Czech Academy of Sciences Publication Activity Database
Vítek, T.; Halačka, Karel; Bartoňová-Marešová, Eva; Vetešník, Lukáš; Spurný, P.
2014-01-01
Roč. 30, č. 1 (2014), s. 102-108 ISSN 0175-8659 Institutional support: RVO:68081766 Keywords : Fish communities * sculpins Cottus * bullhead * Pisces * Pleistocene Subject RIV: EG - Zoology Impact factor: 0.867, year: 2014
A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius.
Cutfield, S M; Cutfield, J F
1993-09-01
The peptide hormone glucagon has been isolated from the islet tissue (Brockmann bodies) of the teleost Cottus scorpius (daddy sculpin) and sequenced. The sequence is HSEGTSNDYSKYLEDRKAQDFVQWLMNN differing at four positions from the glucagon found earlier in the same species by Conlon and coworkers (1987b, Eur. J. Biochem, 164, 117-122). Thus sculpin, in common with anglerfish, possesses two distinct glucagons. Comparative sequence data are presented as a phylogenetic tree.
Brenda Rashleigh; Gary D. Grossman
2005-01-01
We describe and analyze a spatially explicit, individual-based model for the local population dynamics of mottled sculpin (Cottus bairdi). The model simulated daily growth, mortality, movement and spawning of individuals within a reach of stream. Juvenile and adult growth was based on consumption bioenergetics of benthic macroinvertebrate prey;...
Directory of Open Access Journals (Sweden)
Rocaspana Rafel
2017-01-01
Full Text Available The status of Pyrenean sculpin Cottus hispaniolensis was assessed in the Spanish part of the Garonne drainage on the basis of its distribution and abundance from 2001 to 2016. Population trends showed a progressive reduction in range extension and density, exacerbated by a severe spate occurred in 2013. However, C. hispaniolensis was resilient to this natural disturbance by compensating for mortality with increasing recruitment. Both occurrence and density of Pyrenean sculpin showed a positive correlation with coarse substrates. Riverine habitat deterioration, mainly channelization, presence of dams and flow regulation are the main factors threatening sculpin populations. Several management measures are proposed.
Mychek-Londer, Justin G.; Bunnell, David B.
2013-01-01
Accurate estimates of fish consumption are required to understand trophic interactions and facilitate ecosystem-based fishery management. Despite their importance within the food-web, no method currently exists to estimate daily consumption for Great Lakes slimy (Cottus cognatus) and deepwater sculpin (Myoxocephalus thompsonii). We conducted experiments to estimate gastric evacuation (GEVAC) and collected field data from Lake Michigan to estimate index of fullness [(g prey/g fish weight)100%) to determine daily ration for water temperatures ranging 2–5 °C, coinciding with the winter and early spring season. Exponential GEVAC rates equaled 0.0115/h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 °C and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin. Index of fullness varied with fish size, and averaged 1.93% and 1.85% for slimy and deepwater sculpins, respectively. Maximum index of fullness was generally higher (except for the smallest sizes) for both species in 2009–2010 than in 1976 despite reductions in a primary prey, Diporeia spp. Predictive daily ration equations were derived as a function of fish dry weight. Estimates of daily consumption ranged from 0.2 to 0.8% of their body weight, which was within the low range of estimates from other species at comparably low water temperatures. These results provide a tool to estimate the consumptive demand of sculpins which will improve our understanding of benthic offshore food webs and aid in management and restoration of these native species in the Great Lakes.
Cutfield, J F; Cutfield, S M; Carne, A; Emdin, S O; Falkmer, S
1986-07-01
Insulin from the principal islets of the teleost fish, Cottus scorpius (daddy sculpin), has been isolated and sequenced. Purification involved acid/alcohol extraction, gel filtration, and reverse-phase high-performance liquid chromatography to yield nearly 1 mg pure insulin/g wet weight islet tissue. Biological potency was estimated as 40% compared to porcine insulin. The sculpin insulin crystallised in the absence of zinc ions although zinc is known to be present in the islets in significant amounts. Two other hormones, glucagon and pancreatic polypeptide, were copurified with the insulin, and an N-terminal sequence for pancreatic polypeptide was determined. The primary structure of sculpin insulin shows a number of sequence changes unique so far amongst teleost fish. These changes occur at A14 (Arg), A15 (Val), and B2 (Asp). The B chain contains 29 amino acids and there is no N-terminal extension as seen with several other fish. Presumably as a result of the amino acid substitutions, sculpin insulin does not readily form crystals containing zinc-insulin hexamers, despite the presence of the coordinating B10 His.
Conlon, J M; Schmidt, W E; Gallwitz, B; Falkmer, S; Thim, L
1986-12-30
The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.
LABORATORY CULTURE METHODS FOR THE MOTTLED SCULPIN (COTTUS BAIRDI)
Fish from the family Cottidae (Sculpin Family) are being researched to determine their sensitivity to various metals in freshwater systems. The ability to culture them in the lab would facilitate species sensitivity comparisons. We collected adult mottled sculpins (C. bairdi) f...
Energy Technology Data Exchange (ETDEWEB)
Spencer, P. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)], E-mail: paula.spencer@usask.ca; Pollock, R.; Dube, M. [Toxicology Centre, University of Saskatchewan, 44 Campus Drive, Saskatoon, SK, S7N 5B3 (Canada)
2008-12-11
Ammonia is known to be an important toxicant in aquatic environments. Although ammonia toxicity has been well studied in many fish species, effects of chronic exposure on slimy sculpin (Cottus cognatus), a critical biomonitoring species for northern aquatic habitats, are not well known. Further, with increasing mining development in Canada's north, this information is critical to better predict potential effects of mine effluent discharges on northern fish species. Slimy sculpin were exposed to six concentrations of un-ionized ammonia (NH{sub 3}) relevant to concentrations found in northern mining effluents: control (0 ppm), 0.278 ppm, 0.556 ppm, 0.834 ppm, 1.112 ppm, and 1.668 ppm. An LC{sub 50} of 1.529 ppm was calculated from mortality data. Histopathological examination of gills indicated significant tissue damage, measured as lamellar fusion and epithelial lifting, at 0.834 ppm, 1.112 ppm, and 1.668 ppm. Using gill endpoints, NOEC and LOEC were calculated as 0.556 ppm and 0.834 ppm, respectively. An EC{sub 50} of 0.775 ppm was determined for lamellar fusion and an EC{sub 50} of 0.842 ppm for epithelial lifting. Hemorrhage of gills was present in mortalities, which occurred at 1.668 ppm of un-ionized ammonia. A significant decrease in liver somatic index (LSI) was seen in both male and female fish at 0.834 ppm and 1.112 ppm, respectively. Gonadosomatic index (GSI) in female fish significantly increased at 1.668 ppm un-ionized ammonia with an associated significant increase in total wholebody testosterone concentrations. GSI in male fish also significantly increased at 1.668 ppm but no differences were seen in testosterone concentrations. No significant differences were seen in gonad histopathological assessments or condition factor. Gill histopathology endpoints may be a more sensitive indicator for detecting effects in slimy sculpin exposed to ammonia than traditional chronic endpoints. Results from this study indicate that ammonia concentrations commonly
International Nuclear Information System (INIS)
Dorts, Jennifer; Kestemont, Patrick; Thézenas, Marie-Laetitia; Raes, Martine; Silvestre, Frédéric
2014-01-01
Highlights: • Fish acclimated to elevated temperature were subsequently exposed to cadmium. • Interaction of both stressors on LDH activity and protein expression was complex. • Both stressors have opposite effects at branchial protein expression level. • Proteins belonging to the same functional class exhibited differing responses. • Prior acclimation to elevated temperature modulated the effects of cadmium exposure. - Abstract: Temperature and trace metals are common environmental stressors, and their importance is increasing due to global climate change and anthropogenic pollution. The aim of the present study was to investigate whether acclimation to elevated temperature affects the response of the European bullhead (Cottus gobio) to subsequent cadmium (Cd) exposure by using enzymatic and proteomic approaches. Fish acclimated to 15 (standard temperature), 18 or 21 °C for 28 days were exposed to 1 mg Cd/L for 4 days at the respective acclimation temperature. First, exposure to Cd significantly decreased the activity of the lactate dehydrogenase (LDH) in gills of fish acclimated to 15 or 18 °C. However, an acclimation to 21 °C suppressed the inhibitory effect of Cd. Second, using a proteomic analysis by 2D-DIGE, we observed that thermal acclimation was the first parameter affecting the protein expression profile in gills of C. gobio, while subsequent Cd exposure seemed to attenuate this temperature effect. Moreover, our results showed opposite effects of these two environmental stressors at protein expression level. From the 52 protein spots displaying significant interaction effects of temperature and Cd exposure, a total of 28 different proteins were identified using nano LC–MS/MS and the Peptide and Protein Prophet algorithms of Scaffold software. The identified differentially expressed proteins can be categorized into diverse functional classes, related to protein turnover, folding and chaperoning, metabolic process, ion transport, cell
Energy Technology Data Exchange (ETDEWEB)
Dorts, Jennifer, E-mail: jennifer.dorts@unamur.be [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Kestemont, Patrick [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Thézenas, Marie-Laetitia; Raes, Martine [Research Unit in Cell Biology (URBC) (NARILIS), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Silvestre, Frédéric [Research Unit in Environmental and Evolutionary Biology (URBE), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium)
2014-09-15
Highlights: • Fish acclimated to elevated temperature were subsequently exposed to cadmium. • Interaction of both stressors on LDH activity and protein expression was complex. • Both stressors have opposite effects at branchial protein expression level. • Proteins belonging to the same functional class exhibited differing responses. • Prior acclimation to elevated temperature modulated the effects of cadmium exposure. - Abstract: Temperature and trace metals are common environmental stressors, and their importance is increasing due to global climate change and anthropogenic pollution. The aim of the present study was to investigate whether acclimation to elevated temperature affects the response of the European bullhead (Cottus gobio) to subsequent cadmium (Cd) exposure by using enzymatic and proteomic approaches. Fish acclimated to 15 (standard temperature), 18 or 21 °C for 28 days were exposed to 1 mg Cd/L for 4 days at the respective acclimation temperature. First, exposure to Cd significantly decreased the activity of the lactate dehydrogenase (LDH) in gills of fish acclimated to 15 or 18 °C. However, an acclimation to 21 °C suppressed the inhibitory effect of Cd. Second, using a proteomic analysis by 2D-DIGE, we observed that thermal acclimation was the first parameter affecting the protein expression profile in gills of C. gobio, while subsequent Cd exposure seemed to attenuate this temperature effect. Moreover, our results showed opposite effects of these two environmental stressors at protein expression level. From the 52 protein spots displaying significant interaction effects of temperature and Cd exposure, a total of 28 different proteins were identified using nano LC–MS/MS and the Peptide and Protein Prophet algorithms of Scaffold software. The identified differentially expressed proteins can be categorized into diverse functional classes, related to protein turnover, folding and chaperoning, metabolic process, ion transport, cell
Owens, Randall W.; Dittman, Dawn E.
2003-01-01
In Lake Ontario, the diets of slimy sculpin Cottus cognatus and lake whitefish Coregonus clupeaformis shifted from a diet dominated by the burrowing amphipod, Diporeia, and to a lesser extent, Mysis, to a more diverse diet, after Diporeia collapsed, to one dominated by Mysis and prey that were formerly less important or uncommon such as Chironomidae, Oligochaeta, and Ostracoda. Additionally, lake whitefish still preyed on native mollusks like Sphaeriidae and Gastropoda, but also preyed on exotic mollusks, Dreissena spp., which are swallowed intact and subsequently crushed in its muscular stomach. Whether Diporeia was abundant (1992) or scarce (1999), selection indices for Diporeia by slimy sculpins was positive, suggesting that Diporeia was a preferred prey. Unlike lake whitefish, slimy sculpins avoided Dreissena; therefore, energy diverted to Dreissena production was a real loss for slimy sculpins. The shifts in the diet of these benthic fishes corresponded with drastic changes in the benthic community between 1992 and 1999. The collapse of Diporeia, formerly the most abundant macroinvertebrate in the benthic community, along with sharp declines in the abundance of Oligochaeta and Sphaeriidae, coincided with the establishment and rapid expansion of Dreissena bugensis, the quagga mussel, and to a lesser degree Dreissena polymorpha, the zebra mussel. It appears that the Diporeia population first collapsed at depths >70 m in southeastern Lake Ontario by autumn 1992, at shallower depths in the eastern Lake Ontario by 1995, and along the entire south shore line at depths 100 m by 1999. In response to the disappearance of Diporeia, populations of two native benthivores, slimy sculpin and lake whitefish, collapsed in eastern Lake Ontario, perhaps due in part to starvation, because Diporeia was their principal prey. Presently, alternative food resources do not appear sufficient to sustain these two benthivores at their former levels of abundance. We do not expect slimy
Dennenmoser, Stefan; Vamosi, Steven M; Nolte, Arne W; Rogers, Sean M
2017-01-01
Understanding the genomic basis of adaptive divergence in the presence of gene flow remains a major challenge in evolutionary biology. In prickly sculpin (Cottus asper), an abundant euryhaline fish in northwestern North America, high genetic connectivity among brackish-water (estuarine) and freshwater (tributary) habitats of coastal rivers does not preclude the build-up of neutral genetic differentiation and emergence of different life history strategies. Because these two habitats present different osmotic niches, we predicted high genetic differentiation at known teleost candidate genes underlying salinity tolerance and osmoregulation. We applied whole-genome sequencing of pooled DNA samples (Pool-Seq) to explore adaptive divergence between two estuarine and two tributary habitats. Paired-end sequence reads were mapped against genomic contigs of European Cottus, and the gene content of candidate regions was explored based on comparisons with the threespine stickleback genome. Genes showing signals of repeated differentiation among brackish-water and freshwater habitats included functions such as ion transport and structural permeability in freshwater gills, which suggests that local adaptation to different osmotic niches might contribute to genomic divergence among habitats. Overall, the presence of both repeated and unique signatures of differentiation across many loci scattered throughout the genome is consistent with polygenic adaptation from standing genetic variation and locally variable selection pressures in the early stages of life history divergence. © 2016 John Wiley & Sons Ltd.
Sheryl Coombs; Gary D. Grossman
2006-01-01
We compared prey-orienting and rheotactic behaviors in a fluvial (Coweeta Creek) and lacustrine (Lake Michigan) population of mottled sculpin. Blinded sculpin from both populations exhibited unconditioned, mechanosensory based rheotaxis to low velocity flows. Whereas Lake Michigan sculpin generally showed increasing levels of positive rheotaxis to increasing velocities...
Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J
2017-01-01
The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii's sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.
Balakirev, Evgeniy S; Saveliev, Pavel A; Ayala, Francisco J
2017-01-01
The complete mitochondrial (mt) genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii. A surprisingly high level of sequence divergence (10.3%) has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027). At the same time, a surprisingly low level of divergence (1.4%) has been detected between the GenBank C czerskii (KJ956027) and the Amur sculpin Cottus szanaga (KX762049, KX762050). We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii. Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1), bearing 2 introgressed fragments (≈0.9 kb [kilobase]) from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis, submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550). Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information. PMID:28890653
A short-term look at potential changes in Lake Michigan slimy sculpin diets
French, John R. P.; Stickel, Richard G.; Stockdale, Beth A.; Black, M. Glen
2010-01-01
Diporeia hoyi and Mysis relicta are the most important prey items of slimy sculpins (Cottus cognatus) in the Great Lakes. Slimy sculpins were collected from dreissenid-infested bottoms off seven Lake Michigan ports at depths of 27–73 m in fall 2003 to study their lake-wide diets. Relatively large dreissenid biomass occurred at depths of 37- and 46-m. Quagga mussels (Dreissena bugnesis) composed at least 50% of dreissenid biomass at Manistique, Saugatuck, and Sturgeon Bay. Mysis accounted for 82% of the sculpin diet by dry weight at eastern Lake Michigan while Diporeia composed 54–69% of the diet at western Lake Michigan and dominated the diets of slimy sculpins at all sites deeper than 46 m. In northern Lake Michigan, this diet study in new sites showed that slimy sculpin consumed more prey with low energy contents, especially chironomids, than Mysis and Diporeia in shallow sites (depth diet studies on sedentary benthic fishes to be conducted along perimeters of the Great Lakes to observe changes in their diets that may be impacted by changing benthic macroinvertebrate communities.
Czech Academy of Sciences Publication Activity Database
Halačka, Karel; Vítek, T.; Vetešník, Lukáš; Spurný, P.
2012-01-01
Roč. 61, č. 1 (2012), s. 9-16 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : goblet cell * sacciform cell * erythrocyte * leucocyte Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012
Miller, Lana L; Isaacs, Meghan A; Martyniuk, Christopher J; Munkittrick, Kelly R
2015-10-01
Canadian fish-based environmental effects monitoring programs use individual and population-level endpoints to assess aquatic health. Impacts of coal mining and selenium (Se) exposure were assessed in slimy sculpin (Cottus cognatus) from reference streams located both inside and outside of a coal zone, and from 1 stream with a history of coal mining, using traditional environmental effects monitoring endpoints. In addition, physical characteristics of the streams and benthic macro-invertebrate communities were assessed. To determine whether the assessment of effects could be improved by including molecular markers, real-time polymerase chain reaction assays were optimized for genes associated with reproduction (vtg, esr1, star, cyp19a1, and gys2), and oxidative and cellular stress (sod1, gpx, gsr, cat, and hsp 90). Water Se levels exceeded guidelines in the stream with historical mining (4 μg/L), but benthic macroinvertebrates did not exceed dietary thresholds (2-3 μg/g dry wt). Whole-body Se levels were above British Columbia's tissue guideline in fish from all streams, but only above the draft US Environmental Protection Agency (USEPA) criterion (7.91 μg/g dry wt) at the reference stream inside the coal zone. Some markers of cellular and oxidative stress were elevated in fish liver at the exposed site (sod1, gpx), but some were lower (cat, sod1, gpx, gsr, hsp90) in the gonads of fish inside the coal zone. Some of the differences in gene expression levels between the reference and impacted sites were sex dependent. Based on benthic macroinvertebrate assessments, the authors hypothesize that traditional and molecular differences in slimy sculpin at impacted sites may be driven by food availability rather than Se exposure. The present study is the first to adapt molecular endpoints in the slimy sculpin for aquatic health assessments. © 2015 SETAC.
Homola, J J; Ruetz, C R; Kohler, S L; Thum, R A
2016-11-01
This study used analyses of the genetic structure of a non-game fish species, the mottled sculpin Cottus bairdii to hypothesize probable recolonization routes used by cottids and possibly other Laurentian Great Lakes fishes following glacial recession. Based on samples from 16 small streams in five major Lake Michigan, U.S.A., tributary basins, significant interpopulation differentiation was documented (overall F ST = 0·235). Differentiation was complex, however, with unexpectedly high genetic similarity among basins as well as occasionally strong differentiation within basins, despite relatively close geographic proximity of populations. Genetic dissimilarities were identified between eastern and western populations within river basins, with similarities existing between eastern and western populations across basins. Given such patterns, recolonization is hypothesized to have occurred on three occasions from more than one glacial refugium, with a secondary vicariant event resulting from reduction in the water level of ancestral Lake Michigan. By studying the phylogeography of a small, non-game fish species, this study provides insight into recolonization dynamics of the region that could be difficult to infer from game species that are often broadly dispersed by humans. © 2016 The Fisheries Society of the British Isles.
An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream
Energy Technology Data Exchange (ETDEWEB)
Carrico, B.A.; Ryon, M.G.
1996-02-01
A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins.
An Ecological Study on the Introduction of the Banded Sculpin Into a Coal Flyash Impacted Stream
International Nuclear Information System (INIS)
Carrico, B.A.; Ryon, M.G.
1996-02-01
A number of banded sculpins [Cottus carolinae (Gill)] were obtained from a population in a reference stream, marked with subcutaneous acrylic paint injections, and introduced into McCoy Branch, a small second-order stream located on the Oak Ridge Reservation in eastern Tennessee, which was inhabited by only a few banded sculpins prior to the study. McCoy Branch had received deposits of coal ash slurry for a prolonged period, however, there were some indications of recovery in the macroinvertebrate community due to improvements in water quality. Stream habitat characteristics and water chemistry parameters were monitored in McCoy Branch and a reference stream for a three-year period. Feeding patterns and reproductive activities of the banded sculpins were also monitored during the study. Sculpin population parameters including density, condition factor, and young-of-year (YOY) abundance and survival were studied. The results of the study show that the introduced fish have survived and appear to be in good condition. The sculpins have maintained a density of approximately 0.12 fish per square meter of stream, a figure similar to that found in other headwater streams located in the region. Colonization rates and sculpin densities in McCoy Branch were lower than expected, perhaps due to physical habitat degradation and reduced macroinvertebrate abundance. Evidence of sculpin reproduction in McCoy Branch was seen in the presence of gravid female sculpins (1994 and 1995) and YOY fish (1993 through 1995 year classes). This study indicates that McCoy Branch continues to recover from past perturbations to the point where it can now support a viable population of banded sculpins
Sanchez, Wilfried; Bender, Coline; Porcher, Jean-Marc
2014-01-01
Marine ecosystem contamination by microplastics is extensively documented. However few data is available on the contamination of continental water bodies and associated fauna. The aim of this study was to address the occurrence of microplastics in digestive tract of gudgeons (Gobio gobio) from French rivers. These investigations confirm that continental fish ingested microplastics while 12% of collected fish are contaminated by these small particles. Further works are needed to evaluate the occurence of this contamination. © 2013 Published by Elsevier Inc.
Hauge, Joakim
2007-01-01
Freshwater sculpins and salmonids coexist in many streams throughout the Northern hemisphere, and often constitute an important component of stream ecosystems. Alpine bullhead Cottus poecilopus Heckel have been known to predate eggs and fry of brown trout Salmo trutta L., and also to function as a competitor to older brown trout for habitat and prey items. This study was designed to examine possible behavioural differences in activity level and positioning between a sympatric and an allopatri...
Conlon, J M; Falkmer, S; Thim, L
1987-04-01
Three peptides isolated from the Brockmann bodies of the daddy sculpin, a teleostean fish, have been identified as fragments of one or more proglucagons. The peptide L Q D A E D S S R F D A D D T L A G E A R E L S T P K represents the NH2 terminus of proglucagon (residues 1-27), H S E G T F S N D Y S K Y L E T R R A Q D F V Q W L K N S represents glucagon and H A D G T F T S D V S S Y L N D Q A I K D F V A K L K S G K V represents the glucagon-like peptide at the COOH terminus of the precursor. The fast-atom bombardment mass spectra of the three peptides were consistent with the proposed structures and demonstrated that further posttranslational modifications of the peptides had not taken place. Sculpin glucagon is identical to anglerfish glucagon II but sculpin proglucagon(1-27) and glucagon-like peptide show stronger homology to the corresponding regions of anglerfish proglucagon I than to proglucagon II. The structures of the peptides are suggestive of the action of trypsin-like and carboxypeptidase-B-like enzymes at the site of pairs of basic amino acid residues in proglucagon. The presence of a COOH-terminal lysyl group in proglucagon(1-27) may indicate, however, that the penultimate prolyl residue partially inhibits the action of the carboxypeptidase-B-like activity.
THE INVENTORY OF FISH FROM THE NATIONAL PARK CĂLIMANI - DIVERSITY AND DISTRIBUTION
Directory of Open Access Journals (Sweden)
Luiza Florea
2017-07-01
Full Text Available In the Călimani National Park, the inventory of the fish species of community importance, carried out in 2013 through a project from the Sectoral Operational Program for Environment, revealed that there is only one species of community interest in the park, namely Cottus gobio (bullhead. This is a normal fact given that the site is located at altitudes ranging from a maximum of 2083 m to a minimum of 470, and most of the waters are represented by alpine creek. In the all four fishing campaigns, 30 tributaries were investigated and a total of 220 individuals were fished out of which: 156 individuals of river trout (Salmo trutta fario, 9 individuals of common bullhead (Cottus gobio, 52 individuals of rare bullhead (Cottus poecilopus, 2 individuals of grayling (Thymallus thymallus and 1 individuals of minnow (Phoxinus phoxinus. Ihtiofauna has a very low diversity, being constantly represented by one species of fish, Salmo trutta fario, which is well suited to the conditions of the creek situated on slopes of 1-3 m/km. Thus, out of the 30 investigated water courses, Salmo trutta fario is present in 17 water courses. Instead of this, Cottus gobio, a species of fish of community importance, has a very low presence on the territory of Calimani National Park, this situation is, to some extent, inadequate.
Directory of Open Access Journals (Sweden)
Evgeniy S Balakirev
2017-08-01
Full Text Available The complete mitochondrial (mt genome is sequenced in 2 individuals of the Cherskii’s sculpin Cottus czerskii . A surprisingly high level of sequence divergence (10.3% has been detected between the 2 genomes of C czerskii studied here and the GenBank mt genome of C czerskii (KJ956027. At the same time, a surprisingly low level of divergence (1.4% has been detected between the GenBank C czerskii (KJ956027 and the Amur sculpin Cottus szanaga (KX762049, KX762050. We argue that the observed discrepancies are due to incorrect taxonomic identification so that the GenBank accession number KJ956027 represents actually the mt genome of C szanaga erroneously identified as C czerskii . Our results are of consequence concerning the GenBank database quality, highlighting the potential negative consequences of entry errors, which once they are introduced tend to be propagated among databases and subsequent publications. We illustrate the premise with the data on recombinant mt genome of the Siberian taimen Hucho taimen (NCBI Reference Sequence Database NC_016426.1; GenBank accession number HQ897271.1, bearing 2 introgressed fragments (≈0.9 kb [kilobase] from 2 lenok subspecies, Brachymystax lenok and Brachymystax lenok tsinlingensis , submitted to GenBank on June 12, 2011. Since the time of submission, the H taimen recombinant mt genome leading to incorrect phylogenetic inferences was propagated in multiple subsequent publications despite the fact that nonrecombinant H taimen genomes were also available (submitted to GenBank on August 2, 2014; KJ711549, KJ711550. Other examples of recombinant sequences persisting in GenBank are also considered. A GenBank Entry Error Depositary is urgently needed to monitor and avoid a progressive accumulation of wrong biological information.
Gray, Benjamin P.; Norcross, Brenda L.; Beaudreau, Anne H.; Blanchard, Arny L.; Seitz, Andrew C.
2017-01-01
Arctic staghorn sculpin (Gymnocanthus tricuspis) and shorthorn sculpin (Myoxocephalus scorpius) belong to Cottidae, the second most abundant fish family in the western Arctic. Although considered important in food webs, little is known about their food habits throughout this region. To address this knowledge gap, we examined and compared the diets of 515 Arctic staghorn sculpin and 422 shorthorn sculpin using stomachs collected over three summers in the northeastern Chukchi Sea (2010-2012) and one summer in the western Beaufort Sea (2011). We used permutational multivariate analysis of variance (PERMANOVA) and non-metric multidimensional scaling (nMDS) to compare sculpin diets between regions and selected size classes. Differences in mouth morphologies and predator size versus prey size relationships were examined using regression techniques. Arctic staghorn sculpin and shorthorn sculpin diet compositions differed greatly throughout the Chukchi and Beaufort Seas. Regardless of body size, the smaller-mouthed Arctic staghorn sculpin consumed mostly benthic amphipods and polychaetes, whereas the larger-mouthed shorthorn sculpin shifted from a diet composed of benthic and pelagic macroinvertebrates as smaller individuals to shrimps and fish prey as larger individuals. Within shared habitats, the sculpins appear to partition prey, either by taxa or size, in a manner that suggests no substantial overlap occurs between species. This study increases knowledge of sculpin feeding ecology in the western Arctic and offers regional, quantitative diet information that could support current and future food web modeling efforts.
Recherches biologiques et pisciculture expérimentale du goujon (Gobio gobio L.
Directory of Open Access Journals (Sweden)
BRUNET R.
1972-07-01
Full Text Available 1.1. Le goujon Gobio gobio L. (sous-espèce gobio est un poisson de rivières peu rapides, à instinct grégaire, vivant sur fond de gravier entre la région salmonicole et la région cyprinicole. Il peut vivre de 5 à 7 années et se reproduire dès la seconde année. 1.2. Le goujon n'est pas un poisson migrateur comme les expériences réalisées par marquage tendent à le démontrer, mais ce poisson à forte capacité reproductrice peut passer par des périodes de prolifération ou de raréfaction. 1.3. Le goujon est un poisson de type Carnivore qui s'alimente normalement durant toute l'année. Les adultes se nourissent principalement à partir du benthos ; les proies sont, en ordre d'importance décroissante, des larves d'Insectes, des Crustacés, des Mollusques, des Vers et des Algues ou détritus végétaux. Les alevins s'alimentent principalement à partir du plancton ; la nourriture est de même nature qualitativement, mais quantitativement les Crustacés y sont beaucoup plus abondants que les Insectes. 1.4. Le goujon est fréquemment parasité par le Plathelminte Monogène du genre Diplozoon ; ce parasite peut infester 90 % de la population. Il est parfois parasité par un grand Nématode du genre Philometra qui envahit la cavité générale. 1.5. Le goujon pond au printemps et en été, mais le début de la ponte est nettement lié à la température de l'eau (minimum de + 16°C à + 17°C; la ponte est fractionnée, mais peut atteindre 4 000 à 5 000 œufs par femelle et par saison. L'œuf, blanc translucide, mesure 1,5 mm de diamètre; l'incubation est de 125 degrés/jour. L'essai d'élevage en aquarium prouve qu'une alimentation artificielle adaptée doit être possible. 1.6. La pisciculture des alevins est réalisée dans la région toulousaine et permet d'indiquer les normes souhaitables. Pour la ponte, des bassins de 1 000 m2 , avec pente de 1 % et fond de gravier, peuvent recevoir 500 géniteurs. La croissance des alevins d'un
Conlon, J M; Davis, M S; Falkmer, S; Thim, L
1987-11-02
The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.
Huff, David D.; Miller, Loren M.; Vondracek, Bruce C.
2010-01-01
Reintroductions are a common approach for preserving intraspecific biodiversity in fragmented landscapes. However, they may exacerbate the reduction in genetic diversity initially caused by population fragmentation because the effective population size of reintroduced populations is often smaller and reintroduced populations also tend to be more geographically isolated than native populations. Mixing genetically divergent sources for reintroduction purposes is a practice intended to increase genetic diversity. We documented the outcome of reintroductions from three mixed sources on the ancestral composition and genetic variation of a North American fish, the slimy sculpin (Cottus cognatus). We used microsatellite markers to evaluate allelic richness and heterozygosity in the reintroduced populations relative to computer simulated expectations. Sculpins in reintroduced populations exhibited higher levels of heterozygosity and allelic richness than any single source, but only slightly higher than the single most genetically diverse source population. Simulations intended to mimic an ideal scenario for maximizing genetic variation in the reintroduced populations also predicted increases, but they were only moderately greater than the most variable source population. We found that a single source contributed more than the other two sources at most reintroduction sites. We urge caution when choosing whether to mix source populations in reintroduction programs. Genetic characteristics of candidate source populations should be evaluated prior to reintroduction if feasible. When combined with knowledge of the degree of genetic distinction among sources, simulations may allow the genetic diversity benefits of mixing populations to be weighed against the risks of outbreeding depression in reintroduced and nearby populations.
Czech Academy of Sciences Publication Activity Database
Matěna, Josef; Matěnová, V.; Blabolil, Petr; Kopáček, Jiří; Peltanova, J.; Šorf, M.; Žaloudík, Jiří; Vrba, Jaroslav
2017-01-01
Roč. 66, č. 1 (2017), s. 1-10 ISSN 0139-7893 R&D Projects: GA ČR GA206/07/1200; GA ČR(CZ) GAP504/12/1218 Institutional support: RVO:60077344 Keywords : Czech Republic * streams * longitudinal gradients * Salmo trutta s.l. * Cottus gobio Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.739, year: 2016
Energy Technology Data Exchange (ETDEWEB)
Knapen, Dries; Bervoets, Lieven; Verheyen, Erik; Blust, Ronny
2004-04-14
Anthropogenic disturbances cause the environment to change relatively fast. It is reasonable to assume that it is very unlikely for individuals to develop genetic adaptations to their polluted habitats, since adaptation through natural selection is a relatively slow process. Nevertheless, several studies have shown that such adaptations to changing environmental conditions may develop faster than anticipated. This study investigates the impact of historical metal pollution on a natural population of the gudgeon, Gobio gobio. Specimens from a contaminated site and a reference population were subjected to a series of three exposure experiments to cadmium after an acclimation period to reconstituted fresh water of 36 days. First, we performed an acute toxicity test on a sub-sample of both experimental groups to determine times-to-death (TTD) and lethal body burdens (LBB). The remaining individuals were used in a chronic Cd-exposure experiment, after which total Cd-body concentration, as well as Cd-concentrations and metallothionein-like protein (MTLP) levels in liver and gill tissue were determined. From the specimens that were not sacrificed for these measurements, a random subsample was subjected to a second acute toxicity test to evaluate the effect of chronic Cd-exposure (acclimation) on TTD and LBB. Our results show that, particularly after an extra acclimation period to a sublethal Cd-concentration, specimens originating from the contaminated sample area survived the acute exposure experiments better, despite the fact that neither the average Cd-accumulation rate, nor the lethal body concentrations differed between fishes from both groups. We also find that gudgeons from both populations translocated Cd from the gills (and probably also from other compartments) to the liver, where it can be more efficiently detoxified by MTLPs. Indeed, MTLP levels were found to increase faster in liver and gill tissue of specimens from the contaminated site, resulting in
International Nuclear Information System (INIS)
Knapen, Dries; Bervoets, Lieven; Verheyen, Erik; Blust, Ronny
2004-01-01
Anthropogenic disturbances cause the environment to change relatively fast. It is reasonable to assume that it is very unlikely for individuals to develop genetic adaptations to their polluted habitats, since adaptation through natural selection is a relatively slow process. Nevertheless, several studies have shown that such adaptations to changing environmental conditions may develop faster than anticipated. This study investigates the impact of historical metal pollution on a natural population of the gudgeon, Gobio gobio. Specimens from a contaminated site and a reference population were subjected to a series of three exposure experiments to cadmium after an acclimation period to reconstituted fresh water of 36 days. First, we performed an acute toxicity test on a sub-sample of both experimental groups to determine times-to-death (TTD) and lethal body burdens (LBB). The remaining individuals were used in a chronic Cd-exposure experiment, after which total Cd-body concentration, as well as Cd-concentrations and metallothionein-like protein (MTLP) levels in liver and gill tissue were determined. From the specimens that were not sacrificed for these measurements, a random subsample was subjected to a second acute toxicity test to evaluate the effect of chronic Cd-exposure (acclimation) on TTD and LBB. Our results show that, particularly after an extra acclimation period to a sublethal Cd-concentration, specimens originating from the contaminated sample area survived the acute exposure experiments better, despite the fact that neither the average Cd-accumulation rate, nor the lethal body concentrations differed between fishes from both groups. We also find that gudgeons from both populations translocated Cd from the gills (and probably also from other compartments) to the liver, where it can be more efficiently detoxified by MTLPs. Indeed, MTLP levels were found to increase faster in liver and gill tissue of specimens from the contaminated site, resulting in
Energy Technology Data Exchange (ETDEWEB)
Dang, Mai [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia); Nørregaard, Rasmus; Bach, Lis; Sonne, Christian; Søndergaard, Jens; Gustavson, Kim; Aastrup, Peter [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, PO Box 358, DK-4000 Roskilde (Denmark); Nowak, Barbara, E-mail: B.Nowak@utas.edu.au [Institute of Marine and Antarctic Studies University of Tasmania, Launceston, Tasmania 7250 (Australia)
2017-02-15
Fourhorn sculpins (Myoxocephalus quadricornis) and shorthorn sculpins (Myoxocephalus scorpius) have been considered suitable local bioindicators for environmental monitoring studies in the Arctic. Because these species share many characteristics, data from the two species have previously been pooled when assessing marine metal contamination. A chemical and histological study was conducted on fourhorn and shorthorn sculpins collected around a contaminated lead-zinc mine at East Greenland to investigate whether there were any differences in the residues of metals, histopathology and parasites in liver and gills between the two sculpin species. The results demonstrated that concentrations of copper (Cu), zinc (Zn), mercury (Hg) and lead (Pb) were significantly higher in the fourhorn sculpins (p<0.001) while there were no significant differences for arsenic (As) or cadmium (Cd). Furthermore, density of blood vessel fibrosis (p=0.028), prevalence and density of chondroplasia (p=0.002 and p=0.005, respectively), number of mucin-containing mucous cells (p<0.001) and chloride cells (p<0.001) and mean intensity of colonial Peritricha (p<0.001) were significantly higher in fourhorn sculpin. Based on these results we suggest that pooling the two species when conducting environmental assessments is not recommended as it can lead to incorrect conclusions. We propose that a larger study investigating the biological effects of zinc-lead mining in Greenland is needed. - Highlights: • Fourhorn sculpins (Myoxocephalus quadricornis) more sensitive to pollution than shorthorn sculpins (Myoxocephalus scorpius). • Metal residues, histological changes and presence of parasites were species-specific. • Different sculpin species should not be pooled together as pollution biomarkers.
NATIVE AND INTRODUCED LARVAL FISHES IN SUISAN MARSH, CALIFORNIA,: THE EFFECTS OF FRESHWATER FLOW
We sampled ichthyoplankton weekly in Suisun Marsh in the San Francisco Estuary from February to June each year from 1994 to 1999. We collected approximately 227,900 fish, predominantly shimofuri goby Tridentiger bifasciatus (60%) and prickly sculpin Cottus asper (33%). Principal ...
Reproduction of the shorthorn sculpin Myoxocephalus scorpius in northern Norway
Luksenburg, JA; Pedersen, T; Falk-Petersen, IB
The reproduction and life history events of the shorthorn sculpin Myoxocephalus scorpius were studied in an unexploited high latitude population in Tromso, northern Norway. Shorthorn sculpins were sampled from November 1998 to March 1999 to determine sex ratio, spawning period, oogenesis, fecundity,
Fish assemblage structure and relations with environmental conditions in a Rocky Mountain watershed
Quist, M.C.; Hubert, W.A.; Isaak, D.J.
2004-01-01
Fish and habitat were sampled from 110 reaches in the Salt River basin (Idaho and Wyoming) during 1996 and 1997 to assess patterns in fish assemblage structure across a Rocky Mountain watershed. We identified four distinct fish assemblages using cluster analysis: (1) allopatric cutthroat trout (Oncorhynchus clarki (Richardson, 1836)); (2) cutthroat trout - brook trout (Salvelinus fontinalis (Mitchell, 1814)) - Paiute sculpin (Cottus beldingi Eigenmann and Eigenmann, 1891); (3) cutthroat trout - brown trout (Salmo trutta L., 1758) - mottled sculpin (Cottus bairdi Girard, 1850); and (4) Cyprinidae-Catostomidae. The distribution of fish assemblages was explained by thermal characteristics, stream geomorphology, and local habitat features. Reaches with allopatric cutthroat trout and the cutthroat trout - brook trout - Paiute sculpin assemblage were located in high-elevation, high-gradient streams. The other two fish assemblages were generally located in low-elevation streams. Associations between habitat gradients, locations of reaches in the watershed, and occurrence of species were further examined using canonical correspondence analysis. The results suggest that stream geomorphology, thermal conditions, and local habitat characteristics influence fish assemblage structure across a Rocky Mountain watershed, and they provide information on the ecology of individual species that can guide conservation activities. ?? 2004 NRC Canada.
Britton, J.R.; Berry, M.; Sewell, S.; Lees, C.; Reading, P.
2017-01-01
The diet composition of the European otter Lutra lutra was assessed using spraint analysis in the Hampshire Avon, a lowland chalk stream in Southern England, over an 18-month period. Small cyprinid fishes were the main prey item taken in all seasons, with bullhead Cottus gobio and stone loach Barbatula barbatula also important; there were relatively few larger fishes of interest to fisheries found. There were significant seasonal differences in diet composition by season, with signal crayfish...
Directory of Open Access Journals (Sweden)
Leopold A J Nagelkerke
Full Text Available Invasions of Ponto-Caspian fish species into north-western European river basins accelerated since the opening of the Rhine-Main-Danube Canal in 1992. Since 2002, at least five Ponto-Caspian alien fish species have arrived in The Netherlands. Four species belong to the Gobiidae family (Neogobius fluviatilis, Neogobius melanostomus, Ponticola kessleri, and Proterorhinus semilunaris and one to the Cyprinidae family (Romanogobio belingi. These species are expected to be potentially deleterious for the populations of four native benthic fish species: Gobio gobio (Cyprinidae, Barbatula barbatula (Nemacheilidae, Cottus perifretum, and C. rhenanus (Cottidae. Invasion success may be dependent on competitive trophic interactions with native species, which are enabled and/or constrained by feeding-related morphological traits. Twenty-two functional feeding traits were measured in nine species (in total 90 specimens. These traits were quantitatively linked to the mechanical, chemical and behavioral properties of a range of aquatic resource categories, using a previously developed food-fish model (FFM. The FFM was used to predict the trophic profile (TP of each fish: the combined capacities to feed on each of the resource types. The most extreme TPs belonged to three alien species, indicating that they were most specialized among the studied species. Of these three, only P. kessleri overlapped with the two native Cottus species, indicating potential trophic competition. N. fluviatilis and R. belingi did not show any overlap, indicating that there is low trophic competition. The two remaining alien goby species (N. melanostomus and P. semilunaris had average TPs and could be considered generalist feeders. They overlapped with each other and with G. gobio and B. barbatula, indicating potential trophic competition. This study suggests that both generalist and specialist species can be successful invaders. Since the FFM predicts potential interactions between
Nagelkerke, Leopold A J; van Onselen, Eline; van Kessel, Nils; Leuven, Rob S E W
2018-01-01
Invasions of Ponto-Caspian fish species into north-western European river basins accelerated since the opening of the Rhine-Main-Danube Canal in 1992. Since 2002, at least five Ponto-Caspian alien fish species have arrived in The Netherlands. Four species belong to the Gobiidae family (Neogobius fluviatilis, Neogobius melanostomus, Ponticola kessleri, and Proterorhinus semilunaris) and one to the Cyprinidae family (Romanogobio belingi). These species are expected to be potentially deleterious for the populations of four native benthic fish species: Gobio gobio (Cyprinidae), Barbatula barbatula (Nemacheilidae), Cottus perifretum, and C. rhenanus (Cottidae). Invasion success may be dependent on competitive trophic interactions with native species, which are enabled and/or constrained by feeding-related morphological traits. Twenty-two functional feeding traits were measured in nine species (in total 90 specimens). These traits were quantitatively linked to the mechanical, chemical and behavioral properties of a range of aquatic resource categories, using a previously developed food-fish model (FFM). The FFM was used to predict the trophic profile (TP) of each fish: the combined capacities to feed on each of the resource types. The most extreme TPs belonged to three alien species, indicating that they were most specialized among the studied species. Of these three, only P. kessleri overlapped with the two native Cottus species, indicating potential trophic competition. N. fluviatilis and R. belingi did not show any overlap, indicating that there is low trophic competition. The two remaining alien goby species (N. melanostomus and P. semilunaris) had average TPs and could be considered generalist feeders. They overlapped with each other and with G. gobio and B. barbatula, indicating potential trophic competition. This study suggests that both generalist and specialist species can be successful invaders. Since the FFM predicts potential interactions between species, it
Czech Academy of Sciences Publication Activity Database
Marešová, Eva; Lusková, Věra; Lojkásek, B.
2012-01-01
Roč. 67, č. 4 (2012), s. 788-795 ISSN 0006-3088 R&D Projects: GA MŽP(CZ) SPII2D1/9/07 Institutional support: RVO:68081766 Keywords : bullheads * hybrid zones * microsatellites * S7 nuclear gene Subject RIV: EG - Zoology Impact factor: 0.506, year: 2012
DEFF Research Database (Denmark)
Nørregaard, Rasmus Dyrmose; Dang, Mai; Bach, Lis
2018-01-01
light on the present contamination and its potential effects on local fish we investigated gill and liver histology of sculpins (Myoxocephalus spp.) around the former mining area. Two species of sculpins were caught; shorthorn sculpins (M. scorpius; n = 16) and fourhorn sculpins (M. quadricornis; n = 17...... a significantly higher prevalence of chondroplastic tissue and intensity of neutral, mixed and total mucus cells in the gills compared to the shorthorn sculpins. The data indicate that both sculpin species could be useful indicator species for environmental monitoring of metal pollution in Arctic areas. However...
Brown trout and food web interactions in a Minnesota stream
Zimmerman, J.K.H.; Vondracek, B.
2007-01-01
1. We examined indirect, community-level interactions in a stream that contained non-native brown trout (Salmo trutta Linnaeus), native brook trout (Salvelinus fontinalis Mitchill) and native slimy sculpin (Cottus cognatus Richardson). Our objectives were to examine benthic invertebrate composition and prey selection of fishes (measured by total invertebrate dry mass, dry mass of individual invertebrate taxa and relative proportion of invertebrate taxa in the benthos and diet) among treatments (no fish, juvenile brook trout alone, juvenile brown trout alone, sculpin with brook trout and sculpin with brown trout). 2. We assigned treatments to 1 m2 enclosures/exclosures placed in riffles in Valley Creek, Minnesota, and conducted six experimental trials. We used three designs of fish densities (addition of trout to a constant number of sculpin with unequal numbers of trout and sculpin; addition of trout to a constant number of sculpin with equal numbers of trout and sculpin; and replacement of half the sculpin with an equal number of trout) to investigate the relative strength of interspecific versus intraspecific interactions. 3. Presence of fish (all three species, alone or in combined-species treatments) was not associated with changes in total dry mass of benthic invertebrates or shifts in relative abundance of benthic invertebrate taxa, regardless of fish density design. 4. Brook trout and sculpin diets did not change when each species was alone compared with treatments of both species together. Likewise, we did not find evidence for shifts in brown trout or sculpin diets when each species was alone or together. 5. We suggest that native brook trout and non-native brown trout fill similar niches in Valley Creek. We did not find evidence that either species had an effect on stream communities, potentially due to high invertebrate productivity in Valley Creek. ?? 2007 Blackwell Publishing Ltd.
Lake Ontario benthic prey fish assessment, 2015
Weidel, Brian C.; Walsh, Maureen; Holden, Jeremy P.; Connerton, Michael J.
2016-01-01
Benthic prey fishes are a critical component of the Lake Ontario food web, serving as energy vectors from benthic invertebrates to native and introduced piscivores. Since the late 1970’s, Lake Ontario benthic prey fish status was primarily assessed using bottom trawl observations confined to the lake’s south shore, in waters from 8 – 150 m (26 – 492 ft). In 2015, the Benthic Prey Fish Survey was cooperatively adjusted and expanded to address resource management information needs including lake-wide benthic prey fish population dynamics. Effort increased from 55 bottom trawl sites to 135 trawl sites collected in depths from 8 - 225m (26 – 738 ft). The spatial coverage of sampling was also expanded and occurred in all major lake basins. The resulting distribution of tow depths more closely matched the available lake depth distribution. The additional effort illustrated how previous surveys were underestimating lake-wide Deepwater Sculpin, Myoxocephalus thompsonii, abundance by not sampling in areas of highest density. We also found species richness was greater in the new sampling sites relative to the historic sites with 11 new fish species caught in the new sites including juvenile Round Whitefish, Prosopium cylindraceum, and Mottled sculpin, Cottus bairdii. Species-specific assessments found Slimy Sculpin, Cottus cognatus abundance increased slightly in 2015 relative to 2014, while Deepwater Sculpin and Round Goby, Neogobius melanostomus, dramatically increased in 2015, relative to 2014. The cooperative, lake-wide Benthic Prey Fish Survey expanded our understanding of benthic fish population dynamics and habitat use in Lake Ontario. This survey’s data and interpretations influence international resource management decision making, such as informing the Deepwater Sculpin conservation status and assessing the balance between sport fish consumption and prey fish populations. Additionally a significant Lake Ontario event occurred in May 2015 when a single
Halpenny, C.M.; Kocan, R.M.; Hershberger, P.K.
2004-01-01
The parasitic copepod, Haemobaphes intermedius, was detected in 62% of juvenile buffalo sculpins Enophrys bison, a previously unreported host, from the San Juan Islands archipelago in Washington State. Most infestations were characterized by the presence of a single female copepod infestations with multiple H. intermedius occurred either unilaterally or bilaterally in 29% of parasitized individuals. Impaired condition of parasitized hosts was indicated by significantly lower total lengths and weights (34.9 mm; 1.6 g) than in unparasitized cohorts (38.9 mm; 2.1 g). Host specificity was indicated by the failure to detect H. intermedius in 43 sympatric great sculpins Myoxocephalus polyacanthocephalus from the same location.
Baumsteiger, Jason; Kinziger, Andrew P; Aguilar, Andres
2012-12-01
The west coast of North America contains a number of biogeographic freshwater provinces which reflect an ever-changing aquatic landscape. Clues to understanding this complex structure are often encapsulated genetically in the ichthyofauna, though frequently as unresolved evolutionary relationships and putative cryptic species. Advances in molecular phylogenetics through species tree analyses now allow for improved exploration of these relationships. Using a comprehensive approach, we analyzed two mitochondrial and nine nuclear loci for a group of endemic freshwater fish (sculpin-Cottus) known for a wide ranging distribution and complex species structure in this region. Species delimitation techniques identified three novel cryptic lineages, all well supported by phylogenetic analyses. Comparative phylogenetic analyses consistently found five distinct clades reflecting a number of unique biogeographic provinces. Some internal node relationships varied by species tree reconstruction method, and were associated with either Bayesian or maximum likelihood statistical approaches or between mitochondrial, nuclear, and combined datasets. Limited cases of mitochondrial capture were also evident, suggestive of putative ancestral hybridization between species. Biogeographic diversification was associated with four major regions and revealed historical faunal exchanges across regions. Mapping of an important life-history character (amphidromy) revealed two separate instances of trait evolution, a transition that has occurred repeatedly in Cottus. This study demonstrates the power of current phylogenetic methods, the need for a comprehensive phylogenetic approach, and the potential for sculpin to serve as an indicator of biogeographic history for native ichthyofauna in the region. Copyright © 2012 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Timothy
2007-01-01
Increasingly there is a need to assess the contaminant levels in fish as indicators of the health and well-being of both the fish and their consumers, including humans. This paper examines the levels of arsenic, cadmium, chromium, lead, manganese, mercury, and selenium in the kidney, liver, and muscle of great sculpin and flathead sole from Adak Island in the Aleutian Islands, Alaska. Both species are consumed by the local Aleuts and others. There were significant differences in the levels of heavy metals as a function of tissue for both fish species; the liver of sculpin and sole generally had the highest levels of most metals, except for arsenic, lead, and selenium. Sole had significantly higher mean levels of arsenic in kidney (32,384 vs. 531 ppb, wet weight), liver (18,954 vs. 2532 ppb), and muscle (19,452 vs. 1343 ppb) than did sculpin. Sole also had higher mean levels of cadmium (230 vs. 63 ppb), lead (1236 vs. 48 ppb), mercury (150 vs. 107 ppb), and selenium (5215 vs. 1861 ppb) in kidney than did sculpin. There were significant correlations among weight and length measurements for both species. However, except for mercury, there were few significant correlations among tissue types for most metals. Only mercury and manganese levels were significantly correlated with size for sculpin (but not for sole). Levels of arsenic, lead, and mercury may pose a risk to predators that consume them, and arsenic and mercury may pose a risk to human consumers
DEFF Research Database (Denmark)
Ito, Takafumi; Olesen, Niels Jørgen
2013-01-01
Genotype IVb of viral haemorrhagic septicaemia virus (VHSV) was isolated for the first time in the Great Lakes basin in 2003, where it spread and caused mass mortalities in several wild fish species throughout the basin. In order to prevent further spreading of the disease and to assess risks...... mortalities in bluegill Lepomis macrochirus used as positive controls, Japanese fluvial sculpin Cottus pollux, and iwana Salvelinus leucomaenis pluvius were 50, 80 and 0%, respectively. In Expt 2, cumulative mortalities of 100, 100 and 10% were observed in Japanese fluvial sculpin C. pollux, Japanese rice......-isolation by cell culture was successful from all dead fish. We detected the virus in the brain from a few surviving bluegill 50 d post exposure by both cell culture and RT-PCR. These results revealed that VHSV IVb could become a serious threat to wild freshwater fish species in Japan, and that some surviving fish...
Sexual and geographical variation in life history parameters of the shorthorn sculpin
Luksenburg, JA; Pedersen, T
2002-01-01
A total of 293 shorthorn sculpins Myoxocephalus scorpius from Tromso, northern Norway, were sampled between November 1998 and April 1999 to determine sex, total length, age, growth, maturity and mortality. Females grew to larger sizes (L-infinity=26.9 v. 18.5 cm), matured later (2 v. 1 year of age)
Czech Academy of Sciences Publication Activity Database
Moravec, František; Muzzall, P.
2009-01-01
Roč. 95, č. 4 (2009), s. 987-990 ISSN 0022-3395 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Freitascapillaria * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.195, year: 2009
Roseman, Edward F.
2014-01-01
Deepwater sculpins (Myoxocephalus thompsonii) are an important link in deepwater benthic foodwebs of the Great Lakes. Little information exists about deepwater sculpin spawning habits and early life history ecology due to difficulty in sampling deep offshore habitats. Larval and age-0 deepwater sculpins collected in northern Lake Huron and the Detroit River during 2007 were used to improve our understanding of their habitat use, diet, age, and growth. Peak larval density reached 8.4/1000 m3 in the Detroit River during April and was higher than that in Lake Huron. Offshore bottom trawls at DeTour and Hammond Bay first collected benthic age-0 deepwater sculpins in early September when fish were ≥ 25 mm TL. Otolith analysis revealed that hatch dates for pelagic larvae occurred during late March and larvae remained pelagic for 40 to 60 days. Diet of pelagic larvae (10–21 mm TL) was dominated by calanoid copepods at all sample locations. Diets of benthic age-0 fish varied by location and depth: Mysis and chironomids were prevalent in fish from Hammond Bay and the 91 m site at DeTour, but only chironomids were found in fish from the 37 m DeTour site. This work showed that nearshore epilimnetic sites were important for pelagic larvae and an ontogenetic shift from pelagic planktivore to benthivore occurred at about 25 mm TL in late summer. Age analysis showed that larvae remained pelagic long enough to be transported through the St. Clair–Detroit River system, Lake Erie, and the Niagara River, potentially contributing to populations in Lake Ontario.
Geographic variation in host fish use and larval metamorphosis for the endangered dwarf wedgemussel
White, Barbara (St. John); Ferreri, C. Paola; Lellis, William A.; Wicklow, Barry J.; Cole, Jeffrey C.
2017-01-01
Host fishes play a crucial role in survival and dispersal of freshwater mussels (Unionoida), particularly rare unionids at conservation risk. Intraspecific variation in host use is not well understood for many mussels, including the endangered dwarf wedgemussel (Alasmidonta heterodon) in the USA.Host suitability of 33 fish species for dwarf wedgemussel glochidia (larvae) from the Delaware and Connecticut river basins was tested in laboratory experiments over 9 years. Relative suitability of three different populations of a single host fish, the tessellated darter (Etheostoma olmstedi), from locations in the Connecticut, Delaware, and Susquehanna river basins, was also tested.Connecticut River basin A. heterodon metamorphosed into juvenile mussels on tessellated darter, slimy sculpin (Cottus cognatus), and Atlantic salmon (Salmo salar) parr. Delaware River basin mussels metamorphosed using these three species, as well as brown trout (Salmo trutta), banded killifish (Fundulus diaphanus), mottled sculpin (Cottus bairdii), striped bass (Morone saxatilis), and shield darter (Percina peltata). Atlantic salmon, striped bass, and sculpins were highly effective hosts, frequently generating 5+ juveniles per fish (JPF) and metamorphosis success (MS; proportion of attaching larvae that successfully metamorphose) ≥ 0.4, and producing juveniles in repeated trials.In experiments on tessellated darters, mean JPF and MS values decreased as isolation between the mussel source (Connecticut River) and each fish source increased; mean JPF = 10.45, 6.85, 4.14, and mean MS = 0.50, 0.41, and 0.34 in Connecticut, Delaware, and Susquehanna river darters, respectively. Host suitability of individual darters was highly variable (JPF = 2–11; MS = 0.20–1.0).The results show that mussel–host fish compatibility in A. heterodon differs among Atlantic coastal rivers, and suggest that hosts including anadromous Atlantic salmon and striped bass may help sustain A. heterodon in parts of
Energy Technology Data Exchange (ETDEWEB)
Sonne, Christian, E-mail: csh@dmu.dk [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark); Leifsson, Pall S. [University of Copenhagen, Faculty of Health and Medical Sciences, Department of Veterinary Disease Biology, Bülowsvej 17, DK-1870 Frederiksberg (Denmark); Gustavson, Kim [Aarhus University, Faculty of Science and Technology, Department of Bioscience, Arctic Research Centre (ARC), Frederiksborgvej 399, P.O. Box 358, DK-4000 Roskilde (Denmark)
2014-08-15
The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and
International Nuclear Information System (INIS)
Sonne, Christian; Bach, Lis; Søndergaard, Jens; Rigét, Frank F.; Dietz, Rune; Mosbech, Anders; Leifsson, Pall S.; Gustavson, Kim
2014-01-01
The former Black Angel lead–zinc mine in Maarmorilik, West Greenland, is a historic example of how mining activity may result in a significant impact on the surrounding fjord system in terms of elevated concentrations of especially lead (Pb) and zinc (Zn) in seawater, sediments and surrounding biota. In order to shed light on the present contamination and possible effects in the fjord we initiated a range of studies including a pilot study on gill and liver morphology of common sculpins (Myoxocephalus scorpius) around Maarmorilik. Sculpins were caught and sampled at five different stations known to represent a gradient of Pb concentrations. Fish livers from all specimens were analyzed for relevant elements in the area: Fe, Zn, As, Cu, Se, Cd, Pb, Ag, Hg, Co and Ni. Lead, As and Hg showed significant differences among the five stations. For 20% of the sculpins, Hg concentrations were in the range of lowest observed effect dose (LOED) of 0.1–0.5 μg/g ww for toxic threshold on reproduction and subclinical endpoints. Likewise LOEDs for tissue lesions, LOEDs for biochemistry, growth, survival and reproduction were exceeded for Cd (0.42–1.8 μg/g ww) and for As (11.6 μg/g ww) in 28% and 85% of the sculpins, respectively. Similar to this, the no observed effect dose (NOED) for biochemistry was exceeded for Pb (0.32 μg/g ww) and for growth, mortality and reproduction for Zn (60–68 μg/g ww) in 33% and 24% of the sculpins, respectively. For all sculpins, females were significantly larger than males and for five of the elements (Fe, Co, Ni, Cu, Se) females had higher concentrations. The chronic lesions observed in liver (mononuclear cell infiltrates, necrosis, vacuolar hepatocytes, portal fibrosis, bile duct hyperplasia, active melanomacrophage centers) and gills (fusion and edema of secondary lamellae, laminar telangiectasis, mononuclear cell infiltrates, blebs) were similar to those in the literature studies for both wild and laboratory exposed sculpins and
1983-06-01
developmental stage were usually measured. All fish larvae were identified to the lowest taxonomic unit. Complete descriptions of the early life history ...14 04 e44 14 C4 04 %1 On 14 U.0 ’. 1 (T% N Nq N4 C14 Ř 00 IkeA .4 IA C4 - * eq N C- * en .4 .4 U in * . n . aD cc Cn -4 0o en % z ; 0 c 0O 0: oc 0 i...Dissertation. Mich. State Univ. In preparation. Bailey, J. E. 1952. Life history and ecology of the sculpin Cottus bairdi punctulatus in southwestern
Stephensen; Svavarsson; Sturve; Ericson; Adolfsson-Erici; Förlin
2000-04-01
Shorthorn sculpins (Myoxocephalus scorpius) were caught in four Icelandic harbours, differing in size, use and traffic. Biochemical responses in liver were measured and chemicals analysed in bile. Eyrarbakki harbour, which has not been in use for many years was chosen as a control site. Njar partial differentialvík harbour is a small fishing harbour and a marina, Sandger partial differentiali harbour is a large fishing harbour, and Reykjavík harbour is a large fishing harbour and an international transport harbour. Higher levels of DNA-adducts and cytochrome P4501A (CYP1A) in the fish from the harbours in Sandger partial differentiali, Njar partial differentialvík and Reykjavík, compared to Eyrarbakki harbour, indicate PAH exposure. This was confirmed by PAH analysis in bile. The higher activities of the antioxidant enzymes catalase (CAT), glutathione peroxidase (GPx) and glutathione reductase (GR) in fish caught in Sandger partial differentiali, than in fish caught in the other harbours, indicate exposure of sculpin to prooxidative compounds in Sandger partial differentiali harbour. Shorthorn sculpin seems to be a convenient species for monitoring pollution in northern coastal areas.
Directory of Open Access Journals (Sweden)
Britton J. Robert
2017-01-01
Full Text Available The diet composition of the European otter Lutra lutra was assessed using spraint analysis in the Hampshire Avon, a lowland chalk stream in Southern England, over an 18-month period. Small cyprinid fishes were the main prey item taken in all seasons, with bullhead Cottus gobio and stone loach Barbatula barbatula also important; there were relatively few larger fishes of interest to fisheries found. There were significant seasonal differences in diet composition by season, with signal crayfish Pacifastacus leniusculus only being prominent prey items in warmer months and amphibians in winter, revealing that non-fish resources were seasonally important dietary components. Reconstructed body lengths of prey revealed the only species present in diet >350 mm was pike Esox lucius. These dietary data thus provide important information for informing conservation conflicts between otters and fishery interests.
2011-01-19
..., Squid, and Octopus in the Gulf of Alaska AGENCY: National Marine Fisheries Service (NMFS), National... prohibiting directed fishing for sculpins, sharks, squid, and octopus in the Gulf of Alaska (GOA). This action..., and octopus in the GOA. DATES: Effective 1200 hrs, Alaska local time (A.l.t.), January 13, 2011...
Saiki, M.K.; Martin, B.A.
2001-01-01
This study was conducted to gain a better understanding of fishery resources in Abbotts Lagoon, Point Reyes National Seashore. During February/March, May, August, and November 1999, fish were sampled with floating variable-mesh gill nets and small minnow traps from as many as 14 sites in the lagoon. Water temperature, dissolved oxygen, pH, total ammonia(NH3 + NH4+), salinity, turbidity, water depth, and bottom substrate composition were also measured at each site. A total of 2,656 fish represented by eight species was captured during the study. Gill nets captured Sacramento perch, Archoplites interruptus; largemouth bass, Micropterus salmoides; Pacific herring, Clupea pallasi; prickly sculpin, Cottus asper, silver surfperch, Hyperprosopon ellipticum; longfin smelt, Spirinchus thaleichthys; and striped bass, Morone saxatilis; whereas minnow traps captured Sacramento perch; prickly sculpin; and threespine stickleback, Gasterosteus aculeatus. Cluster analysis (Ward's minimum variance method of fish catch statistics identified two major species assemblages-the first dominated by Sacramento perch and, to a lesser extent, by largemouth bass, and the second dominated by Pacific herring and threespine stickleback. Simple discriminant analysis of environmental variables indicated that salinity contributed the most towards separating the two assemblages.
Czech Academy of Sciences Publication Activity Database
Moravec, František; Muzzall, P.
2007-01-01
Roč. 52, č. 1 (2007), s. 51-57 ISSN 1230-2821 R&D Projects: GA ČR(CZ) GA524/06/0170; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Rhabdochona * Cottus * USA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.814, year: 2007
Gerig, Brandon S; Chaloner, Dominic T; Janetski, David J; Rediske, Richard R; O'Keefe, James P; Moerke, Ashley H; Lamberti, Gary A
2016-01-19
In the Great Lakes, introduced Pacific salmon (Oncorhynchus spp.) can transport persistent organic pollutants (POPs), such as polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs), to new environments during their spawning migrations. To explore the nature and extent of POP biotransport by salmon, we compared 58 PCB and 6 PBDE congeners found in spawning salmon directly to those in resident stream fish. We hypothesized that stream fish exposed to salmon spawners would have congener patterns similar to those of salmon, the presumed contaminant source. Using permutational multivariate analysis of variance (PERMANOVA) and nonmetric multidimensional scaling (NMDS), we found that POP congener patterns of Pacific salmon varied among regions in the Great Lakes basin (i.e., Lake Huron, Lake Michigan, or Lake Superior), tissue type (whole fish or eggs), and contaminant type (PCB or PBDE). For stream-resident fish, POP congener pattern was influenced by the presence of salmon, location (i.e., Great Lakes Basin), and species identity (i.e., brook trout [Salvelinus fontinalis] or mottled sculpin [Cottus bairdii]). Similarity in congener patterns indicated that salmon are a source of POPs to brook trout in stream reaches receiving salmon spawners from Lake Michigan and Lake Huron but not from Lake Superior. Congener patterns of mottled sculpin differed from those of brook trout and salmon, suggesting that brook trout and mottled sculpin either use salmon tissue to differing degrees, acquire POPs from different dietary sources, or bioaccumulate or metabolize POPs differently. Overall, our analyses identified the important role of salmon in contaminant biotransport but also demonstrated that the extent of salmon-mediated POP transfer and uptake in Great Lakes tributaries is location- and species-specific.
Honeyfield, D.C.; Hanes, J.W.; Brown, L.; Kraft, C.E.; Begley, T.P.
2010-01-01
Thiaminase induced thiamine deficiency occurs in fish, humans, livestock and wild animals. A non-radioactive thiaminase assay was described in 2007, but a direct comparison with the radioactive 14C-thiamine method which has been in use for more than 30years has not been reported. The objective was to measure thiaminase activity in forage fish (alewife Alosa pseudoharengus, rainbow smelt Osmerus mordax, and slimy sculpin Cottus cognatus) consumed by predators that manifest thiamine deficiency using both methods. Modifications were made to the colorimetric assay to improve repeatability. Modification included a change in assay pH, enhanced sample clean-up, constant assay temperature (37??C), increase in the concentration of 4-nitrothiophenol (4NTP) and use of a spectrophotometer fitted with a 0.2cm cell. A strong relationship between the two assays was found for 51 alewife (R2=0.85), 36 smelt (R2=0.87) and 20 sculpin (R2=0.82). Thiaminase activity in the colorimetric assay was about 1000 times higher than activity measured by the radioactive method. Application of the assay to fish species from which no thiaminase activity has previously been reported resulted in no 4NTP thiaminase activity being found in bloater Coregonus hoyi, lake trout Salvelinus namaycusch, steelhead trout Oncorhynchus mykiss or Chinook salmon Oncorhynchus tshawytscha. In species previously reported to contain thiaminase, 4NTP thiaminase activity was measured in bacteria Paenibacillus thiaminolyticus, gizzard shad Dorosoma cepedianum, bracken fern Pteridium aquilinum, quagga mussel Dreissena bugensis and zebra mussels D. polymorpha. ?? 2010.
Passive sampling of bioavailable organic chemicals in Perry County, Missouri cave streams.
Fox, J Tyler; Adams, Ginny; Sharum, Martin; Steelman, Karen L
2010-12-01
Two types of passive samplers--semipermeable membrane devices (SPMDs) and polar organic chemical integrative samplers (POCIS)--were deployed in spring 2008 to assess bioavailable concentrations of aquatic contaminants in five cave streams and resurgences in Perry County, Missouri. Study sites represent areas of high cave biodiversity and the only known habitat for grotto sculpin (Cottus carolinae). Time-weighted average (TWA) water concentrations were calculated for 20 compounds (n = 9 SPMDs; n = 11 POCIS) originating primarily from agricultural sources, including two organochlorine insecticides, dieldrin and heptachlor epoxide, which were found at levels exceeding U.S. EPA criteria for the protection of aquatic life. GIS data were used to quantify and map sinkhole distribution and density within the study area. Infiltration of storm runoff and its influence on contaminant transport were also evaluated using land cover and hydrological data. This work provides evidence of cave stream contamination by a mix of organic chemicals and demonstrates the applicability of passive samplers for monitoring water quality in dynamic karst environments where rapid transmission of storm runoff makes instantaneous water sampling difficult.
Khanaev, I V; Dzyuba, E V; Kravtsova, L S; Grachev, M A
2016-03-01
In shallow water areas of open Lake Baikal, filamentous green alga of the genus Spirogyra grows abundantly. Together with alga of the genus Ulothrix, it forms algal mats. According to our observations from 2010 to 2013, the spawning habitat conditions for the yellowfin sculpin Cottocomephorus grewingkii (Dybowski, 1874) (Cottidae) proved to be significantly disturbed in the littoral zone of Listvennichnyi Bay (southern Baikal), which, in turn, reduced the number of egg layings. With a 100% projective cover of the floor and a high density of green filamentous algae, the shallow-water stony substrate becomes completely inaccessible for spawning of the August population.
Non-fish prey in the diet of an exclusive fish-eater: the Common Kingfisher Alcedo atthis
Czech Academy of Sciences Publication Activity Database
Čech, Martin; Čech, P.
2015-01-01
Roč. 62, č. 4 (2015), s. 457-465 ISSN 0006-3657 R&D Projects: GA ČR(CZ) GA206/06/1371; GA ČR(CZ) GP206/09/P266 Institutional support: RVO:60077344 Keywords : Lizard Lacerta sp. * newt Triturus sp. * diagnostic bones * Gudgeon Gobio gobio * Blanice River * Slapy Reservoir Subject RIV: EG - Zoology Impact factor: 0.888, year: 2015
International Nuclear Information System (INIS)
Bado-Nilles, Anne; Jolly, Sabrina; Porcher, Jean-Marc; Palluel, Olivier; Geffard, Alain
2014-01-01
The use of a biochemical multi-biomarker approach proved insufficient to obtain clear information about ecosystem health. The fish immune system is considered as an attractive non-specific marker for environmental biomonitoring which has direct implications in individual fitness and population growth. Thus, the present work proposes the use of fish immunomarkers together with more common biochemical biomarkers in sampling conditions optimized to reduce biomarker variability and increase parameter robustness. European bullheads (Cottus sp.) from 11 stations in the Artois-Picardie watershed (France) were sampled. In the multiple discriminant analysis, the sites were highly correlated with apoptosis, respiratory burst, GST and EROD activities. Moreover, the use together of biochemical and immune markers increased the percentage of fish correctly classed at each site and enhanced site separation. This study argues in favor of the utilization of apoptosis, necrosis and respiratory burst for the determination of environmental risk assessment in addition to the set of biochemical biomarkers commonly used in fish. -- Highlights: • Optimization of biomarker variability and parameters robustness for biomonitoring. • Adding of fish immunomarkers together with more current biochemical biomarkers. • Use of immune system allows a better evaluation of fish health. • We argue for the deployment of immunomarkers in freshwater monitoring programs. -- Attractive use of freshwater fish leucocyte non-specific immune function in environmental risk assessment according to international recommendations
Czech Academy of Sciences Publication Activity Database
Lamand, F.; Roche, Kevin Francis; Beisel, J.-N.
2016-01-01
Roč. 26, č. 3 (2016), s. 445-455 ISSN 1052-7613 Institutional support: RVO:68081766 Keywords : unionid conservation * glochidia * threatened species * Eurasian minnow * bullhead * parasitic host Subject RIV: EG - Zoology Impact factor: 3.130, year: 2016
Impact of ocean acidification on the hypoxia tolerance of the woolly sculpin, Clinocottus analis.
Hancock, Joshua R; Place, Sean P
2016-01-01
As we move into the Anthropocene, organisms inhabiting marine environments will continue to face growing challenges associated with changes in ocean pH (ocean acidification), dissolved oxygen (dead zones) and temperature. These factors, in combination with naturally variable environments such as the rocky intertidal zone, may create extreme physiological challenges for organisms that are already performing near their biological limits. Although numerous studies have examined the impacts of climate-related stressors on intertidal animals, little is known about the underlying physiological mechanisms driving adaptation to ocean acidification and how this may alter organism interactions, particularly in marine vertebrates. Therefore, we have investigated the effects of decreased ocean pH on the hypoxia response of an intertidal sculpin, Clinocottus analis . We used both whole-animal and biochemistry-based analyses to examine how the energetic demands associated with acclimation to low-pH environments may impact the fish's reliance on facultative air breathing in low-oxygen environments. Our study demonstrated that acclimation to ocean acidification resulted in elevated routine metabolic rates and acid-base regulatory capacity (Na + ,K + -ATPase activity). These, in turn, had downstream effects that resulted in decreased hypoxia tolerance (i.e. elevated critical oxygen tension). Furthermore, we present evidence that these fish may be living near their physiological capacity when challenged by ocean acidification. This serves as a reminder that the susceptibility of teleost fish to changes in ocean pH may be underestimated, particularly when considering the multiple stressors that many experience in their natural environments.
Acute toxicity of zinc to several aquatic species native to the Rocky Mountains.
Brinkman, Stephen F; Johnston, Walter D
2012-02-01
National water-quality criteria for the protection of aquatic life are based on toxicity tests, often using organisms that are easy to culture in the laboratory. Species native to the Rocky Mountains are poorly represented in data sets used to derive national water-quality criteria. To provide additional data on the toxicity of zinc, several laboratory acute-toxicity tests were conducted with a diverse assortment of fish, benthic invertebrates, and an amphibian native to the Rocky Mountains. Tests with fish were conducted using three subspecies of cutthroat trout (Colorado River cutthroat trout Oncorhynchus clarkii pleuriticus, greenback cutthroat trout O. clarkii stomias, and Rio Grande cutthroat trout O. clarkii virginalis), mountain whitefish (Prosopium williamsoni), mottled sculpin (Cottus bairdi), longnose dace (Rhinichthys cataractae), and flathead chub (Platygobio gracilis). Aquatic invertebrate tests were conducted with mayflies (Baetis tricaudatus, Drunella doddsi, Cinygmula sp. and Ephemerella sp.), a stonefly (Chloroperlidae), and a caddis fly (Lepidostoma sp.). The amphibian test was conducted with tadpoles of the boreal toad (Bufo boreas). Median lethal concentrations (LC(50)s) ranged more than three orders of magnitude from 166 μg/L for Rio Grande cutthroat trout to >67,000 μg/L for several benthic invertebrates. Of the organisms tested, vertebrates were the most sensitive, and benthic invertebrates were the most tolerant.
Beatrix Jones; Gary D. Grossman; Daniel C.I. Walsh; Brady A. Porter; John C. Avise; Anthony C. Flumera
2007-01-01
Understanding how variation in reproductive success is related to demography is a critical component in understanding the life history of an organism. Parentage analysis using molecular markers can be used to estimate the reproductive success of different groups of individuals in natural populations. Previous models have been developed for cases where offspring are...
Invasion strategy and abiotic activity triggers for non-native gobiids of the River Rhine.
Directory of Open Access Journals (Sweden)
Jan Baer
Full Text Available The 24 hour activity patterns of three non-native gobiids (round goby Neogobius melanostomus, Western tubenose goby Proterorhinus semilunaris and bighead goby Ponticola kessleri were assessed over 46 consecutive months between 2011 and 2014 from their occurrence in the cooling water intake of a nuclear power plant on the River Rhine, Germany. In total, 117717 gobiids were identified and classified. The occurrence of all three species varied strongly between sampling years, and species-specific activity triggers were identified. The activity of juveniles of all three gobiids species was positively temperature dependent while adult tubenose goby activity appeared to be negatively temperature dependent. Increasing fluvial discharge in the adjoining main river stimulated the activity of juvenile round goby but inhibited activity of adult tubenose goby. Except for adult bighead goby, activity was also structured by time of day, but with no uniform mean. Meteorological factors such as precipitation, air pressure and duration of sunshine hours had little or no influence on gobiid activity. On selected rare occasions, mainly at night, all three species exhibited pulsed swarming behaviour, with thousands of individuals recorded in the intake water. Round goby swarms exhibited both the highest intensity and the largest swarming individuals, suggesting a potential competitive advantage over tubenose and bighead goby. Electric fishing surveys in natural river stretches corroborated this observation. Negative effects on the native fish fauna were apparent only for the bullhead, Cottus gobio. The activity triggers identified offer a unique insight into the invasion mechanisms of these ecosystem-changing non-native gobiids.
Factors affecting the recovery of fish populations in an industrial river. [Brown trout
Energy Technology Data Exchange (ETDEWEB)
Turnpenny, A W.M.; Williams, R
1981-01-01
The river Ebbw Fawr, an industrial river of South-East Wales, was investigated over a three-year period to follow the re-establishment of fish populations as a result of pollution control measures at coal washeries and a steelworks on the river. These measures were effective in reducing levels of toxic materials and restoring dissolved oxygen levels and pH values acceptable for fish. Five freshwater fish species became established in parts of the river during the study period (1974-77). The brown trout Salmo trutta l. was the first to enter, followed by eel Anguilla anguilla l., stoneloach Noemacheilus barbatulus l., stickleback Gasterosteus aculeatus l. and bullhead Cottus gobio l., respectively. The flounder Platicthys flesus l., a euryhaline species, penetrated the river beyond the upper tidal limit. The minnow Phoxinus phoxinus l., a resident of other parts of the Ebbw system, did not recolonise during the study. Calculated toxicities and the results of fish caging tests indicated that water quality was satisfactory for fish populations throughout the river with the possible exception of a short reach immediately below the steelworks. The absence of fish from some upstream reaches with good water quality was due to the limited numbers of fish available for recolonisation and their restricted movements. Good growth and condition factors among the recolonising brown trout stock suggest that a sport fishery could be developed on the river, though constraints on spawning due to residual silt pollution indicate that stocking with hatchery reared fish will be necessary to maintain trout numbers.
Bunnell, David B.; Mychek-Londer, Justin G.; Diana, James S.; Stott, Wendylee; Madenjian, Charles P.
2012-01-01
As the only extant deepwater cisco in Lake Michigan, bloater is currently at record low levels of abundance. Several mechanisms to regulate their recruitment have been proposed, including skewed sex ratios, predation on their larvae by adult alewife, and climatic factors during early life history stages, but none has unequivocal support. In this research, we evaluated an alternative mechanism of egg predation that was supported by an inverse relationship between bloater recruitment and biomass of slimy sculpin, which are known to be effective egg predators. To that end, we used a combination of field sampling, laboratory experiments, and modeling to estimate the proportion of bloater eggs consumed by sculpins each year between 1973 and 2008. Monthly field sampling between January through May 2009-2010 (when bloater eggs were incubating) offshore of Frankfort (Michigan), Sturgeon Bay (Wisconsin), Two Rivers (Wisconsin), and Muskegon (Michigan) provided benthivore diets for subsequent laboratory processing. Identification and enumeration of stomach contents and subsequent genetic analyses of eggs revealed that the mean proportion of bloater eggs in slimy sculpin diets (N = 1016) equaled 0.04. Bloater eggs also were consumed by deepwater sculpins (N = 699) at a slightly lower mean proportion (0.02), and only one round goby diet among 552 enumerated revealed a bloater egg. Based on the diet results, we developed daily ration models to estimate consumption for both deepwater and slimy sculpins. We conducted feeding experiments to estimate gastric evacuation (GEVAC) for water temperatures ranging 2-5 °C, similar to those observed during egg incubation. GEVAC rates equaled 0.0115/ h for slimy sculpin and 0.0147/h for deepwater sculpin, and did not vary between 2.7 and 5.1 °C for either species or between prey types (Mysis relicta and fish eggs) for slimy sculpin. Index of fullness [(g prey/g fish weight)100%] was estimated from sculpins sampled in
Aquaculture disturbance impacts the diet but not ecological linkages of a ubiquitous predatory fish
McPeek, Kathleen C.; McDonald, P. Sean; VanBlaricom, Glenn
2015-01-01
Aquaculture operations are a frequent and prominent cause of anthropogenic disturbance to marine and estuarine communities and may alter species composition and abundance. However, little is known about how such disturbances affect trophic linkages or ecosystem functions. In Puget Sound, Washington, aquaculture of the Pacific geoduck clam (Panopea generosa) is increasing and involves placing nets and polyvinyl chloride (PVC) tubes in intertidal areas to protect juvenile geoducks from predators. Initial studies of the structured phase of the farming cycle have documented limited impacts on the abundance of some species. To examine the effect of geoduck aquaculture on ecological linkages, the trophic relationships of a local ubiquitous consumer, Pacific staghorn sculpin (Leptocottus armatus), to its invertebrate prey were compared between geoduck aquaculture sites and nearby reference areas with no aquaculture. Mark-recapture data indicated that sculpin exhibit local site fidelity to cultured and reference areas. The stomach contents of sculpin and stable isotope signatures of sculpin and their prey were examined to study the trophic ecology of cultured and reference areas. Results showed that the structured phase of geoduck aquaculture initiated some changes to staghorn sculpin ecology, as reflected in sculpin diet through stomach content analysis. However, carbon and nitrogen stable isotopes revealed that the general food web function of sculpin remained unchanged. The source of carbon at the base of the food web and the trophic position of sculpin were not impacted by geoduck aquaculture. The study has important implications for geoduck aquaculture management and will inform regulatory decisions related to shellfish aquaculture policy.
Ehlo, Chase A.; Layzer, James B.
2014-01-01
Population characteristics and life history aspects of healthy mussel populations are poorly understood. The reproductive cycle, age and growth, and population structure of Obovaria subrotunda were examined at four sites in the middle Duck River, Tennessee. Obovaria subrotunda was confirmed to be a bradytictic species, spawning in the late summer and holding glochidia in the gills for 11 mo until the following summer. Fecundity was positively related to mussel length (R2 = 0.75) and ranged from 7122 to 76,584 glochidia. Fourteen species of fish found in the Duck River, in the families Percidae, Cyprinidae, and Cottidae, were infested with glochidia in the laboratory to examine potential hosts. Juveniles transformed onEtheostoma blennioides (greenside darter), E. obama (spangled darter), E. flabellare (fantail darter), and Cottus carolinae (banded sculpin). Analyses of shell thin-sections indicated that males grew faster and obtained a larger size than females. Individuals live to at least 14 y old. Females became sexually mature at age one. Four sites were quantitatively sampled using a systematic design with three random starts. The observed ratio of adult males to females (0.9∶1) did not differ significantly from 1∶1. Results of the quantitative sampling showed an increase in density compared to earlier studies and a high proportion of 1 to 5 y old O. subrotunda.
Directory of Open Access Journals (Sweden)
Henri Persat
2015-11-01
Full Text Available Because of its position between Central Europe and the Iberian Peninsula, French territory is an obligatory expansion route for their respective continental faunas, freshwater ones included. The twin Rhine-Rhone river drainage basins make an obvious link between both Central and Northern Europe and the South-Western Europe. But how fish might have dispersed along the series of rivers of the Western side of France (Seine, Loire, Charente, Garonne and Adour is less evident, as the ice ages have had a large impact on the pre-existing faunas, before human intervention blurred phylogeographic patterns, either indirectly with trans-watershed canals, or directly with purposeful translocations. What might have survived during the last glacial times is a key question in terms of management and conservation of the local fish biodiversity. Unfortunately, this diversity had been neglected or underappreciated in France until modern phylogeographic and population genetic research provided new and enlightening insights into interspecific and intraspecific variation. Thus, after one century of scientific starvation, French territory recently "gained" a series of novel species in various genera, such as Gobio, Cottus, Squalius, Leuciscus, Phoxinus, and Esox, waiting for more on going "acquisitions" in a near future. These novelties trace a quite different biogeographic landscape of what was formerly supposed to be uniform. Each major river basin retains traces of a more or less recent evolutionary history to put back into the succession of hydrographic and climatic events since the first major invasion, the entrance of cyprinids in Europe during the Oligocene era initiated by the coalescence of what was formerly only an archipelago. The timing of dispersion and on-site speciation will be discussed from the examples provided by the presently investigated genera according to evidence or hypotheses on river connections, sea-level fluctuations and climatic events.
Radioactive background in principal components of the Jihlava River ecosystem
International Nuclear Information System (INIS)
Stanek, Z.; Penaz, M.; Trnkova, J.; Wohlgemuth, E.
1980-01-01
In 1976 through to 1978, the radioactive background was investigated in the various components of the Jihlava River ecosystem. The investigations involved total β-activity, 40 K, residual β-activity, sup(nat)U, 226 Ra and, in some of the samples, also 210 Pb, 90 Sr and 137 Cs. The analyses included water, bottom sediments, samples of aquatic macrophytes (Batrachium fluitans), samples of aquatic invertebrates (Herpobdella octoculata, Anodonta cygnea, Asellus aquaticus, larval Ephemeroptera, larval Trichoptera, exuviae of pupae of Chironomidae) and samples of the tissues of 8 species of fishes (Salmo trutta m. fario, Cyprinus carpio, Rutilus rutilus, Leuciscus cephalus, Leuciscus leuciscus, Chondrostoma nasus, Gobio gobio, Barbus barbus). The activity of the radionuclides under study corresponded to the values reported for uncontaminated streams. (author)
Introduced northern pike predation on salmonids in southcentral Alaska
Sepulveda, Adam J.; Rutz, David S.; Ivey, Sam S.; Dunker, Kristine J.; Gross, Jackson A.
2013-01-01
Northern pike (Esox lucius) are opportunistic predators that can switch to alternative prey species after preferred prey have declined. This trophic adaptability allows invasive pike to have negative effects on aquatic food webs. In Southcentral Alaska, invasive pike are a substantial concern because they have spread to important spawning and rearing habitat for salmonids and are hypothesised to be responsible for recent salmonid declines. We described the relative importance of salmonids and other prey species to pike diets in the Deshka River and Alexander Creek in Southcentral Alaska. Salmonids were once abundant in both rivers, but they are now rare in Alexander Creek. In the Deshka River, we found that juvenile Chinook salmon (Oncorhynchus tshawytscha) and coho salmon (O. kisutch) dominated pike diets and that small pike consumed more of these salmonids than large pike. In Alexander Creek, pike diets reflected the distribution of spawning salmonids, which decrease with distance upstream. Although salmonids dominated pike diets in the lowest reach of the stream, Arctic lamprey (Lampetra camtschatica) and slimy sculpin (Cottus cognatus) dominated pike diets in the middle and upper reaches. In both rivers, pike density did not influence diet and pike consumed smaller prey items than predicted by their gape-width. Our data suggest that (1) juvenile salmonids are a dominant prey item for pike, (2) small pike are the primary consumers of juvenile salmonids and (3) pike consume other native fish species when juvenile salmonids are less abundant. Implications of this trophic adaptability are that invasive pike can continue to increase while driving multiple species to low abundance.
Bottom trawl assessment of Lake Ontario prey fishes
Weidel, Brian C.; Connerton, Michael J.; Holden, Jeremy
2018-01-01
Managing Lake Ontario fisheries in an ecosystem-context requires prey fish community and population data. Since 1978, multiple annual bottom trawl surveys have quantified prey fish dynamics to inform management relative to published Fish Community Objectives. In 2017, two whole-lake surveys collected 341 bottom trawls (spring: 204, fall: 137), at depths from 8-225m, and captured 751,350 fish from 29 species. Alewife were 90% of the total fish catch while Deepwater Sculpin, Round Goby, and Rainbow Smelt comprised the majority of the remaining total catch (3.8, 3.1, and 1.1% respectively). The adult Alewife abundance index for US waters increased in 2017 relative to 2016, however the index for Canadian waters declined. Adult Alewife condition, assessed by the predicted weight of a 165 mm fish (6.5 inches), declined in 2017 from record high values observed in spring 2016. Spring 2017 Alewife condition was slightly less than the 10-year average, but the fall value was well below the 10-year average, likely due to increased Age-1 Alewife abundance. The Age-1 Alewife abundance index was the highest observed in 40 years, and 8-times higher than the previous year. The Age-1 index estimates Alewife reproductive success the preceding year. The warm summer and winter of 2016 likely contributed to the large year class. In contrast the relatively cool 2017 spring and cold winter may result in a lower than average 2017 year class. Abundance indices for Rainbow Smelt, Cisco, and Emerald Shiner either declined or remained at low levels in 2017. Pelagic prey fish diversity continues to be low since a single species, Alewife, dominates the catch. Deepwater Sculpin were the most abundant benthic prey fish in 2017 because Round Goby abundance declined sharply from 2016. Slimy Sculpin density continued to decline and the 2017 biomass index for US waters was the lowest ever observed. Prior to Round Goby proliferation, juvenile Slimy Sculpin comprised ~10% of the Slimy Sculpin catch, but
Benthic prey fish assessment, Lake Ontario 2013
Weidel, Brian C.; Walsh, Maureen; Connerton, Michael J.
2014-01-01
The 2013 benthic fish assessment was delayed and shortened as a result of the U.S. Government shutdown, however the assessment collected 51 of the 62 planned bottom trawls. Over the past 34 years, Slimy Sculpin abundance in Lake Ontario has fluctuated, but ultimately decreased by two orders of magnitude, with a substantial decline occurring in the past 10 years. The 2013 Slimy Sculpin mean bottom trawl catch density (0.001 ind.·m-2, s.d.= 0.0017, n = 52) and mean biomass density (0.015 g·m-2 , s.d.= 0.038, n = 52) were the lowest recorded in the 27 years of sampling using the original bottom trawl design. From 2011-2013, the Slimy Sculpin density and biomass density has decreased by approximately 50% each year. Spring bottom trawl catches illustrate Slimy Sculpin and Round Goby Neogobius melanostoma winter habitat overlaps for as much as 7 months out of a year, providing opportunities for competition and predation. Invasive species, salmonid piscivory, and declines in native benthic invertebrates are likely all important drivers of Slimy Sculpin population dynamics in Lake Ontario. Deepwater Sculpin Myoxocephalus thompsonii, considered rare or absent from Lake Ontario for 30 years, have generally increased over the past eight years. For the first time since they were caught in this assessment, Deepwater Sculpin density and biomass density estimates declined from the previous year. The 2013 abundance and density estimates for trawls covering the standard depths from 60m to 150m was 0.0001 fish per square meter and 0.0028 grams per square meter. In 2013, very few small (recruitment. Nonnative Round Gobies were first detected in the USGS/NYSDEC Lake Ontario spring Alewife assessment in 2002. Since that assessment, observations indicate their population has expanded and they are now found along the entire south shore of Lake Ontario, with the highest densities in U.S. waters just east of the Niagara River confluence. In the 2013 spring-based assessment, both the
International Nuclear Information System (INIS)
Knapen, Dries; De Wolf, Hans; Knaepkens, Guy; Bervoets, Lieven; Eens, Marcel; Blust, Ronny; Verheyen, Erik
2009-01-01
This study presents the results of a microsatellite and allozyme analysis on natural populations of the gudgeon (Gobio gobio) located in a pollution gradient of cadmium and zinc. Differences among contaminated and reference populations were observed at 2 allozyme loci, as well as a relationship between the fish condition factor and glucose-6-phosphate dehydrogenase genotypes, the locus that showed the largest difference in allele frequencies. The microsatellite data partly confirmed the differentiation pattern that was revealed by the allozyme survey. Our data further suggest that at least 2 microsatellite loci may be affected by natural selection. We thus illustrate that both microsatellite and allozyme loci do not necessarily behave as selectively neutral markers in polluted populations. Estimates of population differentiation can therefore be significantly different depending on which loci are being studied. Finally, these results are discussed in the light of the conservation unit concept, because microsatellites are often used to assess genetic variation in endangered natural populations and to propose measures for conservation or management.
Fluorescence- and NOR-studies at chromosomes of several vertebrate-species
International Nuclear Information System (INIS)
Maurer, F.
1984-05-01
In the investigated species of fishes clear-cut Chromomycin-positive blocks were visualised. This holds true as well for Lecaspius delineatus, Gobio gobio, Perca fluciatilis, Cyprinus carpio, Carassius and auratus gibelio. In contrast, DA-DAPI-Fluorescence was homogenous along the entire chromosome. The silver-impregnation-technique proved useful in all investigated species of fisches. In the chicken certain chromosome-districts the Chromomycin-fluorescence was more pronounced than in others; Distamycin-DAPI led to a homogeneous staining along hole the arms. The investigations in mouse-chromosomes revealed an R-banding-pattern. The Distamycin-DAPI-pattern of mouse-chromosomes were complementary to the Chromomycin-pattern and strongly pronounced centromeres. Again Distmycin-DAPI-staining did not allow an unquastinable bandling resolution; simularities to Actimomycin-DAPI-fluorochrome-included patterns were observed. By means of silver-impragnation-techniques the presence of double-point-formed NOR's on more chromosomes were highlighted. However an exact destination of the number was not possible and remains reserved to further investigations. (Author)
Czech Academy of Sciences Publication Activity Database
Kvach, Yuriy; Ondračková, Markéta; Bryjová, Anna; Jurajda, Pavel
2017-01-01
Roč. 72, č. 6 (2017), s. 671-679 ISSN 0006-3088 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Gobio * Romanogobio * sympatric species * parasite community * biological tags Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 0.759, year: 2016
International Nuclear Information System (INIS)
Khan, R.A.; Barker, D.E.; Williams-Ryan, K.; Hooper, R.G.
1994-01-01
Samples of longhorn sculpin (Myoxocephalus octodecemspinosus) were exposed to sediment contaminated with crude oil or pulp and paper mill effluent for periods up to 13 months in the laboratory. Other samples were collected at sites where crude oil or effluent from a pulp and paper mill are discharged. The intensity of gill infections of Trichodina spp. on exposed fish was significantly higher than on controls 5, 9, and 13 months after exposure. The intensity of the ciliates was also greater on sculpins collected near an oil-receiving terminal than on those sampled 5 km from the polluted site. Field collections of longhorn and shorthorn (Myoxocephalus scorpius) sculpins at and distant from a pulp and paper mill had high and low intensities of the ciliates, respectively. Similarly, the intensity of trichodinid ciliates was also significantly greater in longhorn sculpins exposed to effluent-contaminated sediment than in controls 5 months after exposure. The results suggest that the intensity of gill-inhibiting species such as trichodinids in susceptible fish hosts increases after chronic exposure to crude oil and to pulp and paper mill effluent, and the parasites may serve as indicators of pollution. 24 refs., 4 figs., 1 tab
Directory of Open Access Journals (Sweden)
Radek Sanda
2015-11-01
We have analysed control region (mitochondrial non coding DNA of gudgeon populations from all larger river drainages from the west Aegean region (Pinios to Marica basins. Included were also several populations from surrounding areas of the Danube River drainage and from the Black Sea rivers. The results are not at all congruent with the proposed taxonomy. MtDNA haplotypes of Romonagobio banarescui were found not only in the Vardar, but also in the lower Aliakmon River. Haplotypes of Romanogibo elimeus were found in the Pinios, upper Aliakmon and Loudias rivers. Situation of genus Gobio is completely confusing; there is no geographic structure in the distribution of haplotypes. Many different haplogroups are shared in some basins, especially in the drainages of the Struma, Mesta and Marica rivers. This indicates complicated evolutionary history of gudgeons in the region, probably having several historical refugia, and with multiple recent contacts of lineages. Our data indicate a contact between the Danubian, Black Sea and Aegean rivers. The taxonomic status of most of the populations of Gobio from the west Aegean area remains unclear.
Ecology of Siberian Taimen Hucho taimen in the Lake Baikal Basin
Matveyev, Arcadi N.; Pronin, Nikolai M.; Samusenok, Vitali P.; Bronte, Charles R.
1998-01-01
Taimen Hucho taimen historically inhabited most tributaries and littoral areas of Lake Baikal, in south central Siberia, where they supported subsistence and commercial fisheries. Logging, pollution, and overfishing have caused dramatic population declines or local extinction of most stocks. Most of what is known about this species has been published in eastern journals and therefore is not readily available to western scientists. New data collected during the 1980s and 1990s have been combined with other reports to provide an overview of the biology and life history of this species. Taimen are long-lived fish and can reach ages of 29 years and sizes up to 60 kg. Populations can either be strictly riverine or anadromous. Adults from both life histories ascend rivers in spring to spawn and feed, and less extensive migrations occur in fall to prey on spawning omul (Coregonus autumnalis migratorius). Principal food items for age 1 and 2 taimen are macroinvertebrates, but young taimen quickly become piscivorous at age 2 when they consume mainly black Baikal grayling (Thymallus arcticus baicalensis), and sculpins (Taracottus kneri, Cottus kesslerij). Males reach sexual maturity at ages 7 to 8 and later for females at ages 8 to 9. Average egg production per female was about 22,000 eggs. Parasite burdens are heavy but composed of few species and mediated by prey items consumed. This fish is a highly-specialized predator and plays an indispensable role in the structure of fish communities in mountains and foothills. Taimen conservation in the Baikal region is impossible without adoption and implementation of a dedicated rehabilitation program that includes the protection of remaining populations and habitat, and possibly introduction of hatchery-reared fish in selected areas where habitat remains, but parental stocks are low.
Densmore, Christine L.; Panek, Frank M.
2013-01-01
Adverse effects on fishes captured by electrofishing techniques have long been recognized, although the extent of associated physical injury and behavioral alterations are highly variable and dependent on a number of factors. We examined the effects of three-pass pulsed DC (PDC) electrofishing on two salmonid species (Rainbow Trout Oncorhynchus mykiss and Brook Trout Salvelinus fontinalis) and five other genera (Green Sunfish Lepomis cyanellus, Potomac Sculpin Cottus girardi, Fathead Minnow Pimephales promelas, Largemouth Bass Micropterus salmoides, and Channel Catfish Ictalurus punctatus) common to Appalachian streams. We examined the corresponding effects of PDC electroshock on the following physiological indicators of stress and trauma: blood glucose and serum lactate, as well as on other blood chemistry, namely, enzymes, electrolytes, minerals, and proteins. All species demonstrated physiological responses to PDC electroshock, indicated by the biochemical differences in blood parameters in unshocked and shocked groups of fish with or without gross evidence of hemorrhagic trauma. Serum lactate was the most consistent indicator of these effects. Significant differences in whole blood glucose levels were also noted in treatment groups in all species except Green Sunfish, although the patterns observed were not as consistent as for serum lactate. Elevations in the serum enzymes, aspartate aminotransferase and creatine kinase, in the electroshocked fish occurred only in the two salmonid species. In many instances, although blood parameters were elevated in electroshocked fish compared with the unshocked controls for a given species, there were no differences in those levels in electroshocked fish based on the presence of gross hemorrhagic trauma to axial musculature. While some of the blood parameters examined correlated with both the occurrence of electroshock and the resultant tissue injury, there was no apparent link between the altered blood chemistry and
International Nuclear Information System (INIS)
Hemmingsen, A.R.; Buchanan, D.V.; Howell, P.J.
1996-03-01
To fulfill one objective of the present study, genetic characteristics of Oregon bull trout will be determined by analysis of mitochondrial and nuclear DNA. During 1995, the authors collected and sampled a total of 1,217 bull trout from 46 streams in the Columbia River Basin. DNA analysis of those samples will be conducted at University of Montana. They primarily sampled juvenile fish near natal areas to increase the likelihood of identifying discrete populations while minimizing risk of injury to large spawners. Fork lengths of all fish sampled ranged from 2.6 to 60.5 cm with a median of 12 cm. Eighty-four percent of all bull trout sampled were less than 19 cm while two percent were larger than 27 cm. Bull trout were collected by several methods, mostly by electrofishing. Eighty-six percent of all bull trout sampled were collected by electrofishing with a programmable waveform electrofisher. They observed injuries caused by electrofishing to 8% of that proportion. Based on preliminary analysis, no waveform combination used appeared less injurious than others. Highest voltages appeared less injurious than some that were lower. Frequency of electrofishing injury was significantly correlated to fork length over the range-from 4 to 26 cm. There were indications for substantial risk for such injury to bull trout larger than 26 cm. Other species found in association with bull trout included chinook salmon Oncorhynchus tshawytscha, mountain whitefish Prosopium williamsoni, rainbow trout Oncorhynchus mykiss, sculpins Cottus spp., cutthroat trout Oncorhynchus clarki, non-native brook trout Salvelinus fontinalis, and tailed frogs Ascaphus truei. Rainbow trout was the species most frequently associated with bull trout. No injury or mortality was observed for any of the associated species captured
Juvenile groundfish habitat in Kachemak Bay, Alaska, during late summer
Abookire, Alisa A.; Piatt, John F.; Norcross, Brenda L.
2001-01-01
We investigated the habitat of juvenile groundfishes in relation to depth, water temperature, and salinity in Kachemak Bay, Alaska. Stations ranging in depth from 10 to 70 m and with sand or mud-sand substrates were sampled with a small-meshed beam trawl in August-September of 1994 to 1999. A total of 8,201 fishes were captured, comprising at least 52 species. Most fishes (91%) had a total length 5% of the total catch) were flathead sole Hippoglossoides elassodon, slim sculpin Radulinus asprellus, Pacific halibut Hippoglossus stenolepis, and arrowtooth flounder Atheresthes stomias. Depth accounted for most of the spatial variability in juvenile groundfish abundance, and neither temperature nor salinity was correlated with fish abundance. Juvenile groundfishes concentrated in either shallow (less than or equal to 20 m) or deep (50-70 m) water, with co-occurrence of some species between 30-40 m. Shallow fishes were the rock soles, Pacific halibut, and great sculpin Myoxocephalus polyacanthocephalus. Deep species were flathead sole, slim sculpin, spinycheek starsnout Bathyagonus infraspinatus, rex sole Glyptocephalus zachirus, tadpole sculpin Psychrolutes paradoxus, and whitebarred prickleback Poroclinus rothrocki. This 6-year study provides baseline data on relative abundance and distribution of juvenile groundfishes in Kachemak Bay and may provide a useful tool for predicting the presence of species in similar habitats in other areas of Alaska.
Alzate, Adriana; Muñoz, Carlos G.; Zapata, Fernando A.; Giraldo, Alan
2012-01-01
Se hacen cuatro nuevos registros de especies en isla Gorgona, Pacífico colombiano: dos gobios (Gobulus crescentalis y Chriolepis cuneata) y un pez pipa (Cosmocampus arctus), colectados con anestésico en pequeñas colonias de coral aisladas; y un pez globo (Canthigaster janthinoptera) observado y fotografiado. Este estudio extiende el ámbito de distribución de tres de estas especies en el Pacífico Oriental Tropical.
Czech Academy of Sciences Publication Activity Database
Nowak, M.; Mendel, Jan; Szczerbik, P.; Klaczak, A.; Mikolajczyk, T.; Ozga, K.; Falowska, B.; Popek, W.
2011-01-01
Roč. 19, č. 1 (2011), s. 37-49 ISSN 1230-6428 R&D Projects: GA ČR GP206/09/P608 Institutional research plan: CEZ:AV0Z60930519 Keywords : Gobioninae * traditional morphometrics * Vistula Subject RIV: EG - Zoology
Aguirre-Villaseñor, Hugo; Cruz-Acevedo, Edgar; Salas-Singh, Carolina
2016-01-01
Abstract: Psychrolutes phrictus is a benthic deep sea fish known from the eastern North Pacific. On 30 March 2008, a specimen of the blob sculpin P. phrictus (297 mm LT) was caught off the Guerrero coast, Mexico (17°45′24″N, 101°59′04″W). The blob sculpin was taken at a depth of 1,100 m within a temperature range of 3.88-4.25 °C, where hypoxic (0.57-0.39 mg/l) conditions prevailed; the specimen was captured over a muddy bottom using a benthic sledge. Representatives of this species had never ...
Recovery of a mining-damaged stream ecosystem
Directory of Open Access Journals (Sweden)
Christopher A. Mebane
2015-03-01
Full Text Available Abstract This paper presents a 30+ year record of changes in benthic macroinvertebrate communities and fish populations associated with improving water quality in mining-influenced streams. Panther Creek, a tributary to the Salmon River in central Idaho, USA suffered intensive damage from mining and milling operations at the Blackbird Mine that released copper (Cu, arsenic (As, and cobalt (Co into tributaries. From the 1960s through the 1980s, no fish and few aquatic invertebrates could be found in 40 km of mine-affected reaches of Panther Creek downstream of the metals contaminated tributaries, Blackbird and Big Deer Creeks. Efforts to restore water quality began in 1995, and by 2002 Cu levels had been reduced by about 90%, with incremental declines since. Rainbow Trout (Oncorhynchus mykiss were early colonizers, quickly expanding their range as areas became habitable when Cu concentrations dropped below about 3X the U.S. Environmental Protection Agency’s biotic ligand model (BLM based chronic aquatic life criterion. Anadromous Chinook Salmon (O. tshawytscha and steelhead (O. mykiss have also reoccupied Panther Creek. Full recovery of salmonid populations occurred within about 12-years after the onset of restoration efforts and about 4-years after the Cu chronic criteria had mostly been met, with recovery interpreted as similarity in densities, biomass, year class strength, and condition factors between reference sites and mining-influenced sites. Shorthead Sculpin (Cottus confusus were slower than salmonids to disperse and colonize. While benthic macroinvertebrate biomass has increased, species richness has plateaued at about 70 to 90% of reference despite the Cu criterion having been met for several years. Different invertebrate taxa had distinctly different recovery trajectories. Among the slowest taxa to recover were Ephemerella, Cinygmula and Rhithrogena mayflies, Enchytraeidae oligochaetes, and Heterlimnius aquatic beetles. Potential
The lateral line receptor array of cyprinids from different habitats.
Schmitz, Anke; Bleckmann, Horst; Mogdans, Joachim
2014-04-01
The lateral line system of teleost fishes consists of an array of superficial and canal neuromasts (CN). Number and distribution of neuromasts and the morphology of the lateral line canals vary across species. We investigated the morphology of the lateral line system in four diurnal European cyprinids, the limnophilic bitterling (Rhodeus sericeus), the indifferent gudgeon (Gobio gobio), and ide (Leuciscus idus), and the rheophilic minnow (Phoxinus phoxinus). All fish had lateral line canals on head and trunk. The total number of both, CN and superficial neuromasts (SN), was comparable in minnow and ide but was greater than in gudgeon and bitterling. The ratio of SNs to CNs for the head was comparable in minnow and bitterling but was greater in gudgeon and ide. The SN-to-CN ratio for the trunk was greatest in bitterling. Polarization of hair cells in CNs was in the direction of the canal. Polarization of hair cells in SNs depended on body area. In cephalic SNs, hair cell polarization was dorso-ventral or rostro-caudal. In trunk SNs, it was rostro-caudal on lateral line scales and dorso-ventral on other trunk scales. On the caudal fin, hair cell polarization was rostro-caudal. The data show that, in the four species studied here, number, distribution, and orientation of CNs and SNs cannot be unequivocally related to habitat. Copyright © 2013 Wiley Periodicals, Inc.
Spatial distribution of pelagic fish larvae in the northern main basin of Lake Huron
Roseman, Edward F.; O'Brien, Timothy P.
2013-01-01
Larval fish occurrence in inshore and offshore zones in the northern main basin of Lake Huron was assessed during 2007 as part of a larger ecological examination of Lake Huron foodwebs and habitats. Day and night collections using neuston and conical nets at inshore (1.5–15 m depths) and offshore (37 and 91 m depths) locations at De Tour and Hammond Bay to assess the abundance, phenology, and spatial distribution of pelagic ichthyoplankton during spring and early summer were made. In general, densities of larval fishes were higher at De Tour than Hammond Bay during daytime neuston net collections, with the exception of Longnose Sucker, which were only collected at Hammond Bay. Lake Whitefish, Burbot, and Rainbow Smelt dominated inshore catches in early spring with Cisco, Deepwater Sculpin, Emerald Shiner, Bloater, Slimy Sculpin, Ninespine Stickleback, and Yellow Perch larvae also collected.Nighttime nearshore and offshore sampling revealed that Rainbow Smelt and Burbot larvae were present in relatively high abundances compared to inshore densities. Concentrations of larvae of deepwater demersal fishes such as Lake Whitefish and Deepwater Sculpin suggest that inshore zones in northern Lake Huron are important nursery habitats emphasizing a critical production and recruitment linkage between inshore and deepwater zones.
International Nuclear Information System (INIS)
Schwiening, S.; Schmidt, B.; Schuphan, I.
1993-01-01
Water, sediment and fish samples of the river Inde in the course from source to mouth were analysed for their contents of polychlorinated biphenyls (6 indicator-congeners). Analysis of the water samples showed no contents of PCB (detection limit: 10 ng/l). The resulting PCB concentration profile of the sediment showed at the upper part of the Inde uniform PCB values of 18 μg/kg dry weight sediment. In the middle part, after the tributary of an industrial influenced brook, the Vicht, the contents of PCB increased precipitously to about 110 μg/kg dry weight. In the further course - downstream near the mouth into the river Rur - the PCB contents in the sediment decreased steplike along a distance of about 20 km resulting in a level of 34 μg/kg dry weight. From the analysed fishes the brook trout (Salmo trutta forma fario) also showed PCB contents dependent on the position in the river where they were cought. In relation to muscle lipid content the averange values at the upper part of the river amounted to 6 mg/kg, in the middle part to ca 38 mg/kg and downstream to ca 8 mg/kg extractable lipid basis. Because of absence at some sampling points for the roach (Rutilus rutilus) and gudgeon (Gobio gobio) an analogues correlation could not be found. This fishes showed concentrations of PCB ranging from 3 to 5 mg/kg extractable lipid basis. (orig.) [de
Experimental Gravel Bar Habitat Creation in the Tombigbee River, Mississippi
National Research Council Canada - National Science Library
Miller, Andrew C
2006-01-01
Prior to development of the Tennessee Tombigbee Waterway (TTW), the Tombigbee River was well-known for supporting a dense and diverse fauna, including sculpins, minnows, mussels, snails, worms, and immature insects...
Visual sensitivity of deepwater fishes in Lake Superior.
Directory of Open Access Journals (Sweden)
Kelly A Harrington
Full Text Available The predator-prey interactions in the offshore food web of Lake Superior have been well documented, but the sensory systems mediating these interactions remain unknown. The deepwater sculpin, (Myoxocephalus thompsoni, siscowet (Salvelinus namaycush siscowet, and kiyi (Coregonus kiyi inhabit low light level environments. To investigate the potential role of vision in predator-prey interactions, electroretinography was used to determine visual sensitivity for each species. Spectral sensitivity curves revealed peak sensitivity at 525 nm for each species which closely corresponds to the prevalent downwelling light spectrum at depth. To determine if sufficient light was available to mediate predator-prey interactions, visual sensitivity was correlated with the intensity of downwelling light in Lake Superior to construct visual depth profiles for each species. Sufficient daytime irradiance exists for visual interactions to approximately 325 m for siscowet and kiyi and 355 m for the deepwater sculpin during summer months. Under full moon conditions, sufficient irradiance exists to elicit ERG response to light available at approximately 30 m for the siscowet and kiyi and 45 m for the deepwater sculpin. Visual interactions are therefore possible at the depths and times when these organisms overlap in the water column indicating that vision may play a far greater role at depth in deep freshwater lakes than had been previously documented.
Temporal changes in the prevalence of parasites in two Oregon estuary-dwelling fishes.
Olson, Robert E; Pierce, Jack R; Jacobson, Kym C; Burreson, Eugene M
2004-06-01
The parasite faunas of juvenile English sole (Parophrys vetulus) in 1971-1972 and staghorn sculpin (Leptocottus armatus) in 1971 from Yaquina Bay, Oregon, were compared with faunas found in the same estuary in 1997-2000 (English sole) and 1999-2000 (staghorn sculpin). The 7 most commonly occurring parasites in 1971 were compared with the same species observed during the same month and sampling sites in 1997-2000. Multivariate community analysis of juvenile English sole parasites supported the suggestion that the 1971 parasite data were representative of the early-1970s time period. Four of the parasite species infecting English sole and 6 of those infecting staghorn sculpins had significantly lower prevalences in 1997-2000. Parasite species with significantly lower prevalences also had reduced intensity levels. One parasite (Glugea stephani) of English sole increased in prevalence in the 1997-2000 samples in association with the warm estuarine temperatures during the 1997 El Niño year. Although the causes for the changes in occurrence of other parasites were not determined, ecological changes in Yaquina Bay that may have influenced parasite ecology include apparent changes in the estuary ichthyofauna that occurred between the sampling periods. Such changes could be associated with increases in the number of California sea lions (Zalophus californianus) subsequent to establishment of the Marine Mammal Protection Act in 1972.
Viability and infectivity of Ichthyophonus sp. in post-mortem Pacific herring, Clupea pallasii.
Kocan, Richard; Hart, Lucas; Lewandowski, Naomi; Hershberger, Paul
2014-12-01
Ichthyophonus-infected Pacific herring, Clupea pallasii , were allowed to decompose in ambient seawater then serially sampled for 29 days to evaluate parasite viability and infectivity for Pacific staghorn sculpin, Leptocottus armatus . Ichthyophonus sp. was viable in decomposing herring tissues for at least 29 days post-mortem and could be transmitted via ingestion to sculpin for up to 5 days. The parasite underwent morphologic changes during the first 48 hr following death of the host that were similar to those previously reported, but as host tissue decomposition progressed, several previously un-described forms of the parasite were observed. The significance of long-term survival and continued morphologic transformation in the post-mortem host is unknown, but it could represent a saprozoic phase of the parasite life cycle that has survival value for Ichthyophonus sp.
Etude de la structure d'une population de truite commune (Salmo trutta L. dans une zone à barbeau
Directory of Open Access Journals (Sweden)
BAGLINIERE J. L.
1981-10-01
Full Text Available Au total 16 espèces de poissons, dont la truite commune (Salmo trutta L. ont été recensées par pêche électrique dans le cours aval de la rivière Colmont, classée rivière à salmonidés dominants, et un de ses affluents. La présence de gros cyprins d'eaux vives (barbeau, Barbus barbus L., et chevaine, Leuciscus cephalus L. et de quelques espèces de cyprins d'eaux lentes est une caractéristique de la zone à barbeau. Parmi les cyprins, les espèces les plus abondantes sont le goujon (Gobio gobio L. et le chevaine présent dans tous les types d'habitats de la rivière. La population de truites se caractérise par : — une faible densité dans la rivière et l'affluent et par une bonne croissance. Ces deux paramètres montrent des variations annuelles. — une ségrégation spatiale des classes d'âge ; les truites 0+ sont localisées principalement dans l'affluent, alors que dans la rivière les truites sont âgées d'au moins 1 an et sont présentes uniquement dans les zones rapide-radier. Les caractéristiques de cette population de truite sont discutées en considérant l'interaction possible avec les autres populations pisciaires dans un milieu dont l'habitat est dégradé.
Mebane, Christopher A.
2006-01-01
In 2001, the U.S. Environmental Protection Agency (EPA) released updated aquatic life criteria for cadmium. Since then, additional data on the effects of cadmium to aquatic life have become available from studies supported by the EPA, Idaho Department of Environmental Quality (IDEQ), and the U.S. Geological Survey, among other sources. Updated data on the effects of cadmium to aquatic life were compiled and reviewed and low-effect concentrations were estimated. Low-effect values were calculated using EPA's guidelines for deriving numerical national water-quality criteria for the protection of aquatic organisms and their uses. Data on the short-term (acute) effects of cadmium on North American freshwater species that were suitable for criteria derivation were located for 69 species representing 57 genera and 33 families. For longer-term (chronic) effects of cadmium on North American freshwater species, suitable data were located for 28 species representing 21 genera and 17 families. Both the acute and chronic toxicity of cadmium were dependent on the hardness of the test water. Hardness-toxicity regressions were developed for both acute and chronic datasets so that effects data from different tests could be adjusted to a common water hardness. Hardness-adjusted effects values were pooled to obtain species and genus mean acute and chronic values, which then were ranked by their sensitivity to cadmium. The four most sensitive genera to acute exposures were, in order of increasing cadmium resistance, Oncorhynchus (Pacific trout and salmon), Salvelinus ('char' trout), Salmo (Atlantic trout and salmon), and Cottus (sculpin). The four most sensitive genera to chronic exposures were Hyalella (amphipod), Cottus, Gammarus (amphipod), and Salvelinus. Using the updated datasets, hardness dependent criteria equations were calculated for acute and chronic exposures to cadmium. At a hardness of 50 mg/L as calcium carbonate, the criterion maximum concentration (CMC, or 'acute
Offshore Fish Community: Ecological Interactions
The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone...
The offshore benthic fish community
Lantry, Brian F.; Lantry, Jana R.; Weidel, Brian C.; Walsh, Maureen; Hoyle, James A.; Schaner, Teodore; Neave, Fraser B.; Keir, Michael
2014-01-01
Lake Ontario’s offshore benthic fish community includes primarily slimy sculpin, lake whitefish, rainbow smelt, lake trout, burbot, and sea lamprey. Of these, lake trout have been the focus of an international restoration effort for more than three decades (Elrod et al. 1995; Lantry and Lantry 2008). The deepwater sculpin and three species of deepwater ciscoes (Coregonus spp.) that were historically important in the offshore benthic zone became rare or were extirpated by the 1960s (Christie 1973; Owens et al. 2003; Lantry et al. 2007b; Roth et al. 2013). Ecosystem changes continue to influence the offshore benthic fish community, including the effects of dreissenid mussels, the near disappearance of burrowing amphipods (Diporeia spp.) (Dermott et al. 2005; Watkins et al. 2007), and the increased abundance and expanded geographic distribution of round goby (see Nearshore Fish Community chapter) (Lantry et al. 2007b). The fish-community objectives for the offshore benthic fish community, as described by Stewart et al. (1999), are:
Status and trends of prey fish populations in Lake Michigan, 2013
Madenjian, Charles P.; Bunnell, David B.; Desorcie, Timothy J.; Kostich, Melissa Jean; Armenio, Patricia M.; Adams, Jean V.
2015-01-01
The U.S. Geological Survey Great Lakes Science Center has conducted lake-wide surveys of the fish community in Lake Michigan each fall since 1973 using standard 12-m bottom trawls towed along contour at depths of 9 to 110 m at each of seven index transects. The resulting data on relative abundance, size and age structure, and condition of individual fishes are used to estimate various population parameters that are in turn used by state and tribal agencies in managing Lake Michigan fish stocks. All seven established index transects of the survey were completed in 2013. The survey provides relative abundance and biomass estimates between the 5-m and 114-m depth contours of the lake (herein, lake-wide) for prey fish populations, as well as burbot, yellow perch, and the introduced dreissenid mussels. Lake-wide biomass of alewives in 2013 was estimated at 29 kilotonnes (kt, 1 kt = 1000 metric tonnes), which was more than three times the 2012 estimate. However, the unusually high standard error associated with the 2013 estimate indicated no significant increase in lake-wide biomass between 2012 and 2013. Moreover, the age distribution of alewives remained truncated with no alewife exceeding an age of 5. The population of age-1 and older alewives was dominated (i.e., 88%) by the 2010 and 2012 year-classes. Record low biomass was observed for deepwater sculpin (1.3 kt) and ninespine stickleback (0.004 kt) in 2013, while bloater (1.6 kt) and rainbow smelt (0.2 kt) biomasses remained at low levels. Slimy sculpin lake-wide biomass was 0.32 kt in 2013, marking the fourth consecutive year of a decline. The 2013 biomass of round goby was estimated at 10.9 kt, which represented the peak estimate to date. Burbot lake-wide biomass (0.4 kt in 2013) has remained below 3 kt since 2001. Numeric density of age-0 yellow perch (i.e., fish per ha, which is indicative of a relatively poor year-class. Lake-wide biomass estimate of dreissenid mussels in 2013 was 23.2 kt. Overall, the total
Shinn, Cândida; Blanchet, Simon; Loot, Géraldine; Lek, Sovan; Grenouillet, Gaël
2015-12-15
The response of organisms to environmental stress is currently used in the assessment of ecosystem health. Morphological changes integrate the multiple effects of one or several stress factors upon the development of the exposed organisms. In a natural environment, many factors determine the patterns of morphological differentiation between individuals. However, few studies have sought to distinguish and measure the independent effect of these factors (genetic diversity and structure, spatial structuring of populations, physical-chemical conditions, etc.). Here we investigated the relationship between pesticide levels measured at 11 sites sampled in rivers of the Garonne river basin (SW France) and morphological changes of a freshwater fish species, the gudgeon (Gobio gobio). Each individual sampled was genotyped using 8 microsatellite markers and their phenotype characterized via 17 morphological traits. Our analysis detected a link between population genetic structure (revealed by a Bayesian method) and morphometry (linear discriminant analysis) of the studied populations. We then developed an original method based on general linear models using distance matrices, an extension of the partial Mantel test beyond 3 matrices. This method was used to test the relationship between contamination (toxicity index) and morphometry (PST of morphometric traits), taking into account (1) genetic differentiation between populations (FST), (2) geographical distances between sites, (3) site catchment area, and (4) various physical-chemical parameters for each sampling site. Upon removal of confounding effects, 3 of the 17 morphological traits studied were significantly correlated with pesticide toxicity, suggesting a response of these traits to the anthropogenic stress. These results underline the importance of taking into account the different sources of phenotypic variability between organisms when identifying the stress factors involved. The separation and quantification of
Recent changes in the deep-water fish populations of Lake Michigan
Moffett, James W.
1957-01-01
The deep-water fish fauna of Lake Michigan consisted of lake trout (Salvelinus namaycush), burbot (Lota lota maculosa), seven species of chubs or deep-water ciscoes (Leucichthys spp.), and the deep-water sculpin (Myoxocephalus quadricornis). Other species occupied the deep-water zone but were not typically part of the fauna.
Thompson, Roy; Vaughan, Martin
2014-01-01
Chlorinated paraffins (CPs) are high molecular weight organochlorine compounds that have been used in a variety of industrial applications for many years. Medium-chain chlorinated paraffins (MCCPs) (CAS 85535-85-9; Alkanes, C14-17 , chloro) are currently under investigation as potential persistent bioaccumulative toxic (PBT) compounds. In this article, the bioaccumulation potential of MCCPs is assessed using a tiered framework proposed after a recent Society of Environmental Toxicology and Chemistry (SETAC) Pellston Workshop in 2008. The framework proposes the use of physicochemical properties and modeling assessment, bioconcentration/bioaccumulation (BCF/BAF) assessment, biomagnification (BMF) assessment, and trophic magnification factor (TMF) assessment. It is hoped that use of this framework could harmonize and improve the efficiency and effectiveness of the chemical substance evaluation screening process for PBT properties. When applied to MCCPs, the following conclusions were made: empirical physiochemical data is available negating the use of models; laboratory BCFs range from 1000 to 15 000 (growth-corrected lipid normalized values) for 2 MCCP structures; field BAFs were an order of magnitude higher than the trigger criterion for "B status possible"; although results may not meet acceptance criteria for field studies, laboratory-derived BMFs for a number of C14-17 chlorinated alkanes were less than the trigger value of 1 (based on whole-body concentrations) whereas field-derived BMFs were less than 1 (based on lipid corrected values [generally used for field data] excluding one measure for sculpin, [Cottus cognatus]-Diporeia that was based on only one detectable sample); and finally, TMFs were less than the trigger criterion value of 1, which are considered the most convincing evidence for bioaccumulative properties of a compound and the "Gold Standard" measure of bioaccumulation. This article also discusses the uncertainties surrounding the published data
Directory of Open Access Journals (Sweden)
Voicu Răzvan
2016-04-01
Full Text Available The fish fauna of the Hârtibaciu River has experienced a disrupted connectivity due to the hydrotechnical works and the Brădeni/Retiş Dam located across the Hârtibaciu watercourse being one of this significant obstacles. The newly proposed constructed wetlands can improve the habitat quality for the fish species of conservative interest sampled in the Brădeni/Retiş Dam proximity Rhodeus amarus, and can increase the individuals’ number of this population. Also can benefit the local populations of Phoxinus phoxinus and Gobio obtusirostris. Using gravitational force and also the underground layout, a proposed technical solution gives maximum safety regarding the water supply for the newly proposed to be created wetlands.
2013-03-01
..., sculpins, sharks, squids, and octopuses. \\5\\ In December 2012 the Council recommended that the red king... decreased because of smaller OFLs and ABCs resulting from lower biomass estimates. The TACS for octopuses... Squids BSAI 2,620 1,970 700 595 0 2,620 1,970 700 595 0 Octopuses BSAI 3,450 2,590 500 425 0 3,450 2,590...
Elevated temperature exacerbates Ichthyophonus infections in buffalo sculpin
Halpenny, C.M.; Kocan, R.M.; Winton, J.R.; Perry, J.A.; Hershberger, P.K.
2002-01-01
High incidences of Ichthyophonus hoferi, a parasite primarily of marine and estuarine fishes, have recently been reported in rockfishes and Pacific herring from the eastern North Pacific (Kent et al 2001, Hershberger et al 2002). Taxonomic position of I. hoferi remains unresolved, but recent phylogenetic studies have grouped the organism with Dermocystidium, Psorospermium, the rosette agent of salmonids, and Rhinosporidium in the Mesomycetozoa, a novel clade of protists near the animal-fungal divergence (Herr et al 1999). Genetic differences among isolates from the east coast of North America indicate that more than one species of Ichthyophonus exist (Rand et al 2000), and different species have likely been assigned the same name based on morphological characteristics. Therefore, hereafter in this manuscript, the organism will be referred to as Ichthyophonus .
Erman, Don C.; Ligon, Franklin K.
1988-01-01
A small, coastal stream in the San Francisco Bay area of California, USA, received the discharges from a drinking-water filtration plant. Two types of discharges were present. Discharges from filter backwashing were 3 4 times base stream flow, occurred 10 60 times per day, contained fine sediments, and each lasted about 10 min. The other discharge was a large, steady flow of relatively sediment-free water from occasional overflow of the delivery aqueduct which generally lasted several hours a day. Samples of invertebrates from natural substrates had significantly fewer taxa and lower density at the two stations below the backwash than at the two above. However, when stable artificial substrates were used, there were no significant differences among all four stations. The aqueduct apparently had no effect because the. invertebrate community at the station upstream of the backwash but downstream of the aqueduct was statistically similar to the station above the aqueduct. To test for acute toxicity, we exposed additional artificial substrates to short-term simulated backwash conditions. These exposures had no effect on invertebrate density or drift. Three-spine stickleback ( Gasterosteus aculeatus) populations were also significantly reduced at the two downstream stations and were made up mostly of larger, adult fish. Prickly sculpins ( Cottus asper), restricted to the most downstream station, were emaciated and had poor growth, probably as a result of scarce benthic food organisms. Artificial redds with eggs of rainbow trout ( Salmo gairdneri) had significantly lower survival at two stations below the plant backwash (30.7% and 41.8%) than at the one above it (61.4%). Hatchery rainbow trout held in cages below the treatment plant from 7 to 37 days survived and continued to feed. Thus, the major effect of the water treatment plant on fish and invertebrates probably was not from acute toxicity in the discharges or the occasionally large discharge of clean water from the
Franklin, C E
1998-09-01
1. Studies of evolutionary temperature adaptation of muscle and locomotor performance in fish are reviewed with a focus on the Antarctic fauna living at subzero temperatures. 2. Only limited data are available to compare the sustained and burst swimming kinematics and performance of Antarctic, temperate and tropical species. Available data indicate that low temperatures limit maximum swimming performance and this is especially evident in fish larvae. 3. In a recent study, muscle performance in the Antarctic rock cod Notothenia coriiceps at 0 degree C was found to be sufficient to produce maximum velocities during burst swimming that were similar to those seen in the sculpin Myoxocephalus scorpius at 10 degrees C, indicating temperature compensation of muscle and locomotor performance in the Antarctic fish. However, at 15 degrees C, sculpin produce maximum swimming velocities greater than N. coriiceps at 0 degree C. 4. It is recommended that strict hypothesis-driven investigations using ecologically relevant measures of performance are undertaken to study temperature adaptation in Antarctic fish. Recent detailed phylogenetic analyses of the Antarctic fish fauna and their temperate relatives will allow a stronger experimental approach by helping to separate what is due to adaptation to the cold and what is due to phylogeny alone.
Harris, C.; Johnson, B.; Ambrose, W. G.; Bourque, B.; Dostie, P.; Crowley, E.
2010-12-01
The carbon and nitrogen stable isotope compositions of collagen extracted from well-preserved archeological fish bones has the potential to provide useful information on fish diets and food web dynamics over time. Previous work on the Turner Farm archaeological site in Penobscot Bay, Gulf of Maine, reveals significant shifts in fish diets have occurred since European colonization (post 1620’s). The objective of the present study was to analyze samples from other archaeological sites within Penobscot Bay to characterize the spatial extent of the isotopic shift measured at Turner Farm. Stratified cod, flounder, and sculpin bones were analyzed from eight coastal middens located approximately 50km apart from one another within Penobscot Bay. The bones were sampled from three time horizons (0kya, 0.5-1kya, and 2.2-2.4kya). All bone samples were demineralized in 0.2M HCl at 4°C for 2 to 7 days and then extracted in 0.25M NaOH at 4°C for 1 to 2 hours. After freeze-drying, the bulk isotopic composition of each sample was analyzed using the EA-IRMS. In all stratigraphic horizons analyzed, cod were more enriched in δ13C and δ15N than sculpin, and flounder were the most depleted in δ13C and δ15N . However, the isotopic offsets between the fish species decreased from 2.4kya to the present. The nitrogen isotope composition was relatively constant over time and space for all species, implying that trophic levels for the fishes analyzed have not changed significantly in Penobscot Bay for the last 2,400 years. The carbon isotope composition also appears to be constant spatially in Penobscot Bay, however, the modern signal was more depleted than the paleo signal in all three species. The difference between the modern and paleo δ13C is ~5‰ for cod and flounder, and ~9‰ for sculpin. These shifts may, in part, be explained by decreases in both primary producer and prey species diversity, as kelp forests replace eelgrass beds in the Gulf of Maine.
Directory of Open Access Journals (Sweden)
Anderson Alves
2012-09-01
Full Text Available The family Loricariidae with about 690 species divided into six subfamilies, is one of the world’s largest fish families. Cytogenetic studies conducted in the family showed that among 90 species analyzed the diploid number ranges from 2n=38 in Ancistrus sp. to 2n=96 in Hemipsilichthys gobio Luetken, 1874. In the present study, fluorescence in situ hybridization (FISH was employed to determine the chromosomal localization of the 18S rDNA gene in four suckermouth armoured catfishes: Kronichthys lacerta (Nichols, 1919, Pareiorhaphis splendens (Bizerril, 1995, Liposarcus multiradiatus (Hancock, 1828 and Hypostomus prope plecostomus (Linnaeus, 1758. All species analyzed showed one chromosome pair with 18S rDNA sequences, as observed in the previous Ag-NORs analyses. The presence of size and numerical polymorphism was observed and discussed, with proposing a hypothesis of the Ag-NOR evolution in Loricariidae.
Contaminants of emerging concern in a large temperate estuary.
Meador, James P; Yeh, Andrew; Young, Graham; Gallagher, Evan P
2016-06-01
This study was designed to assess the occurrence and concentrations of a broad range of contaminants of emerging concern (CECs) from three local estuaries within a large estuarine ecosystem. In addition to effluent from two wastewater treatment plants (WWTP), we sampled water and whole-body juvenile Chinook salmon (Oncorhynchus tshawytscha) and Pacific staghorn sculpin (Leptocottus armatus) in estuaries receiving effluent. We analyzed these matrices for 150 compounds, which included pharmaceuticals, personal care products (PPCPs), and several industrial compounds. Collectively, we detected 81 analytes in effluent, 25 analytes in estuary water, and 42 analytes in fish tissue. A number of compounds, including sertraline, triclosan, estrone, fluoxetine, metformin, and nonylphenol were detected in water and tissue at concentrations that may cause adverse effects in fish. Interestingly, 29 CEC analytes were detected in effluent and fish tissue, but not in estuarine waters, indicating a high potential for bioaccumulation for these compounds. Although concentrations of most detected analytes were present at relatively low concentrations, our analysis revealed that overall CEC inputs to each estuary amount to several kilograms of these compounds per day. This study is unique because we report on CEC concentrations in estuarine waters and whole-body fish, which are both uncommon in the literature. A noteworthy finding was the preferential bioaccumulation of CECs in free-ranging juvenile Chinook salmon relative to staghorn sculpin, a benthic species with relatively high site fidelity. Published by Elsevier Ltd.
Rhea, Darren T.; Farag, Aïda M.; Harper, David D.; McConnell, Elizabeth; Brumbaugh, William G.
2013-01-01
The Yankee Fork is a large tributary of the Salmon River located in central Idaho, USA, with an extensive history of placer and dredge-mining activities. Concentrations of selenium (Se) and mercury (Hg) in various aquatic trophic levels were measured in the Yankee Fork during 2001 and 2002. Various measurements of fish health were also performed. Sites included four on the mainstem of the Yankee Fork and two off-channel sites in partially reclaimed dredge pools used as rearing habitat for cultured salmonid eggs and fry. Hg concentrations in whole mountain whitefish and shorthead sculpin ranged from 0.28 to 0.56 μg/g dry weight (dw), concentrations that are generally less than those reported to have significant impacts on fish. Biofilm and invertebrates ranged from 0.05 to 0.43 μg Hg/g dw. Se concentrations measured in biota samples from the Yankee Fork were greater than many representative samples collected in the Snake and Columbia watersheds and often exceeded literature-based toxic thresholds. Biofilm and invertebrates ranged from 0.58 to 4.66 μg Se/g dw. Whole fish ranged from 3.92 to 7.10 μg Se/g dw, and gonads ranged from 6.91 to 31.84 μg Se/g dw. Whole-body Se concentrations exceeded reported toxicological thresholds at three of four sites and concentrations in liver samples were mostly greater than concentrations shown to have negative impacts on fish health. Histological examinations performed during this study noted liver abnormalities, especially in shorthead sculpin, a bottom-dwelling species.
Frenzel, Steven A.
2000-01-01
Organochlorines, semivolatile organic compounds (SVOCs), and trace elements were investigated in streambed sediments and fish tissues at selected sites in the Cook Inlet Basin, Alaska, during 1998. At most sites, SVOCs and organochlorine compounds were either not detected or detected at very low concentrations. Chester Creek at Arctic Boulevard at Anchorage, which was the only site sampled with a significant degree of development in the watershed, had elevated levels of many SVOCs in streambed sediment. Coring of sediments from two ponds on Chester Creek confirmed the presence of elevated concentrations of a variety of organic compounds. Moose Creek, a stream with extensive coal deposits in its watershed, had low concentrations of numerous SVOCs in streambed sediment. Three sites located in national parks or in a national wildlife refuge had no detectable concentrations of SVOCs. Trace elements were analyzed in both streambed sediments and tissues of slimy sculpin. The two media provided similar evidence for elevated concentrations of cadmium, lead, and zinc at Chester Creek. In this study, 'probable effect levels '(PELs) were determined from sediments finer than 0.063 millimeters, where concentrations tend to be greatest. Arsenic and chromium concentrations exceeded the PEL at eight and six sites respectively. Zinc exceeded the PEL at one site. Cadmium and copper concentrations were smaller than the PEL at all sites. Mercury concentrations in streambed sediments from the Deshka River were near the PEL, and selenium concentrations at that site also appear to be elevated above background levels. At half the sites where slimy sculpin were sampled, selenium concentrations were at levels that may cause adverse effects in some species.
Perrot, Vincent; Pastukhov, Mikhail V; Epov, Vladimir N; Husted, Søren; Donard, Olivier F X; Amouroux, David
2012-06-05
Mercury undergoes several transformations that influence its stable isotope composition during a number of environmental and biological processes. Measurements of Hg isotopic mass-dependent (MDF) and mass-independent fractionation (MIF) in food webs may therefore help to identify major sources and processes leading to significant bioaccumulation of methylmercury (MeHg). In this work, δ(13)C, δ(15)N, concentration of Hg species (MeHg, inorganic Hg), and stable isotopic composition of Hg were determined at different trophic levels of the remote and pristine Lake Baikal ecosystem. Muscle of seals and different fish as well as amphipods, zooplankton, and phytoplankton were specifically investigated. MDF during trophic transfer of MeHg leading to enrichment of heavier isotopes in the predators was clearly established by δ(202)Hg measurements in the pelagic prey-predator system (carnivorous sculpins and top-predator seals). Despite the low concentrations of Hg in the ecosystem, the pelagic food web reveals very high MIF Δ(199)Hg (3.15-6.65‰) in comparison to coastal fish (0.26-1.65‰) and most previous studies in aquatic organisms. Trophic transfer does not influence MIF signature since similar Δ(199)Hg was observed in sculpins (4.59 ± 0.55‰) and seal muscles (4.62 ± 0.60‰). The MIF is suggested to be mainly controlled by specific physical and biogeochemical characteristics of the water column. The higher level of MIF in pelagic fish of Lake Baikal is mainly due to the bioaccumulation of residual MeHg that is efficiently turned over and photodemethylated in deep oligotrophic and stationary (i.e., long residence time) freshwater columns.
Pedro, Sara; Fisk, Aaron T; Tomy, Gregg T; Ferguson, Steven H; Hussey, Nigel E; Kessel, Steven T; McKinney, Melissa A
2017-10-01
Contaminant dynamics within Arctic marine food webs may be altered through the climate-driven northward invasions of temperate/boreal species. Here, we compare tissue concentrations of total mercury (THg) and legacy and emerging persistent organic pollutants (POPs) in native versus invading forage species sampled from 2012 to 2014 near Arviat, Clyde River, and Resolute Bay, NU, representing, low, mid- and high eastern Canadian Arctic regions, respectively. Concentrations of THg, legacy Σ-polychlorinated biphenyls (ΣPCB) and Σ-organochlorine (ΣOC) pesticides were detected in all forage species, whereas emerging halogenated flame retardants were detected in only a few individuals. Concentrations of major contaminant groups among regions did not vary for Arctic cod (Boreogadus saida), while for sculpin (Cottoidea) there was no clear latitudinal trend. Thus, considering interspecific variation, native sculpin and northern shrimp (Pandalus borealis) had the highest overall concentrations of THg (0.17 ± 0.02 and 0.21 ± 0.01 μg g -1 wet weight, respectively), ΣPCB (322 ± 35 and 245 ± 25 ng g -1 lipid weight (lw), respectively), and ΣOC (413 ± 38 and 734 ± 64 ng g -1 lw, respectively). Comparing the keystone native species, Arctic cod, to its 'replacement' species, capelin (Mallotus villosus) and sandlance (Ammodytes spp.), THg concentrations were higher in Arctic cod compared to capelin (p compound patterns, in capelin and sandlance relative to Arctic cod seem, therefore, more likely related to a more "temperate"-type contaminant signature in the invaders. Nevertheless, the relatively small (up to two-fold) magnitude of these differences suggested limited effects of these ecological changes on contaminant uptake by Arctic piscivores. Copyright © 2017 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Petersen, James H.; Poe, Thomas P.
1993-12-01
Northern squawfish (Ptychocheilus oregonensis) predation on juvenile salmonids was characterized during 1992 at ten locations in the Columbia River below Bonneville Dam and at three locations in John Day Reservoir. During the spring and summer, 1,487 northern squawfish were collected in the lower Columbia River and 202 squawfish were sampled in John Day Reservoir. Gut content data, predator weight, and water temperature were used to compute a consumption index (CI) for northern squawfish, and overall diet was also described. In the Columbia River below Bonneville Dam, northern squawfish diet was primarily fish (spring 69%; summer 53%), most of which were salmonids. Salmonids were also the primary diet component in the Bonneville Dam tailrace, John Day Dam forebay, and the McNary Dam tailrace. Crustaceans were the dominant diet item at the John Day mid-reservoir location, although sample sizes were small. About half of the non-salmonid preyfish were sculpins. The consumption index (CI) of northern squawfish was generally higher during summer than during spring. The highest CI`s were observed during summer in the tailrace boat restricted zones of Bonneville Dam (CI = 7.8) and McNary Dam (CI = 4.6). At locations below Bonneville Dam, CI`s were relatively low near Covert`s Landing and Rooster Rock, higher at four locations between Blue Lake and St. Helens, and low again at three downriver sites (Kalama, Ranier, and Jones Beach). Northern squawfish catches and CI`s were noticeably higher throughout the lower Columbia compared to mid-reservoir sites further upriver sampled during 1990--92. Predation may be especially intense in the free-flowing section of the Columbia River below Bonneville Dam. Smallmouth bass (Micropterus dolomieui; N = 198) ate mostly fish -- 25% salmonids, 29% sculpins, and 46% other fish. Highest catches of smallmouth bass were in the John Day Dam forebay.
Retinol, alpha-tocopherol and fatty acid content in Bulgarian black Sea fish species
Directory of Open Access Journals (Sweden)
Stancheva, M.
2012-06-01
Full Text Available The aim of the present study was to measure and evaluate the total lipids, fatty acid profile, retinol content and alpha-tocopherol content in the edible tissue of four commercially important fish species from the Bulgarian Black sea: Sprat (Sprattus sprattus, Round Goby (Neogobius rattan, Black Sea Horse Mackerel (Trahurus medditeraneus ponticus and Shad (Alosa pontica. Fat soluble vitamins were analyzed simultaneously using an HPLC system. The highest content of retinol was established in the Sprat (142.3 ± 4.4 μg/100g and the highest content of alphatocopherol was found in the Black Sea Horse Mackerel (1112.7 ± 39.2 μg/100g. The fatty acid (FA composition was analyzed by GC/MS. The content of omega 3 (n3 FAs was significantly higher (p , 0.001 than the content of omega 6 (n6 FAs in each of the analyzed fish samples. The n6/n3 FA ratio was within the recommended range (0.20–1.50 for Sprat, Round Goby and Shad. Relatively high levels of retinol and alpha-tocopherol, FA composition, n3/n6 FA and PUFA/SFA ratios indicate that these fish species have good nutritional quality.
El objeto de la investigación presentada es definir y comparar los lípidos totales, el perfil de ácidos grasos y el contenido de retinol y alfa-tocoferol en el tejido comestible de cuatro especies de peces con importancia comercial del Mar Negro búlgaro —espadín (Sprattus Sprattus, gobio de boca negra (Neogobius Melanostomus, chicharro (Trachurus Trachurus y sábalo del Mar Negro (Caspialosa Pontica. Dos vitaminas liposolubles son analizadas simultáneamente mediante cromatografía líquida de alta eficacia (HPLC. El contenido mayor de retinol se encuentra en el espadín (142.3 ± 4.4 μg/100g, y de alfa-tocoferol en el chicharro (1112.7 ± 39.2 μg/100g. El contenido de ácidos grasos ha sido analizado mediante cromatografía gaseosa/espectrometría de masas (GC/MS. El contenido de ácidos grasos (AG
Tracing organophosphorus and brominated flame retardants and plasticizers in an estuarine food web.
Brandsma, Sicco H; Leonards, Pim E G; Leslie, Heather A; de Boer, Jacob
2015-02-01
Nine organophosphorus flame retardants (PFRs) were detected in a pelagic and benthic food web of the Western Scheldt estuary, The Netherlands. Concentrations of several PFRs were an order of magnitude higher than those of the brominated flame retardants (BFRs). However, the detection frequency of the PFRs (6-56%) was lower than that of the BFRs (50-97%). Tris(2-butoxyethyl) phosphate (TBOEP), tris(isobutyl) phosphate (TIBP) and tris(2-chloroisopropyl) phosphate (TCIPP) were the dominant PFRs in sediment with median concentrations of 7.0, 8.1 and 1.8 ng/g dry weight (dw), respectively. PFR levels in the suspended particular matter (SPM) were 2-12 times higher than that in sediment. TBOEP, TCIPP, TIBP, tris(2-chloroethyl) phosphate (TCEP) and tris(phenyl) phosphate (TPHP) were found in organisms higher in the estuarine food web. The highest PFR concentrations in the benthic food web were found in sculpin, goby and lugworm with median concentrations of 17, 7.4, 4.6 and 2.0 ng/g wet weight (ww) for TBOEP, TIBP, TCIPP and TPHP, respectively. Comparable levels were observed in the pelagic food web, BDE209 was the predominant PBDE in sediment and SPM with median concentrations up to 9.7 and 385 ng/g dw, respectively. BDE47 was predominant in the biotic compartment of the food web with highest median levels observed in sculpin and common tern eggs of 79 ng/g lipid weight (lw) (2.5 ng/g ww) and 80 ng/g lw (11 ng/g ww), respectively. Trophic magnification was observed for all PBDEs with the exception of BDE209. Indications of trophic magnification of PFRs were observed in the benthic food web for TBOEP, TCIPP and TCEP with tentative trophic magnification factors of 3.5, 2.2 and 2.6, respectively (pwebs. The relative high PFR levels in several fish species suggest high emissions and substantial exposure of organisms to PFRs in the Western Scheldt. Copyright © 2014 Elsevier B.V. All rights reserved.
Nakae, Masanori; Senou, Hiroshi
2014-01-01
Abstract The potential fish species pool of the Kubo, Tochikura, and Ichinono river systems (tributaries of the Iwai River, Kitakami River drainage), Iwate Prefecture, northern Japan, was compared with the observed ichthyofauna by using historical records and new field surveys. Based on the literature survey, the potential species pool comprised 24 species/subspecies but only 20, including 7 non-native taxa, were recorded during the fieldwork. The absence during the survey of 11 species/subspecies from the potential species pool suggested either that sampling effort was insufficient, or that accurate determination of the potential species pool was hindered by lack of biogeographic data and ecological data related to the habitat use of the species. With respect to freshwater fish conservation in the area, Lethenteron reissneri, Carassius auratus buergeri, Pseudorasbora pumila, Tachysurus tokiensis, Oryzias latipes, and Cottus nozawae are regarded as priority species, and Cyprinus rubrofuscus, Pseudorasbora parva, and Micropterus salmoides as targets for removal. PMID:25425932
Energy Technology Data Exchange (ETDEWEB)
Braunbeck, Thomas; Brauns, Annika; Keiter, Steffen [Sektion Aquatische Oekologie und Toxikologie, Univ. Heidelberg (Germany); Hollert, Henner [Inst. fuer Umweltforschung (Biologie V), Lehr- und Forschungsgebiet Oekosystemanalyse, Rheinisch-Westfaelische Technische Hochschule Aachen, Aachen (Germany); Schwartz, Patrick [Basel Univ. (CH). Mensch-Gesellschaft-Umwelt (MGU)
2009-04-15
Background, aim, and scope: Reports about declines or unusual structures of fish populations in native aquatic systems in Central Europe and North America are in sharp contrast to an obvious improvement of general water quality. The Neckar River may serve as an example of a formerly severely contaminated freshwater system in Southern Germany, the ecological situation of which could be substantially improved over the last three decades. Nevertheless, there are still deficits in the composition of the fish fauna, which cannot be explained by conventional chemical-analytical, hydromorphological and limnological methodologies. Therefore, in search of explanations for ecological deficits, ecotoxicological investigations with an increasing focus on sediment contamination have been performed along the Lower Neckar River over a period of 10 years. In addition to sediment tests, fish populations were screened for genotoxic and embryotoxic effects as well as alterations in the structure of central metabolic organs such as the liver. Materials and methods: Roach (Rutilus rutilus) and gudgeon (Gobio gobio) from the Lower Neckar River were studied with respect to histo- and cytological alterations of the liver as well as the induction of genotoxicity in liver, gut, gills and blood cells by means of the comet and micronucleus assays. At the same time, both native sediments and acetonic sediment extracts were tested for toxicity to zebrafish (Danio rerio) embryos and permanent fish cell cultures. Results: Massive disturbances of the liver ultrastructure indicate severe stress in the fish from the Lower Neckar River despite good supply of nutrition. Both cyto- and embryotoxicity tests document a considerable toxic potential of sediments from the Lower Neckar River, and results of both the comet assay and the micronucleus test provide evidence of the presence of genotoxic agents in the sediments and their effects in fish. There has been no decrease of genotoxicity over the last 10
Czech Academy of Sciences Publication Activity Database
Karlsbakk, E.; Bårdsgjære Einen, A.C.; Bartošová, Pavla
2013-01-01
Roč. 60, č. 5 (2013), s. 425-432 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GPP506/11/P724 Institutional support: RVO:60077344 Keywords : Myxosporeans * marine fish * new species * Artediellus atlanticus * Triglops murrayi * SSU rRNA gene sequences * pseudogene * northern Atlantic Ocean * Sphaeromyxa balbianii Subject RIV: EE - Microbiology, Virology Impact factor: 1.211, year: 2013
Connectivity and conditional models of access and abundance of species in stream networks.
Chelgren, Nathan D; Dunham, Jason B
2015-07-01
Barriers to passage of aquatic organisms at stream road crossings are a major cause of habitat fragmentation in stream networks. Accordingly, large investments have been made to restore passage at these crossings, but often without estimation of population-level benefits. Here, we describe a broad-scale approach to quantifying the effectiveness of passage restoration in terms interpretable at population levels, namely numbers of fish and length of stream gained through restoration, by sampling abundance in a study design that accounts for variable biogeographic species pools, variable stream and barrier configurations, and variable probabilities of capture and detectability for multiple species. We modified an existing zero-inflated negative-binomial model to estimate the probability of site access, abundance conditional on access, and capture probability of individual fish. Therein, we modeled probability of access as a function of gradient, stream road-crossing type, and downstream access by fish simultaneously with a predictive model for abundance at sites accessible to fish. Results indicated that replacement of barriers with new crossing designs intended to allow for greater movement was associated with dramatically higher probability of access for all fishes, including migratory Pacific salmon, trout, sculpin, and lamprey. Conversely, existing non-replaced crossings negatively impacted fish distributions. Assuming no downstream constraints on access, we estimated the potential length of stream restored by the program ranged between 7.33 (lamprey) and 15.28 km (small coastal cutthroat and rainbow trout). These contributions represented a fraction of the total length available upstream (187 km) of replaced crossings. When limited ranges of species were considered, the estimated contributions of culvert replacement were reduced (1.65-km range, for longnose dace to 12.31 km for small coastal cutthroat and rainbow trout). Numbers of fish contributed ranged from
Second Baseline Study in the Citronen Fjord Area North Greenland 1997
DEFF Research Database (Denmark)
Glahder, C.
is not significantly different from that of uncontaminated fjords in West Greenland. This year relatively many Collared lemmings were seen which was probably the reason why one pair of Arctic foxes raised six cubs, why two pairs of Long-tailed skuas fled youngs (1 and 2), and why a Gyr falcon, female, was seen (a new...... period samples were collected of seaweed (Laminaria sp), fish (Fourhorned sculpin), river sediments, Arctic willow, Entired-leafed mountain avens, grasses and faeces from Muskox, Alpine hare and Collared lemming. These samples have been prepared for storage, and are now stored at the National...... Environmental Research Institute, Department of Arctic Environment together with the samples from the first baseline study in 1994. Sea water and fresh water were sampled and analysed for dissolved zinc. The total amount of zinc discharged from the Eastern River during the period from 22 June to 13 August...
2012-09-27
... true for waste waters from septic systems (Aley 2012, pers. comm.). Contamination of groundwater by... degradation of aquatic resources, including such things as illegal waste disposal, chemical leaching, contaminated groundwater, vertical drains, urban development, sedimentation, and industrial sand mining...
Energy Technology Data Exchange (ETDEWEB)
MacFarlin, Kelly M.; Perkins, Robert A. [University of Alaska Fairbanks (United States)], email: raperkins@alaska.edu; Gardiner, William W.; Word, Jack D. [NewFields NorthWest (United States)
2011-07-01
In the event of a marine oil spill, managers have to make correct and rapid decisions, weighing a number of possibilities, which include natural attenuation, mechanical recovery, in situ burning, and/or chemical dispersion. To do this, the relative toxicity of physically and chemically dispersed fresh oil and the rates of biodegradation for fresh and weathered oil need to be understood in advance. A joint industry program was established in 2008 to research and discuss these areas. Phase 1 activities included determining the species relevant to the Beaufort and Chukchi Sea ecosystems, creating and setting up a toxicity and biodegradation laboratory with a cold room in Barrow, Alaska, developing collection and culture methods for test organisms, and developing toxicity and biodegradation test protocols. The second phase of this now completed research is discussed in this paper. It consisted of toxicity testing of the local environmentally significant species, the copepod (C. glacialis), Arctic cod (B. saida), and larval sculpin (Myoxocephalus sp.).
Forestry practices and aquatic biodiversity: Fish
Gresswell, Robert E.
2005-01-01
In the Pacific Northwest, fish communities are found in a diverse array of aquatic habitats ranging from the large coastal rivers of the temperate rainforests, to the fragmented and sometimes ephemeral streams of the xeric interior basins, and high-elevation streams and lakes in the mountainous areas (Rieman et al. 2003). Only high-elevation lakes and streams isolated above barriers to fish passage remained historically devoid of fish because they were never invaded following Pleistocene glaciation (Smith 1981). Despite this widespread distribution and once great population abundances, taxonomic diversity of fishes in these forested systems is naturally lower than in aquatic habitats in the eastern U.S. (Reeves, Bisson, and Dambacher 1998). Interactions among factors that influence species richness in aquatic systems (e.g., basin size, long-term stability of habitat, and barriers to colonization; Smith 1981) continue to influence the occurrence and persistence of fishes in these systems today. Consequently, the larger low-elevation rivers and estuaries support the greatest variety of fish species. In the high-elevation tributary streams, fish communities are less complex because these aquatic systems were less climatically and geologically stable, and fish populations were smaller and more prone to local extirpation. Furthermore, barriers to fish passage inhibited dispersal and colonization (Smith 1981). Streams in forested landscapes generally support salmon and trout, Oncorhynchus spp., whitefish Prosopium spp., sculpins Cottus spp., suckers Catostomus spp., and minnows (Cyprinidae), but in some of the colder streams, chars (e.g., Salvelinus confluentus and Salvelinus malma) and lampreys (Petromyzontidae)may also occur (Rieman et al. 2003).Although biodiversity defined in terms of fish species richness is low in the Pacific Northwest, intraspecific variability is high, and polytypic fish species are common in the diverse aquatic habitats of the region. For
Michael K. Young; Kevin S. McKelvey; Kristine L. Pilgrim; Michael K. Schwartz
2013-01-01
There is growing interest in broad-scale biodiversity assessments that can serve as benchmarks for identifying ecological change. Genetic tools have been used for such assessments for decades, but spatial sampling considerations have largely been ignored. Here, we demonstrate how intensive sampling efforts across a large geographical scale can influence identification...
Physiological and biochemical responses of small fish exposed to Athabasca oil sands sediment
International Nuclear Information System (INIS)
Tetrault, G.R.; Environment Canada, Burlington, ON; McMaster, M.E.; Dixon, D.G.; Parrott, J.L.
2002-01-01
A study was conducted to determine the influence of naturally occurring oil sands related compounds on the reproductive function and hepatic responses of fish. Wild fish, both exposed and unexposed to the compounds in question, were collected along with sediments for laboratory testing. The study showed that in vitro gonadal incubation levels of steroid production were lower at the tributary sites within the oil sands deposits. One indicator of exposure to oil sands related compounds (hepatic 7-ethoxyresorufin-O-deethylase activity) was shown to be 5 times higher at the same sites. In addition, slimy sculpin were exposed to sediment samples from the Steepbank River site for 4 to 8 days to evaluate the absorption of the indicator. The indicator in exposed fish was found to be comparable to that measured in fish native to the oil sands area. The study was not capable of predicting an altered ability of gonadal tissue of exposed fish to produce steroid hormones in vitro. It was concluded that future development could compromise the reproductive health of fish in the area
Offshore Fish Community: Ecological Interactions | Science ...
The offshore (>80 m) fish community of Lake Superior is made up of predominately native species. The most prominent species are deepwater sculpin, kiyi, cisco, siscowet lake trout, burbot, and the exotic sea lamprey. Bloater and shortjaw cisco are also found in the offshore zone. Bloater is abundant in the offshore zone but appears restricted to depths shallower than 150 m (Selgeby and Hoff 1996; Stockwell et al. 2010), although it occuppied greater depths several decades ago (Dryer 1966; Peck 1977). Shortjaw is relatively rare in the offshore zone (Hoff and Todd 2004; Gorman and Hoff 2009; Gorman and Todd 2007). Lake whitefish is also known to frequent bathymetric depths >100 m (Yule et al. 2008b). In this chapter, we develop a conceptual model of the offshore food web based on data collected during 2001-2005 and on inferences from species interactions known for the nearshore fish community. We then develop a framework for examination of energy and nutrient movements within the pelagic and benthic habitats of the offshore zone and across the offshore and nearshore zones. To document research results.
Directory of Open Access Journals (Sweden)
Maria Ilhéu
Full Text Available Invasive species are regarded as a biological pressure to natural aquatic communities. Understanding the factors promoting successful invasions is of great conceptual and practical importance. From a practical point of view, it should help to prevent future invasions and to mitigate the effects of recent invaders through early detection and prioritization of management measures. This study aims to identify the environmental determinants of fish invasions in Mediterranean-climate rivers and evaluate the relative importance of natural and human drivers. Fish communities were sampled in 182 undisturbed and 198 disturbed sites by human activities, belonging to 12 river types defined for continental Portugal within the implementation of the European Union's Water Framework Directive. Pumpkinseed sunfish, Lepomis gibbosus (L., and mosquitofish, Gambusia holbrooki (Girard, were the most abundant non-native species (NNS in the southern river types whereas the Iberian gudgeon, Gobio lozanoi Doadrio and Madeira, was the dominant NNS in the north/centre. Small northern mountain streams showed null or low frequency of occurrence and abundance of NNS, while southern lowland river types with medium and large drainage areas presented the highest values. The occurrence of NNS was significantly lower in undisturbed sites and the highest density of NNS was associated with high human pressure. Results from variance partitioning showed that natural environmental factors determine the distribution of the most abundant NNS while the increase in their abundance and success is explained mainly by human-induced disturbance factors. This study stresses the high vulnerability of the warm water lowland river types to non-native fish invasions, which is amplified by human-induced degradation.
Sundin, L; Turesson, J; Taylor, E W
2003-03-01
Glutamate is a major neurotransmitter of chemoreceptor and baroreceptor afferent pathways in mammals and therefore plays a central role in the development of cardiorespiratory reflexes. In fish, the gills are the major sites of these receptors, and, consequently, the terminal field (sensory area) of their afferents (glossopharyngus and vagus) in the medulla must be an important site for the integration of chemoreceptor and baroreceptor signals. This investigation explored whether fish have glutamatergic mechanisms in the vagal sensory area (Xs) that could be involved in the generation of cardiorespiratory reflexes. The locations of the vagal sensory and motor (Xm) areas in the medulla were established by the orthograde and retrograde axonal transport of the neural tract tracer Fast Blue following its injection into the ganglion nodosum. Glutamate was then microinjected into identified sites within the Xs in an attempt to mimic chemoreceptor- and baroreceptor-induced reflexes commonly observed in fish. By necessity, the brain injections were performed on anaesthetised animals that were fixed by 'eye bars' in a recirculating water system. Blood pressure and heart rate were measured using an arterial cannula positioned in the afferent branchial artery of the 3rd gill arch, and ventilation was measured by impedance probes sutured onto the operculum. Unilateral injection of glutamate (40-100 nl, 10 mmol l(-1)) into the Xs caused marked cardiorespiratory changes. Injection (0.1-0.3 mm deep) in different rostrocaudal, medial-lateral positions induced a bradycardia, either increased or decreased blood pressure, ventilation frequency and amplitude and, sometimes, an initial apnea. Often these responses occurred simultaneously in various different combinations but, occasionally, they appeared singly, suggesting specific projections into the Xs for each cardiorespiratory variable and local determination of the modality of the response. Response patterns related to chemoreceptor reflex activation were predominantly located rostral of obex, whereas patterns related to baroreceptor reflex activation were more caudal, around obex. The glutamate-induced bradycardia was N-methyl-D-aspartate (NMDA) receptor dependent and atropine sensitive. Taken together, our data provide evidence that glutamate is a putative player in the central integration of chemoreceptor and baroreceptor information in fish.
Healing of corneal epithelial wounds in marine and freshwater fish.
Ubels, J L; Edelhauser, H F
The corneal epithelium of a fish is in direct contact with the aquatic environment and is a barrier to movement of ions and water into and through the cornea. This tissue layer is thus important in maintenance of corneal transparency. When the epithelium is wounded, its protective function is lost and corneal transparency remains compromised until the epithelial barrier is re-established. This study was undertaken to investigate the healing response of the fish cornea to epithelial abrasion. Wounds were stained with fluorescein and photographed during healing. Wound areas were measured by planimetry. The cornea of the sculpin, a marine teleost, becomes edematous after wounding and heals at 2.54 to 3.42 mm2/hr. Nonswelling corneas of the elasmobranchs--dogfish shark and skate--heal at 1.29 mm2/hr, respectively. The wounded eye of the rainbow trout, a freshwater teleost, is stressed by the low osmolality of the environment. Severe corneal edema and cataracts develop following epithelial wounding, and the cornea heals at 0.64 mm2/hr. Although the healing rates in teleosts differ from those in mammals, histology shows that the corneal healing mechanism is essentially the same in fish and mammals.
International Nuclear Information System (INIS)
1995-11-01
The System Operation Review (SOR) is a study and environmental compliance process being used by the three Federal agencies to analyze future operations of the system and river use issues. The goal of the SOR is to achieve a coordinated system operation strategy for the river that better meets the needs of all river users. This technical appendix addresses only the effects of alternative system operating strategies for managing the Columbia River system. In this appendix the Resident Fish Work Group (RFWG) has attempted to characterize and evaluate impacts of dam operation on an extremely complex and diverse integrated resource. Not only is this required under the National Environmental Policy Act (NEPA) for SOR, there are resident fish populations that have status under the Federal Endangered Species Act (ESA) or equivalent state regulations (Kootenai River white sturgeon, Snake River white sturgeon, sandroller, shorthead and torrent sculpins, bull trout, westslope cutthroat trout, redband trout, and burbot). The RFWG has also attempted to develop operating alternatives that benefit not only resident fish, but anadromous fish, wildlife, and other human interests as well. The authors have recognized the co-evolution of resident fish, anadromous fish, and other integrated resources in the basin
Hypothesis carbon flow through the deepwater Lake Ontario foodweb
International Nuclear Information System (INIS)
Flint, R.W.
1986-01-01
Several accounts in recent years have attempted to conceptualize foodwebs in valuable fishery systems, producing useful heuristic tools to help shape research and management policy. Here a mass balance conceptual model of the Lake Ontario deepwater foodweb is developed to evaluate energy pathways and determine available nutrition for predatory salmonines. A number of different trophic links were defined from phytoplankton, through the various forage species, to the tertiary consumers. Phytoplankton photosynthesis resulted in 178 g C/m/sup 2//yr production at the base of the foodweb. Approximately 60% of primary production was counted as required support for pelagic zooplankton and benthos. Dominant forage fish (alewife, smelt and sculpin) annually appeared to consume all smaller zooplankton carbon production, 93% of mysid production, 66% of most benthic community production, and, more specifically, 94% of amphipod carbon production. The model indicated that approximately 1.22 g C/m/sup 2//yr was available for support of top level predators. Based upon historic fishery records and stocking rates, these predators required approximately half of the annual carbon available as nutritional support. Impacts of trophic rearrangements in the Lake Ontario foodweb are discussed based upon model results
Czech Academy of Sciences Publication Activity Database
Gil de Pertierra, A.A.; Arredondo, N.J.; Kuchta, Roman; Incorvaia, I.S.
2015-01-01
Roč. 90, č. 3 (2015), s. 247-256 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Cestoda * fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.316, year: 2015
Biological recipient control at the Ringhals nuclear power plant. Annual report for 2011
International Nuclear Information System (INIS)
Jansson, Maria; Gustavsson, Frida; Fagerholm, Bjoern
2012-01-01
The cooling system of the Ringhals nuclear power plant affects the fish community in two steps. In the first step, seawater is used to cool the system in the nuclear power plant. Fish eggs, larvae and small juveniles are carried by the incoming water and are exposed to risk of damage or mortality. In the second step the heated water is released back into the sea, where the fish is affected by the increase in temperature. Reactor 1 and reactor 3 at Ringhals nuclear power plant produced electricity during the major part of the year 2011, with exceptions for the annual audits, and shorter stops in production. Reactor 2 only operated between January and April, due to a fire which led to a shutdown and a thorough remediation work during the rest of the year. Reactor 4 was producing electricity from January to June, but was later shutdown due to a prolonged annual audit until November. Fish eggs and fish larvae are sampled in the incoming cooling water using a modified Bongo net to monitor losses of eggs and larvae in the nuclear power plant. The abundance of shorthorn sculpin larvae (Myoxocephalus scorpius) has decreased since the sampling period started, although it is still the most abundant larvae. Also the abundance of rock gunnel larvae (Pholis gunnellus) has decreased over the years. To sample juvenile fish a modified Isaacs-Kidd midwater-trawl is used. This sampling is mainly focused on glass eels (Anguilla anguilla). The abundance of glass eels have declined strongly since the beginning of the 1980's, but a minor increase was observed in 2011. The decline of the glass eel abundance is most probably due to a general decrease in recruitment and not to a local effect caused by the nuclear power plant. The effects of the heated water released into the sea are monitored by fykenet surveys in the recipient as well as in a reference area. These two areas are monitored in two seasons to compare differences between the two areas in naturally cold and warm water of the
Energy Technology Data Exchange (ETDEWEB)
Jansson, Maria; Gustavsson, Frida; Fagerholm, Bjoern
2012-07-01
The cooling system of the Ringhals nuclear power plant affects the fish community in two steps. In the first step, seawater is used to cool the system in the nuclear power plant. Fish eggs, larvae and small juveniles are carried by the incoming water and are exposed to risk of damage or mortality. In the second step the heated water is released back into the sea, where the fish is affected by the increase in temperature. Reactor 1 and reactor 3 at Ringhals nuclear power plant produced electricity during the major part of the year 2011, with exceptions for the annual audits, and shorter stops in production. Reactor 2 only operated between January and April, due to a fire which led to a shutdown and a thorough remediation work during the rest of the year. Reactor 4 was producing electricity from January to June, but was later shutdown due to a prolonged annual audit until November. Fish eggs and fish larvae are sampled in the incoming cooling water using a modified Bongo net to monitor losses of eggs and larvae in the nuclear power plant. The abundance of shorthorn sculpin larvae (Myoxocephalus scorpius) has decreased since the sampling period started, although it is still the most abundant larvae. Also the abundance of rock gunnel larvae (Pholis gunnellus) has decreased over the years. To sample juvenile fish a modified Isaacs-Kidd midwater-trawl is used. This sampling is mainly focused on glass eels (Anguilla anguilla). The abundance of glass eels have declined strongly since the beginning of the 1980's, but a minor increase was observed in 2011. The decline of the glass eel abundance is most probably due to a general decrease in recruitment and not to a local effect caused by the nuclear power plant. The effects of the heated water released into the sea are monitored by fykenet surveys in the recipient as well as in a reference area. These two areas are monitored in two seasons to compare differences between the two areas in naturally cold and warm water of
Toxaphene in the aquatic environment of Greenland
International Nuclear Information System (INIS)
Vorkamp, Katrin; Rigét, Frank F.; Dietz, Rune
2015-01-01
The octa- and nonachlorinated bornanes (toxaphene) CHBs 26, 40, 41, 44, 50 and 62 were analysed in Arctic char (Salvelinus alpinus), shorthorn sculpin (Myoxocephalus scorpius), ringed seal (Pusa hispida) and black guillemot eggs (Cepphus grylle) from Greenland. Despite their high trophic level, ringed seals had the lowest concentrations of these species, with a Σ 6 Toxaphene median concentration of 13–20 ng/g lipid weight (lw), suggesting metabolisation. The congener composition also suggests transformation of nona- to octachlorinated congeners. Black guillemot eggs had the highest concentrations (Σ 6 Toxaphene median concentration of 971 ng/g lw). Although concentrations were higher in East than in West Greenland differences were smaller than for other persistent organic pollutants. In a circumpolar context, toxaphene had the highest concentrations in the Canadian Arctic. Time trend analyses showed significant decreases for black guillemot eggs and juvenile ringed seals, with annual rates of −5 to −7% for Σ 6 Toxaphene. The decreases were generally steepest for CHBs 40, 41 and 44. - Highlights: • Toxaphene was detected in freshwater and marine species of Greenland. • Relatively low concentrations in ringed seal suggest metabolisation. • The concentrations in Greenland appear lower than those in the Canadian Arctic. • Significant decreases were found in juvenile ringed seals and black guillemot eggs. - The banned insecticide toxaphene is widely present in the aquatic environment of Greenland, but concentrations are decreasing
Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.
Miller, Robert J; Hocevar, John; Stone, Robert P; Fedorov, Dmitry V
2012-01-01
Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.
An extraordinary gobioid fish fossil from Southern France.
Directory of Open Access Journals (Sweden)
Christoph Gierl
Full Text Available BACKGROUND: The classification of gobioid fishes is still under discussion. Several lineages, including the Eleotridae and Butidae, remain difficult to characterize because synapomorphies are rare (Eleotridae or have not yet been determined (Butidae. Moreover, the fossil record of these groups is scarce. RESULTS: Exceptionally well-preserved fish fossils with otoliths in situ from uppermost Oligocene sediments (≈23-24 Mio. y. ago in Southern France provide the most in-depth description of a fossil gobioid to date. The species was initially described as Cottus aries Agassiz, then transferred to †Lepidocottus Sauvage, and subsequently assigned to Gobius. Based on a comparative analysis of meristic, osteological and otolith data, this species most likely is a member of the family Butidae. This discovery is important because it represents the first record of a fossil butid fish based on articulated skeletons from Europe. SIGNIFICANCE: The Butidae and Eleotridae are currently distributed in W-Africa, Madagascar, Asia and Australia, but they do not appear in Europe and also not in the Mediterranean Sea. The new results indicate that several species of the Butidae thrived in Europe during the Oligocene and Early Miocene. Similar to the recent Butidae and Eleotridae, these fishes were adapted to a wide range of salinities and thrived in freshwater, brackish and marginal marine habitats. The fossil Butidae disappeared from Europe and the Mediterranean and Paratethys areas during the Early Miocene, due probably to their lack of competitiveness compared to other Gobioidei that radiated during this period of time. In addition, this study documents the great value of otoliths for gobioid systematics.
Kocan, Richard; LaPatra, Scott; Hershberger, Paul
2013-01-01
Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.–infected tissues. By 24–48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a “halo” and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae (“germination tubes”) were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20–25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤25 μm to ≥82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.
Structure-forming corals and sponges and their use as fish habitat in Bering Sea submarine canyons.
Directory of Open Access Journals (Sweden)
Robert J Miller
Full Text Available Continental margins are dynamic, heterogeneous settings that can include canyons, seamounts, and banks. Two of the largest canyons in the world, Zhemchug and Pribilof, cut into the edge of the continental shelf in the southeastern Bering Sea. Here currents and upwelling interact to produce a highly productive area, termed the Green Belt, that supports an abundance of fishes and squids as well as birds and marine mammals. We show that in some areas the floor of these canyons harbors high densities of gorgonian and pennatulacean corals and sponges, likely due to enhanced surface productivity, benthic currents and seafloor topography. Rockfishes, including the commercially important Pacific ocean perch, Sebastes alutus, were associated with corals and sponges as well as with isolated boulders. Sculpins, poachers and pleuronectid flounders were also associated with corals in Pribilof Canyon, where corals were most abundant. Fishes likely use corals and sponges as sources of vertical relief, which may harbor prey as well as provide shelter from predators. Boulders may be equivalent habitat in this regard, but are sparse in the canyons, strongly suggesting that biogenic structure is important fish habitat. Evidence of disturbance to the benthos from fishing activities was observed in these remote canyons. Bottom trawling and other benthic fishing gear has been shown to damage corals and sponges that may be very slow to recover from such disturbance. Regulation of these destructive practices is key to conservation of benthic habitats in these canyons and the ecosystem services they provide.
Kocan, Richard; LaPatra, Scott; Hershberger, Paul
2013-04-01
Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.-infected tissues. By 24-48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a "halo" and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae ("germination tubes") were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20-25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤ 25 μm to ≥ 82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.
Meador, James P; Yeh, Andrew; Gallagher, Evan P
2017-11-01
The Fish Plasma Model (FPM) was applied to water exposure and tissue concentrations in fish collected from two wastewater treatment plant impacted estuarine sites. In this study we compared predicted fish plasma concentrations to Cmax values for humans, which represents the maximum plasma concentration for the minimum therapeutic dose. The results of this study show that predictions of plasma concentrations for a variety of pharmaceutical and personal care products (PPCPs) from effluent concentrations resulted in 37 compounds (54%) exceeding the response ratio (RR = Fish [Plasma]/1%Cmax total ) of 1 compared to 3 compounds (14%) detected with values generated with estuarine receiving water concentrations. When plasma concentrations were modeled from observed whole-body tissue residues, 16 compounds out of 24 detected for Chinook (67%) and 7 of 14 (50%) for sculpin resulted in an RR tissue value greater than 1, which highlights the importance of this dose metric over that using estuarine water. Because the tissue residue approach resulted in a high percentage of compounds with calculated response ratios exceeding a value of unity, we believe this is a more accurate representation for exposure in the field. Predicting plasma concentrations from tissue residues improves our ability to assess the potential for adverse effects in fish because exposure from all sources is captured. Tissue residues are also more likely to represent steady-state conditions compared to those from water exposure because of the inherent reduction in variability usually observed for field data and the time course for bioaccumulation. We also examined the RR in a toxic unit approach to highlight the importance of considering multiple compounds exhibiting a similar mechanism of action. Published by Elsevier Ltd.
Changes in the Lake Michigan food web following dreissenid mussel invasions: A synthesis
Madenjian, Charles P.; Bunnell, David B.; Warner, David M.; Pothoven, Steven A.; Fahnenstiel, Gary L.; Nalepa, Thomas F.; Vanderploeg, Henry A.; Tsehaye, Iyob; Claramunt, Randall M.; Clark, Richard D
2015-01-01
Using various available time series for Lake Michigan, we examined changes in the Lake Michigan food web following the dreissenid mussel invasions and identified those changes most likely attributable to these invasions, thereby providing a synthesis. Expansion of the quagga mussel (Dreissena rostriformis bugensis) population into deeper waters, which began around 2004, appeared to have a substantial predatory effect on both phytoplankton abundance and primary production, with annual primary production in offshore (> 50 m deep) waters being reduced by about 35% by 2007. Primary production likely decreased in nearshore waters as well, primarily due to predatory effects exerted by the quagga mussel expansion. The drastic decline inDiporeia abundance in Lake Michigan during the 1990s and 2000s has been attributed to dreissenid mussel effects, but the exact mechanism by which the mussels were negatively affecting Diporeia abundance remains unknown. In turn, decreased Diporeiaabundance was associated with reduced condition, growth, and/or energy density in alewife (Alosa pseudoharengus), lake whitefish (Coregonus clupeaformis), deepwater sculpin (Myoxocephalus thompsonii), and bloater (Coregonus hoyi). However, lake-wide biomass of salmonines, top predators in the food web, remained high during the 2000s, and consumption of alewives by salmonines actually increased between the 1980–1995 and 1996–2011 time periods. Moreover, abundance of the lake whitefish population, which supports Lake Michigan's most valuable commercial fishery, remained at historically high levels during the 2000s. Apparently, counterbalancing mechanisms operating within the complex Lake Michigan food web have enabled salmonines and lake whitefish to retain relatively high abundances despite reduced primary production.
Tummers, Jeroen S; Hudson, Steve; Lucas, Martyn C
2016-11-01
A more holistic approach towards testing longitudinal connectivity restoration is needed in order to establish that intended ecological functions of such restoration are achieved. We illustrate the use of a multi-method scheme to evaluate the effectiveness of 'nature-like' connectivity restoration for stream fish communities in the River Deerness, NE England. Electric-fishing, capture-mark-recapture, PIT telemetry and radio-telemetry were used to measure fish community composition, dispersal, fishway efficiency and upstream migration respectively. For measuring passage and dispersal, our rationale was to evaluate a wide size range of strong swimmers (exemplified by brown trout Salmo trutta) and weak swimmers (exemplified by bullhead Cottus perifretum) in situ in the stream ecosystem. Radio-tracking of adult trout during the spawning migration showed that passage efficiency at each of five connectivity-restored sites was 81.3-100%. Unaltered (experimental control) structures on the migration route had a bottle-neck effect on upstream migration, especially during low flows. However, even during low flows, displaced PIT tagged juvenile trout (total n=153) exhibited a passage efficiency of 70.1-93.1% at two nature-like passes. In mark-recapture experiments juvenile brown trout and bullhead tagged (total n=5303) succeeded in dispersing upstream more often at most structures following obstacle modification, but not at the two control sites, based on a Laplace kernel modelling approach of observed dispersal distance and barrier traverses. Medium-term post-restoration data (2-3years) showed that the fish assemblage remained similar at five of six connectivity-restored sites and two control sites, but at one connectivity-restored headwater site previously inhabited by trout only, three native non-salmonid species colonized. We conclude that stream habitat reconnection should support free movement of a wide range of species and life stages, wherever retention of such
Peterson, Sarah H; Ackerman, Joshua T; Eagles-Smith, Collin A; Herzog, Mark P; Hartman, C Alex
2018-01-01
Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster's tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster's terns are limited in the distance they forage; thus, changes in the prey species returned to Forster's tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available habitat.
Peterson, Sarah; Ackerman, Joshua T.; Eagles-Smith, Collin A.; Herzog, Mark; Hartman, C. Alex
2018-01-01
Predators sample the available prey community when foraging; thus, changes in the environment may be reflected by changes in predator diet and foraging preferences. We examined Forster’s tern (Sterna forsteri) prey species over an 11-year period by sampling approximately 10,000 prey fish returned to 17 breeding colonies in south San Francisco Bay, California. We compared the species composition among repeatedly-sampled colonies (≥ 4 years), using both relative species abundance and the composition of total dry mass by species. Overall, the relative abundances of prey species at seven repeatedly-sampled tern colonies were more different than would be expected by chance, with the most notable differences in relative abundance observed between geographically distant colonies. In general, Mississippi silverside (Menidia audens) and topsmelt silverside (Atherinops affinis) comprised 42% of individuals and 40% of dry fish mass over the study period. Three-spined stickleback (Gasterosteus aculeatus) comprised the next largest proportion of prey species by individuals (19%) but not by dry mass (6%). Five additional species each contributed ≥ 4% of total individuals collected over the study period: yellowfin goby (Acanthogobius flavimanus; 10%), longjaw mudsucker (Gillichthys mirabilis; 8%), Pacific herring (Clupea pallasii; 6%), northern anchovy (Engraulis mordax; 4%), and staghorn sculpin (Leptocottus armatus; 4%). At some colonies, the relative abundance and biomass of specific prey species changed over time. In general, the abundance and dry mass of silversides increased, whereas the abundance and dry mass of three-spined stickleback and longjaw mudsucker decreased. As central place foragers, Forster’s terns are limited in the distance they forage; thus, changes in the prey species returned to Forster’s tern colonies suggest that the relative availability of some fish species in the environment has changed, possibly in response to alteration of the available
International Nuclear Information System (INIS)
Hoekstra, P.F.; O'Hara, T.M.; Fisk, A.T.; Borgaa, K.; Solomon, K.R.; Muir, D.C.G.
2003-01-01
The trophic status and biomagnification of persistent OCs within the near-shore Beaufort-Chukchi Seas food web from Barrow, AK is discussed. - Stable isotope values (δ 13 C, δ 15 N) and concentrations of persistent organochlorine contaminants (OCs) were determined to evaluate the near-shore marine trophic status of biota and biomagnification of OCs from the southern Beaufort-Chukchi Seas (1999-2000) near Barrow, AK. The biota examined included zooplankton (Calanus spp.), fish species such as arctic cod (Boreogadus saida), arctic char (Salvelinus alpinus), pink salmon (Oncorhynchus gorbuscha), and fourhorn sculpin (Myoxocephalus quadricornis), along with marine mammals, including bowhead whales (Balaena mysticetus), beluga whales (Delphinapterus leucas), ringed seals (Phoca hispida) and bearded seals (Erignathus barbatus). The isotopically derived trophic position of biota from the Beaufort-Chukchi Seas marine food web, avian fauna excluded, is similar to other coastal food webs in the Arctic. Concentrations of OCs in marine mammals were significantly greater than in fish and corresponded with determined trophic level. In general, OCs with the greatest food web magnification factors (FWMFs) were those either formed due to biotransformation (e.g. p,p'-DDE, oxychlordane) or considered recalcitrant (e.g. β-HCH, 2,4,5-Cl substituted PCBs) in most biota, whereas concentrations of OCs that are considered to be readily eliminated (e.g. γ-HCH) did not correlate with trophic level. Differences in physical-chemical properties of OCs, feeding strategy and possible biotransformation were reflected in the variable biomagnification between fish and marine mammals. The FWMFs in the Beaufort-Chukchi Seas region were consistent with reported values in the Canadian Arctic and temperate food webs, but were statistically different than FWMFs from the Barents and White Seas, indicating that the spatial variability of OC contamination in top-level marine Arctic predators is
Temporal and geographic variation in fish communities of lower Cook Inlet, Alaska
Robards, Martin D.; Piatt, John F.; Kettle, Arthur B.; Abookire, Alisa A.
1999-01-01
Nearshore and shelf fish communities were studied in three areas of lower Cook Inlet, Alaska: the Barren Islands (oceanic and well-mixed waters), Kachemak Bay (mixed oceanic waters with significant freshwater runoff), and Chisik Island (estuarine waters). Fish were sampled with beach seines (n=413 sets) and midwater trawls (n=39 sets). We found that lower Cook Inlet supported a diverse nearshore fish community of at least 52 species. Fifty of these species were caught in Kachemak Bay, 24 at Chisik Island, and 12 at the Barren Islands. Pacific sand lance dominated Barren Islands and Kachemak Bay nearshore habitats, comprising 99% and 71% of total individuals, respectively. The nearshore Chisik Island fish community was not dominated by any one species; instead it exhibited higher diversity. These spatial differences appeared linked to local oceanographic regimes and sediment influx. Analysis of historical data revealed that the nearshore Kachemak Bay fish community changed significantly between 1976 and 1996, showing increased diversity and abundance in several taxa, notably gadids, salmonids, pleuronectids, and sculpins. Decadal differences appeared to be related to large-scale climate changes in the North Pacific. Catches of most taxa peaked in May-August, and were low during other months of the year. Several species were present for only part of the summer. Species composition of seine catches differed significantly between consecutive high and low tides, but not between consecutive sets or years. Midwater trawls took 26 species, 14 of which were present in Kachemak Bay, 19 near Chisik Island, and 7 at the Barren Islands. Community structures in shelf and nearshore waters were similar: diversity was high and abundance low at Chisik Island, whereas a few abundant species dominated at both Kachemak Bay and the Barren Islands. In addition, the low fish abundance near Chisik Island appeared to be related to declining seabird numbers at this colony.
Buser, Thaddaeus J; Sidlauskas, Brian L; Summers, Adam P
2018-05-01
We contrast 2D vs. 3D landmark-based geometric morphometrics in the fish subfamily Oligocottinae by using 3D landmarks from CT-generated models and comparing the morphospace of the 3D landmarks to one based on 2D landmarks from images. The 2D and 3D shape variables capture common patterns across taxa, such that the pairwise Procrustes distances among taxa correspond and the trends captured by principal component analysis are similar in the xy plane. We use the two sets of landmarks to test several ecomorphological hypotheses from the literature. Both 2D and 3D data reject the hypothesis that head shape correlates significantly with the depth at which a species is commonly found. However, in taxa where shape variation in the z-axis is high, the 2D shape variables show sufficiently strong distortion to influence the outcome of the hypothesis tests regarding the relationship between mouth size and feeding ecology. Only the 3D data support previous studies which showed that large mouth sizes correlate positively with high percentages of elusive prey in the diet. When used to test for morphological divergence, 3D data show no evidence of divergence, while 2D data show that one clade of oligocottines has diverged from all others. This clade shows the greatest degree of z-axis body depth within Oligocottinae, and we conclude that the inability of the 2D approach to capture this lateral body depth causes the incongruence between 2D and 3D analyses. Anat Rec, 301:806-818, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
Czech Academy of Sciences Publication Activity Database
Baran, Roman; Kubečka, Jan; Kubín, M.; Lojkásek, B.; Mrkvička, T.; Ricard, Daniel; Rulík, M.
2015-01-01
Roč. 86, č. 2 (2015), s. 805-811 ISSN 0022-1112. [Česká ichtyologická konference /13./. Červená nad Vltavou, 24.10.2012-26.10.2012] Institutional support: RVO:60077344 Keywords : alpine bullhead * brown trout * macroinvertebrates * organic carbon * shading * water temperature Subject RIV: EH - Ecology, Behaviour Impact factor: 1.246, year: 2015
Stability of liquid fuels with biogenic content
Energy Technology Data Exchange (ETDEWEB)
Koch, Winfried; Hoffmann, Hajo; Pohland vom Schloss, Heide [OWI - Oel-Waerme-Institut GmbH, Herzogenrath (Germany)
2013-06-01
Mineral-based fuels for diesel- and spark-ignition engines are always mixtures of many components with a wide distillation range. These insure, for example, a low viscosity and good cold starting properties. Therefore, the fuel system components are designed for mineral-based diesel and gasoline fuels. Biofuels like biodiesel and bioethanol, which only partially show these physical properties, are introduced into the fuel market because of political and ecological aspects. Currently common biofuels, such as ethanol and biodiesel, are investigated in uncommon high blend levels of 10 vol.-% and 30 vol.-% as well as future biofuels. Biodiesel (fatty acid methyl ester, FAME) has poor cold-flow properties concerning to the CP and CFPP. Therefore, biodiesel has the tendency to form crystalline deposits at sub-zero temperatures. For bioethanol applications, an adjustment of the materials used, for example for sealing, is necessary. It is well known that the negative implications of biofuels require an additive treatment for an optimal performance. In contrast to previous examinations, in which technical components were analyzed by their own, in the presented investigations (''GObio''-project), the complete system of sensitive fuel tank and feed system with auxiliary units like independent vehicle heaters is used to determine the influences of the biofuels. The investigations are based on hardware in the loop testing. A target of the project was to modify the application technology like the independent vehicle heater and the in-tank pumps to use the biofuels in the conventional systems. Furthermore, it was an objective to upgrade the performance of the fuels through the development and the treatment with additives. During operation with low blend levels no problems were detected so that safe operation using diesel with up to 7 vol.-% FAME according to EN 590 is ensured. At the temperature levels present in the fuel leading parts during operation
Bioaccumulation of radionuclides in fertilized Canadian Shield lake basins
International Nuclear Information System (INIS)
Bird, G.A.; Schwartz, W.J.; Hesslein, R.H.; Mills, K.H.; Turner, M.A.
1998-01-01
Radionuclide tracers of heavy metals ( 59 Fe, 60 Co, 65 Zn, 75 Se 85 Sr, 134 Cs and 203 Hg) representing potential contamination from nuclear power plants, industry and agriculture were added to separate basins of Lake 226, Experimental Lakes Area, northwestern Ontario. The two basins were part of a eutrophication experiment and differed in their trophic status; the north basin (L226N) was eutrophic whereas the south basin (L226S) was mesotrophic. Our objective was to determine the uptake of the radionuclides by biota and the effect of lake trophic status on their bioaccumulation. The trophic status of the lakes did not appear to have a marked effect on the accumulation of radionuclides by the biota. This may have been because of a mid-summer leakage of nutrients between the basins which enhanced primary production in L226S, because there is a time lag between primary production and the availability of the radionuclides to the fishes or because trophic status does not affect the uptake of at least some of these radionuclides. However, there was a tendency for faster uptake of the radionuclides in L226N by fish than L226S, but the differences were not significant. Concentrations in the biota generally decreased in the order: fathead minnow>pearl dace>tadpoles>slimy sculpin>leeches. Concentrations in biota generally decreased in the order: 65 Zn> 203 Hg> 75 Se> 134 Cs> 60 Co> 85 Sr= 59 Fe. Cobalt-60 concentrations in tadpoles were greater than in the other biota. Radionuclide concentrations in the tissues of lake whitefish indicated that uptake was predominately from food. Radionuclide concentrations were usually higher in the posterior gut, liver and kidney than in other tissues, whereas body burdens were generally high in the muscle for 75 Se, 134 Cs and 203 Hg; kidney and gut for 60 Co; and bone for 65 Zn and 75 Se. Mercury-203 burdens were also high in the bone and gut
Heterosigma bloom and associated fish kill
Hershberger, P.K.; Rensel, J.E.; Postel, J.R.; Taub, F.B.
1997-01-01
A bloom of the harmful marine phytoplankton, Heterosigma carterae occurred in upper Case Inlet, south Puget Sound, Washington in late September, 1994, correlating with the presence of at least 35 dead salmon. This marks the first time that this alga has been closely correlated with a wild fish kill; in the past it was thought to be associated with kills of penned fish at fish farms only. We were informed of the presence of a possible harmful algal bloom and dead salinois Ilear the town of Allyn on 27 September and a team was formed to investigate. We arrived at the Allyn waterfront at 17:30 hours the same day. Prior to our arrival, state agency personnel walked approximatcly two miles of shoreline from the powerlines north of the dock, to the mouth of Sherwood Creek and conducted the only official count of dead fish present along the shore consisting of 12 coho salmon (Oncorhynchus kisutch), 11 chum salmon (Oncorhynchus keta), 12 chinook salmon (Oncorhynchus tschawytscha), one flat fish, and one sculpin on the morning of 9/27. Since previous harmful blooms of Heterosigma have resultedin the majority of net penreared salmon sinking to the bottom of pens, and only approximately two miles of shoreline were sampled, it is suspected that many more exposed fish may have succumbed than were counted. Witnesses who explored the east side of the bay reported seeing many dead salmon there as well, but no counts were made. State agency personnel who observed the fish kill reported seeing “dying fish coming to the beach, gulping at the surface, trying to get out of the water” Scavengers were seen consuming the salmon carcasses; these included two harbor seals, a house cat, and Hymenopteran insects. None suffered any noticeable acute ill effects. Although precise cause of death has not been ascertained, visual inspection of the reproductive organs from a deceased male chum salmon found on the shore at Allyn confirmed that the fish was not yet reproductively mature and
The distribution of 4-nonylphenol in marine organisms of North American Pacific Coast estuaries.
Diehl, Jennifer; Johnson, Sarah E; Xia, Kang; West, Amy; Tomanek, Lars
2012-04-01
One of the chemical breakdown products of nonylphenol ethoxylates, 4-nonylphenol (4-NP), accumulates in organisms and is of concern as an environmental pollutant due to its endocrine disrupting effects. We measured 4-NP levels in the seawater, sediment, and twelve organisms within the California estuary, Morro Bay, and examined biomagnification of 4-NP using stable isotope abundances (δ(15)N and δ(13)C) to quantify trophic position. 4-NP concentrations in organisms from Morro Bay included 25000±8600 ng g(-1) lw in liver of California sea lion, 14000±5600 ng g(-1) lw in liver of harbor porpoise, 138000±55000 ng g(-1) lw in liver of sea otters, 15700±3600 ng g(-1) lw in liver of seabirds, 36100±6100 ng g(-1) lw in arrow goby fish, 62800±28400 ng g(-1) lw in oysters, and 12700±1300 ng g(-1) lw in mussels. 4-NP levels generally showed a pattern of trophic dilution among organisms in Morro Bay, with exceptions of biomagnification observed between three trophic links: mussel to sea otter (BMF 10.9), oyster to sea otter (BMF 2.2), and arrow goby to staghorn sculpin (BMF 2.7). Our examination of other west coast estuaries of USA and Canada revealed that mean 4-NP concentrations in gobies and mussels from Morro Bay were significantly higher than those from a more urbanized estuary, San Francisco Bay (goby: 11100±3800 ng g(-1) lw) and from a remote estuary, Bamfield Inlet, Canada (goby: 9000±900 ng g(-1) lw, mussel: 6100±700 ng g(-1) lw). Relative to other estuaries worldwide, 4-NP levels in seawater (0.42±0.16 μg L(-1)) and sediment (53±14 ng g(-1) dw) of Morro Bay are low, but gobies and oysters have higher 4-NP levels than comparable fauna. Copyright © 2012 Elsevier Ltd. All rights reserved.
VanCompernolle, M.; Ficklin, D. L.; Knouft, J.
2017-12-01
Streamflow and stream temperature are key variables influencing growth, reproduction, and mortality of freshwater fish. Climate-induced changes in these variables are expected to alter the structure and function of aquatic ecosystems. Using Maxent, a species distribution model (SDM) based on the principal of maximum entropy, we predicted potential distributional responses of 100 fish species in the Mobile River Basin (MRB) to changes in climate based on contemporary and future streamflow and stream temperature estimates. Geologic, topographic, and landcover data were also included in each SDM to determine the contribution of these physical variables in defining areas of suitable habitat for each species. Using an ensemble of Global Climate Model (GCM) projections under a high emissions scenario, predicted distributions for each species across the MRB were produced for both a historical time period, 1975-1994, and a future time period, 2060-2079, and changes in total area and the percent change in historical suitable habitat for each species were calculated. Results indicate that flow (28%), temperature (29%), and geology (29%), on average, contribute evenly to determining areas of suitable habitat for fish species in the MRB, with landcover and slope playing more limited roles. Temperature contributed slightly more predictive ability to SDMs (31%) for the 77 species experiencing overall declines in areas of suitable habitat, but only 21% for the 23 species gaining habitat across all GCMs. Species are expected to lose between 15-24% of their historical suitable habitat, with threatened and endangered species losing 22-30% and those endemic to the MRB losing 19-28%. Sculpins (Cottidae) are expected to lose the largest amount of historical habitat (up to 84%), while pygmy sunfish (Elassomatidae) are expected to lose less than 1% of historical habitat. Understanding which species may be at risk of habitat loss under future projections of climate change can help
Presser, Theresa S.
2013-01-01
Coal and associated waste rock are among environmental selenium (Se) sources that have the potential to affect reproduction in fish and aquatic birds. Ecosystems of southern West Virginia that are affected by drainage from mountaintop coal mines and valleys filled with waste rock in the Coal, Gauley, and Lower Guyandotte watersheds were assessed during 2010 and 2011. Sampling data from earlier studies in these watersheds (for example, Upper Mud River Reservoir) and other mining-affected watersheds also are included to assess additional hydrologic settings and food webs for comparison. Basin schematics give a comprehensive view of sampled species and Se concentration data specific to location and date. Food-web diagrams document the progression of Se trophic transfer across suspended particulate material, invertebrates, and fish for each site to serve as the basis for developing an ecosystem-scale model to predict Se exposure within the hydrologic conditions and food webs of southern West Virginia. This approach integrates a site-specific predator’s dietary exposure pathway into modeling to ensure an adequate link to Se toxicity and, thus, to species vulnerability. Site-specific fish abundance and richness data in streams documented various species of chub, shiner, dace, darters, bass, minnow, sunfish, sucker, catfish, and central stoneroller (Campostoma anomalum), mottled sculpin (Cottus bairdii), and least brook lamprey (Lampetra aepyptera). However, Se assessment species for streams, and hence, model species for streams, were limited to creek chub (Semotilus atromaculatus) and central stoneroller. Both of these species of fish are generally considered to have a high tolerance for environmental stress based on traditional comparative fish community assessment, with creek chub being present at all sites. Aquatic insects (mayfly, caddisfly, stonefly, dobsonfly, chironomid) were the main invertebrates sampled in streams. Collection of suspended particulate material
International Nuclear Information System (INIS)
Meador, James P.; Yeh, Andrew; Gallagher, Evan P.
2017-01-01
The Fish Plasma Model (FPM) was applied to water exposure and tissue concentrations in fish collected from two wastewater treatment plant impacted estuarine sites. In this study we compared predicted fish plasma concentrations to Cmax values for humans, which represents the maximum plasma concentration for the minimum therapeutic dose. The results of this study show that predictions of plasma concentrations for a variety of pharmaceutical and personal care products (PPCPs) from effluent concentrations resulted in 37 compounds (54%) exceeding the response ratio (RR = Fish [Plasma]/1%Cmax total ) of 1 compared to 3 compounds (14%) detected with values generated with estuarine receiving water concentrations. When plasma concentrations were modeled from observed whole-body tissue residues, 16 compounds out of 24 detected for Chinook (67%) and 7 of 14 (50%) for sculpin resulted in an RR tissue value greater than 1, which highlights the importance of this dose metric over that using estuarine water. Because the tissue residue approach resulted in a high percentage of compounds with calculated response ratios exceeding a value of unity, we believe this is a more accurate representation for exposure in the field. Predicting plasma concentrations from tissue residues improves our ability to assess the potential for adverse effects in fish because exposure from all sources is captured. Tissue residues are also more likely to represent steady-state conditions compared to those from water exposure because of the inherent reduction in variability usually observed for field data and the time course for bioaccumulation. We also examined the RR in a toxic unit approach to highlight the importance of considering multiple compounds exhibiting a similar mechanism of action. - Highlights: • Fish Plasma Model (FPM) to assess risk based on water and fish tissue concentrations. • Plasma levels predicted with receiving water concentrations underestimate exposure for feral fish.
Burns, Douglas A.; Riva-Murray, K.; Bode, R.W.; Passy, S.
2008-01-01
Atmospheric acid deposition has decreased in the northeastern United States since the 1970s, resulting in modest increases in pH, acid-neutralizing capacity (ANC), and decreases in inorganic monomeric aluminum (AlIM) concentrations since stream chemistry monitoring began in the 1980s in the acid-sensitive upper Neversink River basin in the Catskill Mountains of New York. Stream pH has increased by 0.01 units/year during 1987-2003 at three sites in the Neversink basin as determined by Seasonal Kendall trend analysis. In light of this observed decrease in stream acidity, we sampled 12 stream sites within the Neversink River watershed for water chemistry, macroinvertebrates, fish, and periphytic diatoms in 2003 to compare with a similar data set collected in 1987. Metrics and indices that reflect sensitivity to stream acidity were developed with these biological data to determine whether changes in stream biota over the intervening 16 years parallel those of stream chemistry. Statistical comparisons of data on stream chemistry and an acid biological assessment profile (Acid BAP) derived from invertebrate data showed no significant differences between the two years. For pH and ANC, however, values in 2003 were generally lower than those in 1987; this difference likely resulted from higher streamflow in summer 2003. Despite these likely flow-induced changes in summer 2003, an ordination and cluster analysis of macroinvertebrate taxa based on the Acid BAP indicated that the most acidic sites in the upstream half of the East Branch Neversink River form a statistically significant separate cluster consistent with less acidic stream conditions. This analysis is consistent with limited recovery of invertebrate species in the most acidic reaches of the river, but will require additional improvement in stream chemistry before a stronger conclusion can be drawn. Data on the fish and periphytic diatom communities in 2003 indicate that slimy sculpin had not extended their habitat
National Research Council Canada - National Science Library
Schoengold, Carole
1999-01-01
...; Tests MILL YARD, DIAMOND BEECH, MIGHTY OAK, MIDDLE NOTE, MISSION GHOST, MISSION CYBER, MISTY ECHO, DISKO ELM, MINERAL QUARRY, DISTANT ZENITH, DIAMOND FORTUNE, and HUNTERS TROPHY, 9 October 1985 to 18 September 1992...
1999-05-01
2l.SU -Wf6e:uJfr-02tSU -V 69E ;W 9-2l IS« 0VS9 v 6se :w e"g(HSH ttWS:uJB-86SU ¥0l-8:uJ9"fr6SUOVW WW2 :lug-98SU U68l-:ujg-,£SSH — —VZL-VU61ZSU...and JAYCOR conducted infrared window material optical properties experiments; Lawrence Livermore National Laboratory (LLNL) conducted 146 device
Hydroclimatic alteration increases vulnerability of montane meadows in the Sierra Nevada, California
Viers, J. H.; Peek, R.; Purdy, S. E.; Emmons, J. D.; Yarnell, S. M.
2012-12-01
available habitat for aquatic species, particularly for cold water fishes (ie, salmonids and sculpins). Earlier timing and longer low flow duration will force aquatic biota to withstand more days at thermally challenging temperatures, potentially promoting non-native species. Decreased mean annual flow, less overall snow volume, and warmer daily air temperatures will potentially decrease the number of days of standing water available for amphibian reproduction. A core strategy for maintaining meadow ecosystems, ecosystem services, and dependent biodiversity is to reduce vulnerabilities, such as unstable stream banks that promote cycles of incision, and increase resilience to disturbance, such as actively removing encroaching vegetation that can overtap water tables and build up wildfire fuels. Reducing meadow vulnerability to hydroclimatic alteration and ensuring sustained ecosystem services will require active ecosystem management (ie, managed for indicator species, but with focus on hydrological functioning); coordinated hydrological management (ie, conservation action and removal of stressors coordinated across all ownerships and management regimes); and effective communication to minimize human activities that reduce resilience, as well as improve human
Mercury levels and potential risk from subsistence foods from the Aleutians.
Burger, Joanna; Gochfeld, Michael; Jeitner, Christian; Burke, Sean; Stamm, Tim; Snigaroff, Ronald; Snigaroff, Dan; Patrick, Robert; Weston, Jim
2007-10-01
Considerable attention has been devoted to contaminants (mainly PCBs and mercury) in subsistence foods (particularly fish) from various parts of the world. However, relatively little attention has been devoted to examining mercury levels in a full range of subsistence foods from a particular region. While managers and scientists compute risk based on site-specific data on contaminant levels and consumption rates, a first step in making risk decisions by subsistence peoples is knowledge about the relative levels of mercury in the foods they eat. This study examined levels of mercury in subsistence foods (edible components) from several islands in the western Aleutians of Alaska, including algae (4 species), invertebrates (9 species), fish (15 species) and birds (5 species). Samples were gathered by both subsistence hunters/fishers and by scientists using the same equipment. Another objective was to determine if there were differences in mercury levels in subsistence foods gathered from different Aleutian islands. We tested the null hypotheses that there were no interspecific and interisland differences in mercury levels. Because of variation in distribution and the nature of subsistence hunting and fishing, not all organisms were collected from each of the islands. There were significant and important differences in mercury levels among species, but the locational differences were rather small. There was an order of magnitude difference between algae/some invertebrates and fish/birds. Even within fish, there were significant differences. The highest mean mercury levels were in flathead sole (Hippoglossoides elassodon, 0.277 ppm), yellow irish lord (Hemilepidotus jardani, 0.281 ppm), great sculpin (Myoxocephalus polyacanthocephalus, 0.366 ppm), glaucous-winged gull (Larus glaucescens, 0.329 ppm) and its eggs (0.364 ppm), and pigeon guillemot (Cepphus columba, 0.494 ppm). Mercury levels increased with increasing weight of the organisms for limpets (Tectura scutum
Mercury in Sediment, Water, and Biota of Sinclair Inlet, Puget Sound, Washington, 1989-2007
Paulson, Anthony J.; Keys, Morgan E.; Scholting, Kelly L.
2010-01-01
specimens, and caged mussels. Total mercury concentrations in muscle and liver of English sole from Sinclair Inlet ranked in the upper quarter and third, respectively, of Puget Sound locations. For other species, concentrations from Sinclair Inlet were within the mid-range of locations (for example, Chinook salmon). Total mercury concentrations of the long-lived and higher trophic rockfish in composites and individual specimens from Sinclair Inlet tended to be the highest in Puget Sound. For a given size, sand sole, graceful crab, staghorn sculpin, surf perch, and sea cucumber individuals collected from Sinclair Inlet had higher total mercury concentrations than individuals collected from non-urban estuaries. Total mercury concentrations in individual English sole and ratfish were not significantly different than in individuals of various sizes collected from either urban or non-urban estuaries in Puget Sound. Total mercury concentrations in English sole collected from Sinclair Inlet after the 2000-2001 dredging appear to have lower total mercury concentrations than those collected before (1996) the dredging project. The highest total mercury concentrations of mussels caged in 2002 were not within the Bremerton naval complex, but within the Port Orchard Marina and inner Sinclair Inlet.
Directory of Open Access Journals (Sweden)
Onoprienko V.
2014-04-01
physiological processes. The result of this effect is the difference in weight, size and body parts. To clarify, as our model species was taken Cottus Sandpiper (Neogobius fluviatilis Pallas. The reason for this was the fact that this species, along with other Ponto- Caspian solonovato - freshwater gobies, the International Union for Conservation of Nature classified as species biology are poorly understood and require further research. This fact that deepened interest of ichthyologists in this group of fish, in this regard appeared in the literature as material for the bulls and in Sandpiper. Based on the above, the purpose of this paper is a comparative morphometric parameters characteristic of individuals of this species of fresh and salt water bodies of Ukraine. All this affects the absolute morphometric parameters, which decrease in the direction from sea to the river. However, it should be noted that in rivers with rich feeding grounds sheer size of some individuals close to the size and species of sea Kakhovskoe reservoir. This situation is observed in the Sandpiper Grouse River. Here are some specimens reach a length (TL 118-148 mm and a weight of 15-36 g, Kakhovskoe Reservoir: 106-150 mm 11-38 g, in the Sea of Azov: 115-174 mm 17-58 g. For relative parameters Sandpiper with these reservoirs are more similar, however, for some of them, there are differences. Among the latter is most clearly distinguished the ratio SL / N. This indicator podovzhenist (prohonystist body. As pointed out by VP Mitrofanov (1977, this indicator shows the hydrodynamic qualities of fish: the larger the index, the more active lifestyle is individual. When compared with individuals with a little water and a large stream, in the latter case, individuals are more elongated. This is confirmed by our material: the ratio SL / L for the smallest species of sea of Azov (4.96, slightly more for Kakhovsky reservoir (5.52 and even more for rivers Grouse, Trubizh, Desna, Ros (respectively 5, 86, 6.22 , 6
Directory of Open Access Journals (Sweden)
V. P. Onoprienko
2014-04-01
physiological processes. The result of this effect is the difference in weight, size and body parts. To clarify, as our model species was taken Cottus Sandpiper (Neogobius fluviatilis Pallas. The reason for this was the fact that this species, along with other Ponto- Caspian solonovato - freshwater gobies, the International Union for Conservation of Nature classified as species biology are poorly understood and require further research. This fact that deepened interest of ichthyologists in this group of fish, in this regard appeared in the literature as material for the bulls and in Sandpiper. Based on the above, the purpose of this paper is a comparative morphometric parameters characteristic of individuals of this species of fresh and salt water bodies of Ukraine. All this affects the absolute morphometric parameters, which decrease in the direction from sea to the river. However, it should be noted that in rivers with rich feeding grounds sheer size of some individuals close to the size and species of sea Kakhovskoe reservoir. This situation is observed in the Sandpiper Grouse River. Here are some specimens reach a length (TL 118-148 mm and a weight of 15-36 g, Kakhovskoe Reservoir: 106-150 mm 11-38 g, in the Sea of Azov: 115-174 mm 17-58 g. For relative parameters Sandpiper with these reservoirs are more similar, however, for some of them, there are differences. Among the latter is most clearly distinguished the ratio SL / N. This indicator podovzhenist (prohonystist body. As pointed out by VP Mitrofanov (1977, this indicator shows the hydrodynamic qualities of fish: the larger the index, the more active lifestyle is individual. When compared with individuals with a little water and a large stream, in the latter case, individuals are more elongated. This is confirmed by our material: the ratio SL / L for the smallest species of sea of Azov (4.96, slightly more for Kakhovsky reservoir (5.52 and even more for rivers Grouse, Trubizh, Desna, Ros (respectively 5, 86