inlet, south Puget Sound, Washington in late September, 1994, correlating with the presence of at least 35 dead salmon. This marks the first time that this alga has been closely correlated with a wild fish kill; in the past it was thought to be associated with kills of penned fish at fish farms only. We were informed of the presence of a possible harmful algal bloom and dead salinois Ilear the town of Allyn on 27 September and a team was formed to investigate. We arrived at the Allyn waterfront at 17:30 hours the same day. Prior to our arrival, state agency personnel walked approximatcly two miles of shoreline from the powerlines north of the dock, to the mouth of Sherwood Creek and conducted the only official count of dead fish present along the shore consisting of 12 coho salmon (Oncorhynchus kisutch), 11 chum salmon (Oncorhynchus keta), 12 chinook salmon (Oncorhynchus tschawytscha), one flat fish, and one sculpin on the morning of 9/27. Since previous harmful blooms of Heterosigma have resultedin the majority of net penreared salmon sinking to the bottom of pens, and only approximately two miles of shoreline were sampled, it is suspected that many more exposed fish may have succumbed than were counted. Witnesses who explored the east side of the bay reported seeing many dead salmon there as well, but no counts were made. State agency personnel who observed the fish kill reported seeing “dying fish coming to the beach, gulping at the surface, trying to get out of the water” Scavengers were seen consuming the salmon carcasses; these included two harbor seals, a house cat, and Hymenopteran insects. None suffered any noticeable acute ill effects. Although precise cause of death has not been ascertained, visual inspection of the reproductive organs from a deceased male chum salmon found on the shore at Allyn confirmed that the fish was not yet reproductively mature and

  8. Effects of discharge fluctuation and the addition of fine sediment on stream fish and macroinvertebrates below a water-filtration facility

    Erman, Don C.; Ligon, Franklin K.

    1988-01-01

    A small, coastal stream in the San Francisco Bay area of California, USA, received the discharges from a drinking-water filtration plant. Two types of discharges were present. Discharges from filter backwashing were 3 4 times base stream flow, occurred 10 60 times per day, contained fine sediments, and each lasted about 10 min. The other discharge was a large, steady flow of relatively sediment-free water from occasional overflow of the delivery aqueduct which generally lasted several hours a day. Samples of invertebrates from natural substrates had significantly fewer taxa and lower density at the two stations below the backwash than at the two above. However, when stable artificial substrates were used, there were no significant differences among all four stations. The aqueduct apparently had no effect because the. invertebrate community at the station upstream of the backwash but downstream of the aqueduct was statistically similar to the station above the aqueduct. To test for acute toxicity, we exposed additional artificial substrates to short-term simulated backwash conditions. These exposures had no effect on invertebrate density or drift. Three-spine stickleback ( Gasterosteus aculeatus) populations were also significantly reduced at the two downstream stations and were made up mostly of larger, adult fish. Prickly sculpins ( Cottus asper), restricted to the most downstream station, were emaciated and had poor growth, probably as a result of scarce benthic food organisms. Artificial redds with eggs of rainbow trout ( Salmo gairdneri) had significantly lower survival at two stations below the plant backwash (30.7% and 41.8%) than at the one above it (61.4%). Hatchery rainbow trout held in cages below the treatment plant from 7 to 37 days survived and continued to feed. Thus, the major effect of the water treatment plant on fish and invertebrates probably was not from acute toxicity in the discharges or the occasionally large discharge of clean water from the

  9. Determining potential adverse effects in marine fish exposed to pharmaceuticals and personal care products with the fish plasma model and whole-body tissue concentrations

    Meador, James P.; Yeh, Andrew; Gallagher, Evan P.

    2017-01-01

    The Fish Plasma Model (FPM) was applied to water exposure and tissue concentrations in fish collected from two wastewater treatment plant impacted estuarine sites. In this study we compared predicted fish plasma concentrations to Cmax values for humans, which represents the maximum plasma concentration for the minimum therapeutic dose. The results of this study show that predictions of plasma concentrations for a variety of pharmaceutical and personal care products (PPCPs) from effluent concentrations resulted in 37 compounds (54%) exceeding the response ratio (RR = Fish [Plasma]/1%Cmax total ) of 1 compared to 3 compounds (14%) detected with values generated with estuarine receiving water concentrations. When plasma concentrations were modeled from observed whole-body tissue residues, 16 compounds out of 24 detected for Chinook (67%) and 7 of 14 (50%) for sculpin resulted in an RR tissue value greater than 1, which highlights the importance of this dose metric over that using estuarine water. Because the tissue residue approach resulted in a high percentage of compounds with calculated response ratios exceeding a value of unity, we believe this is a more accurate representation for exposure in the field. Predicting plasma concentrations from tissue residues improves our ability to assess the potential for adverse effects in fish because exposure from all sources is captured. Tissue residues are also more likely to represent steady-state conditions compared to those from water exposure because of the inherent reduction in variability usually observed for field data and the time course for bioaccumulation. We also examined the RR in a toxic unit approach to highlight the importance of considering multiple compounds exhibiting a similar mechanism of action. - Highlights: • Fish Plasma Model (FPM) to assess risk based on water and fish tissue concentrations. • Plasma levels predicted with receiving water concentrations underestimate exposure for feral fish.

  10. Medium-chain chlorinated paraffins (MCCPs): a review of bioaccumulation potential in the aquatic environment.

    Thompson, Roy; Vaughan, Martin

    2014-01-01

    Chlorinated paraffins (CPs) are high molecular weight organochlorine compounds that have been used in a variety of industrial applications for many years. Medium-chain chlorinated paraffins (MCCPs) (CAS 85535-85-9; Alkanes, C14-17 , chloro) are currently under investigation as potential persistent bioaccumulative toxic (PBT) compounds. In this article, the bioaccumulation potential of MCCPs is assessed using a tiered framework proposed after a recent Society of Environmental Toxicology and Chemistry (SETAC) Pellston Workshop in 2008. The framework proposes the use of physicochemical properties and modeling assessment, bioconcentration/bioaccumulation (BCF/BAF) assessment, biomagnification (BMF) assessment, and trophic magnification factor (TMF) assessment. It is hoped that use of this framework could harmonize and improve the efficiency and effectiveness of the chemical substance evaluation screening process for PBT properties. When applied to MCCPs, the following conclusions were made: empirical physiochemical data is available negating the use of models; laboratory BCFs range from 1000 to 15 000 (growth-corrected lipid normalized values) for 2 MCCP structures; field BAFs were an order of magnitude higher than the trigger criterion for "B status possible"; although results may not meet acceptance criteria for field studies, laboratory-derived BMFs for a number of C14-17 chlorinated alkanes were less than the trigger value of 1 (based on whole-body concentrations) whereas field-derived BMFs were less than 1 (based on lipid corrected values [generally used for field data] excluding one measure for sculpin, [Cottus cognatus]-Diporeia that was based on only one detectable sample); and finally, TMFs were less than the trigger criterion value of 1, which are considered the most convincing evidence for bioaccumulative properties of a compound and the "Gold Standard" measure of bioaccumulation. This article also discusses the uncertainties surrounding the published data

  11. Changes in stream chemistry and biology in response to reduced levels of acid deposition during 1987-2003 in the Neversink River Basin, Catskill Mountains

    Burns, Douglas A.; Riva-Murray, K.; Bode, R.W.; Passy, S.

    2008-01-01

    Atmospheric acid deposition has decreased in the northeastern United States since the 1970s, resulting in modest increases in pH, acid-neutralizing capacity (ANC), and decreases in inorganic monomeric aluminum (AlIM) concentrations since stream chemistry monitoring began in the 1980s in the acid-sensitive upper Neversink River basin in the Catskill Mountains of New York. Stream pH has increased by 0.01 units/year during 1987-2003 at three sites in the Neversink basin as determined by Seasonal Kendall trend analysis. In light of this observed decrease in stream acidity, we sampled 12 stream sites within the Neversink River watershed for water chemistry, macroinvertebrates, fish, and periphytic diatoms in 2003 to compare with a similar data set collected in 1987. Metrics and indices that reflect sensitivity to stream acidity were developed with these biological data to determine whether changes in stream biota over the intervening 16 years parallel those of stream chemistry. Statistical comparisons of data on stream chemistry and an acid biological assessment profile (Acid BAP) derived from invertebrate data showed no significant differences between the two years. For pH and ANC, however, values in 2003 were generally lower than those in 1987; this difference likely resulted from higher streamflow in summer 2003. Despite these likely flow-induced changes in summer 2003, an ordination and cluster analysis of macroinvertebrate taxa based on the Acid BAP indicated that the most acidic sites in the upstream half of the East Branch Neversink River form a statistically significant separate cluster consistent with less acidic stream conditions. This analysis is consistent with limited recovery of invertebrate species in the most acidic reaches of the river, but will require additional improvement in stream chemistry before a stronger conclusion can be drawn. Data on the fish and periphytic diatom communities in 2003 indicate that slimy sculpin had not extended their habitat

  12. Biological recipient control at the Oskarshamn nuclear power plant. Annual report for 2011

    Andersson, Jan; Franzen, Fredrik; Lingman, Anna

    2012-01-01

    (Anguilla anguilla) did not change over time in the recipient since the 1980s. The prevalence of swim bladder parasites (Anguillicoloides sp.) has been 50-60% since the parasite was established in Hamnefjaerden in the late 1980's. Gillnet surveys are performed in the spring on the open coast at the power plant to study effects on Baltic herring and other marine species, normally appearing at low water temperatures. Problems due to an increasing population of grey seals forced a change in fishing methodology in 2011, and the pelagic nets were replaced with a series of demersal nets. The abundances of the long term dominants Baltic herring (Clupea harengus), sea scorpions (Myoxocephalus scorpius) and cod (Gadus morhua) have shown large periodic variations since the survey was established in the early 1970's. Cod alone has shown a long term decrease, probably reflecting the general situation in the Baltic Sea. Silver eel (Anguilla anguilla) catches decreased in the local fishery, but increased in the reference area until silver eel fishing stopped in this area in 2001. The long term development is however believed to reflect the general trends of eel in the Baltic region. Abundance and species richness in soft bottom macro fauna increased strongly in shallow sites between 1962-2011, in Simpevarp as well as in the reference area. The number of species increased also on deeper sites, but the total abundance did not change significantly. The abundance of the introduced polychaete Marenzelleria sp. increased rapidly in recent years and is now among the dominants in both areas. The trend is reflective of the general changes in the Baltic Sea. Vegetation on hard bottoms is monitored on three sites in the coastal gradient of cooling water. The algal communities are considered to have good ecological status and the studied sites are among the richest in the region. The Fucus vesiculosus cover decreased however, in recent years due to the wearing of ice. Fucus increased its

  13. Biological recipient control at the Oskarshamn nuclear power plant. Annual report for 2011; Biologisk recipientkontroll vid Oskarshamns kaernkraftverk. Aarsrapport foer 2011

    Andersson, Jan; Franzen, Fredrik; Lingman, Anna

    2012-07-01

    (Anguilla anguilla) did not change over time in the recipient since the 1980s. The prevalence of swim bladder parasites (Anguillicoloides sp.) has been 50-60% since the parasite was established in Hamnefjaerden in the late 1980's. Gillnet surveys are performed in the spring on the open coast at the power plant to study effects on Baltic herring and other marine species, normally appearing at low water temperatures. Problems due to an increasing population of grey seals forced a change in fishing methodology in 2011, and the pelagic nets were replaced with a series of demersal nets. The abundances of the long term dominants Baltic herring (Clupea harengus), sea scorpions (Myoxocephalus scorpius) and cod (Gadus morhua) have shown large periodic variations since the survey was established in the early 1970's. Cod alone has shown a long term decrease, probably reflecting the general situation in the Baltic Sea. Silver eel (Anguilla anguilla) catches decreased in the local fishery, but increased in the reference area until silver eel fishing stopped in this area in 2001. The long term development is however believed to reflect the general trends of eel in the Baltic region. Abundance and species richness in soft bottom macro fauna increased strongly in shallow sites between 1962-2011, in Simpevarp as well as in the reference area. The number of species increased also on deeper sites, but the total abundance did not change significantly. The abundance of the introduced polychaete Marenzelleria sp. increased rapidly in recent years and is now among the dominants in both areas. The trend is reflective of the general changes in the Baltic Sea. Vegetation on hard bottoms is monitored on three sites in the coastal gradient of cooling water. The algal communities are considered to have good ecological status and the studied sites are among the richest in the region. The Fucus vesiculosus cover decreased however, in recent years due to the wearing of ice. Fucus increased its

  14. Forestry practices and aquatic biodiversity: Fish

    Gresswell, Robert E.

    2005-01-01

    In the Pacific Northwest, fish communities are found in a diverse array of aquatic habitats ranging from the large coastal rivers of the temperate rainforests, to the fragmented and sometimes ephemeral streams of the xeric interior basins, and high-elevation streams and lakes in the mountainous areas (Rieman et al. 2003). Only high-elevation lakes and streams isolated above barriers to fish passage remained historically devoid of fish because they were never invaded following Pleistocene glaciation (Smith 1981). Despite this widespread distribution and once great population abundances, taxonomic diversity of fishes in these forested systems is naturally lower than in aquatic habitats in the eastern U.S. (Reeves, Bisson, and Dambacher 1998). Interactions among factors that influence species richness in aquatic systems (e.g., basin size, long-term stability of habitat, and barriers to colonization; Smith 1981) continue to influence the occurrence and persistence of fishes in these systems today. Consequently, the larger low-elevation rivers and estuaries support the greatest variety of fish species. In the high-elevation tributary streams, fish communities are less complex because these aquatic systems were less climatically and geologically stable, and fish populations were smaller and more prone to local extirpation. Furthermore, barriers to fish passage inhibited dispersal and colonization (Smith 1981). Streams in forested landscapes generally support salmon and trout, Oncorhynchus spp., whitefish Prosopium spp., sculpins Cottus spp., suckers Catostomus spp., and minnows (Cyprinidae), but in some of the colder streams, chars (e.g., Salvelinus confluentus and Salvelinus malma) and lampreys (Petromyzontidae)may also occur (Rieman et al. 2003).Although biodiversity defined in terms of fish species richness is low in the Pacific Northwest, intraspecific variability is high, and polytypic fish species are common in the diverse aquatic habitats of the region. For

  15. Mercury in Sediment, Water, and Biota of Sinclair Inlet, Puget Sound, Washington, 1989-2007

    Paulson, Anthony J.; Keys, Morgan E.; Scholting, Kelly L.

    2010-01-01

    specimens, and caged mussels. Total mercury concentrations in muscle and liver of English sole from Sinclair Inlet ranked in the upper quarter and third, respectively, of Puget Sound locations. For other species, concentrations from Sinclair Inlet were within the mid-range of locations (for example, Chinook salmon). Total mercury concentrations of the long-lived and higher trophic rockfish in composites and individual specimens from Sinclair Inlet tended to be the highest in Puget Sound. For a given size, sand sole, graceful crab, staghorn sculpin, surf perch, and sea cucumber individuals collected from Sinclair Inlet had higher total mercury concentrations than individuals collected from non-urban estuaries. Total mercury concentrations in individual English sole and ratfish were not significantly different than in individuals of various sizes collected from either urban or non-urban estuaries in Puget Sound. Total mercury concentrations in English sole collected from Sinclair Inlet after the 2000-2001 dredging appear to have lower total mercury concentrations than those collected before (1996) the dredging project. The highest total mercury concentrations of mussels caged in 2002 were not within the Bremerton naval complex, but within the Port Orchard Marina and inner Sinclair Inlet.

  16. Cadmium risks to freshwater life: derivation and validation of low-effect criteria values using laboratory and field studies

    Mebane, Christopher A.

    2006-01-01

    In 2001, the U.S. Environmental Protection Agency (EPA) released updated aquatic life criteria for cadmium. Since then, additional data on the effects of cadmium to aquatic life have become available from studies supported by the EPA, Idaho Department of Environmental Quality (IDEQ), and the U.S. Geological Survey, among other sources. Updated data on the effects of cadmium to aquatic life were compiled and reviewed and low-effect concentrations were estimated. Low-effect values were calculated using EPA's guidelines for deriving numerical national water-quality criteria for the protection of aquatic organisms and their uses. Data on the short-term (acute) effects of cadmium on North American freshwater species that were suitable for criteria derivation were located for 69 species representing 57 genera and 33 families. For longer-term (chronic) effects of cadmium on North American freshwater species, suitable data were located for 28 species representing 21 genera and 17 families. Both the acute and chronic toxicity of cadmium were dependent on the hardness of the test water. Hardness-toxicity regressions were developed for both acute and chronic datasets so that effects data from different tests could be adjusted to a common water hardness. Hardness-adjusted effects values were pooled to obtain species and genus mean acute and chronic values, which then were ranked by their sensitivity to cadmium. The four most sensitive genera to acute exposures were, in order of increasing cadmium resistance, Oncorhynchus (Pacific trout and salmon), Salvelinus ('char' trout), Salmo (Atlantic trout and salmon), and Cottus (sculpin). The four most sensitive genera to chronic exposures were Hyalella (amphipod), Cottus, Gammarus (amphipod), and Salvelinus. Using the updated datasets, hardness dependent criteria equations were calculated for acute and chronic exposures to cadmium. At a hardness of 50 mg/L as calcium carbonate, the criterion maximum concentration (CMC, or 'acute

  17. Hydroclimatic alteration increases vulnerability of montane meadows in the Sierra Nevada, California

    Viers, J. H.; Peek, R.; Purdy, S. E.; Emmons, J. D.; Yarnell, S. M.

    2012-12-01

    available habitat for aquatic species, particularly for cold water fishes (ie, salmonids and sculpins). Earlier timing and longer low flow duration will force aquatic biota to withstand more days at thermally challenging temperatures, potentially promoting non-native species. Decreased mean annual flow, less overall snow volume, and warmer daily air temperatures will potentially decrease the number of days of standing water available for amphibian reproduction. A core strategy for maintaining meadow ecosystems, ecosystem services, and dependent biodiversity is to reduce vulnerabilities, such as unstable stream banks that promote cycles of incision, and increase resilience to disturbance, such as actively removing encroaching vegetation that can overtap water tables and build up wildfire fuels. Reducing meadow vulnerability to hydroclimatic alteration and ensuring sustained ecosystem services will require active ecosystem management (ie, managed for indicator species, but with focus on hydrological functioning); coordinated hydrological management (ie, conservation action and removal of stressors coordinated across all ownerships and management regimes); and effective communication to minimize human activities that reduce resilience, as well as improve human

  18. Selenium in ecosystems within the mountaintop coal mining and valley-fill region of southern West Virginia-assessment and ecosystem-scale modeling

    Presser, Theresa S.

    2013-01-01

    Coal and associated waste rock are among environmental selenium (Se) sources that have the potential to affect reproduction in fish and aquatic birds. Ecosystems of southern West Virginia that are affected by drainage from mountaintop coal mines and valleys filled with waste rock in the Coal, Gauley, and Lower Guyandotte watersheds were assessed during 2010 and 2011. Sampling data from earlier studies in these watersheds (for example, Upper Mud River Reservoir) and other mining-affected watersheds also are included to assess additional hydrologic settings and food webs for comparison. Basin schematics give a comprehensive view of sampled species and Se concentration data specific to location and date. Food-web diagrams document the progression of Se trophic transfer across suspended particulate material, invertebrates, and fish for each site to serve as the basis for developing an ecosystem-scale model to predict Se exposure within the hydrologic conditions and food webs of southern West Virginia. This approach integrates a site-specific predator’s dietary exposure pathway into modeling to ensure an adequate link to Se toxicity and, thus, to species vulnerability. Site-specific fish abundance and richness data in streams documented various species of chub, shiner, dace, darters, bass, minnow, sunfish, sucker, catfish, and central stoneroller (Campostoma anomalum), mottled sculpin (Cottus bairdii), and least brook lamprey (Lampetra aepyptera). However, Se assessment species for streams, and hence, model species for streams, were limited to creek chub (Semotilus atromaculatus) and central stoneroller. Both of these species of fish are generally considered to have a high tolerance for environmental stress based on traditional comparative fish community assessment, with creek chub being present at all sites. Aquatic insects (mayfly, caddisfly, stonefly, dobsonfly, chironomid) were the main invertebrates sampled in streams. Collection of suspended particulate material